BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i8 len=2514 path=[31329:0-343 25007:344-369 25033:370-1432
15649:1433-1462 46384:1463-1568 26196:1569-1628 15876:1629-1704
47072:1705-1728 49376:1729-1742 49390:1743-1746 49394:1747-1747
49395:1748-1752 47119:1753-1776 26397:1777-1802 44013:1803-1815
49435:1816-1818 49438:1819-1907 14227:1908-1936 47272:1937-1948
26565:1949-1981 49538:1982-1986 47307:1987-2032 26649:2033-2044
2887:2045-2068 49607:2069-2080 2923:2081-2089 2932:2090-2103
49666:2104-2127 49690:2128-2130 16861:2131-2153 16884:2154-2181
15953:2182-2211 15983:2212-2237 46828:2238-2309 40477:2310-2333
46923:2334-2354 40522:2355-2378 46967:2379-2483 40649:2484-2513]

Length=2514
                                                                      Score     E

ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     426   3e-135   
emb|CDO98832.1|  unnamed protein product                                424   2e-134   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     420   4e-133   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          418   4e-132   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     417   4e-132   
emb|CDO98833.1|  unnamed protein product                                416   2e-131   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     409   9e-129   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    405   2e-127   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     397   3e-124   
emb|CDO98834.1|  unnamed protein product                                386   8e-120   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     386   9e-120   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          385   2e-119   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     379   2e-117   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    370   3e-116   Petunia integrifolia [violet-flowered petunia]
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     375   1e-115   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    375   1e-115   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    374   6e-114   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     371   1e-113   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     370   1e-113   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                370   2e-113   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     369   2e-113   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     369   3e-113   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     368   3e-113   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     367   5e-112   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     364   8e-112   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     363   2e-111   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    364   2e-111   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     363   2e-111   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                363   6e-111   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     362   8e-111   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                362   1e-110   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 361   5e-110   Ricinus communis
gb|EPS70728.1|  pectinesterase                                          359   8e-110   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    360   8e-110   
gb|EPS72184.1|  pectinesterase family protein                           358   2e-109   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    358   3e-109   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                357   1e-108   
gb|EPS59322.1|  pectinesterase                                          355   2e-108   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                357   2e-108   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    355   7e-108   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     354   9e-108   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     353   1e-107   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         353   3e-107   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    352   7e-107   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    352   8e-107   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     351   9e-107   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     352   1e-106   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    350   5e-106   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     348   8e-106   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    349   1e-105   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     348   1e-105   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    349   2e-105   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             348   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    347   4e-105   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    347   9e-105   
ref|XP_002865716.1|  pectinesterase family protein                      347   9e-105   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                345   1e-104   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    347   1e-104   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    346   2e-104   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    345   5e-104   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    347   8e-104   
gb|AEL79481.1|  pectin methylesterase-like protein                      343   1e-103   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    345   2e-103   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             343   2e-103   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    343   3e-103   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    341   9e-103   
ref|XP_006382447.1|  pectin methylesterase family protein               341   1e-102   
ref|XP_002314364.1|  putative pectinesterase family protein             340   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    341   2e-102   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    340   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    342   2e-102   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             340   3e-102   
ref|XP_002872255.1|  pectinesterase family protein                      342   3e-102   
emb|CDY19737.1|  BnaA09g03900D                                          338   3e-102   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    340   6e-102   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     338   6e-102   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    343   6e-102   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    342   9e-102   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    338   9e-102   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          339   1e-101   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          338   2e-101   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-101   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             342   3e-101   
emb|CBI39537.3|  unnamed protein product                                343   3e-101   
emb|CDY57858.1|  BnaC08g47740D                                          333   5e-101   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             337   5e-101   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    337   5e-101   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    340   5e-101   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             336   1e-100   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    338   1e-100   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    340   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884519.1|  pectinesterase family protein                      338   2e-100   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    336   2e-100   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    335   2e-100   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    337   2e-100   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    338   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          336   2e-100   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                345   2e-100   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    336   2e-100   
emb|CDY05188.1|  BnaC05g46150D                                          336   3e-100   
emb|CDY27751.1|  BnaA05g31600D                                          336   3e-100   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    338   3e-100   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             336   4e-100   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    342   4e-100   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          333   5e-100   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    334   5e-100   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             338   6e-100   
emb|CBI27741.3|  unnamed protein product                                327   7e-100   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    333   7e-100   
emb|CDY24663.1|  BnaA05g30620D                                          333   8e-100   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    333   1e-99    
emb|CDX99968.1|  BnaC09g03330D                                          336   1e-99    
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    333   1e-99    
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    333   1e-99    
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    333   2e-99    
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             332   2e-99    
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    333   2e-99    
gb|AFI23411.1|  pectin methylesterase                                   333   2e-99    
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    332   2e-99    
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    332   3e-99    
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    333   4e-99    
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    332   4e-99    
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                335   4e-99    
emb|CDY71928.1|  BnaCnng75130D                                          325   4e-99    
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             331   5e-99    
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             332   5e-99    
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    332   5e-99    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          332   6e-99    Vitis vinifera
dbj|BAC42986.1|  putative pectinesterase                                334   6e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         331   7e-99    
ref|XP_002882495.1|  pectinesterase family protein                      331   8e-99    
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    332   8e-99    
ref|XP_003627458.1|  Pectinesterase                                     331   9e-99    
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     330   1e-98    
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    321   1e-98    Daucus carota [carrots]
gb|AFB77929.1|  pectin methylesterase                                   330   2e-98    
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  321   2e-98    
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             333   2e-98    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          330   3e-98    
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         329   4e-98    
dbj|BAC42959.2|  putative pectin methylesterase                         328   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    328   5e-98    
emb|CDY33925.1|  BnaA02g30620D                                          328   6e-98    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          328   6e-98    
gb|AFW03475.1|  pectin methylesterase 1                                 329   6e-98    
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    328   6e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAF63815.1|  pectin methylesterase, putative                         328   7e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDX74137.1|  BnaA03g29100D                                          332   7e-98    
gb|KHG08631.1|  Pectinesterase 3                                        328   7e-98    
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    331   8e-98    
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    328   9e-98    
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     322   1e-97    
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    332   1e-97    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     328   1e-97    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    327   1e-97    
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    332   2e-97    
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    327   2e-97    
gb|AFW03480.1|  pectin methylesterase 1                                 327   2e-97    
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             327   2e-97    
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    327   2e-97    
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     327   3e-97    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    327   3e-97    
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    330   3e-97    
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    326   3e-97    
emb|CDY34927.1|  BnaA01g32580D                                          326   3e-97    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    327   3e-97    Citrus sinensis [apfelsine]
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    326   3e-97    
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    320   4e-97    
ref|XP_002516960.1|  Pectinesterase precursor, putative                 327   4e-97    Ricinus communis
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     326   4e-97    
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          326   4e-97    
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    330   4e-97    
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             326   5e-97    
emb|CDY05295.1|  BnaC05g45080D                                          326   6e-97    
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     325   7e-97    
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    326   8e-97    
emb|CAA96435.1|  pectin methylesterase                                  317   8e-97    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    332   8e-97    
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                323   8e-97    
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    330   9e-97    
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    325   9e-97    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             324   1e-96    
emb|CAA96434.1|  pectin methylesterase                                  316   2e-96    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             324   2e-96    
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   2e-96    
ref|XP_010687597.1|  PREDICTED: pectinesterase                          325   2e-96    
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     324   2e-96    
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             325   2e-96    
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     324   2e-96    
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    324   2e-96    
ref|XP_003591168.1|  Pectinesterase                                     325   3e-96    
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     324   3e-96    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  324   4e-96    
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     323   4e-96    
gb|AFC98398.1|  pectin methylesterase                                   323   4e-96    
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    323   4e-96    
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    323   4e-96    
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    323   5e-96    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   322   7e-96    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     323   7e-96    
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     317   8e-96    
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    322   9e-96    
ref|XP_008439965.1|  PREDICTED: pectinesterase                          322   9e-96    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    323   9e-96    
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     323   9e-96    
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    323   1e-95    
gb|EPS65387.1|  pectinesterase                                          322   1e-95    
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    322   1e-95    
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    322   1e-95    
emb|CAB95025.1|  pectin methylesterase                                  322   1e-95    Nicotiana tabacum [American tobacco]
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    322   1e-95    
emb|CDY34642.1|  BnaC08g42010D                                          318   2e-95    
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     323   2e-95    
gb|AAO85706.1|  pectin methyl-esterase                                  322   2e-95    Nicotiana benthamiana
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             322   2e-95    
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     318   2e-95    
ref|NP_001274969.1|  pectin methyl esterase                             322   2e-95    
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              315   2e-95    
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    321   2e-95    
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    321   2e-95    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     321   2e-95    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    322   2e-95    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    321   2e-95    
ref|XP_002889876.1|  At1g11580/T23J18_33                                321   2e-95    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          322   3e-95    
gb|AFQ23194.1|  pectin methylesterase                                   322   3e-95    
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             321   3e-95    
ref|XP_003591164.1|  Pectinesterase                                     322   3e-95    
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    332   3e-95    
gb|EPS69059.1|  hypothetical protein M569_05708                         335   3e-95    
ref|NP_172624.1|  methylesterase PCR A                                  320   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275859.1|  pectinesterase 1 precursor                         321   5e-95    
ref|XP_002304257.2|  pectinesterase family protein                      321   5e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     321   5e-95    
gb|AAK59760.1|  At1g11580/T23J18_33                                     320   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    320   6e-95    
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    321   7e-95    
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     321   8e-95    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     321   8e-95    
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     320   9e-95    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         320   1e-94    
emb|CDO99718.1|  unnamed protein product                                319   1e-94    
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    320   1e-94    
ref|XP_002981054.1|  hypothetical protein SELMODRAFT_114014             314   1e-94    
gb|ABZ89800.1|  pectin methylesterase-like protein                      320   2e-94    Taiwania cryptomerioides
emb|CDX80613.1|  BnaC07g28310D                                          322   2e-94    
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     319   2e-94    
ref|XP_002982529.1|  hypothetical protein SELMODRAFT_116557             314   2e-94    
gb|EAY94391.1|  hypothetical protein OsI_16158                          319   2e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    317   2e-94    
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        318   2e-94    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    318   2e-94    
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     319   2e-94    
ref|NP_001265901.1|  pectinesterase 3-like                              319   2e-94    
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          320   2e-94    Sorghum bicolor [broomcorn]
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             318   2e-94    
gb|EAY94388.1|  hypothetical protein OsI_16156                          319   2e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    319   2e-94    
ref|NP_001052981.1|  Os04g0458900                                       318   3e-94    Oryza sativa Japonica Group [Japonica rice]
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     319   3e-94    
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    319   3e-94    Citrus sinensis [apfelsine]
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     319   3e-94    
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     322   3e-94    
ref|XP_003591166.1|  Pectinesterase                                     319   3e-94    
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     318   3e-94    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             319   3e-94    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     318   4e-94    
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    318   4e-94    
emb|CAH67075.1|  OSIGBa0097P08.5                                        318   4e-94    Oryza sativa [red rice]
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     318   4e-94    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          318   5e-94    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     317   5e-94    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             318   5e-94    
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     317   5e-94    
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    321   6e-94    
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    318   6e-94    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     315   6e-94    
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    318   6e-94    
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    318   6e-94    
ref|XP_009594458.1|  PREDICTED: pectinesterase                          321   7e-94    
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    318   7e-94    
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     318   7e-94    
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             318   8e-94    
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    317   8e-94    
emb|CDY68790.1|  BnaAnng28400D                                          321   8e-94    
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    318   9e-94    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             317   9e-94    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             317   1e-93    
emb|CAC01624.1|  putative pectin methylesterase                         317   1e-93    
gb|ABK94644.1|  unknown                                                 309   1e-93    
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    318   1e-93    
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     318   1e-93    
ref|XP_002868170.1|  predicted protein                                  321   1e-93    
ref|XP_010315470.1|  PREDICTED: pectinesterase                          318   1e-93    
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            316   2e-93    
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             317   2e-93    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     316   2e-93    
emb|CAC18727.1|  putative pectin methylesterase                         315   2e-93    
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    317   2e-93    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    316   2e-93    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     317   2e-93    
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             313   2e-93    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          315   2e-93    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     316   2e-93    
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    317   2e-93    
gb|AAL24278.1|  AT3g14310/MLN21_9                                       310   2e-93    
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             320   2e-93    
dbj|BAD95369.1|  pectin methylesterase like protein                     310   2e-93    
gb|AHC69829.1|  pectin methylesterase PME2.1                            316   2e-93    
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 316   3e-93    
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                317   3e-93    
emb|CDY66111.1|  BnaAnng21510D                                          321   3e-93    
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     315   3e-93    
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    317   3e-93    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          315   3e-93    
emb|CDY02461.1|  BnaA08g00680D                                          308   3e-93    
gb|KHN43418.1|  Putative pectinesterase/pectinesterase inhibitor 13     312   3e-93    
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    315   3e-93    
emb|CBI22967.3|  unnamed protein product                                330   3e-93    
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...    321   3e-93    
ref|XP_003604119.1|  Pectinesterase                                     318   3e-93    
gb|EPS67019.1|  pectinesterase                                          308   3e-93    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     315   3e-93    
dbj|BAK05856.1|  predicted protein                                      317   4e-93    
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              315   4e-93    
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    315   4e-93    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     315   5e-93    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     314   5e-93    
ref|NP_001042866.1|  Os01g0312500                                       310   6e-93    
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    315   6e-93    
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    315   6e-93    
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    312   8e-93    
emb|CAC18726.1|  putative pectin methylesterase                         315   8e-93    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   309   8e-93    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     315   8e-93    
ref|XP_011039649.1|  PREDICTED: pectinesterase-like isoform X2          314   8e-93    
emb|CDX76371.1|  BnaA08g10290D                                          307   9e-93    
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             315   9e-93    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    314   1e-92    
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    315   1e-92    
ref|XP_011039648.1|  PREDICTED: pectinesterase-like isoform X1          313   1e-92    
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             313   1e-92    
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    315   1e-92    
gb|AGG23325.1|  pectin methylesterase 1                                 314   1e-92    
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    314   1e-92    
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    315   1e-92    
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 313   1e-92    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    314   1e-92    
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    314   1e-92    
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     314   1e-92    
ref|XP_011039646.1|  PREDICTED: pectinesterase-like                     313   2e-92    
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          314   2e-92    
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     314   2e-92    
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    314   2e-92    
gb|ACQ85264.1|  pectin methylesterase                                   314   2e-92    
emb|CDP21547.1|  unnamed protein product                                317   2e-92    
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    313   2e-92    
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    314   2e-92    
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    315   2e-92    
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             313   2e-92    
ref|XP_006382081.1|  hypothetical protein POPTR_0006s27270g             313   2e-92    
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             313   2e-92    
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    317   2e-92    
ref|XP_006387527.1|  putative pectin methylesterase LuPME5 family...    312   3e-92    
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    314   3e-92    
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     314   3e-92    
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     313   3e-92    
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     313   3e-92    
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     313   3e-92    
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    317   3e-92    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   308   3e-92    
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    313   3e-92    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            312   4e-92    
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    312   4e-92    
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    310   4e-92    
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     313   4e-92    
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    315   4e-92    
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             313   4e-92    
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    313   4e-92    
ref|XP_008224789.1|  PREDICTED: pectinesterase                          312   5e-92    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     312   5e-92    
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    313   5e-92    
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                312   6e-92    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 309   6e-92    
gb|EPS66234.1|  hypothetical protein M569_08543                         313   6e-92    
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 312   7e-92    
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   312   7e-92    
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                312   7e-92    
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...    315   7e-92    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   313   8e-92    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    311   8e-92    
ref|XP_003626199.1|  Pectinesterase                                     313   8e-92    
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    312   8e-92    
emb|CDY08206.1|  BnaA05g14130D                                          312   8e-92    
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 312   8e-92    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     311   8e-92    
ref|XP_002317208.1|  pectin methylesterase family protein               311   8e-92    
emb|CDY51798.1|  BnaC06g41940D                                          312   8e-92    
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            315   9e-92    
gb|ACJ02103.1|  pectin methylesterase                                   311   9e-92    
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    311   9e-92    
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   306   9e-92    
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     311   9e-92    
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         303   9e-92    
gb|ACF79975.1|  unknown                                                 311   9e-92    
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     309   1e-91    
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    312   1e-91    
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    312   1e-91    
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    311   1e-91    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          310   1e-91    
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     311   2e-91    
ref|XP_002275000.1|  PREDICTED: pectinesterase                          311   2e-91    
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        312   2e-91    
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     311   2e-91    
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    311   2e-91    
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             311   2e-91    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     310   2e-91    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   311   2e-91    
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     311   2e-91    
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             311   2e-91    
ref|XP_008797393.1|  PREDICTED: probable pectinesterase/pectinest...    310   2e-91    
emb|CDY33229.1|  BnaC01g37020D                                          311   2e-91    
gb|AAC50023.1|  ATPME2 precursor                                        311   2e-91    
emb|CBI26012.3|  unnamed protein product                                311   2e-91    
ref|XP_003604120.1|  Pectinesterase                                     312   2e-91    
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              310   3e-91    
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 313   3e-91    
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     310   3e-91    
dbj|BAK06954.1|  predicted protein                                      310   3e-91    
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         310   3e-91    
ref|XP_002516192.1|  Pectinesterase PPE8B precursor, putative           310   3e-91    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            310   3e-91    
gb|AAC72288.1|  putative pectin methylesterase                          311   3e-91    
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               311   4e-91    
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 311   4e-91    
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        311   4e-91    
ref|NP_188048.1|  pectin methylesterase 3                               311   4e-91    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   311   4e-91    
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    306   4e-91    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     308   4e-91    
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    310   5e-91    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          310   5e-91    
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     310   5e-91    
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   311   5e-91    
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                     309   5e-91    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          310   6e-91    
ref|XP_011093901.1|  PREDICTED: probable pectinesterase/pectinest...    308   6e-91    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         310   6e-91    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     309   7e-91    
gb|EPS61512.1|  pectinesterase                                          307   7e-91    
gb|AAF23891.1|  pectin methyl esterase                                  308   7e-91    
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    310   7e-91    
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    309   7e-91    
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     309   7e-91    
gb|EEC70505.1|  hypothetical protein OsI_01594                          309   8e-91    
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    310   8e-91    
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 309   8e-91    
ref|NP_001274785.1|  pectin methyl esterase                             308   9e-91    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             310   9e-91    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          309   9e-91    
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    310   9e-91    
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    310   1e-90    
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     309   1e-90    
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                308   1e-90    
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     309   1e-90    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    309   1e-90    
gb|EPS74082.1|  hypothetical protein M569_00674                         307   1e-90    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          309   1e-90    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     308   1e-90    
gb|EAZ09211.1|  hypothetical protein OsI_31486                          304   1e-90    
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    310   1e-90    
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   308   1e-90    
ref|NP_175786.1|  pectin methylesterase 2                               309   1e-90    
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     308   1e-90    
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             314   1e-90    
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             310   1e-90    
ref|XP_007012502.1|  Pectin methylesterase 3                            309   2e-90    
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             309   2e-90    
ref|XP_009391195.1|  PREDICTED: probable pectinesterase/pectinest...    308   2e-90    
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     308   2e-90    
gb|AHB84678.1|  pectin methylesterase                                   308   2e-90    
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         308   2e-90    
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     307   2e-90    
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          308   2e-90    
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    309   2e-90    
ref|XP_009359675.1|  PREDICTED: probable pectinesterase/pectinest...    307   2e-90    
ref|XP_007031046.1|  Pectinesterase-2 precursor                         308   2e-90    
ref|XP_002885033.1|  ATPME3                                             309   2e-90    
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    308   2e-90    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     308   2e-90    
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    308   2e-90    
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     308   2e-90    
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          308   3e-90    
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    308   3e-90    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   306   3e-90    
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                308   3e-90    
ref|XP_002891774.1|  ATPME2                                             308   3e-90    
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     307   3e-90    
ref|XP_008337791.1|  PREDICTED: probable pectinesterase/pectinest...    306   3e-90    
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     308   3e-90    



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   426 bits (1094),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 243/316 (77%), Gaps = 3/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS ++K+IN AL+++P +N +R VI IKAGVY E+V +P K NNIVF+GEGP 
Sbjct  232   NVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNEHVEIPRKMNNIVFIGEGPT  291

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N ADG   GT+K+ T  V  + F+ +D+  ENTAG VK QAVALR+S DMA+
Sbjct  292   KTKITGSLNYADGT--GTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVALRVSGDMAI  349

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HSYRQF+R CTI+GT+DFIFG+A  VFQ+CKMI RKP++ QACMV
Sbjct  350   FHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRKPMDNQACMV  409

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD RG   IV+Q+C I AE    AA PP K +LGRPWKEFSRT+IM S ID  + 
Sbjct  410   TAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIA  469

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGWSPW GNFALDT +YAEY+NRGPG+ T  RV WKGY++ I+P+VA QFTPG F+M D
Sbjct  470   PEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPGVFIMGD  529

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+  + +P+ PG +
Sbjct  530   E-WVKLSGVPYEPGMI  544



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   424 bits (1090),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 244/312 (78%), Gaps = 4/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FK+I AA++++P  N++  VI IKAG+YKEYV +P   N IV +GEGP KT
Sbjct  251   VVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLPKHVNGIVLVGEGPTKT  310

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN  DGV  GT+++ T++V  +  + +DL IEN+AGAVK QAVALR+S D  +V+
Sbjct  311   KITGNKNFVDGV--GTFQTPTLSVNGDATILKDLGIENSAGAVKHQAVALRVSGDRTIVY  368

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLYTH+YRQ+YR CTISGT+DFIFG+A  VFQ CKM+ RKP+E Q CMVTA
Sbjct  369   NCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCKMVVRKPMENQGCMVTA  428

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRK+RRG  AIV+Q+C IVA+PA  A  PP K +LGRPWKEFSRT+IM + ID  + PE
Sbjct  429   QGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPE  488

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNF +DTC+YAEY NRGPGA T KRV+WKG K+ I+P++A+ FTPG ++  D  
Sbjct  489   GWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIAQSFTPGAYIQGDA-  546

Query  1606  WLGRAQIPFSPG  1571
             W+  + +P++PG
Sbjct  547   WITASGVPYAPG  558



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   420 bits (1080),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 241/310 (78%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS ++KTI  AL ++P  N++  VILIKAG YKE V +P    N+VF+GEGP KT
Sbjct  251   VVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIPRSITNVVFIGEGPTKT  310

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN ADG   GTY + TV V  +GFV RD+  ENTAGA K QAVALR+SAD  V +
Sbjct  311   KITGNKNFADGT--GTYHTATVAVNGDGFVARDIGFENTAGAKKHQAVALRVSADKTVFY  368

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLYTHSYRQFY+ CTI+GT+DFIFG+A VVFQ+CKMI RKP + QACMVTA
Sbjct  369   NCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKMIVRKPGDNQACMVTA  428

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKD RG  AIV+Q+CDI AEPA  +A PP K +LGRPWKE+SRT+I+ S+ID  + PE
Sbjct  429   QGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPE  488

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW GNFAL+T +YAEY+NRGPGA+ DKRVKW GYKRNISP+ A+++ P  F+  D  
Sbjct  489   GWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQD-N  547

Query  1606  WLGRAQIPFS  1577
             W+ +  I ++
Sbjct  548   WIKKTGISYA  557



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   418 bits (1074),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 238/309 (77%), Gaps = 3/309 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS ++KTI  AL ++P  N++  VILIKAG YKE V +P    N+VF+GEGP KT
Sbjct  251   VVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIPRSMINVVFIGEGPTKT  310

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN ADG   GTY + TV V  +GFV RD+  ENTAGA K QAVALR+SAD  V +
Sbjct  311   KITGNKNFADGT--GTYHTATVAVNGDGFVARDIGFENTAGAKKHQAVALRVSADKTVFY  368

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLYTHSYRQFY+ CTI+GT+DFIFG+A  VFQ+CKMI RKP + QACMVTA
Sbjct  369   NCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKMIVRKPGDNQACMVTA  428

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKD RG  AIV+Q+CDI AEPA  +  PP K +LGRPWKE+SRT+IM S+ID  + PE
Sbjct  429   QGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPE  488

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW GNFAL+T +YAEY+NRGPGA+ DKRVKW GYKRNISP+ A+++ P  F+  D  
Sbjct  489   GWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQD-N  547

Query  1606  WLGRAQIPF  1580
             W+ +  I +
Sbjct  548   WIKKTGISY  556



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   417 bits (1073),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 241/316 (76%), Gaps = 3/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VA DGS ++K+IN AL+++P  N ++ VI IKAGVY E+V +P K NNI+F+GEGP 
Sbjct  232   NVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNEHVEIPRKMNNIIFIGEGPT  291

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N ADG   GT+K+ T  V  + F+ +D+  ENTAG VK QAVALR+S DMA+
Sbjct  292   KTKITGSLNYADGT--GTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVALRVSGDMAI  349

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HSYRQF+R CTI+GT+DFIFG+A  VFQ+C+MI RKP++ QACMV
Sbjct  350   FHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRKPMDNQACMV  409

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD RG   IV+Q+C I AE    AA PP K +LGRPWKEFSRT+IM S ID  + 
Sbjct  410   TAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFIA  469

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGWSPW GNFALDT +YAEY+NRGPG+ T  RV WKGY++ I+P+VA QFTP  F+M D
Sbjct  470   PEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPAVFIMGD  529

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+  + +P+ PG +
Sbjct  530   E-WVKLSGVPYEPGMI  544



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   416 bits (1068),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 241/312 (77%), Gaps = 4/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FK+I AA++++P  N++  VI IKAG+YKEYV +P   N IV +GEGP KT
Sbjct  235   VVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLPKHVNGIVLVGEGPTKT  294

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN  DGV  GT+++ T++V  +  + +DL IEN+AGAVK QAVALR+S D  +V+
Sbjct  295   KITGNKNFVDGV--GTFQTPTLSVNGDATILKDLGIENSAGAVKHQAVALRVSGDRTIVY  352

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLYTH+YRQ+YR CTISGT+DFIFG+   VFQ CKM+ RKP+E Q CMVTA
Sbjct  353   NCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMVVRKPMENQGCMVTA  412

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRK+RRG  AIV+Q+C IVA+PA  A  PP K +LGRPWKEFSRT+IM + ID  + PE
Sbjct  413   QGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPE  472

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNF +DTC+YAEY NRGPGA T KRV+WKG K+ I+P++A+ FTPG ++  D  
Sbjct  473   GWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIAQSFTPGAYIQGDA-  530

Query  1606  WLGRAQIPFSPG  1571
             W+  + + ++ G
Sbjct  531   WITASGVTYASG  542



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   409 bits (1051),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 241/316 (76%), Gaps = 3/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS ++K+IN AL ++P  N ++ VI IKAG+YKEY+ +P K N+IVF+GEGP 
Sbjct  240   NVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAGIYKEYIDIPKKMNHIVFIGEGPT  299

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN ADG+  GT+++ TV +  + F+ +D+ IENTAGA+K QAVALR+S D A+
Sbjct  300   KTKITGNKNFADGI--GTFQTATVAINGDNFMAKDIGIENTAGAIKHQAVALRVSGDKAI  357

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC  + YQDTLY H+YRQF+R CTI+GT+DFIFG+A  VFQSCKMI RKP+  QACMV
Sbjct  358   FHNCQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKMIVRKPMANQACMV  417

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRRG  AIV+Q+C+I AE    +  P  K +LGRPWKEFSRT+IM S ID  + 
Sbjct  418   TAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFID  477

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GWS W G+FAL T +YAEY+NRG GA+++ RV W+GYK+NI  E+A  F PG F++AD
Sbjct  478   PQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIAAGFAPGVFILAD  537

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+  + +P+  G +
Sbjct  538   E-WVRLSGVPYESGLM  552



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   405 bits (1042),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 235/309 (76%), Gaps = 3/309 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FKTI  AL  +P  N +  VILIKAG YKE V VP    N+VF+GEGP KT
Sbjct  247   VVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEIVDVPRGVTNVVFIGEGPTKT  306

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN ADG    T+ + TV V  +GFV RD+  ENTAGA+K QAVALR+SAD AV +
Sbjct  307   KITGNKNYADGT--ATFHTATVAVNGDGFVARDIGFENTAGAMKHQAVALRVSADKAVFY  364

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLYTHSYRQFY+ C+ISGT+DFIFG+A  VFQ+CKMI RKP   QACMVTA
Sbjct  365   NCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKPGNNQACMVTA  424

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKD RG  AIV+++C+I AEPA  +  PP K +LGRPWKE+SRT+IM + ID  + PE
Sbjct  425   QGRKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQTQIDAFIDPE  484

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW GNFAL+T +YAEY+NRGPGA+TDKRVKW GYKRNISP+ A+++ P  F+  D  
Sbjct  485   GWAPWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEAEKYAPNIFIDQD-S  543

Query  1606  WLGRAQIPF  1580
             W+ +  I +
Sbjct  544   WIKKTGISY  552



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   397 bits (1020),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 233/309 (75%), Gaps = 3/309 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FKTI  AL  +P  N +  VILIKAG YKE V +P    N+VF+GEGP KT
Sbjct  243   VVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEMVDIPRGVTNVVFIGEGPTKT  302

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNKN ADG    T+ + TV V  +GFV +D+  ENTAGA+K QAVALR+SAD  V +
Sbjct  303   KITGNKNYADGTA--TFHTSTVAVNGDGFVAKDIGFENTAGAMKHQAVALRVSADKTVFY  360

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLYTHSYRQFY+ C+ISGT+DFIFG+A  VFQ+CKMI RKP   QACMVTA
Sbjct  361   NCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKPGANQACMVTA  420

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKD RG  AI++++C+I AEPA     PP K +LGRPWKE+SRT+IM S ID  + PE
Sbjct  421   QGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPE  480

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW GNFAL+T +YAEY+NRGPGA+TD+RVKW GYK++ISP+ A+++ P  F+  D  
Sbjct  481   GWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEKYAPNIFIDQDS-  539

Query  1606  WLGRAQIPF  1580
             W+ +  I +
Sbjct  540   WIKKTGISY  548



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   386 bits (991),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 233/314 (74%), Gaps = 4/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             ++AQDGS  FKTI  A++++P  N    VILIKAGVYKE +++P + NN+V MGEGP  T
Sbjct  255   IIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKEVILIPRRINNVVIMGEGPNVT  314

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              IT NKN  DG+  GT+ + TV +  +G + RD+ IEN+AG  K QAVALR+S D  +V+
Sbjct  315   KITANKNYVDGI--GTFHTATVAINGDGCILRDIGIENSAGPEKHQAVALRVSGDRTIVY  372

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY+H+YRQFYR  TISGT+DFIFG+A  VFQ+CK+I R PL  QACMVTA
Sbjct  373   NCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLIVRMPLVNQACMVTA  432

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R   AIV+Q+C IVA+PAL +A+PP + +LGRPWKE+SRT+IM S ID  + P+
Sbjct  433   QGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRTIIMQSNIDGFIDPQ  492

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW G F L T +YAEY+NRGPGA+TD+RV W G + +I+P+VA+ FTPG + + D  
Sbjct  493   GWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQ-HITPQVAESFTPGKYFIGDS-  550

Query  1606  WLGRAQIPFSPGYV  1565
             W+  +  P+ PG +
Sbjct  551   WITASGFPYVPGML  564



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   386 bits (991),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 233/316 (74%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVAQDGS +FKTI  A++S+P   D   VI +KAG YKE VI P K NN+V +G+GP 
Sbjct  259   NIVVAQDGSGQFKTITGAINSLPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPL  318

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+KN  DGV   T+ +  + V  +GF+ +D+ IENTAG +K QAVA+R+S D ++
Sbjct  319   KTRISGSKNYVDGV--QTFHTAVLGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSI  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +N H+N++QDTLY H+YRQ+YR CTI+GT+DFIFG+A  VFQ+C+MI RKPL  Q CMV
Sbjct  377   FYNVHMNSFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR     VIQ+C I+AEPA  +  PP K +LGRPWK+FSRT+IM + ID  + 
Sbjct  437   TAQGRKERRSTGVTVIQNCHILAEPAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIA  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+PW+GNFALDT +Y E+KNRGPG+   +RV+WKG +  I+P +A+ FTPG     D
Sbjct  497   PEGWAPWEGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIAESFTPGRLFAGD  555

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+ ++ +P+  G V
Sbjct  556   E-WVRQSGVPYVAGMV  570



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   385 bits (989),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 231/316 (73%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVAQDGS +FKTI  A++S+P   D   VI +KAG YKE VI P K NN+V +G+GP 
Sbjct  259   NIVVAQDGSGQFKTITGAINSLPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPL  318

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+KN  DGV   T+ +  + V  +GF+ +D+ IENTAG +K QAVA+R+S D ++
Sbjct  319   KTRISGSKNYVDGV--QTFHTAVLGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSI  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +N H+N +QDTLY H+YRQ+YR CTI+GT+DFIFG+A  VFQ+C+MI RKPL  Q CMV
Sbjct  377   FYNVHMNGFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR     VIQ+C I+AEPA  +  PP K +LGRPWK+FSRT+IM + ID  + 
Sbjct  437   TAQGRKERRSTGVTVIQNCHILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIA  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+PW+GNFALDT +Y E+KNRGPG+   +RV+WKG +  I+P +A  FTPG     D
Sbjct  497   PEGWAPWQGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIADSFTPGRLFAGD  555

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+ ++ +P+  G V
Sbjct  556   E-WVRQSGVPYVAGMV  570



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   379 bits (973),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 228/317 (72%), Gaps = 3/317 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS ++KTI  AL ++P  N    VILIKAG+YKEYV V     N+VF+GEG  KT
Sbjct  237   VVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVDVEKGMTNVVFIGEGSTKT  296

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNK V +  +G T+ + TV V  EGFV RD+  ENTAGAVKEQAVALR++AD AV++
Sbjct  297   KITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENTAGAVKEQAVALRVNADKAVIY  356

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS RQFYR C I+GT+DF+FG+A  VFQ+CK+I RKP +GQ CMVTA
Sbjct  357   NCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKPGDGQNCMVTA  416

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR       A+V+Q+C+I AEP   A  PP K FLGRPWKE+SRT+IM S+ID  + P 
Sbjct  417   QGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQSYIDGFIDPT  476

Query  1786  GWSPWKGN-FALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLM-A  1616
             GW+PW    F + TCWYAEY+NRGPGAS DKR+  W+GY++ IS +VA  FT G F+   
Sbjct  477   GWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANSFTAGLFINPT  536

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D  +L +A IP+  G +
Sbjct  537   DSSFLPKADIPYEAGMM  553



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   370 bits (950),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 226/315 (72%), Gaps = 3/315 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
              VA DGS ++KTI  ALD++P  N    +I IKAGVYKEY+ +P    N+V +GEGP KT
Sbjct  60    TVALDGSGQYKTIKEALDAVPKKNTEPFIIFIKAGVYKEYIDIPKSMTNVVLIGEGPTKT  119

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNK+V DG    T+ + TV V    FV +++  ENTAG  KEQAVALR+SAD A+++
Sbjct  120   KITGNKSVKDG--PSTFHTTTVGVNGANFVAKNIGFENTAGPEKEQAVALRVSADKAIIY  177

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY H+YRQFYR CTI+GTVDFIFGN   V Q+CK+I RKP + Q+CMVTA
Sbjct  178   NCQIDGYQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVLQNCKVIVRKPAQNQSCMVTA  237

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +     AIV+Q+C+I  +    + +PP+K +LGRPWKE+SRT+IM S+ID  + PE
Sbjct  238   QGRTEPIQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPWKEYSRTIIMQSYIDKFIEPE  297

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADE  1610
             GW+PW   NF  DT +YAEY+NRGPGA+ DKR+ WKG+++  + E A++FT G ++  DE
Sbjct  298   GWAPWNITNFGRDTSYYAEYQNRGPGAALDKRITWKGFQKGFTGEAAQKFTAGVYINNDE  357

Query  1609  QWLGRAQIPFSPGYV  1565
              WL +A +P+  G +
Sbjct  358   NWLQKANVPYEAGMM  372



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   375 bits (962),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 225/317 (71%), Gaps = 3/317 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS ++KTI  AL ++P  N    VILIKAG+YKEYV V     N+VF+GEG  KT
Sbjct  237   VVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVEVEKGMTNVVFIGEGSTKT  296

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNK+V    +G T+ + TV V  EGFV RD+  ENTAG  +EQAVALR++AD AV++
Sbjct  297   KITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPAQEQAVALRVNADKAVIY  356

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS RQFYR C ISGT+DF+FG+A  VFQ+CK+I R+P +GQ CMVTA
Sbjct  357   NCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLIVRRPGDGQNCMVTA  416

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR       A VIQ+C+I AEP   AA P  K FLGRPWKE+SRT+IM SFID  + P 
Sbjct  417   QGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRTIIMQSFIDGFIDPS  476

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLM-A  1616
             GW+PW   +F + TCWYAEY+NRG GAS DKRV  W+GY+R IS +VA  FT G F+   
Sbjct  477   GWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGDVANSFTAGVFINPT  536

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D  +L +A IP+  G +
Sbjct  537   DNSFLPKADIPYEAGMM  553



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   375 bits (963),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 236/317 (74%), Gaps = 6/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVIL-IKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             ++VVA+DGS +F+TIN AL  IP +N R+T +L IKAGVYKE V+   K  N++ +G+GP
Sbjct  262   NLVVAKDGSGRFRTINEALKHIP-LNSRKTFVLHIKAGVYKEQVVFDEKMTNVMLVGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT I+ NKN ADG    T+K+ TV+V  + F+ RD+  EN+AGA+K QAVAL + +DMA
Sbjct  321   TKTRISFNKNYADGTT--TFKTATVSVFGDNFIARDIGFENSAGAIKHQAVALMVRSDMA  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + HNCH++ YQDTLY HS RQFYR CTI+GT+DF+ G+A  VFQ+CKM+ RKPL+ Q C+
Sbjct  379   IFHNCHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNCKMLIRKPLDNQQCI  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR  RR A+A+++Q+C I A+P+          +LGRPWK +SRT+IM S+ID+I+
Sbjct  439   VTAQGRSKRREASALILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDII  498

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              P+GW PW G+F L+TC+YAEYKNRGPGAST +RVKWKG K+ I+P+ A +FT G F+  
Sbjct  499   QPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIKK-ITPQHAVEFTAGRFMKG  557

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  A +P+  G +
Sbjct  558   D-RWIRTAGVPYVAGML  573



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   374 bits (961),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 231/316 (73%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K+ +IN AL  +P  N    VI IKAGVYKE VIV     N++F+G+G  
Sbjct  372   NVVVAKDGSGKYTSINEALQEVPKDNPTTFVIYIKAGVYKEQVIVTKSMTNVMFIGDGRT  431

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N ADG   GT+++ TV V  +GF+ +D+  ENTAGA+K QAVALR+ +D ++
Sbjct  432   KTKITGDLNYADGT--GTFRTATVGVVGDGFIAKDIGFENTAGAIKHQAVALRVQSDQSI  489

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY HS+RQFYR CTISGT+DFIFG++  V Q+CK+I RKPLE Q C+V
Sbjct  490   FYNCQMDGYQDTLYAHSHRQFYRDCTISGTIDFIFGDSATVLQNCKIIVRKPLENQQCIV  549

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR +RR  +A+V+Q+C I  +P        NK +LGRPWKEFSRTLIM S ID+I+ 
Sbjct  550   TAQGRIERREVSALVLQNCTISGDPEYLPVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIA  609

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+FAL+T WYAE+ NRGPGA    RV W+G K+ I+  +A++FTPG FL  D
Sbjct  610   PEGWLPWNGDFALNTLWYAEFGNRGPGAVQTHRVTWRGIKK-INAAIARRFTPGVFLRGD  668

Query  1612  EQWLGRAQIPFSPGYV  1565
             + W+ +A +P++PG +
Sbjct  669   D-WIPKAGVPYTPGLI  683



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   371 bits (952),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+QDGS +F TI+AA+ ++P  ND+  VI +KAGVYKE V++P   N IV +G+GP KT
Sbjct  280   VVSQDGSGQFNTISAAIATVPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKT  339

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              +TG  N A+GV   TY + TV V ++ F+ +D+  ENTAGA   QAVALR S D AV +
Sbjct  340   RVTGRLNFAEGV--KTYHTATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFY  397

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR CTISGT+DFIFG+A  +FQ+C+ + RKPL  QACM+TA
Sbjct  398   NVHIDGYQDTLYAHTYRQYYRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITA  457

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR DRR   AIVIQ+ DI AEPAL  A+PP+K++LGRPWK+FS T+IM S I   + PE
Sbjct  458   QGRVDRRSVGAIVIQNGDIAAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIGGFIAPE  517

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW G FALDT +YAEYKNRGPG+    RV+WKG +  +SP++A+ +T G     DE 
Sbjct  518   GWSPWAGTFALDTLYYAEYKNRGPGSDVKNRVQWKGIQ-TLSPQMAESWTGGKIYGGDE-  575

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  576   WIRISGVPYVP  586



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   370 bits (949),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +F TI+AA+ S+P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  262   VVAQDGSGQFNTISAAIASVPPKNNQTFVIHVKAGVYKEYVQIPKKVNKIVLIGDGPLKT  321

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   TY + TV V A+ F+ +D+  ENTAGA   QAVALR+S D AV +
Sbjct  322   RISGRKNYAEGV--KTYHTATVAVNADDFLAKDIGFENTAGAAGHQAVALRVSGDRAVFY  379

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG++  +FQ+CK + RKP+  QACMVTA
Sbjct  380   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDSQALFQNCKFVVRKPMANQACMVTA  439

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R    A +IQ+ D VAEPAL  A+PP+KV+LGRPWK  SRT+IM S I   + PE
Sbjct  440   QGRVERHSLGATIIQNGDFVAEPALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPE  499

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+ W G FALDT +YAEY+NRGPG+    RVKWKG +  +SP++A+ +T G F   DE 
Sbjct  500   GWAEWSGTFALDTLYYAEYQNRGPGSDLKNRVKWKGIQ-TLSPQMAESWTGGKFYGGDE-  557

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  558   WVKNSGVPYIP  568



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   370 bits (950),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/314 (54%), Positives = 226/314 (72%), Gaps = 4/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS ++ TI AAL ++P   ++  VI +KAGVYKE VI+P   NNIV +G+GP KT
Sbjct  274   VVAKDGSGQYGTIAAALKTLPKKTNQTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKT  333

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I GNKN ADGV   T+ +  + V  +GF+ +D+ IENTAGA K QAVA+R+S D A+ +
Sbjct  334   RIIGNKNYADGVQ--TFHTAVLAVNGDGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFY  391

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQFYR C I+GT+DFIFG+A  +FQ C+++ R+P++ QACMVTA
Sbjct  392   NVHMDGYQDTLYAHAYRQFYRDCQITGTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTA  451

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKD+R     V+Q CDIVA+PA  A  PP   +LGRPWKE+SRT++M S ID  + PE
Sbjct  452   QGRKDQRSVGVTVLQGCDIVADPAFLAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPE  511

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GN+AL T +Y EY+NRG G+    RV WKG K+ I+P +A+ FTPG  +  ++ 
Sbjct  512   GWSPWMGNYALSTLYYGEYQNRGAGSGLSGRVTWKGIKK-ITPAIAQSFTPG-VVYKNDT  569

Query  1606  WLGRAQIPFSPGYV  1565
             W+  + IP+  G +
Sbjct  570   WVSTSGIPYVSGML  583



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   369 bits (946),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 223/317 (70%), Gaps = 4/317 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS ++KTI  AL ++P  N    VILIKAG+YKEYV V     N+VF+GEG  KT
Sbjct  238   VVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKEYVEVEKGMTNVVFIGEGSTKT  297

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGNK      +G T+ + TV V  EGFV RD+  ENTAG   EQAVALR++AD AV++
Sbjct  298   KITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPTLEQAVALRVNADKAVIY  357

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS RQFYR C ISGT+DF+FG+A  VFQ+CK+I RKPL+ Q CMVTA
Sbjct  358   NCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLIVRKPLDSQNCMVTA  417

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR       AIVIQ+C+I A+P   AA P    +LGRPWKE+SRT+IM SFID  + P 
Sbjct  418   QGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYLGRPWKEYSRTIIMQSFIDGFIDPA  476

Query  1786  GWSPWKG-NFALDTCWYAEYKNRGPGASTDKRV-KWKGYKRNISPEVAKQFTPGPFLM-A  1616
             GWSPW   +F L TCWYAEY+NRGPGAS DKRV  W+GY+R IS +VA  FT G F+  +
Sbjct  477   GWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGDVANSFTAGQFINPS  536

Query  1615  DEQWLGRAQIPFSPGYV  1565
                +L +A IP+  G +
Sbjct  537   GSSFLPKADIPYEAGMM  553



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   369 bits (946),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 230/322 (71%), Gaps = 8/322 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS + K+IN AL ++P  N +  VI IKAG+Y EYV V +   N+VF+GEGP 
Sbjct  237   NVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNEYVQVANTMTNVVFIGEGPN  296

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DG+    + + TV +  +GFV +D+  EN+AG +K QAVALR+SA+MAV
Sbjct  297   KTKITGNKNYLDGL--PVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRVSAEMAV  354

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKP--LEGQAC  1979
               NC ++ YQ TL TH  RQFYR CTI+GT+DFIFG+A  VFQ+CK+IARKP  ++ QA 
Sbjct  355   FQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEEMQTQAI  414

Query  1978  MVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKEFSRTLIMFSFIDN  1802
              + AQGR  + G  AI+IQ+C I AEPAL A NPP NK +LGRPWK +SRT+IM S ID 
Sbjct  415   TIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIMQSQIDG  474

Query  1801  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              + PEGW+PW G FALDT ++ EY+NRGPGA+TDKRV WK Y +N +P+V  +FTPG  L
Sbjct  475   FIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKFTPGVVL  534

Query  1621  MADEQ---WLGRAQIPFSPGYV  1565
                +    W+ +  +P+ PG +
Sbjct  535   KGGDNTDTWVTKTGVPYEPGMM  556



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   368 bits (945),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 230/322 (71%), Gaps = 8/322 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS + K+IN AL ++P  N +  VILIKAG+Y EYV V +   N+VF+GEGP 
Sbjct  237   NVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNEYVQVANTMTNVVFIGEGPN  296

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DG+    + + TV +  +GFV +D+  EN+AG +K QAVALR+SA+MAV
Sbjct  297   KTKITGNKNYLDGL--PVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRVSAEMAV  354

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKP--LEGQAC  1979
               NC ++ YQ TL TH  RQ YR CTI+GT+DFIFG+A  VFQ+CK+IARKP  ++ QA 
Sbjct  355   FQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEEMQTQAI  414

Query  1978  MVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKEFSRTLIMFSFIDN  1802
              + AQGR  + G  AI+IQ+C I AEPAL A NPP NK +LGRPWK +SRT+IM S ID 
Sbjct  415   TIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIMQSQIDG  474

Query  1801  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              + PEGW+PW G FALDT ++ EY+NRGPGA+TDKRV WK Y +N +P+V  +FTPG  L
Sbjct  475   FIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKFTPGVVL  534

Query  1621  MADEQ---WLGRAQIPFSPGYV  1565
                +    W+ +  +P+ PG +
Sbjct  535   KGGDNTDTWVTKTGVPYEPGMM  556



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   367 bits (943),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 227/311 (73%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +F TI+AA+ S+P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  310   VVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVYKEYVQIPKKMNKIVLIGDGPLKT  369

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   TY + TV V A+ F+ +D+  ENTAGA+  QAVALR+S D AV +
Sbjct  370   RISGRKNFAEGV--KTYHTATVAVNADDFLAKDIGFENTAGALGHQAVALRVSGDRAVFY  427

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACM+TA
Sbjct  428   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMITA  487

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R      VIQ+ DIVAEPAL  A+PP+KV+LGRPWK  SRT+IM S I   + PE
Sbjct  488   QGRVERHSLGVTVIQNGDIVAEPALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPE  547

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW G FALDT +YAEY+NRGPG+    RV WKG ++ +SP++A+ +T G     DE 
Sbjct  548   GWAPWAGTFALDTLYYAEYQNRGPGSDLKARVTWKGIQK-LSPQMAESWTGGKLFGGDE-  605

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  606   WIRGSGVPYVP  616



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   364 bits (935),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI+AA+ S+P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  235   VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKT  294

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   TY + TV+V A+ F  +D+  ENTAG    QAVALR+S D A+ H
Sbjct  295   RISGRKNYAEGV--KTYHTATVSVNADEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFH  352

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  353   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTA  412

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT+IM S I   V+PE
Sbjct  413   QGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPE  472

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A+ +T       DE 
Sbjct  473   GWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMAESWTGAKMYQGDE-  530

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  531   WIRNSGVPYVP  541



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   363 bits (933),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI+AA+ S+P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  235   VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKT  294

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   T+ + TV+V A+ F  +D+  ENTAG    QAVALR+S D A+ H
Sbjct  295   RISGRKNYAEGV--KTFHTATVSVNADEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFH  352

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  353   NVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTA  412

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT+IM S I   V+PE
Sbjct  413   QGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPE  472

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A+ +T       DE 
Sbjct  473   GWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMAESWTGAKMYQGDE-  530

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  531   WIRNSGVPYVP  541



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   364 bits (935),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 224/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS K+KTI  AL+ +P  N++  VI IK GVYKE V+V  K  N++ +G+GP 
Sbjct  265   DVVVAQDGSGKYKTIREALNEVPKKNNKTFVIYIKEGVYKEKVLVDKKTTNVMIIGDGPT  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVITG+ N  DGV   T  + T T     F+ +D+  EN+AGA K QAVALR+ +DM+V
Sbjct  325   KTVITGSLNYVDGV--QTCNTATFTAIGSYFIAKDIKFENSAGAEKHQAVALRVQSDMSV  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++NCH++A+QDTLY H++RQFYR CTISGT+DFIFG+A  VFQ+C+M  +KPLE Q C+V
Sbjct  383   IYNCHMDAFQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQNCQMFVKKPLENQQCIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR +RR A+AIV+Q+C I A+PA       NK +LGRPWK++SRT+IM S ID+++ 
Sbjct  443   TASGRSERRSASAIVLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLIQ  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW  W GNFAL+TC+YAEY NRG G++T  R KW+G K   +  +   FTP  F   D
Sbjct  503   PQGWLAWMGNFALNTCFYAEYGNRGAGSATTGRAKWRGIKSMTAQHIV-DFTPKAFFKGD  561

Query  1612  EQWLGRAQIPFSP  1574
             + W+    +P+SP
Sbjct  562   DAWITATGVPYSP  574



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   363 bits (932),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI+AA+ S+P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  235   VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKT  294

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   T+ + TV+V A+ F  +D+  ENTAG    QAVALR+S D A+ H
Sbjct  295   RISGRKNYAEGV--KTFHTATVSVNADEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFH  352

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  353   NVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTA  412

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT+IM S I   V+PE
Sbjct  413   QGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPE  472

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G + + SP++A+ +T       DE 
Sbjct  473   GWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGIQ-HFSPQMAESWTENVMYQGDE-  530

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  531   WIRNSGVPYVP  541



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   363 bits (931),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 223/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  A+DS+P  N++  VI IKAGVYKE+V +P K N IVF+G+GP KT
Sbjct  255   VVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVYKEHVEIPKKMNKIVFIGDGPLKT  314

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+K+ A GV   T+++ TV V AE F  +++  ENTAGA   QAVALR+S D AV +
Sbjct  315   RITGSKSFAGGV--KTFQTATVAVNAEEFTAKNIGFENTAGAEGHQAVALRVSGDKAVFY  372

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N  ++ YQDTLY H+YRQFY  C+ISGT+DFIFG++  +FQ+CK I RKP++ QACMVTA
Sbjct  373   NVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDNQACMVTA  432

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R   AIVIQ+  I AE A  A  P    +LGRPWKE SRT+IM S ID  + P+
Sbjct  433   QGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPD  492

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNFALDTC+Y EY+NRG G+    RV WKG K+ I+PE+A+ +T G     DE 
Sbjct  493   GWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIKK-ITPEIAQSWTGGVAFKGDE-  550

Query  1606  WLGRAQIPFSP  1574
             W+  A++P+ P
Sbjct  551   WIKAARVPYVP  561



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   362 bits (928),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI+AA+ ++P  N++  VI +KAGVYKEYV +P K N IV +G+GP KT
Sbjct  235   VVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKT  294

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   T+ + TV+V A+ F  +D+  ENTAG    QAVALR+S D A+ H
Sbjct  295   RISGRKNYAEGV--KTFHTATVSVNADEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFH  352

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  353   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTA  412

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT+IM S I   V+PE
Sbjct  413   QGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPE  472

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G + + SP++A+ +T       DE 
Sbjct  473   GWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGIQ-HFSPQMAESWTGAKMYQGDE-  530

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  531   WIRNSGVPYVP  541



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   362 bits (929),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 223/311 (72%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  A+DS+P  N++  VI IKAGVYKE+V +P K N IVF+G+GP KT
Sbjct  253   VVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVYKEHVEIPKKMNKIVFIGDGPLKT  312

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+K+ A GV   T+++ TV V +E F  +++  ENTAGA   QAVALR+S D AV +
Sbjct  313   RITGSKSFAGGV--KTFQTATVAVNSEEFTAKNIGFENTAGAEGHQAVALRVSGDKAVFY  370

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N  ++ YQDTLY H+YRQFY  C+ISGT+DFIFG++  +FQ+CK I RKP++ QACMVTA
Sbjct  371   NVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSLFQNCKFIVRKPMDNQACMVTA  430

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R   AIVIQ+  I AE A  A  P    +LGRPWKE SRT+IM S ID  + P+
Sbjct  431   QGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPD  490

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNFALDTC+Y EY+NRG G+    RV WKG K+ I+PE+A+ +T G     DE 
Sbjct  491   GWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIKK-ITPEIAQSWTGGVAFKGDE-  548

Query  1606  WLGRAQIPFSP  1574
             W+  A++P+ P
Sbjct  549   WIKAARVPYVP  559



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   361 bits (926),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 221/313 (71%), Gaps = 4/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA+DGS  +KTI  AL  IP  ++   V+ IK G+Y+EYV       N+V +G+GP 
Sbjct  269   DLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKEGIYEEYVEFNRSMTNLVVIGDGPD  328

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+KN  DG+   TY++ TV V  + FV R++  EN+AGA+K QAVALR+S+D AV
Sbjct  329   KTRITGSKNFVDGI--NTYRTATVAVIGDNFVARNIGFENSAGAIKHQAVALRVSSDYAV  386

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH+ RQFYR CT+SGT+DF+FG+APVVFQ+C  + RKPLE Q C+V
Sbjct  387   FYNCSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVVFQNCTFLVRKPLENQQCIV  446

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK RR  +AI+IQ+  I A P L+      K +LGRPWKEFSRT+IM +FID+++ 
Sbjct  447   TAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQ  506

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGWSPW G+F L TCWY EY N GPG+    RVKW G K  +S + A  FTPG FL  D
Sbjct  507   PEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGIK-PVSRQHAIDFTPGRFLRGD  565

Query  1612  EQWLGRAQIPFSP  1574
               W+    +P++P
Sbjct  566   -SWIKPTGVPYAP  577



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   359 bits (922),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 218/310 (70%), Gaps = 4/310 (1%)
 Frame = -3

Query  2503  VAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKTV  2324
             VAQDGS  FKTI AAL ++P  ++   VI +KAGVYKE VI+P K NN+V  G+GP KT 
Sbjct  253   VAQDGSGDFKTIGAALSTLPKKSNATFVIHVKAGVYKETVIIPKKVNNVVIYGDGPNKTR  312

Query  2323  ITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVHN  2144
             +  NKN ADGV   T+ + T+ V ++GF+ +D+  EN+AGA K QAVA+R+S D A+ +N
Sbjct  313   VVNNKNYADGV--ETFHTATLAVNSDGFMAKDIAFENSAGASKHQAVAVRVSGDKAIFYN  370

Query  2143  CHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTAQ  1964
               ++ YQDTLY H YRQ YR CTISGT+DFIFG+A  VFQ C+MI RKP   Q CMVTAQ
Sbjct  371   VVMDGYQDTLYAHGYRQLYRNCTISGTIDFIFGDATAVFQKCRMIVRKPDINQNCMVTAQ  430

Query  1963  GRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEG  1784
             GRKD+R     VIQ  +IV EP   A  P    FLGRPWKE+SRT+IM ++ID  + P G
Sbjct  431   GRKDQRSIGITVIQDSEIVPEPGFTAVVPKIDAFLGRPWKEYSRTIIMQTYIDGFIDPAG  490

Query  1783  WSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQW  1604
             WSPW GN+AL+T +Y EY+NRGPG+ T KRV WKG K+ I+PE+A+ FT     + D  W
Sbjct  491   WSPWMGNYALNTLYYGEYQNRGPGSDTSKRVTWKGIKK-ITPELAQTFTAQKVFLND-GW  548

Query  1603  LGRAQIPFSP  1574
             +  + +P++P
Sbjct  549   VTNSSVPYTP  558



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   360 bits (923),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 224/316 (71%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA+DGS K+KTI  AL  IP  +++  V+ +K GVY+E +I   K   +  +G+GP 
Sbjct  259   DLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVYREQIIFDKKMWRLTLIGDGPT  318

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I  N N  DGV   T+K+ TV V  E F+ +D+  EN AGA+K QAVALR+ +D +V
Sbjct  319   KTRIVYNSNYVDGV--NTFKTATVAVLGEQFLAKDIGFENDAGAIKHQAVALRVQSDFSV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++ YQDTLYTH++RQFYR CTISGT+DFIFG+A  +FQ+CKM+ RKPL+ Q C+V
Sbjct  377   FYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQNCKMLVRKPLDNQQCIV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI++Q+C I A+ +        + FLGRPWKE+SRT+IM SFID+I+ 
Sbjct  437   TAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQ  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F + TC+Y+E+ NRGPG+S   RVKWKG K  I+P  A  FT G FL  +
Sbjct  497   PEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-TITPAHAVDFTVGTFLRGN  555

Query  1612  EQWLGRAQIPFSPGYV  1565
               WL +  +PFS G V
Sbjct  556   -TWLPKFGVPFSAGMV  570



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   358 bits (919),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 218/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDGS +FKTI AAL ++P  ++   VI +KAGVYKE VIVP K NN+V  G+GP 
Sbjct  250   NVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVKAGVYKETVIVPKKVNNVVIYGDGPE  309

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT +  NKN ADGV   T+ + T+ V ++GF+ +D+  EN+AG  K QAVA+R+S D AV
Sbjct  310   KTRVVNNKNYADGV--QTFHTATLAVNSDGFMAKDIAFENSAGPTKHQAVAVRVSGDKAV  367

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +N  ++ YQDTLY H YRQFYR CTISGT+DF+FG+A  VFQ C+ I RKP   Q CMV
Sbjct  368   FYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVFGDATAVFQKCRFIVRKPDINQNCMV  427

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD R     VIQ+ +IV E    A  P    FLGRPWKE+SRTLIM +FID  + 
Sbjct  428   TAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKIDAFLGRPWKEYSRTLIMNTFIDGFID  487

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GWSPW GN+ L+T +Y EY+N+GPGA T KRV WKG ++ I+PE+A  FT     + D
Sbjct  488   PAGWSPWMGNYGLNTLYYGEYQNKGPGADTSKRVTWKGIQK-ITPEIALSFTAQKVYLND  546

Query  1612  EQWLGRAQIPFSPG  1571
               W+  + +P++PG
Sbjct  547   -GWVTNSSVPYTPG  559



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   358 bits (920),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 224/315 (71%), Gaps = 4/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +I VA+DGS K+KTI+ AL  +P  ++   VI IKAGVY E V +     +++ +G+GP 
Sbjct  265   NITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKAGVYHEQVQINRSMTHLMIIGDGPT  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DG    T+K+ TV V  +GF+ +D+  EN+AG  K QAVALR+ +DM++
Sbjct  325   KTKITGNKNFVDGT--PTFKTATVAVIGDGFMAKDIGFENSAGPEKHQAVALRVQSDMSI  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTISGT+DFIFGN+ VV Q C+++ RKPLE Q  +V
Sbjct  383   FYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVVLQKCRIVVRKPLENQQNIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKDRR   AI++QSC IVA+P L       + +LGRPWKE+SRT+IM + ID+++ 
Sbjct  443   TAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLIN  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI-SPEVAKQFTPGPFLMA  1616
             P+GW PW G+FAL TC+YAEY NRGPGA   +RVKW+G K +I +PE A+QFT G F+  
Sbjct  503   PDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRG  562

Query  1615  DEQWLGRAQIPFSPG  1571
             D  W+    +P+  G
Sbjct  563   DS-WIKPTGVPYDSG  576



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   357 bits (915),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 221/314 (70%), Gaps = 4/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FKTI  A+++IP  N +  VI IKAG+YKE+V +P K N +V +GEGP KT
Sbjct  256   VVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKT  315

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+K+ A GV   T+ + TV V  E F+ +D+  ENTAGA   QAVALR+S D A+  
Sbjct  316   RITGSKSYAGGV--KTFHTATVAVNGEDFMAKDIGFENTAGAEGHQAVALRVSGDRAIFL  373

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N  ++ YQDTLY H+YRQ+YR  TISGT+DFIFG++   FQ+CK I RKP++ QACMVTA
Sbjct  374   NVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMDNQACMVTA  433

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R   AIVIQ+ DI AEPA  A  PP   +LGRPWKE SRT+IM + I   + PE
Sbjct  434   QGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPE  493

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNFALDTC+Y EY+NRG G+   KRV WKG K+ I+PE+A  +T G     D+ 
Sbjct  494   GWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDD-  551

Query  1606  WLGRAQIPFSPGYV  1565
             W+  A +P++P ++
Sbjct  552   WIKTAGVPYNPSFM  565



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   355 bits (912),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 227/314 (72%), Gaps = 4/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS ++K+INAA+++ P+ N R  VI +KAG+Y+EYV VP  K NIV +G+G  +T
Sbjct  228   VVALDGSGQYKSINAAINAAPSKNARPFVIHVKAGLYREYVEVPKHKTNIVILGDGATRT  287

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG KN+A GV   T+ + T  V A+ F  +D+ IENTAG    QAVALR++ D AV++
Sbjct  288   RITGRKNLAGGV--KTFATATFAVNADDFTAKDIGIENTAGPEGHQAVALRVTGDRAVLY  345

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N +++ +QDTLY H++RQFYR C ISGT+DF+FGNA  +FQ+C+ I RKP+  QACMVTA
Sbjct  346   NLNIDGFQDTLYAHAHRQFYRNCRISGTIDFVFGNALSIFQNCQFIVRKPMANQACMVTA  405

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR  R    AIVIQ+ +I AE A   A P  + +LGRPWK+FS T+IM S+I   + P+
Sbjct  406   QGRDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQ  465

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+PW G+FALDTC+YAEY+NRGPG++T +RVKWKG K +I P+ A ++ PG     D+Q
Sbjct  466   GWAPWAGSFALDTCYYAEYRNRGPGSNTSQRVKWKGIK-HIDPQTAARYAPGK-AYGDDQ  523

Query  1606  WLGRAQIPFSPGYV  1565
             W+ RA +P+  G +
Sbjct  524   WIRRAGVPYVSGMM  537



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   357 bits (916),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 221/314 (70%), Gaps = 4/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FKTI  A+++IP  N +  VI IKAG+YKE+V +P K N +V +GEGP KT
Sbjct  273   VVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKT  332

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+K+ A GV   T+ + TV V  E F+ +D+  ENTAGA   QAVALR+S D A+  
Sbjct  333   RITGSKSYAGGV--KTFHTATVAVNGEDFMAKDIGFENTAGAEGHQAVALRVSGDRAIFL  390

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N  ++ YQDTLY H+YRQ+YR  TISGT+DFIFG++   FQ+CK I RKP+E QACMVTA
Sbjct  391   NVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMENQACMVTA  450

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R   AIVIQ+ DI AEPA  A  PP   +LGRPWKE SRT+IM + I   + PE
Sbjct  451   QGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPE  510

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNFALDTC+Y EY+NRG G+   KRV WKG K+ I+PE+A  +T G     D+ 
Sbjct  511   GWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDD-  568

Query  1606  WLGRAQIPFSPGYV  1565
             W+  + +P++P ++
Sbjct  569   WIKSSGVPYNPSFM  582



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   355 bits (911),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 225/316 (71%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA+DGS K++T+N AL  IP   ++  VI IK GVYKE V+      +++ +G+GP 
Sbjct  264   DVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKEQVMFAKSMTHVMIIGDGPT  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DGV   T+K+ TV+V    F+ +D+  EN+AG  K QAVALR+ +DM++
Sbjct  324   KTRITGSLNFIDGV--QTFKTATVSVIGSNFIAKDIGFENSAGPQKHQAVALRVQSDMSI  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++ YQDTLY H++RQFYR C I+GT+DFIFG++  VFQ+CKM+ RKPL+ Q C+V
Sbjct  382   FYNCHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNCKMVIRKPLDNQNCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR +RR A A+V+Q+C I  +PA       NK +LGRPWKEFSRT+IM S ID+++ 
Sbjct  442   TAQGRTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEFSRTIIMNSRIDDVIA  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+FAL+TC+Y E  NRGPG+  D RVKW+G K+ +  + A ++TPG F+  D
Sbjct  502   PEGWLPWAGDFALNTCFYTEILNRGPGSKLDGRVKWRGIKK-VPAQRAVEYTPGRFIRGD  560

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+  A +P+  G +
Sbjct  561   -WWIKAAGVPYVSGML  575



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   354 bits (908),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 224/316 (71%), Gaps = 3/316 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+  G  ++KTI  AL ++P  +    VILIKAG YKE++ +     N+V +GEGP KT
Sbjct  236   VVSASGGGQYKTIQEALQAVPKSSPTPFVILIKAGTYKEHIQIEKNMLNVVLIGEGPTKT  295

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG++ V    +  T+ + T+ V  +GFV +D+ IENTAG  KEQAVALRI+AD AV++
Sbjct  296   IITGDQAVVPNRIS-TWHTATLGVCGDGFVMKDMGIENTAGPTKEQAVALRINADKAVLY  354

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLY HS RQFYR CTI+GT+DF+FG+A  VFQ+CK+I RKP   QACM+TA
Sbjct  355   NCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPGPNQACMITA  414

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR  +      VIQ+CDI A+ AL +ANPP KV+LGRPWKEFS+T+IM S ID  V P 
Sbjct  415   QGRMRKDSLGGFVIQNCDIKADKALTSANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPS  474

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMAD  1613
             GWSPW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS +V   FT G F+   
Sbjct  475   GWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSFTAGKFINTQ  534

Query  1612  EQWLGRAQIPFSPGYV  1565
             + WL    IP+  G +
Sbjct  535   QPWLPMFDIPYEAGMM  550



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   353 bits (907),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 224/316 (71%), Gaps = 3/316 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+  G  ++KTI  AL ++P  +    VILIKAG YKE++ +     N+V +GEGP KT
Sbjct  236   VVSTSGGGQYKTIQEALQAVPRSSPTPFVILIKAGTYKEHIEIEKNMLNVVLIGEGPTKT  295

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG++ V    +  T+ + T+ V  +GFV +D+ IENTAG  KEQAVALRI+AD AV++
Sbjct  296   IITGDQAVVPNRIS-TWHTATLGVCGDGFVMKDMGIENTAGPTKEQAVALRINADKAVLY  354

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC+++ YQDTLY HS RQFYR CTI+GT+DF+FG+A  VFQ+CK+I RKP   QACM+TA
Sbjct  355   NCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPGPNQACMITA  414

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR  +      VIQ+CDI A+ AL +ANPP KV+LGRPWKEFS+T+IM S ID  V P 
Sbjct  415   QGRMRKDSLGGFVIQNCDIKADQALTSANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPS  474

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMAD  1613
             GWSPW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS +V   FT G F+   
Sbjct  475   GWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSFTAGKFINTQ  534

Query  1612  EQWLGRAQIPFSPGYV  1565
             + WL    IP+  G +
Sbjct  535   QPWLPMFDIPYEAGMM  550



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   353 bits (907),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 216/316 (68%), Gaps = 7/316 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT---VILIKAGVYKEYVIVPSKKNNIVFMGE  2342
             ++ VA+DGS  FKTI  ALDSIP      T   V+ IKAGVY+EYV      + ++ +G+
Sbjct  265   NLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFVLYIKAGVYQEYVEFTKSMDYLMVIGD  324

Query  2341  GPAKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISAD  2162
             GP KT ITGNKN  DGV   TY + TV V  + F+ +++  EN+AGA+K QAVALR+SAD
Sbjct  325   GPEKTRITGNKNFVDGV--NTYHTATVVVLGDNFIAKNIGFENSAGAIKHQAVALRVSAD  382

Query  2161  MAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQA  1982
              AV +NC ++ YQDTLYTH+ RQFYR C+ISGT+DF+FG+APVVFQ+CK + RKPLE Q 
Sbjct  383   FAVFYNCAMDGYQDTLYTHAKRQFYRECSISGTIDFVFGDAPVVFQNCKFLVRKPLENQQ  442

Query  1981  CMVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDN  1802
             C+VTAQGRK RR  + I+IQ+    A P L       K +LGRPWK+FSRT+IM S+ID+
Sbjct  443   CIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQYKSYLGRPWKQFSRTIIMESYIDD  502

Query  1801  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             I+ PEGW PW G F L TCWY E+ N GPG+    RVKW G K  I  + A  FTPG FL
Sbjct  503   IIEPEGWLPWFGTFGLKTCWYTEFNNYGPGSDKKARVKWNGIK-TIDRQHALDFTPGRFL  561

Query  1621  MADEQWLGRAQIPFSP  1574
               D  W+    IP+SP
Sbjct  562   RGD-TWIKPTGIPYSP  576



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   352 bits (903),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 225/316 (71%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D VVA+DGS K+KT+ AAL+ +P  +++  VI +KAGVY+E V+V      ++ +G+GP 
Sbjct  257   DAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVMVEKSMTWVMMIGDGPT  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT IT  KN  DG    T+K+ TV+V    F+ +D+  EN+AGA K QAVALR+ +DM+V
Sbjct  317   KTKITAGKNYIDGT--PTFKTATVSVIGSNFIAKDIGFENSAGAAKHQAVALRVQSDMSV  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGN  VVFQ+CK++ RKP++ Q C+V
Sbjct  375   FYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDNQQCIV  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR  R+   AI++Q+C I + P        NK FLGRPWK++SRT+IM S ID+++ 
Sbjct  435   TAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNFAL+T +YAE  NRGPGA+TDKRVKWKG K+ I+ E A  FT   F+  D
Sbjct  495   PEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITMEHALDFTAARFIRGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++ G +
Sbjct  554   P-WIKPTGVPYTSGMM  568



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   352 bits (903),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 225/316 (71%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D VVA+DGS K+KT+ AAL+ +P  +++  VI +KAGVY+E V+V      ++ +G+GP 
Sbjct  260   DAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVMVEKSMTWVMMIGDGPT  319

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT IT  KN  DG    T+K+ TV+V    F+ +D+  EN+AGA K QAVALR+ +DM+V
Sbjct  320   KTKITAGKNYIDGT--PTFKTATVSVIGSNFIAKDIGFENSAGAAKHQAVALRVQSDMSV  377

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGN  VVFQ+CK++ RKP++ Q C+V
Sbjct  378   FYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDNQQCIV  437

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR  R+   AI++Q+C I + P        NK FLGRPWK++SRT+IM S ID+++ 
Sbjct  438   TAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLIQ  497

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNFAL+T +YAE  NRGPGA+TDKRVKWKG K+ I+ E A  FT   F+  D
Sbjct  498   PEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITMEHALDFTAARFIRGD  556

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++ G +
Sbjct  557   P-WIKPTGVPYTSGMM  571



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   351 bits (901),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 222/317 (70%), Gaps = 5/317 (2%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+  G  ++KTI  A++++P  N    VILIKAG YKE++ +   K N+VF+GEGP KT
Sbjct  236   VVSASGGGQYKTIQEAVNAVPKNNPTPFVILIKAGTYKEHIEIDKNKPNVVFIGEGPTKT  295

Query  2326  VITGNKNVA-DGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVV  2150
             +ITG++ V  DG    T+ +  + V  EGFV +D+ IENTAG  KEQAVALRI+AD AVV
Sbjct  296   IITGDRGVKHDGY--ATWHTCALGVAGEGFVIKDIGIENTAGPAKEQAVALRINADKAVV  353

Query  2149  HNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVT  1970
             HNC ++ YQDTLY HS+RQFYR CTI+GTVDFIFG+A  VFQ+CK+I RKP   QACM+T
Sbjct  354   HNCKIDGYQDTLYAHSFRQFYRDCTITGTVDFIFGDASAVFQNCKLIVRKPGNAQACMIT  413

Query  1969  AQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVP  1790
             AQGR         VIQ+CDI A+PA  +  PP K +LGRPWKE+S+T+IM S ID  + P
Sbjct  414   AQGRTVPTSFGGFVIQNCDIKADPAFTSTTPPIKAYLGRPWKEYSKTIIMQSNIDAFIDP  473

Query  1789  EGWSPWKG-NFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMA  1616
              GW+PW   +F L TC+YAEY+NRGPGA+  KRV  W+GY++ IS +   ++T G F+  
Sbjct  474   TGWAPWNSTDFGLHTCFYAEYQNRGPGAALGKRVSTWRGYQKGISGDAINKYTAGKFINT  533

Query  1615  DEQWLGRAQIPFSPGYV  1565
              + WL +  IP+  G +
Sbjct  534   QQPWLPKFDIPYDAGMM  550



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   352 bits (902),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 226/316 (72%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA+DGS K+KT+  AL+ +P  +++  VI +KAGVY+E V+V      ++ +G+GP 
Sbjct  257   DVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGVYQEQVMVDKSMTWVMMIGDGPT  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT IT  KN  DG    T+K+ TV+V    F+ +D+  EN+AGA K QAVALR+ +DM++
Sbjct  317   KTKITAGKNYVDGT--PTFKTATVSVIGSNFIAKDIGFENSAGAAKHQAVALRVQSDMSI  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGNA  VFQ+CK++ RKP++ Q C+V
Sbjct  375   FYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQNCKILVRKPMDNQQCIV  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR  R+   AI++Q+C I ++P        NK +LGRPWK++SRT+IM   ID+++ 
Sbjct  435   TAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWKQYSRTIIMQCQIDDLIQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+FAL T +YAE  NRGPGA+TDKRVKWKG K+ I+P+ A  FT G F+  D
Sbjct  495   PEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIKK-ITPQHALDFTVGRFIRGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P+S G +
Sbjct  554   P-WIKPTGVPYSSGMM  568



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   350 bits (898),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 219/315 (70%), Gaps = 5/315 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             ++VVA+DGS +FKTI  A+D +P   +  T VI IKAGVY+EYV+V     +++ +G+GP
Sbjct  261   NVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQEYVLVKKTLTHLMLIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT+ITGNKN  DG    T+K+ TV V AE F+ RD+  ENTAG  K QAVALR+ AD A
Sbjct  321   KKTIITGNKNFIDGT--PTFKTATVAVTAEHFMARDIGFENTAGPQKHQAVALRVQADKA  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             V +NC ++ YQDTLY H+ RQFYR CT+SGT+DFIFG+A  +FQSC  + RKPL  Q C+
Sbjct  379   VFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCTFLVRKPLPNQQCI  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GRK+RR  +A++IQ+C       L       + FLGRPWKE+SRT+IM S+I +++
Sbjct  439   VTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLI  498

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW PW G++ L TC+Y EY N GPG+   KRVKW+G K NI+P+ A  FTPG FL  
Sbjct  499   QPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGIK-NITPQHAVDFTPGRFLKG  557

Query  1615  DEQWLGRAQIPFSPG  1571
             D +W+    +P+  G
Sbjct  558   D-RWIKPTGVPYVSG  571



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   348 bits (894),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 219/311 (70%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +F TI+AA+ S+P  N++  VI +KAG+YKEYV +P K N IV +G+GP KT
Sbjct  237   VVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQIPKKMNKIVLIGDGPLKT  296

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   T+ + TV V A+ F+ +D+  ENTAG    QAVALR+S D AV  
Sbjct  297   RISGRKNYAEGV--KTFHTATVAVSADEFMAKDIGFENTAGPQGHQAVALRVSGDRAVFF  354

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  355   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMVTA  414

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R   A VIQ+ DIVAEPAL  A PP KV+LGRPWK  SRT+IM S I   V PE
Sbjct  415   QGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPE  474

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+ W GNFALDT +YAEY+NRGPG+    RVKW G + + + ++A+ +T G     DE 
Sbjct  475   GWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPGIQ-HFTQQMAESWTGGRIYGGDE-  532

Query  1606  WLGRAQIPFSP  1574
             W+  +  P+ P
Sbjct  533   WIRISGTPYVP  543



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   349 bits (895),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/316 (52%), Positives = 218/316 (69%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VAQDGS K+KTI  AL ++P   +   VI IK GVYKE V+V     N++  G+GP 
Sbjct  265   DVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKEGVYKENVMVDRSMTNVMMFGDGPT  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG    T+K+ T+ V  +GF+ ++L +ENTAGA K QAVALR+ +D +V
Sbjct  325   KTKITGSLNYVDGT--STFKTATLAVVGDGFIGKNLGVENTAGAAKHQAVALRVQSDKSV  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH+ RQFYR CTISGT+DF+FG+A VVFQ+C M+ RKP+  Q C+V
Sbjct  383   FYLCQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMANQQCIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDR  A  IV+ +C I A+P L +A+     +LGRPWKE+SRT+IM S ID ++ 
Sbjct  443   TAQGRKDRHEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLIN  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              +GW PW G F L TC+Y E  NRGPGA+T KRV WKGYK+ +    A ++T   F+   
Sbjct  503   EDGWQPWLGEFGLKTCFYTEIGNRGPGAATTKRVTWKGYKK-VDLTHAHKYTVQQFIQG-  560

Query  1612  EQWLGRAQIPFSPGYV  1565
             + WL +  +PF+PG +
Sbjct  561   KTWLPKTGVPFTPGLM  576



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   348 bits (892),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 218/311 (70%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +F TI+AA+ S+P  N++  VI +KAG+YKEYV +P K N IV +G+GP KT
Sbjct  237   VVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQIPKKMNKIVLIGDGPLKT  296

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              I+G KN A+GV   T+ + TV V A+ F+ +D+  ENTAG    QAVALR+S D AV  
Sbjct  297   RISGRKNYAEGV--KTFHTATVAVSADEFMAKDIGFENTAGPQGHQAVALRVSGDRAVFF  354

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ+CK + RKP   QACMVTA
Sbjct  355   NVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVRKPGPNQACMVTA  414

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R   A VIQ+ DIVAEPAL  A PP KV+LGRPWK  SRT+IM S I   V PE
Sbjct  415   QGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPE  474

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW+ W GNFALDT +YAEY+NRGPG+    RVKW G + + + ++A+ +T G     DE 
Sbjct  475   GWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPGIQ-HFTQQMAESWTGGRIYGGDE-  532

Query  1606  WLGRAQIPFSP  1574
             W+     P+ P
Sbjct  533   WIRITGTPYVP  543



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   349 bits (895),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 221/315 (70%), Gaps = 5/315 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             ++VVA+DGS +F+TI AALD +P   +  T VI IKAGVY+EY+ +     +++ +G+GP
Sbjct  261   NVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQEYLQIKKTVTHLMLIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT+ITGNKN  DG    T+K+ TV V AE F+ RD+  ENTAG  K QAVALR+ AD A
Sbjct  321   KKTIITGNKNFVDGT--PTFKTATVAVTAEHFMARDIGFENTAGPQKHQAVALRVQADKA  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             V +NC ++ YQDTLY H+ RQFYR CT+SGT+DFIFG+A  +FQ C  + RKPL  Q C+
Sbjct  379   VFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCTFLVRKPLPNQQCI  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GRK+RR  +A++IQ+C I A+  L       + FLGRPWKE+SRT+IM S+I +++
Sbjct  439   VTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLI  498

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW PW G++ L TC+Y EY N GPG++  KRVKW+G K  I+P+ A  FT G F+M 
Sbjct  499   QPEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVKWRGIK-TITPQHALDFTAGRFVMG  557

Query  1615  DEQWLGRAQIPFSPG  1571
             D +W+    +P+  G
Sbjct  558   D-RWIKPTGVPYVSG  571



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   348 bits (894),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 215/313 (69%), Gaps = 4/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS  F TI  AL  +P  + +  V+ IKAGVY+EY+ +     N+V +G+G  
Sbjct  264   DIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVIGDGKE  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I GNKN  DG+   T+ + TV V  + FV +++  EN AGA+K QAVALR+SAD A+
Sbjct  324   NTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVSADYAI  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ +QDTLYTH+ RQFYR C+ISGT+DF+FG+A  VFQ+CK + RKPLE Q C+V
Sbjct  382   FYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLENQQCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK RR  +A++IQS  I A P L       K +LGRPWKE+SRT+IM SFID+++ 
Sbjct  442   TAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQ  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G F L TCWY E+ N GPG+S + RVKW G K  I+ + A  FTPG FL  D
Sbjct  502   PEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGRFLKGD  560

Query  1612  EQWLGRAQIPFSP  1574
               W+    IP++P
Sbjct  561   S-WIKATGIPYTP  572



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   347 bits (891),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 215/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL  +P  N +  VI IK GVY E V VP K  ++ F+G+GP 
Sbjct  258   DVVVAQDGSGQYKTINEALSVVPKANQKPFVIYIKQGVYNEKVDVPKKMTHVTFIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV +  + F  +++  ENTAG    QAVALR+SAD AV
Sbjct  318   KTKITGSLNYYIGKVK-TYHTATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  VV Q C ++ RKP++GQ+CM+
Sbjct  377   FHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMI  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  +V+ +C I  EP        NK +LGRPWK+FSRT+IM + ID++V 
Sbjct  437   TAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVD  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N GPG+   +RVKW G K+ +SP+ A +FTP  FL  +
Sbjct  497   PAGWLPWNGSFALNTLYYAEYENNGPGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN  555

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  556   -LWIPPTRVPY  565



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   347 bits (889),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 216/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS  F TI  AL  +P  + +  V+ IKAGVY+EY+ +     N+V +G+G  
Sbjct  264   DIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVIGDGRE  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I GNKN  DG+   T+ + TV V  + FV +++  EN AGA+K QAVALR+SAD AV
Sbjct  324   NTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVSADYAV  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ +QDTLYTH+ RQFYR C+ISGT+DF+FG+A  VFQ+CK + RKPLE Q C+V
Sbjct  382   FYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLENQQCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK RR  +A++IQ+  I A P L       K +LGRPWKE+SRT+IM SFID+++ 
Sbjct  442   TAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLIQ  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G F L TCWY E+ N GPG+S + RVKW G K  I+ + A  FTPG FL  D
Sbjct  502   PEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGRFLKGD  560

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    IP++P  V
Sbjct  561   S-WIKATGIPYTPFLV  575



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   347 bits (889),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 220/311 (71%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS ++KTIN AL+ +P  N +  VI IK GVY E V V  K  ++ F+G+GP 
Sbjct  260   NVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPT  319

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV +  + F  +++  ENTAG    QAVALR+S D AV
Sbjct  320   KTKITGSLNFYIGKVK-TYHTATVAINGDHFTAKNIGFENTAGPEGHQAVALRVSGDYAV  378

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY HS+RQF+R CTISGTVDFIFG+A VV Q+C ++ RKP++GQ+CM+
Sbjct  379   FYNCQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFGDAKVVLQNCNIVVRKPMKGQSCMI  438

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R ++ +V+Q+C I  EPA       NK +LGRPWKEFSRT+IM + IDNI+ 
Sbjct  439   TAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNIID  498

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N GPG+   +RVKW G K+ ISP+ A++FTP  FL  +
Sbjct  499   PAGWLPWNGDFALNTLYYAEYENNGPGSDQAQRVKWPGIKK-ISPKQARRFTPARFLRGN  557

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  558   -LWIPPNRVPY  567



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   345 bits (886),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 220/311 (71%), Gaps = 4/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  A+++IP  N++  +I IKAG+YKE+V +P K N +VF+G+GP KT
Sbjct  232   VVAQDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGLYKEHVEIPKKVNKVVFIGDGPFKT  291

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+K+ A GV   T+++ TV V  E F  +++  ENTAGA   QAVALR+SAD A+  
Sbjct  292   RITGSKSFAGGV--KTFQTATVAVNGEEFTAKNIAFENTAGAEGHQAVALRVSADKAIFQ  349

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             N  ++ YQDTLY H+YRQ+YR CTISGT+DFIFG++  +FQ+C  I RKP++ QACMVTA
Sbjct  350   NVAIDGYQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDNQACMVTA  409

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R   AIVIQ+  I AEPA  +  P    +LGRPWKE SRT+IM S ID  + P+
Sbjct  410   QGRVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGFISPK  469

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWSPW GNFALDT +Y EY+NRG G+    RV WKG  ++++ + A+++T G     DE 
Sbjct  470   GWSPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGI-QHMTQQKAEEWTGGAAFRGDE-  527

Query  1606  WLGRAQIPFSP  1574
             W+  + +P+ P
Sbjct  528   WITSSGVPYVP  538



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   347 bits (889),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 220/316 (70%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS K+KTINAAL  +P  +++  VI +KAG+YKE V++P    ++   G+GP 
Sbjct  265   DLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVKAGIYKEIVVIPKHMTHLTMYGDGPT  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTV+TG+ N  DG+   T+K+ T +     F  RD+  ENTAGA K QAVALR+ +D ++
Sbjct  325   KTVVTGSLNFIDGI--QTFKTATFSAIGANFYARDMGFENTAGAAKHQAVALRVQSDRSI  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC ++ YQDTLY H++RQFYR CTISGT+DF+FGNA   FQ+CK++ RKPL+ Q C+V
Sbjct  383   FFNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPLDNQQCIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR +R+   A++ QSC  + +PA       NK +LGRPWKE+SRT+I+ S ID+I+ 
Sbjct  443   TAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSRTIIIGSTIDDIIQ  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F L+T +YAE +N+G GA   KRVKW+G K +I+P+ A  FTP  F+  D
Sbjct  503   PEGWLPWMGDFGLNTLFYAEVQNKGAGADESKRVKWRGIK-HITPQHAADFTPRRFIDGD  561

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    IP+S G +
Sbjct  562   A-WIPAKGIPYSSGMM  576



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   346 bits (887),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 219/316 (69%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D +VAQDGS ++KTI  A++ IP  N+   V+ IK GVYKE V +     +++ +G+GP 
Sbjct  258   DAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKEQVSLARSHTHVLMIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN N A+GV   T+K+ TV++  + F+ +D+  EN+AGA+  QAVALR+ ADM+V
Sbjct  318   KTKITGNLNYANGV--QTFKTATVSISGDHFMAKDIGFENSAGAIGHQAVALRVQADMSV  375

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTI+GT+DFIFG+A  VFQ+CK++ RKPLE Q C+V
Sbjct  376   FYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLENQQCIV  435

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R     VIQ+C I A+P        NK +LGRPW+E SRT++M S ID+++ 
Sbjct  436   TAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIA  495

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNF L+T +Y+EY N+G GA    RVKW G K+ ++PE A  +T   F+  D
Sbjct  496   PEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIKK-LTPEAADGYTAAKFIQGD  554

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+ +  +P++ G +
Sbjct  555   E-WIPQTGVPYTAGMI  569



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   345 bits (884),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 221/316 (70%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D++VAQDGS K+KTINAAL  +P  +++  VI +KAG+YKE V++P    ++   G+GP 
Sbjct  264   DLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKEIVVIPKHMTHLTMYGDGPT  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTV+TG+ N  DG+   T+K+ T +     F  RD+  ENTAG+ K QAVALR+ +D ++
Sbjct  324   KTVVTGSLNFIDGI--QTFKTATFSAIGANFYARDMGFENTAGSAKHQAVALRVQSDRSI  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTISGT+DF+FGNA   FQ+CK++ RKP++ Q C+V
Sbjct  382   FYNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPMDNQQCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR +R+   A++ Q C  + +PA       NK +LGRPWK++SRT+I+ S ID+I+ 
Sbjct  442   TAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQ  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F L+T +YAE +N+GPGA   KRVKW+G K +I+P+ A  FTP  F+  D
Sbjct  502   PEGWLPWMGDFGLNTLFYAEVQNKGPGAVETKRVKWRGIK-HITPQHAADFTPRRFIDGD  560

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    IP+S G +
Sbjct  561   A-WIPAKGIPYSSGMM  575



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   347 bits (890),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 217/316 (69%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN ALD+IP   +   V+ IKAG+YKEY+ V     N+VF+G+GP 
Sbjct  254   DIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKEYIQVNRSMTNLVFIGDGPD  313

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+K   DG+   T+++ TV +  + F+ +++  ENTAGA+K QAVA+R+ +DMAV
Sbjct  314   KTIISGDKGFKDGIT--TFRTQTVAIIGDNFIAKNIGFENTAGAIKHQAVAVRVQSDMAV  371

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ+C ++ RKPL  QAC +
Sbjct  372   FHNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTLLVRKPLPNQACPI  431

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR+D R     V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  432   TAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQ  491

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW  +F L T +Y+E +N GPG+    RV W G K+  S ++  QFTP  F+  D
Sbjct  492   PQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIKKLTSKDI-DQFTPAKFIQGD  550

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  551   S-WIPATGVPYTPGLL  565



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   343 bits (879),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 217/311 (70%), Gaps = 2/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+ DGS ++KTI  A++++P  N +  VILIK G+YKE + +   K N+V +GEGP KT
Sbjct  236   VVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEGIYKENIEIEKDKLNVVLIGEGPTKT  295

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG+  V +G    T+ + T+ V   GFV +D+ I+NTAG  KEQAVALR++AD A V+
Sbjct  296   IITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIGIQNTAGPEKEQAVALRVNADKAAVY  355

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS RQFYR C I+GT+DF+FG A  VFQ+CK+I RKP + Q CM+TA
Sbjct  356   NCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVFQNCKLIVRKPGDTQNCMMTA  415

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QG  D +     VIQ+CDI AEP   A NP  K +LGRPWK +SRT+IM S ID  +  E
Sbjct  416   QGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPWKMYSRTIIMQSNIDAFINSE  475

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRV-KWKGYKRNISPEVAKQFTPGPFLMAD  1613
             GW+PW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS +   +FT   F+  +
Sbjct  476   GWAPWNTTDFGIHTCFYAEYQNRGPGATLDKRVSHWRGYQKDISGDTINKFTADKFINTN  535

Query  1612  EQWLGRAQIPF  1580
              QWL  A IP+
Sbjct  536   PQWLPVADIPY  546



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   345 bits (884),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 216/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL+ +P   +   V+ IK G+YKEYV V     ++VF+G+GP 
Sbjct  191   DIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGPD  250

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVI+G+KN  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  251   KTVISGDKNYKDGIT--TYRTATVAIVGDHFIAKNMGFENTAGAIKHQAVAIRVLSDESI  308

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  309   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  368

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C I  EP        +K +LGRPWKE+SRT+ M +FI + + 
Sbjct  369   TAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIP  428

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNFALDT +Y+E +N GPGA   KRV W G K+ +S E   +FTP  ++  D
Sbjct  429   PEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIKK-LSEEEILKFTPAEYIQGD  487

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P+ PG
Sbjct  488   -AWIPGKGVPYIPG  500



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   343 bits (879),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 218/313 (70%), Gaps = 3/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS ++K+I+ AL ++P  N    VI IK G+YKE V V  K  ++ F+G+GP 
Sbjct  255   NVVVAQDGSGQYKSIDEALKAVPQNNRWPFVIYIKQGIYKENVDVTKKMTHVTFIGDGPT  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             +T ITGN N   G V  TY++ TV +  + F  +++  ENTAG    QAVALR+SAD AV
Sbjct  315   RTKITGNLNFRIGKVK-TYQTATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAV  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY H++RQFYR CTISGTVDFIFG+A  +FQ+C ++ RKP+ GQ+C+V
Sbjct  374   FHNCQMDGYQDTLYVHAHRQFYRDCTISGTVDFIFGDAKSLFQNCNIVVRKPMGGQSCIV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  IV+ +C I  EPA       NK +LGRPWK FSRT++M + IDN++ 
Sbjct  434   TAQGRTDVRESTGIVLHNCRITGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVID  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N GPG++  +RV W G K NISP  A +FTP  FL  +
Sbjct  494   PAGWLPWDGDFALNTLYYAEYQNSGPGSNQAQRVNWAGIK-NISPRQALKFTPARFLRGN  552

Query  1612  EQWLGRAQIPFSP  1574
               W+ +  +P++P
Sbjct  553   -LWIPQTHVPYTP  564



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   343 bits (879),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 214/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FK+IN AL ++P  N    VI IK G+YKE V V      + F+G+GP KT
Sbjct  262   VVALDGSGQFKSINDALKTVPKNNKFPFVIYIKQGIYKEKVDVTKTMTYVTFIGDGPTKT  321

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TGN N   G V  TY++ TV V  E F  +D+  ENTAG    QAVALR+SAD AV +
Sbjct  322   IVTGNLNFGIGNVK-TYQTATVAVNGENFTAKDIGFENTAGPEGHQAVALRVSADYAVFY  380

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS+RQFYR CTISGT+D+IFG+A   FQ+CKM+ RKP+ GQ+CMVTA
Sbjct  381   NCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCKMVVRKPMGGQSCMVTA  440

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D+R +  I++ +C I+ +PA       NK +LGRPWKEFSRT+IM + ID+I+ P+
Sbjct  441   QGRTDKRESTGIILHNCRIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPK  500

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFALDT  Y EY+N G G+  + RVKW G K+ +S   A QFT G FL  +  
Sbjct  501   GWLEWNGNFALDTLEYGEYENNGSGSGQEMRVKWPGIKK-LSARQALQFTAGRFLRGN-T  558

Query  1606  WLGRAQIPFSP  1574
             W+ R ++P++P
Sbjct  559   WIPRRRVPYTP  569



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   341 bits (875),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 212/309 (69%), Gaps = 3/309 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FK+INAAL ++P  N    VI IK G+YKE V V    + + F+G+GP KT
Sbjct  261   VVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKT  320

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGN N   G V  TY++ TV V  E F  +D+  ENTAG    QAVALR+SAD AV H
Sbjct  321   RITGNLNFGMGKVK-TYQTATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFH  379

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY HS+RQFYR CTISGT+D+IFG+A   FQ+C M+ RKP+ GQ+CMVTA
Sbjct  380   NCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTA  439

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D+R    IV+ +C I  +PA       NK +LGRPWK+FSRT+IM + I++I+ P+
Sbjct  440   QGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPK  499

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFALDT  YAE++N+GPG++   RVKW G K+  +P  A +FT G FL     
Sbjct  500   GWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGG-T  557

Query  1606  WLGRAQIPF  1580
             W+ + Q+P+
Sbjct  558   WIPQTQVPY  566



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   341 bits (875),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 210/313 (67%), Gaps = 4/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS  F TI  AL  +P  + +  V+ IKAG+Y+EY+       N++ +G+G  
Sbjct  265   DIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRE  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I GNKN  DG+   TY + TV V  + FV +++  EN AGA+K QAVALR+SAD A+
Sbjct  325   TTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNIGFENNAGAIKHQAVALRVSADYAL  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ +QDT+YTH+ RQFYR C+ISGT+DF+FG+A  VFQ+CK + RKPLE Q C+V
Sbjct  383   FYNCSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLIRKPLENQQCIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK RR  +AI+IQ+  I A P L       K +LGRPWKEFSRT+IM SFID+++ 
Sbjct  443   TAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQ  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G F L TCWY E+ N GPG+S   RVKW G K  I  + A  FTPG F    
Sbjct  503   PEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TIDRQHALDFTPGRFFKGG  561

Query  1612  EQWLGRAQIPFSP  1574
               W+    IP++P
Sbjct  562   A-WIKTTGIPYTP  573



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   340 bits (873),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 218/316 (69%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D +VAQDGS ++KTI  A++ IP   +   VI IK GVYKE V +     +++ +G+GP 
Sbjct  258   DAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKEQVSLARSHTHVLMIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN N A+GV   T+K+ TV++  + F+ +D+  EN+AGA+  QAVALR+ ADM+V
Sbjct  318   KTKITGNLNYANGV--QTFKTATVSISGDHFMAKDIGFENSAGAIGHQAVALRVQADMSV  375

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTI+GT+DFIFG+A  VFQ+CK++ RKPL+ Q C+V
Sbjct  376   FYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLDNQQCIV  435

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R     VIQ+C I A+P        NK +LGRPW+E SRT++M S ID+++ 
Sbjct  436   TAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIA  495

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F L+T +Y+EY N+G GA    RVKW G K+ ++PE A  +T   F+  D
Sbjct  496   PEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIKK-LTPEAADGYTAAKFIQGD  554

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+ +  +P++ G +
Sbjct  555   E-WIPQTGVPYTAGMI  569



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   341 bits (875),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 218/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA+DGS  FKTIN A+  +P  +++  ++ IK G+Y+E V +     N++ +G+GP 
Sbjct  264   NLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPT  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG    T+K+ TV V  +GF+ + +  EN+AGA K QAVALR+ +D ++
Sbjct  324   KTKITGSLNFVDGT--PTFKTATVAVLGDGFIAKGIGFENSAGAAKHQAVALRVQSDRSI  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH+ RQFYR CTISGT+DFIFG+A V+FQ+C  + RKPL+ Q C+V
Sbjct  382   FYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI+IQ+    A+P         K +LGRPWKEFSRT+IM S+I++++ 
Sbjct  442   TAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQ  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL TC+Y E++NRGPGA T  RVKW+G K  I P  A  F PG FL  D
Sbjct  502   PSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHAIDFAPGRFLSGD  560

Query  1612  EQWLGRAQIPFSPG  1571
              +W+    +P++ G
Sbjct  561   -RWIPSTGVPYNSG  573



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   340 bits (873),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 220/311 (71%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS ++KTIN AL+++P  N +  VI IK GVY E V V  K  ++ F+G+GP 
Sbjct  259   NVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPT  318

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV +  + F  +++  ENTAG    QAVALR+SAD+AV
Sbjct  319   KTKITGSLNYYIGKVK-TYLTATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADLAV  377

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY HS+RQF+R CT+SGTVDFIFG+  VV Q+C ++ RKP++ Q+CM+
Sbjct  378   FYNCQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFGDGIVVLQNCNIVVRKPMKSQSCMI  437

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+R +  +V+Q+C I  EPA       NK +LGRPWKEFSRT+IM + ID+++ 
Sbjct  438   TAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVID  497

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N GPG++  +RVKW G K+ +SP+ A +FTP  FL  +
Sbjct  498   PAGWLPWNGDFALNTLYYAEYENNGPGSNQAQRVKWPGIKK-LSPKQALRFTPARFLRGN  556

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  557   -LWIPPNRVPY  566



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   342 bits (877),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 220/318 (69%), Gaps = 5/318 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVIL-IKAGVYKEYV-IVPSKKNNIVFMGEG  2339
             D+VVA+DG+  F TI  AL+S+P   + +T+I+ IK GVY E V I  +   + +  G+G
Sbjct  277   DLVVAKDGTGNFATILEALESLPKTKENKTIIMYIKEGVYSEIVEISRNLTGSFIMYGDG  336

Query  2338  PAKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADM  2159
             P +T ITG+ N  DG    T+K+ TV+V A GF+C+D+ IEN AGA K QAVAL++ ADM
Sbjct  337   PTRTKITGSLNFIDGT--PTFKTATVSVNAHGFICKDIGIENAAGAEKHQAVALKVVADM  394

Query  2158  AVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQAC  1979
              V  NC ++ YQDTLY HS R F+R CTISGT+D+IFGN   +FQ+CKM+ RKP+  QA 
Sbjct  395   VVFFNCQMDGYQDTLYAHSGRHFFRDCTISGTIDYIFGNGESIFQNCKMVIRKPMVNQAN  454

Query  1978  MVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNI  1799
             +VTAQGRK  R  +AIV+Q C I A+P+L       K +LGRPWKEFSRT+IM + ID+ 
Sbjct  455   IVTAQGRKTEREVSAIVLQGCTISADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDS  514

Query  1798  VVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1619
             + P+GW PW G+F L TC+YAE+ NRGPGA    RVKW G K  ++PE A+++T  P++ 
Sbjct  515   ISPDGWMPWMGDFGLQTCYYAEFNNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQ  574

Query  1618  ADEQWLGRAQIPFSPGYV  1565
             AD+ W+    IP+ PG +
Sbjct  575   ADD-WVKPLGIPYVPGLM  591



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   340 bits (872),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 214/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS ++KTIN AL+ +P  N    VI IK GVY E V V  K  ++ F+G+GP 
Sbjct  259   NVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQGVYNEKVNVTKKMTHVTFIGDGPT  318

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV V  + F  +++  ENTAG    QAVALR+SAD AV
Sbjct  319   KTKITGSLNYHIGKVK-TYHTATVAVNGDNFTAKNIGFENTAGPEGHQAVALRVSADYAV  377

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  VV Q+C ++ RKP++ Q+CM+
Sbjct  378   FHNCQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVVLQNCNIVVRKPMKNQSCMI  437

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  +V+ +C I+ EP        NK +LGRPWKEFSRT+IM + IDN++ 
Sbjct  438   TAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVID  497

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL T +YAE++N GPG+   +RVKW G K+ +SP+ A +FTP  FL  +
Sbjct  498   PAGWLPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN  556

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  557   -LWIPPNRVPY  566



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   342 bits (878),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 218/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL+ +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  251   DIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIKAGIYKEYVQVNRSMTHLVFIGDGPE  310

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVI+G+K+  DG+   TYK+ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  311   KTVISGSKSYKDGIT--TYKTATVAIVGDHFIAKNIGFENTAGAIKHQAVAIRVLSDESI  368

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  369   FYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLNQACPI  428

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C IV EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  429   TAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIMNTFIPDFIP  488

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F L+T +Y+E +N GPGA   KRV W G K+ +S E    FTP  ++  D
Sbjct  489   PEGWQPWLGDFGLNTLFYSEVQNTGPGAPITKRVTWPGIKK-LSEEEILTFTPAQYIQGD  547

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P+ PG
Sbjct  548   -AWIPGKGVPYIPG  560



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   338 bits (866),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 221/315 (70%), Gaps = 4/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL ++P  N+   V+ IK+G YKEYV V     N+VF+G+GP 
Sbjct  66    DMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQVNRTMPNLVFIGDGPT  125

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+  QAVA+R+ +D ++
Sbjct  126   KSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGALNYQAVAVRVLSDESI  183

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  184   FYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPI  243

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C I  E    A    +K +LGRPWKE+S+T+IM +FI + + 
Sbjct  244   TAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIP  303

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              EGWSPW+GNF LDT +Y+E +N GPGA+   RV W+G K+ +S E   ++TP  ++  D
Sbjct  304   GEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEIVEYTPAKYIQGD  362

Query  1612  EQWLGRAQIPFSPGY  1568
             + W+    +P++PG+
Sbjct  363   D-WIPGKGVPYTPGF  376



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   340 bits (872),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 216/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DI+VA+DGS  +KTI  ALD +P   +   +I IK GVY E+++V     +++ +G+G  
Sbjct  273   DIIVAKDGSGSYKTITEALDHVPKYGNETFIIYIKEGVYNEHILVTRSMTSVMMIGDGAN  332

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN ADG    TY + TV ++ + F+ RD+  EN+AG  K QAVALR+SAD A+
Sbjct  333   KTRITGNKNFADGT--PTYHTATVAIQGDHFMARDIGFENSAGPEKHQAVALRVSADEAI  390

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH+ RQFY  CTISGT+DF+FG+A  VFQ+C  + RKPL  Q+C+V
Sbjct  391   FYRCSMDGYQDTLYTHAQRQFYCDCTISGTIDFVFGDATAVFQNCTFLIRKPLPNQSCIV  450

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI+IQ+  I AEP        NK +LGRPWKE+SRT+IM S+ID+++ 
Sbjct  451   TAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQ  510

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW+G + L TC+YAE  N GP A+  +RV W+G K+ I+      FTPG F   D
Sbjct  511   PEGWLPWEGEWGLKTCFYAESGNTGPAANKARRVTWRGIKQ-ITENHTADFTPGRFFRGD  569

Query  1612  EQWLGRAQIPFSPG  1571
              +W+  + +P+ PG
Sbjct  570   -KWIRLSGVPYIPG  582



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   338 bits (868),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 217/316 (69%), Gaps = 5/316 (2%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV+  G  ++KTI  A++++P  N    +ILIKAG YKE++ +   K N+VF+GEG  KT
Sbjct  236   VVSASGGGQYKTIQEAVNAVPKNNPTPFIILIKAGTYKEHIEIEKSKPNVVFIGEGATKT  295

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG++ V +G    T+ +  + V  EGFV RD+ +ENTAG  KEQAVALRI+AD A+V+
Sbjct  296   IITGDRGVKNGGGYATWHTCALGVAGEGFVIRDIGLENTAGPEKEQAVALRINADKAIVY  355

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ +QDTLY HS+RQFYR C I+GT+DF+FG+A  VFQ+C++I RKP   QACMVTA
Sbjct  356   NCKIDGFQDTLYAHSFRQFYRDCIITGTIDFMFGDASAVFQNCQIIVRKPGNTQACMVTA  415

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR         VIQ+CDI  EP   +     K +LGRPWKEFS+T+IM S ID  + P 
Sbjct  416   QGRTVPTSVGGFVIQNCDIKPEPGFPST---TKAYLGRPWKEFSKTIIMQSNIDAFIDPS  472

Query  1786  GWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMAD  1613
             GW+PW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+R IS +   QFT G F+  +
Sbjct  473   GWAPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQRGISGDAINQFTAGKFINTE  532

Query  1612  EQWLGRAQIPFSPGYV  1565
               WL +  IP+  G +
Sbjct  533   SPWLPKGDIPYDAGMM  548



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   343 bits (879),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 219/312 (70%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS KFKTI  AL  +P  N R+ VI IK GVYKE V V  K  N++F+G+GP 
Sbjct  381   NVVVAKDGSGKFKTIAQALAMVPMQNKRKFVIHIKQGVYKEKVEVTKKMLNVMFVGDGPT  440

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+       VG T+++ TV V  + F+ +D+  ENTAGA + QAVALR+SAD AV
Sbjct  441   KTIITGDIAFLPNRVG-TFRTATVAVNGDYFMAKDVGFENTAGAARHQAVALRVSADFAV  499

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH+N YQDTLY H++RQFYR C ISGT+DFIFG+A  VFQ+C  + R+P++ Q C+V
Sbjct  500   FFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQNCVFVIRRPMDNQQCIV  559

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR    IVI +  I+ + +       N+ FLGRPWKE+SRT+IM + ID+++ 
Sbjct  560   TAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVID  619

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R ISP  A++F PG FL  +
Sbjct  620   PEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-ISPRDAREFAPGNFLRGN  678

Query  1612  EQWLGRAQIPFS  1577
               W+ + +IP++
Sbjct  679   -TWIPQTRIPYN  689



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   342 bits (878),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 219/312 (70%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS KFKTI  AL  +P  N R+ VI IK GVYKE V V  K  N++F+G+GP 
Sbjct  381   NVVVAKDGSGKFKTIAQALAMVPMKNKRKFVIHIKQGVYKEKVEVTKKMLNVMFVGDGPT  440

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+       VG T+++ TV V  + F+ +D+  ENTAGA + QAVALR+SAD A+
Sbjct  441   KTIITGDIAFLPNRVG-TFRTATVAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFAL  499

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH+N YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ+C  + R+P++ Q C+V
Sbjct  500   FFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIV  559

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR    IVI +  I+ + +       N+ FLGRPWKE+SRT+IM + ID+++ 
Sbjct  560   TAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVID  619

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R ISP  A++F PG FL  +
Sbjct  620   PEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-ISPRAAREFAPGNFLRGN  678

Query  1612  EQWLGRAQIPFS  1577
               W+ + +IP++
Sbjct  679   -TWIPQTRIPYN  689



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   338 bits (868),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 218/317 (69%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN-DRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+ VA+DGS + K+I  A+  IP  N D+  VI +K GVY EYV++     N++ +G+GP
Sbjct  261   DVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYNEYVMIDKFMTNVMMIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT ITGNKN ADG    T+++ TV V  + FV +D+  EN+AGA   QAVALR+ +D++
Sbjct  321   TKTKITGNKNYADGT--KTFQTATVAVVGDYFVAKDIGFENSAGAKGHQAVALRVQSDLS  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ+CKMI RKP++ QACM
Sbjct  379   IFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACM  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR   A+V+Q+C I  +P        +K +LGRPWK  +RT++M S ID+I+
Sbjct  439   VTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRPWKALARTIVMQSQIDDII  498

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+ ++PE A  FT G  LM 
Sbjct  499   TPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK-LTPEHAVDFTAGR-LME  556

Query  1615  DEQWLGRAQIPFSPGYV  1565
              ++W+  + +P+  G V
Sbjct  557   GDKWIKPSGVPYVAGMV  573



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 215/314 (68%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DI+VA+DGS  +KTI  AL  +P   +   +I IK G+Y E+++V     N++ +G+G  
Sbjct  278   DIIVAKDGSGSYKTITEALKHVPKYGNETFIIYIKEGIYNEHILVTRSMTNVMMIGDGAN  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DG    TY + TV ++ + F+  D+  EN+AG  K QAVALR+SAD A+
Sbjct  338   KTRITGNKNFVDGTT--TYHTATVAIQGDHFMVMDIGFENSAGPEKHQAVALRVSADKAI  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH+ RQFYR CTISGT+DF+FG+A  +FQ+C  + RKPL  Q+C+V
Sbjct  396   FYRCSMDGYQDTLYTHAQRQFYRDCTISGTIDFVFGDATAIFQNCTFLIRKPLPNQSCIV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI+IQ+  I A+P        NK +LGRPWKE+SRT+IM S+ID+++ 
Sbjct  456   TAQGRKERRQPSAIIIQNSTITADPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQ  515

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW+G + L TC+YAE  N GP A+  +RV W+G K+ I+   A  FTPG F   D
Sbjct  516   PEGWLPWEGEWGLKTCFYAELGNTGPAANKARRVTWRGIKK-ITENHAADFTPGRFFRGD  574

Query  1612  EQWLGRAQIPFSPG  1571
              +W+  + +P+ PG
Sbjct  575   -KWIRLSGVPYIPG  587



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   338 bits (868),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 218/314 (69%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D  V+Q G  ++KTI+ A+  +P  N    +I IKAG YKEY+ +  K+ N++ +G+GP 
Sbjct  269   DATVSQSGGGQYKTISEAIAKVPMNNASPFIIYIKAGTYKEYINIEKKQTNVILVGDGPT  328

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+KN A G+   T+K+ TV V  +GF+ RDLTIEN++G    QAVAL++ +D+AV
Sbjct  329   KTIITGSKNFAAGI--NTFKTATVGVLGDGFMARDLTIENSSGPEGHQAVALKVVSDLAV  386

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++NC     QDTLY    RQFYR CT+SGT+DFIFG+A  VFQ+CK++ RKP   Q CMV
Sbjct  387   LYNCRFTGNQDTLYALRGRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKPGPNQQCMV  446

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + +G  A + + C + +EP  KA    N  +LGRPWKE+S+T+ M+S ID+ + 
Sbjct  447   TAQGRTEEKGPGAFIFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIA  506

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW+ W+GNFALDT +YAE++N+G GA   +RVKWKG K  +S + A  FTP    ++ 
Sbjct  507   PKGWTEWQGNFALDTLYYAEFENKGAGADKSQRVKWKGIK-TLSAQEADGFTPAKLFVSG  565

Query  1612  EQWLGRAQIPFSPG  1571
             ++W+  + +P++PG
Sbjct  566   DKWIPESGVPYAPG  579



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   330 bits (847),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 218/317 (69%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN-DRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D VVA+DGS +++TI  A+  IP  N D+  VI +K GVY EYV++     N++ +G+G 
Sbjct  49    DAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGA  108

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT +TG+KN A GV   T+++ TV V  + F+ +D+ IEN+AGA   QAVALR+ +D++
Sbjct  109   XKTKVTGSKNFAAGV--QTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLS  166

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ+CKMI RKP++ QACM
Sbjct  167   IFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACM  226

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR  + I++Q+C I  +P        NK +LGRPWK  +RT++M S ID I+
Sbjct  227   VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  286

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K N+S + A  FT G F+  
Sbjct  287   APEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFVEG  345

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G V
Sbjct  346   D-KWIKPSGVPYVAGMV  361



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   342 bits (877),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 215/314 (68%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL ++P   +   V+ IK G+YKEYV V     ++VF+G+G  
Sbjct  250   DIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGSD  309

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVITG+KN  DG+   TYK+ TV +  + F+ +++  ENTAG +K QAVA+R+ AD ++
Sbjct  310   KTVITGDKNYKDGIT--TYKTATVAIVGDHFIAKNIGFENTAGPIKHQAVAIRVLADQSI  367

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  368   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  427

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C IV EP   A    +K +LGRPWKEFSRT+IM +FI + + 
Sbjct  428   TAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIMNTFIPDFIP  487

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNF L+T +Y+E +N GPG+   KRV W G K+ +S E    FTP  ++  D
Sbjct  488   PEGWQPWLGNFGLETLFYSEVRNIGPGSGLTKRVTWPGIKK-LSEEEILTFTPAQYIQGD  546

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P+ PG
Sbjct  547   -AWIPGKGVPYIPG  559



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   343 bits (879),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 218/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA+DGS  FKTIN A+  +P  +++  ++ IK G+Y+E V +     N++ +G+GP 
Sbjct  264   NLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPT  323

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG    T+K+ TV V  +GF+ + +  EN+AGA K QAVALR+ +D ++
Sbjct  324   KTKITGSLNFVDGT--PTFKTATVAVLGDGFIAKGIGFENSAGAAKHQAVALRVQSDRSI  381

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLYTH+ RQFYR CTISGT+DFIFG+A V+FQ+C  + RKPL+ Q C+V
Sbjct  382   FYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQCIV  441

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI+IQ+    A+P         K +LGRPWKEFSRT+IM S+I++++ 
Sbjct  442   TAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLIQ  501

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL TC+Y E++NRGPGA T  RVKW+G K  I P  A  F PG FL  D
Sbjct  502   PSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHAIDFAPGRFLSGD  560

Query  1612  EQWLGRAQIPFSPG  1571
              +W+    +P++ G
Sbjct  561   -RWIPSTGVPYNSG  573



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   333 bits (854),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 214/312 (69%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K KTI  AL  +P  N R+ VI IK GVYKE + V  K  N++F+G+GP 
Sbjct  158   NVVVAKDGSGKCKTIEQALAMVPMKNRRKFVIYIKQGVYKEKIEVTKKMKNVMFVGDGPT  217

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITGN       +G TY++ T  V  + F+ +D+  ENTAGA + QAVALR+SAD AV
Sbjct  218   KTIITGNVAFLPDRIG-TYRTSTFAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFAV  276

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH+  YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ+C+ + R+P++ Q C+V
Sbjct  277   FFNCHMAGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDNQQCIV  336

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR    IVI +  I  +   +     N+ FLGRPWKE+SRT+IM + ID+++ 
Sbjct  337   TAQGRKDRRETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVID  396

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W   FAL T +Y+EY+NRG G+   +RV+W+G +R IS   A+ F PG FL  +
Sbjct  397   PEGWLKWNETFALKTLFYSEYRNRGRGSGQARRVRWRGIQR-ISARQARGFAPGEFLRGN  455

Query  1612  EQWLGRAQIPFS  1577
               W+ + +IP++
Sbjct  456   A-WITKRRIPYN  466



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   337 bits (863),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 218/317 (69%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN-DRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+ VA+DGS + K+I  A+  IP  N D+  VI +K GVY E+V++     N++ +G+GP
Sbjct  261   DVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYNEHVMIDKFMTNVMMIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT ITGNKN ADG    T+++ TV V  + FV +D+  EN+AGA   QAVALR+ +D++
Sbjct  321   TKTKITGNKNYADGT--KTFQTATVAVVGDYFVAKDIGFENSAGAKGHQAVALRVQSDLS  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ+CKMI RKP++ QACM
Sbjct  379   IFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACM  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR   A+V+Q+C I  +P        +K +LGRPWK  +RT++M S ID+I+
Sbjct  439   VTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDII  498

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+ ++PE A  FT G  LM 
Sbjct  499   TPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK-LTPEHAVDFTAGR-LME  556

Query  1615  DEQWLGRAQIPFSPGYV  1565
              ++W+  + +P+  G V
Sbjct  557   GDRWIKPSGVPYVAGMV  573



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   337 bits (863),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 213/311 (68%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL  +P  N +  VI IK GVY E V V  K  ++ F+G+GP 
Sbjct  258   DVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV +  + F  +++  ENTAG    QAVALR+SAD AV
Sbjct  318   KTKITGSLNYYIGKVK-TYHTATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  VV Q C ++ RKP++GQ+CM+
Sbjct  377   FHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMI  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R +  +V+ +C I  EP        NK +LGRPWK+FSRT+IM + I+++V 
Sbjct  437   TAQGRTNERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVD  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N G G+   +RVKW G K+ +SP+ A +FTP  FL  +
Sbjct  497   PAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN  555

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  556   -LWIPPTRVPY  565



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   340 bits (872),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 219/312 (70%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K KTI  AL  +P  N R+ VI IK GVYKE V V  K  N++F+G+GP 
Sbjct  381   NVVVAKDGSGKCKTIAQALAMVPMKNKRKFVIHIKQGVYKETVEVTKKMLNVMFVGDGPT  440

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+       VG T+++ TV V  + F+ +D+  ENTAGA + QAVALR+SAD AV
Sbjct  441   KTIITGDIAFLPNRVG-TFRTATVAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFAV  499

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH+N YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ+C  + R+P++ Q C+V
Sbjct  500   FFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIV  559

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR    IVI +  I+ + +       N+ FLGRPWKE+SRT+IM + ID+++ 
Sbjct  560   TAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVID  619

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R ISP  A++F+PG FL  +
Sbjct  620   PEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-ISPRAAREFSPGNFLRGN  678

Query  1612  EQWLGRAQIPFS  1577
               W+ + +IP++
Sbjct  679   -TWIPQTRIPYN  689



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   336 bits (861),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 217/317 (68%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VV++ G  K+KTIN AL  IP  N+ +  VI +K GVY E+V       N++ +G+GP
Sbjct  261   DVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KTVITG +N ADG    TY + TV V  + F+ +D+  ENTAGA+  QAVALR+ +D++
Sbjct  321   TKTVITGRRNYADGT--QTYLTATVGVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLS  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  379   IFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR  +A+++Q+C I  E         NK +LGRPWK ++R ++M S ID+++
Sbjct  439   VTAQGRLDRRSPSALILQNCTISGERGYD--KELNKAYLGRPWKSYARAIVMQSQIDDVI  496

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G    +TCW+ E+ NRG GA   KRV W+G K+ ++PE A  FT G F+  
Sbjct  497   APEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRGMKK-LTPEHAADFTAGKFIFG  555

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  556   D-RWILPSGVPYVAGMM  571



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   338 bits (868),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 215/315 (68%), Gaps = 4/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL+ +P   +   V+ IKAGVYKEY+ V     ++VF+G+GP 
Sbjct  257   DIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIKAGVYKEYIQVNKSMTDLVFIGDGPD  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+K   DG+   TY++ TV +  + F+ +D+  ENTAGA+K QAVA+R+ +DM+V
Sbjct  317   KTIISGDKGFKDGIT--TYRTQTVAIVGDRFIAKDIGFENTAGAIKHQAVAVRVQSDMSV  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  375   FYNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR+D R     V Q C I  EP   +    +K +LGRPWK +SRT+IM +FI + V 
Sbjct  435   TAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E +N GPG+    RV W G K+  + ++  QFTP  F+  D
Sbjct  495   PQGWQPWNGDFGLSTLFYSEIQNTGPGSDVVNRVTWAGIKKLTNNDLL-QFTPAQFIQGD  553

Query  1612  EQWLGRAQIPFSPGY  1568
               W+    +P++PG+
Sbjct  554   S-WIPATGVPYTPGF  567



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   340 bits (872),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 216/311 (69%), Gaps = 4/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL+ +P   +   V+ IK G+YKEYV V     ++VF+G+GP 
Sbjct  252   DIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQVNRSMTHLVFIGDGPD  311

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVI+G+K+  DG+   TYK+ TV +  + F+ +++  ENTAGA+K QAVA+R+ AD ++
Sbjct  312   KTVISGSKSYKDGIT--TYKTATVAIVGDHFIAKNIAFENTAGAIKHQAVAIRVLADESI  369

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  370   FYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLNQACPI  429

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C IV EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  430   TAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFVP  489

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G F L+T +Y+E +N GPGA+  KRV W G K+ +S E   +FTP  ++  D
Sbjct  490   PEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIKK-LSDEEILKFTPAQYIQGD  548

Query  1612  EQWLGRAQIPF  1580
               W+    +P+
Sbjct  549   -AWIPGKGVPY  558



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   338 bits (867),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 216/327 (66%), Gaps = 4/327 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYTTINEALQFVPKKKNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNKN  DG+   TY++ TV +    F+ +++  ENTAGA+K QAVALR+ +D ++
Sbjct  315   KTIISGNKNYKDGIT--TYRTATVAIVGNYFIAKNIGFENTAGAIKHQAVALRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R     V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  433   TAHGRKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +S E   +FTP  ++  D
Sbjct  493   PQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSDEDILKFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV*NKQAIMRESP  1532
               W+    +P++PG +    A    +P
Sbjct  552   -TWVPGKGVPYTPGLLAGNPAAATTTP  577



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   336 bits (861),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 214/315 (68%), Gaps = 5/315 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVA+DGS K+ TIN AL  IP  ++   VI IK GVYKEYV +     N++ +G+G  
Sbjct  267   NIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKEGVYKEYVTIERNMTNLLIIGDGAN  326

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+KN  DG    T  + TV V  + F  RD+  ENTAGA K QAVALR++AD A+
Sbjct  327   KTRITGDKNFIDGF--PTSLTATVVVLGDHFRARDIGFENTAGAHKHQAVALRVNADEAI  384

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH+ RQFYR C +SGT+DF+FG+A  VFQ+C+ I R+P++ Q C+V
Sbjct  385   FYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAVFQNCRFIVRRPMDNQQCIV  444

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AI+IQ+   VA+P           +LGRPWKEFSRT+IM SFID+++ 
Sbjct  445   TAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRPWKEFSRTIIMESFIDDLIQ  504

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGA-STDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
             P GW PW G+F L TC+Y E+ NRGPGA    +R KWKG K NI+ + A+ FTPG F   
Sbjct  505   PRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWKGVK-NITAKHARDFTPGSFFKG  563

Query  1615  DEQWLGRAQIPFSPG  1571
             D  W+ R  IP+  G
Sbjct  564   D-WWIKRTGIPYVSG  577



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   335 bits (860),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 216/317 (68%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VV++ G  K+KTIN AL  IP  N+ +  VI +K GVY E+V       N++ +G+GP
Sbjct  262   DVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGP  321

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KTVITG KN A+G    TY++ TV V  + F+ +D+  ENTAGA+  QAVALR+ +D++
Sbjct  322   TKTVITGRKNYAEGT--QTYQTATVAVVGDYFIAKDIGFENTAGAIGHQAVALRVQSDLS  379

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  380   IFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  439

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GR DRR   A+++Q+C I  E         NK +LGRPWK ++R ++M S ID+++
Sbjct  440   VTAHGRLDRRSPTALILQNCTISGESGYD--KELNKAYLGRPWKSYARAIVMQSQIDDVI  497

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G    +TCW+ E+ NRG GA   KRV W+G K+ ++PE A  FT G F+  
Sbjct  498   APEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRGMKK-LTPEHAADFTAGKFIFG  556

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  557   D-RWILPSGVPYVAGMM  572



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   337 bits (865),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 217/327 (66%), Gaps = 4/327 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN A+ ++P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  256   DIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVHIKAGIYKEYVQVNRSMTHLVFIGDGPD  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNKN  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D A+
Sbjct  316   KTIISGNKNFKDGIT--TYRTATVAIVGDHFIAKNIGFENTAGAIKHQAVAVRVQSDEAI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  374   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQNCTLLVRKPLPNQACPI  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR+D R     V Q C I  EP   A    +K +LGRPWKE+SRT+IM SFI + V 
Sbjct  434   TAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQ  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E +N GPGA+   RV W G K   + E+ K F P  F+ +D
Sbjct  494   PQGWQPWLGDFGLKTLFYSEVQNIGPGAALASRVTWAGIKTLSNEEILK-FAPAEFIQSD  552

Query  1612  EQWLGRAQIPFSPGYV*NKQAIMRESP  1532
               W+    +P+ PG +     +   SP
Sbjct  553   A-WVPGKGVPYIPGLLDGNPTVATTSP  578



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   338 bits (867),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 219/327 (67%), Gaps = 4/327 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL  +P   +   V+ IKAG+YKEYV V    +++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNKN  DG+   TY++ TV +    F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  315   KTIISGNKNYKDGIT--TYRTATVAIVGNYFIAKNIGFENTAGAIKHQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  433   TAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +S E   +FTP  ++  D
Sbjct  493   PQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV*NKQAIMRESP  1532
             + W+    +P++ G +    A    +P
Sbjct  552   D-WIPGKGVPYTTGLLAGNPAAATTTP  577



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   336 bits (861),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 216/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS    T+N AL  +PA   +  VI +K G+YKE V +     N+  +G+GP 
Sbjct  268   DVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYKENVNIEKNMTNVFMIGDGPT  327

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K+VIT   N  DGV   T+ + TV V   GFV +++  EN+AGA K QAVALR+ +D ++
Sbjct  328   KSVITAGLNFVDGV--KTFNTATVGVVGNGFVAKNMGFENSAGAEKHQAVALRVESDFSI  385

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTISGT+DFIFGN+ VVFQ+C+++ RKPL+ Q   +
Sbjct  386   FYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVFQNCQIVVRKPLDNQQNTI  445

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR DRR   A+++ +C IVA+P           +LGRPWKE+SR  I+ S ID++V 
Sbjct  446   TAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLPTYLGRPWKEYSRAFILQSEIDDLVQ  505

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +Y+EY NRGPGA+T +RVKW+G K +I+ E A++FT   FL   
Sbjct  506   PAGWLPWAGDFALNTLFYSEYDNRGPGAATAERVKWRGLK-SITAEHAEKFTVARFLGGT  564

Query  1612  EQWLGRAQIPFSPGYV  1565
             E W+  A +PF PG +
Sbjct  565   E-WIKNASVPFIPGLI  579



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   345 bits (886),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 221/316 (70%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA+DGS K++TIN AL  IP  +++  V+ IK GVY+E V + S   +++ +G+GP 
Sbjct  235   DLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEEKVQINSSLTHLMMVGDGPT  294

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG   GTY++ TV V+ + F+ +++  EN+AGA K QAVALR+SAD ++
Sbjct  295   KTRITGHLNFIDGT--GTYQTATVAVQGDDFIAKEIGFENSAGAAKHQAVALRVSADKSI  352

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++ YQDTLY H+YRQFY+ C ISGTVDFIFG++  VFQ C ++ RKP++ Q C+V
Sbjct  353   FYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPMDNQQCIV  412

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD R    IVIQ+C  VA+P L         +LGRPWKE+SRT+IM SF+D+ + 
Sbjct  413   TAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLDDFIQ  472

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW  W   FAL+T +Y E+ NRGP A   KRVKW G K  + P   ++FTPG FL  +
Sbjct  473   PDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVKE-LPPSRVQRFTPGEFLDGN  531

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+   Q+P++ G++
Sbjct  532   -RWIPPTQVPYAAGFI  546



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   336 bits (862),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  257   DIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPE  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAGA+K QAVA+R+ +D ++
Sbjct  317   KTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESI  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  375   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  435   TAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   + E+ K FTP  ++  D
Sbjct  495   PQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  554   -VWVHGKGVPYTPGLL  568



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   336 bits (862),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  257   DIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPE  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAGA+K QAVA+R+ +D ++
Sbjct  317   KTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESI  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  375   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  435   TAHGRKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   + E+ K FTP  ++  D
Sbjct  495   PQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  554   -VWVHGKGVPYTPGLL  568



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   336 bits (862),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  257   DIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPE  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAGA+K QAVA+R+ +D ++
Sbjct  317   KTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESI  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  375   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  435   TAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQ  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   + E+ K FTP  ++  D
Sbjct  495   PQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNEEILK-FTPDQYIQGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  554   -VWVHGKGVPYTPGLL  568



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   338 bits (868),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 221/315 (70%), Gaps = 4/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL ++P  N+   V+ IK+G YKEYV V     N+VF+G+GP 
Sbjct  251   DMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQVNRTMPNLVFIGDGPT  310

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+  QAVA+R+ +D ++
Sbjct  311   KSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGALNYQAVAVRVLSDESI  368

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  369   FYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPI  428

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C I  E    A    +K +LGRPWKE+S+T+IM +FI + + 
Sbjct  429   TAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIP  488

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              EGWSPW+GNF LDT +Y+E +N GPGA+   RV W+G K+ +S E   ++TP  ++  D
Sbjct  489   GEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEIVEYTPAKYIQGD  547

Query  1612  EQWLGRAQIPFSPGY  1568
             + W+    +P++PG+
Sbjct  548   D-WIPGKGVPYTPGF  561



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   336 bits (861),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL ++P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYTTINDALKNVPKKKNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNKN  DG+   TY++ TV +  + F+ +++   NTAG +K QAVA+R+ +D ++
Sbjct  315   KTIISGNKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAGPIKHQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  433   TAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   + E+ K FTP  ++  +
Sbjct  493   PQGWQPWLGNFGLDTLFYSEVQNTGPGAALASRVTWPGIKTLSNDEILK-FTPDQYIQGN  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -VWVPGKGVPYTPGLL  566



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   342 bits (878),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 214/314 (68%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL+ +P   +   V+ IK G+YKEYV V     ++VF+G+GP 
Sbjct  252   DIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGPD  311

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVI+G+KN  DG+   TYK+ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  312   KTVISGDKNYKDGIT--TYKTATVAIVGDHFIAKNMGFENTAGAIKHQAVAIRVLSDESI  369

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQSC ++ RKPL  QAC +
Sbjct  370   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSCTLLVRKPLPNQACPI  429

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C IV EP        +K +LGRPWKE+SRT+ M +FI + + 
Sbjct  430   TAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFIP  489

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW GNF L+T +Y+E  N GPGA   KRV W G K+ +S E   + TP  ++  D
Sbjct  490   PEGWQPWLGNFGLETLFYSEVGNTGPGADVTKRVTWPGIKK-LSEEEILKITPAEYIQGD  548

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P+ PG
Sbjct  549   -AWIPGKGVPYIPG  561



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   333 bits (855),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 220/322 (68%), Gaps = 8/322 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS + K+IN AL ++P  N +  VI IKAG+Y E + V +   N+VF+GEG  
Sbjct  238   NVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENIEVANTMTNVVFIGEGSN  297

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT IT NKN  DG+    +++ TV++  +GFV +D+  EN+AG +K++AVALR+SA+M  
Sbjct  298   KTKITSNKNYLDGL--PIFQTATVSISGQGFVAKDIAFENSAGPLKKEAVALRVSAEMTA  355

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKP--LEGQAC  1979
               NC ++ YQ TL TH  RQFYR CTISGT+DFIFG+A  V Q+CK+IARKP  ++ QA 
Sbjct  356   FQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVLQNCKIIARKPEEMQTQAI  415

Query  1978  MVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKEFSRTLIMFSFIDN  1802
              + AQGR +  G   I+IQ+C I AEPAL A NPP NK FLGRP K +SRT++M S ID 
Sbjct  416   TIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRNKAFLGRPAKMYSRTIVMQSQIDG  475

Query  1801  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              + PEGW+P+ G F L+T ++ EY+NRGPGA+TD+RV WK Y +N   +V  +F PG  L
Sbjct  476   FIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYMKNPPQDVIAKFAPGVVL  535

Query  1621  MADEQ---WLGRAQIPFSPGYV  1565
                +    W+ +  +P+ P  +
Sbjct  536   KGGDNTDGWVTKTGVPYEPAMM  557



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   334 bits (856),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 218/317 (69%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN-DRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D VVA+DGS +++TI  A+  IP  N D+  VI +K GVY EYV++     N++ +G+G 
Sbjct  264   DAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGA  323

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT +TG+KN A GV   T+++ TV V  + F+ +D+ IEN+AGA   QAVALR+ +D++
Sbjct  324   XKTKVTGSKNFAAGV--QTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLS  381

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ+CKMI RKP++ QACM
Sbjct  382   IFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACM  441

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR  + I++Q+C I  +P        NK +LGRPWK  +RT++M S ID I+
Sbjct  442   VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  501

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K N+S + A  FT G F+  
Sbjct  502   APEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFVEG  560

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G V
Sbjct  561   D-KWIKPSGVPYVAGMV  576



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   338 bits (866),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYTTINDALMFVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPE  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVALR+ +D A+
Sbjct  315   KTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAGAIKHQAVALRVQSDEAI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  433   TAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW+G+F L T +Y+E +N GPGA+   RV W G K  +S E   +FTP  ++  D
Sbjct  493   PQGWQPWQGDFGLKTLFYSEVQNTGPGATVANRVTWAGIK-TLSDEDILKFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++ G +
Sbjct  552   -TWVPGKGVPYTSGLL  566



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   327 bits (837),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 204/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  +KT+  A+ S P  + +R +I IKAGVYKE V VP KK NI+F+G+G  
Sbjct  55    DVTVAADGSGNYKTVGEAVASAPERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRT  114

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV V  +GF+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  115   NTIITASRNVVDGST--TFHSATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSA  172

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQF+ GC ++GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  173   FYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNAAAVLQDCDIHARRPNSGQRNMV  232

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   LK        +LGRPWKE+SRT++M + I +++ 
Sbjct  233   TAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVVMQTSISDVIN  292

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW GNFALDT +YAEY+N G GA T KRV WKG+K   S   A+ FT G F+   
Sbjct  293   PAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASEAQAFTAGSFI-GG  351

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  352   SSWLPSTGFPFSLG  365



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   333 bits (854),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 215/312 (69%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTIN AL+++P  N    VI IK GVYKE V+V  K   + F+G+GP KT
Sbjct  251   VVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVVTRKMPYVTFIGDGPTKT  310

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VITG+ N   G V  TY +  +TVE E F  + + +ENTAG    QAVALR+S D AV  
Sbjct  311   VITGSLNFGIGKVK-TYLTAPLTVEGEHFTAKGIGMENTAGPEGGQAVALRVSGDYAVFF  369

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG++  + Q+CK++ RKP+ GQ+CMVTA
Sbjct  370   DCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPMAGQSCMVTA  429

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R    IV+ +C IV +PA       +K +LGRPWKEFSRT++M + +D+++ P 
Sbjct  430   QGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVMKTIVDDVIDPA  489

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPGA+  +RVKW G K+ ++PE A  +T   FL  +  
Sbjct  490   GWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTPEQALSYTGDRFLSGN-T  547

Query  1606  WLGRAQIPFSPG  1571
             W+ R Q+P++ G
Sbjct  548   WIPRTQVPYTAG  559



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   333 bits (855),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 214/312 (69%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDGS  FKTI  AL  +P  N    +I IK G+YKE V V  K   + F+G+GP 
Sbjct  258   NVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPN  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN N   G V  T+ + T+T+E E F  +++ IENTAG    QAVALR+SAD AV
Sbjct  318   KTKITGNLNFGIGKVK-TFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG+A  + Q+C ++ RKP  GQ+CMV
Sbjct  377   FYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  +V+ +C I+ EPA       NK +LGRPWKEFSRT+IM + ID+++ 
Sbjct  437   TAQGRSDVRESTGLVLHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVID  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PWKG+FAL T +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D
Sbjct  497   PAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD  555

Query  1612  EQWLGRAQIPFS  1577
               W+ + Q+P+S
Sbjct  556   -TWIPQTQVPYS  566



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   333 bits (854),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 208/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS  F TI  AL  +P  + +  V+ IKAG+Y+EY+       N++ +G+G  
Sbjct  265   DIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRE  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I GNKN  DG+   TY + TV V  + FV +++  E  AGA+K QAVALR+SAD A+
Sbjct  325   TTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNIGFEKNAGAIKHQAVALRVSADYAL  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ +QDTLYT + RQF R C++SGT+DF+FG+A  VFQ+CK + RKPLE Q C+V
Sbjct  383   FYNCSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQNCKFLIRKPLENQQCIV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK RR  +AIVIQ+  I A P L       K +LGRPWKEFSRT+IM SFID+++ 
Sbjct  443   TAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVIQ  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G F L TCWY E+ N GPG+S   RVKW G K  I  + A  FTPG F    
Sbjct  503   PEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TIDRQHALDFTPGRFFKGG  561

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    IP++P  V
Sbjct  562   A-WIKTTGIPYTPFLV  576



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   336 bits (862),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 219/315 (70%), Gaps = 4/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL ++P  N+   VI IK+G YKEYV V     N+VF+G+GP 
Sbjct  251   DMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIKSGTYKEYVQVNRTMPNLVFIGDGPD  310

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+  QAVA+R+ +D ++
Sbjct  311   KSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGALNYQAVAVRVLSDESI  368

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  369   FYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLANQACPI  428

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R +   V+Q C I  E    A    +K +LGRPWKE+S+T+IM +FI + + 
Sbjct  429   TAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFIP  488

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              EGWSPW+GNF LDT +Y+E +N GPGA+   RV W G K+ +S E   ++TP  ++  D
Sbjct  489   GEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWPGIKK-LSEEEIVEYTPAKYIQGD  547

Query  1612  EQWLGRAQIPFSPGY  1568
             + W+    +P++PG+
Sbjct  548   D-WIPGKGVPYTPGF  561



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   333 bits (855),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 214/310 (69%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS +++TI  AL ++P  N+RR VI IK+GVY E V +  K  +++F+G+GP KT
Sbjct  277   VVAKDGSGQYRTITEALAAVPKNNERRFVIYIKSGVYAENVELTKKMTHVMFIGDGPTKT  336

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TGN +     +  TY++ TV V  + F+ +D+  ENTAG    QAVALR+SAD AV +
Sbjct  337   IVTGNLSFHPNRIS-TYRTSTVAVNGDWFMAKDMAFENTAGPEGHQAVALRVSADYAVFY  395

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ+C+ + R+P+E Q C+VTA
Sbjct  396   NCRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCQFVVRRPMENQQCIVTA  455

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGRKDRR    IVI    I+ +P        N+ +LGRPWKE+SRT+IM S ID+I+ PE
Sbjct  456   QGRKDRRETTGIVIHKSRIMGDPTYLPVKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPE  515

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W   FALDT +YAEY+N GPG+    RV+W G + ++S   A Q+TP  FL  +  
Sbjct  516   GWMKWNETFALDTLYYAEYQNTGPGSDQAGRVRWNGIQ-HLSDSAATQYTPDNFLRGN-T  573

Query  1606  WLGRAQIPFS  1577
             W+ + ++P++
Sbjct  574   WIPKTRVPYA  583



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   333 bits (853),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 215/317 (68%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VV+  G  K+KTIN AL  IP  N+ +  VI +K GVY E+V       N++ +G+GP
Sbjct  262   DVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGP  321

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KTVITG KN A+G    TY++ TV V  + F+ +D+  ENTAGA+  QAVALR+ +D++
Sbjct  322   TKTVITGRKNYAEGT--QTYQTATVAVVGDYFIAKDIGFENTAGAIGHQAVALRVQSDLS  379

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  380   IFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  439

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GR D R  +A+++Q+C I  E         NK +LGRPWK ++R ++M S ID+++
Sbjct  440   VTAHGRLDMRSPSALILQNCTISGERGYN--KELNKAYLGRPWKSYARAIVMQSQIDDVI  497

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G    +TCW++E+ NRG GA   KRV W G K+ ++PE A  FT G F+  
Sbjct  498   APEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSGMKK-LTPEHAADFTAGKFMFG  556

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  557   D-RWILPSGVPYVAGMM  572



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   333 bits (853),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 211/311 (68%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS ++KTIN AL  +P  N +  VI IK GVY E V V  K  ++ F+G+GP 
Sbjct  258   NVVVAQDGSGEYKTINEALSVVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + TV +  +    +++  ENTAG    QAVALR+SAD AV
Sbjct  318   KTKITGSLNYYIGKVK-TYHTATVAINGDNLTAKNIGFENTAGPEGHQAVALRVSADYAV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  VV Q C ++ RKP++ Q+CM+
Sbjct  377   FHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKSQSCMI  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  +V+ +C I  EP        NK +LGRPWK+FSRT+IM + I+++V 
Sbjct  437   TAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVD  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL+T +YAEY+N G G+   +RVKW G K+ +SP+ A +FTP  FL  +
Sbjct  497   PAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN  555

Query  1612  EQWLGRAQIPF  1580
               W+   ++P+
Sbjct  556   -LWIPPTRVPY  565



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 217/309 (70%), Gaps = 3/309 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  AL+++P  N    VI IK G+YKE VIV  K   + F+G+GP KT
Sbjct  257   VVAQDGSGQFKTIADALNAVPKDNRLPFVIHIKQGIYKEKVIVTKKMPYVTFIGDGPTKT  316

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITG+ N   G V  T+ + TVT++ E F  +++ IENTAG    QAVALR+SAD AV +
Sbjct  317   KITGSLNFGLGKVK-TFLTATVTIDGEHFTAKNIWIENTAGPEGGQAVALRVSADYAVFY  375

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP  GQ+CMVTA
Sbjct  376   SCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKGGQSCMVTA  435

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R +  +V+ +C IV EPA       NK +LGRPWK+FSRT+IM + ID+++ P 
Sbjct  436   QGRTDVRESTGLVLHNCHIVGEPAYIPVKSVNKAYLGRPWKKFSRTIIMKTTIDDVIDPA  495

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW+G+FAL+T +YAE+ N GPG++  +RV W G K+ +SPE A  +T G FL  D  
Sbjct  496   GWLPWRGDFALETLYYAEHLNIGPGSNQAQRVNWPGIKK-LSPEEALLYTGGRFLHGD-T  553

Query  1606  WLGRAQIPF  1580
             W+ + Q+P+
Sbjct  554   WIPQTQVPY  562



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   333 bits (853),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 217/317 (68%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN-DRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D VVA+DGS +++TI  A+  IP  N D+  VI +K GVY EYV++     N++ +G+G 
Sbjct  264   DAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGA  323

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT +TG+KN A GV   T+++ TV V  + F+ +D+ IEN+AGA   QAVALR+ +D++
Sbjct  324   TKTKVTGSKNFAAGV--QTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLS  381

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ+CKMI RKP++ QACM
Sbjct  382   IFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACM  441

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR DRR  + I++Q+C I  +P        NK +LGRPWK  +RT++M S ID I+
Sbjct  442   VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  501

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K N+  + A  FT G F+  
Sbjct  502   APEGWMEWTGSNNHQSCWFGEYRNRGPGSDMSKRVKWSGIK-NLGADQAVAFTSGKFVEG  560

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G V
Sbjct  561   D-KWIKPSGVPYVAGMV  576



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   333 bits (853),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  FKT++AA+++ P  + RR VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  276   DVVVAADGSGDFKTVSAAVEAAPEKSSRRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRT  335

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+IT ++NV DG    T+ S TV    E F+ RDLT +NTAG+ K QAVALR+ +D++ 
Sbjct  336   KTIITASRNVVDGST--TFHSATVAAVGERFLARDLTFQNTAGSSKHQAVALRVGSDLSA  393

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + A+QDTLY HS RQFY  C I+GTVDFIFGN   VFQ C + AR P  GQ  MV
Sbjct  394   FYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGNGAAVFQDCDIHARLPGSGQKNMV  453

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        FLGRPWKE+SRT++M S + +++ 
Sbjct  454   TAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSRTVVMQSTVTDVID  513

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL T +YAEY+N G GA T  RVKWKGYK   S   A+ FTPG F+  +
Sbjct  514   PAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAEAQAFTPGRFIDGN  573

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PF+ G
Sbjct  574   S-WLGATGFPFALG  586



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 214/312 (69%), Gaps = 4/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VAQDGS K+KTIN AL  IP   +   V+ +K GVYKE V       N++ +G+GP 
Sbjct  272   NVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKEQVNFTKSMTNVMLIGDGPT  331

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+ N  DG+  GT+++ TV      F+ +D+  EN AGA K QAVALR+ +DMA+
Sbjct  332   KTTISGSLNFIDGI--GTFRTATVAAVGSNFMAKDIGFENNAGASKHQAVALRVGSDMAI  389

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTI+GT+DFIFG++ VVFQ+C ++ RKPL+ Q C+V
Sbjct  390   FYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDNQQCIV  449

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR +RR    IV+Q+C I A           K +LGRPWK FSRT+IM S ID+++ 
Sbjct  450   TAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLIS  509

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G+F L+TC+YAEY NRGP ++T  RV W+G K+ I+ +    FT G F+ + 
Sbjct  510   PEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQHVNDFTVGRFI-SG  567

Query  1612  EQWLGRAQIPFS  1577
               WLG + +P++
Sbjct  568   HLWLGASGVPYT  579



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   332 bits (850),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 214/312 (69%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDGS  FKTI  AL  +P  N    +I IK G+YKE V V  K   + F+G+GP 
Sbjct  258   NVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPN  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN N   G V  T+ + T+T+E E F  +++ IENTAG    QAVALR+SAD AV
Sbjct  318   KTKITGNLNFGIGKVK-TFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG+A  + Q+C ++ RKP  GQ+CMV
Sbjct  377   FYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R +  +V+ +C I+ +PA       NK +LGRPWKEFSRT+IM + ID+++ 
Sbjct  437   TAQGRSDVRESTGLVLHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVID  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PWKG+FAL T +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D
Sbjct  497   PAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD  555

Query  1612  EQWLGRAQIPFS  1577
               W+ + Q+P+S
Sbjct  556   -TWIPQTQVPYS  566



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   333 bits (854),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 213/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN A+  +P   +   V+ IKAGVYKEYV V     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVHIKAGVYKEYVQVNKSMTHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAGA+K QAVA+R+ +D ++
Sbjct  315   KTIISGSKNYKDGIT--TYRTATVAIIGDYFIAKNIGFVNTAGAIKHQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  433   TAHGRKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K  +S E    FTP  ++  D
Sbjct  493   PQGWQPWLGNFGLDTLFYSEVQNIGPGAALAGRVTWPGIK-TLSDEEILSFTPDQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -VWVPGKGVPYTPGLL  566



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   332 bits (851),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 215/324 (66%), Gaps = 12/324 (4%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAIN--------DRRTVILIKAGVYKEYVIVPSKKNNI  2357
             D+VVA+DGS  FKTI  AL   P I+        ++  VI IK GVY+E V V +    +
Sbjct  268   DVVVAKDGSGNFKTITEALKQAPIIDATKVEKGTNKTFVIYIKEGVYEEEVQVEANMWFV  327

Query  2356  VFMGEGPAKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVAL  2177
             + +G+GP KT ITG KN ADG V   +K+ TV++    F+ +D+  EN+AGA K QA+AL
Sbjct  328   MLIGDGPTKTKITGKKNFADGFV--LFKTATVSIFGHNFIAKDIGFENSAGAEKHQAIAL  385

Query  2176  RISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKP  1997
              + +D +V +NCH+N YQDTLY HSYRQFYR CT+SGT+DFIFGNA  VFQ+CK++ RKP
Sbjct  386   LVQSDKSVFYNCHINGYQDTLYAHSYRQFYRHCTVSGTIDFIFGNAAAVFQNCKLVIRKP  445

Query  1996  LEGQACMVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1817
             LE + C++TAQ R+  R     ++Q+C I+A+P        +K FLG PWK+FSRT+IM 
Sbjct  446   LEDEGCVITAQARQHVREPTGFILQNCTIMADPLYYPLRLKSKAFLGHPWKKFSRTIIMQ  505

Query  1816  SFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFT  1637
             SF+ + + PEGW PW G F   +C+++EY+NRGPGA+   RVKW G K+ I+P+ A  FT
Sbjct  506   SFLPDSIAPEGWKPWMGTFGQSSCFFSEYENRGPGAALLGRVKWHGIKK-ITPQQADGFT  564

Query  1636  PGPFLMADEQWLGRAQIPFSPGYV  1565
             P  F   +  W+    +P+ PG +
Sbjct  565   PSKFYQGN-HWIIPTGVPYEPGMM  587



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   335 bits (860),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 217/320 (68%), Gaps = 8/320 (3%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT----VILIKAGVYKEYVIVPSKKNNIVFMG  2345
             ++VVA+DGS  + T+N AL +I  I D++     V+ IK GVY+E V+V S   N++F+G
Sbjct  259   NLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTFVLYIKEGVYEEKVVVNSSLTNLMFLG  318

Query  2344  EGPAKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISA  2165
             +GP KT ITG  N  DG    TY++ TV ++ + F+ RD+  EN+AGA K QAVALR+SA
Sbjct  319   DGPTKTKITGRLNFIDGT--NTYQTATVAIQGDHFIARDIGFENSAGAEKHQAVALRVSA  376

Query  2164  DMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQ  1985
             DM + +NC ++ YQDTLY H+YRQFYR C ISGT+DFIFG++  VFQ C ++ RKPL+ Q
Sbjct  377   DMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISGTIDFIFGDSAAVFQGCSLVVRKPLDNQ  436

Query  1984  ACMVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFID  1805
              C+VTAQGRKD R    +V+Q+C  V +PA       NK +LGRPWKEFSRT+IM S+I 
Sbjct  437   DCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYPVRNTNKAYLGRPWKEFSRTIIMESYIS  496

Query  1804  NIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1625
             +     GW PW  +FALDT +YAE+ NRGP ++   RVKW G K  +  +  K+FT   F
Sbjct  497   DSFQAAGWLPWFEDFALDTLFYAEFNNRGPSSNKTDRVKWHGIKE-LPAKRVKRFTADEF  555

Query  1624  LMADEQWLGRAQIPFSPGYV  1565
             L   E+W+ R ++P+  G++
Sbjct  556   LDG-ERWIPRTKVPYDGGFI  574



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   325 bits (832),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 216/313 (69%), Gaps = 3/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS ++K+IN AL ++P  N    VI IK GVYKE V+V  +  ++ F+G+GP 
Sbjct  59    NVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPT  118

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N   G V  TY + ++TVE + FV +++ IENTAG    QA ALR+SAD  V
Sbjct  119   KTKITGSVNFGIGKVR-TYLTSSLTVEGDNFVAKNMGIENTAGPPGGQAAALRVSADCVV  177

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             + NC ++ YQDTLY HS+RQFYR  TISGTVDFIFG++  +FQ+C ++ RKP+ GQ CMV
Sbjct  178   IFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMV  237

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R   AIV+ +C I+ EPA       NK +LGRPWKEF+RT++M + I +++ 
Sbjct  238   TAQGRTDVREPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVID  297

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GWS W G+FAL T +YAEY+N GPG++  +RVKW G +R   P+ A  F PG FL + 
Sbjct  298   PAGWSAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFL-SG  355

Query  1612  EQWLGRAQIPFSP  1574
               W+ +  +P+ P
Sbjct  356   GSWIPQTGVPYLP  368



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   331 bits (849),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 213/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VV++ G  K+KTIN AL  IP  N+ +  VI +K GVY E+V       N++ +G+GP
Sbjct  261   DVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFDKHMTNVMLIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KTVITG KN ADG    TY++ TV V  + F+ +D+  ENTAGA+  QAVALR+ +D++
Sbjct  321   TKTVITGRKNYADGT--QTYQTATVAVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLS  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  379   IFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GR D R  +A+++Q+C I  E         NK +LGRPW   +R ++M S ID+++
Sbjct  439   VTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRPWTSLARAIVMQSQIDDVI  496

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G    +TCW+ E+ NRG GA   KRV W G K+ ++PE A  FT G F+  
Sbjct  497   APEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK-LTPEQAADFTAGKFIFG  555

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  556   D-RWILPSGVPYVAGMM  571



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   332 bits (850),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 213/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VV++ G  K+KTIN AL  IP  N+ +  VI +K GVY E+V       N++ +G+GP
Sbjct  264   DVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFDKHMTNVMLIGDGP  323

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KTVITG KN ADG    TY++ TV V  + F+ +D+  ENTAGA+  QAVALR+ +D++
Sbjct  324   TKTVITGRKNYADGT--QTYQTATVAVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLS  381

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  382   IFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  441

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GR D R  +A+++Q+C I  E         NK +LGRPW   +R ++M S ID+++
Sbjct  442   VTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRPWTSLARAIVMQSQIDDVI  499

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G    +TCW+ E+ NRG GA   KRV W G K+ ++PE A  FT G F+  
Sbjct  500   APEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK-LTPEQAADFTAGKFIFG  558

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  559   D-RWILPSGVPYVAGMM  574



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   332 bits (850),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 212/322 (66%), Gaps = 16/322 (5%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS +FK+INAAL ++P  N    VI IK G+YKE V V    + + F+G+GP KT
Sbjct  261   VVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKT  320

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGN N   G V  TY++ TV V  E F  +D+  ENTAG    QAVALR+SAD AV H
Sbjct  321   RITGNLNFGMGKVK-TYQTATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFH  379

Query  2146  NCHLNAY-------------QDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIA  2006
             NC ++ Y             QDTLY HS+RQFYR CTISGT+D+IFG+A   FQ+C M+ 
Sbjct  380   NCQIDGYVDSFYANCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVV  439

Query  2005  RKPLEGQACMVTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1826
             RKP+ GQ+CMVTAQGR D+R    IV+ +C I  +PA       NK +LGRPWK+FSRT+
Sbjct  440   RKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTI  499

Query  1825  IMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAK  1646
             IM + I++I+ P+GW  W GNFALDT  YAE++N+GPG++   RVKW G K+  +P  A 
Sbjct  500   IMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAG  558

Query  1645  QFTPGPFLMADEQWLGRAQIPF  1580
             +FT G FL     W+ + Q+P+
Sbjct  559   EFTAGKFLQGG-TWIPQTQVPY  579



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   332 bits (852),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 209/314 (67%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++AA+ + P  + +R +I IKAGVYKE V V  KK NI+F+G+G +
Sbjct  300   DVVVAADGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGVYKENVEVGKKKTNIMFLGDGRS  359

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+KNV DG    T+ S TV V  E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  360   NTIITGSKNVVDGST--TFNSATVAVVGEKFIARDITFQNTAGPSKHQAVALRVGSDLSA  417

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ C + AR+P  GQ  M+
Sbjct  418   FYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNAAAVFQDCDIHARRPNSGQKNML  477

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+A     K +LGRPWKE+SRT++M + I N++ 
Sbjct  478   TAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSRTVVMQTSITNVID  537

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +Y EY+N G GA T KRV WKG+K   S   A+ FTPG F+ A 
Sbjct  538   PAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASEAQGFTPGTFI-AG  596

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    P+S G
Sbjct  597   SSWLGSTGFPYSLG  610



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   334 bits (856),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 218/327 (67%), Gaps = 4/327 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL  +P   +   V+ IKAG+YKEYV V    +++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNKN  DG+    Y++ TV +    F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  315   KTIISGNKNYKDGITA--YRTATVAIVGNYFIAKNIGFENTAGAIKHQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQ+TLYTHS+RQF+R CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + V 
Sbjct  433   TAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +S E   +FTP  ++  D
Sbjct  493   PQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV*NKQAIMRESP  1532
             + W+    +P++ G +    A    +P
Sbjct  552   D-WIPGKGVPYTTGLLAGNPAAATTTP  577



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   331 bits (848),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 217/316 (69%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS ++KTIN A+  IP   +   VI IK G+YK+ V +    ++I+ +G+G  
Sbjct  256   DIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQQVTISRSLSHIMMIGDGAT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N A GV   T+K+ TV+V    F+ +D+  ENTAGA+  QAVALR+ +DM++
Sbjct  316   KTKITGDLNYAAGV--QTFKTSTVSVSGSHFIAKDIGFENTAGAIGHQAVALRVQSDMSI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTI+GT+DFIFG+A  VFQ+CK++ RKPLE Q C+V
Sbjct  374   FYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCIV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R A   V+Q+C+I A+         NK +LGRPWKE+SRT+ M   ID+++ 
Sbjct  434   TAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLID  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+FALDT  Y+EY+NRGPG+ T  RV WKG K+ +S + A  FT   F+  D
Sbjct  494   PKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSAQDADAFTVAKFIGGD  552

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    I ++ G +
Sbjct  553   -LWIPDTGISYASGMM  567



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   331 bits (848),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 216/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  AL+ +P  N    VI IK G+YKE V+V  K   + F+G+GP KT
Sbjct  261   VVAQDGSGQFKTITDALNGVPKGNTVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGPNKT  320

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VITG+ N   G V  T+ + T+TVE + F  +++ IENTAG    QAVALR+SAD AV H
Sbjct  321   VITGSLNFGIGKVK-TFLTATITVEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFH  379

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP +GQ+CMVTA
Sbjct  380   SCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQSCMVTA  439

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R +  +V+  C I  +PA       NK +LGRPWKEFSRT+IM + ID+++ P 
Sbjct  440   QGRSNVRESTGLVLHGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPA  499

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPG++  +RVKW G K+ ++P+ A  +T   FL  D  
Sbjct  500   GWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRGD-T  557

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  558   WIPQTQVPYT  567



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   332 bits (851),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 217/321 (68%), Gaps = 4/321 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D VVA+DGS  +KTI+ AL+ +P   +   VI IK GVY E V V     N++ +G+G  
Sbjct  280   DAVVAKDGSGSYKTISEALEHVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGTN  339

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN+N  DG    TY++ TV +  + F+  D+  +N+AG  K QAVALR+SAD A+
Sbjct  340   KTRITGNQNFVDGT--PTYRTATVAIHGDHFMAMDIGFDNSAGPEKHQAVALRVSADEAI  397

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH++RQFYR CTISGT+DF+FG+A  +FQ+C  + RKPL  Q+C+V
Sbjct  398   FYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVRKPLPDQSCIV  457

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+RR  +AIVIQ+  I A+P        N+ +LGRPWKE+SRT+IM S+ID+++ 
Sbjct  458   TAQGRKERRQPSAIVIQNSTITADPDYFPVKNVNRAYLGRPWKEYSRTIIMESYIDDVIQ  517

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W G + L TC+Y E+ N GP A+  +RV W+G K+ I+   A QFTPG F   D
Sbjct  518   PEGWLAWAGQWGLRTCFYTEFCNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGD  576

Query  1612  EQWLGRAQIPFSPGYV*NKQA  1550
             E W+  + +P  PG   N+++
Sbjct  577   E-WIKLSGVPCVPGLTTNRRS  596



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   331 bits (849),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  FKT++ A+ + P  + +R VI IKAGVYKE V VP KK NI+F+G+G  
Sbjct  278   DVVVAADGSGNFKTVSEAVAAAPLKSSKRYVIKIKAGVYKENVEVPKKKTNIMFLGDGRT  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV +    F+ RD+T +NTAG  K QAVALR+ AD++ 
Sbjct  338   NTIITGSRNVVDG--STTFHSATVAIVGGNFLARDITFQNTAGPAKHQAVALRVGADLSA  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY H+ RQF+  C ISGTVDFIFGN+ VVFQ+C + AR+P  GQ  MV
Sbjct  396   FYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNSAVVFQNCDIHARRPNSGQKNMV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT+ M S I +++ 
Sbjct  456   TAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTYLGRPWKEYSRTVFMQSSISDVID  515

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T  Y EY+N GPGA T KRV WKG+K   S   A+ FTPG F+   
Sbjct  516   PVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWKGFKVITSAAEAQSFTPGNFI-GG  574

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  575   SSWLGSTGFPFSLG  588



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   330 bits (847),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 209/314 (67%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  + T++ A+ + P  + +R +I IKAGVY+E V VP KK NI+ +G+G  
Sbjct  265   DVTVAADGSGHYTTVSEAVAAAPEKSHKRYIIRIKAGVYRENVNVPKKKTNIMMVGDGRI  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG ++V DG    T++S +V    EGF+ RD+T +NTAG  K+QAVALR+ +D + 
Sbjct  325   NTIITGRRSVVDG--STTFRSASVAAVGEGFLARDITFQNTAGPSKDQAVALRVGSDKSA  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C++ AYQDTLY HS RQFY    I GTVDFIFGNA  +FQ+C + AR+P  GQ  MV
Sbjct  383   FYRCNIIAYQDTLYVHSLRQFYVDSLIVGTVDFIFGNAAAIFQNCDIHARRPNRGQKNMV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      I+IQ C I A   LK        +LGRPWKE+SRT+IM SFI +++ 
Sbjct  443   TAQGRDDPNQNTGIIIQKCRIGATSDLKPVKRSFPTYLGRPWKEYSRTVIMQSFITDVIH  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W GNFAL+T +Y EY+N G GA+T KRVKWKGYK   S  VA+QFT   F++ D
Sbjct  503   PEGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWKGYKVITSATVAQQFTVKNFILGD  562

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  563   -HWLGSTGFPFSAG  575



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 204/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  +KT++ A+ + P  +  R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  8     NVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIMFLGDGRT  67

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT +KNV DG    T+ S TV     GF+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  68    STIITASKNVQDGST--TFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVGSDLSA  125

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQF+  C I+GTVDFIFGNA VV Q C + AR+P  GQ  MV
Sbjct  126   FYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSGQKNMV  185

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+        +LGRPWKE+SRT++M S I N++ 
Sbjct  186   TAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVIN  245

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW GNFALDT +Y EY+N G GA+T  RV WKG+K   S   A+ FTPG F+ A 
Sbjct  246   PAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFI-AG  304

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  305   GSWLKATTFPFSLG  318



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   330 bits (846),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT++ A+   P  + +R +I IKAGVY+E V VP KK+NI+F+G+G  
Sbjct  271   NVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG++NV DG    T+ S TV    E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  331   KTIITGSRNVVDG--STTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ+C + ARKP  GQ  MV
Sbjct  389   FYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQ  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ A 
Sbjct  509   PAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  568   GSWLSSTGFPFALG  581



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   321 bits (823),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 204/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  +KT++ A+ + P  +  R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  8     NVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIMFLGDGRT  67

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT +KNV DG    T+ S TV     GF+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  68    STIITASKNVQDGST--TFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVGSDLSA  125

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQF+  C I+GTVDFIFGNA VV Q C + AR+P  GQ  MV
Sbjct  126   FYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSGQKNMV  185

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+        +LGRPWKE+SRT++M S I N++ 
Sbjct  186   TAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVIN  245

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW GNFALDT +Y EY+N G GA+T  RV WKG+K   S   A+ FTPG F+ A 
Sbjct  246   PAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFI-AG  304

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  305   GSWLKATTFPFSLG  318



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   333 bits (855),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 216/314 (69%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTIN AL ++P   +   V+ IK G+YKEYV V     ++VF+G+GP 
Sbjct  253   DMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIKEGIYKEYVQVNRSMPDLVFIGDGPD  312

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTV++G+K+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  313   KTVLSGDKSFKDGIT--TYRTATVGIIGDHFIAKNMGFENTAGAIKHQAVAIRVLSDESI  370

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  371   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  430

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R +   V+Q C I  E    A    +K +LGRPWKE+S+T+IM +FI + V 
Sbjct  431   TAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFVP  490

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              +GW PW+GNF LDT +Y+E +N GPGA    RV W G K+ +S E   +FTP  ++  D
Sbjct  491   AQGWQPWQGNFGLDTLFYSEVRNTGPGAPVTNRVTWPGIKK-LSEEEVLEFTPSRYIQGD  549

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P++PG
Sbjct  550   A-WIPGKGVPYTPG  562



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   330 bits (845),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  +KT++ A+ + P  +++R +I IKAGVYKE V V  KK NI+F+G+G  
Sbjct  269   DVTVASDGSGNYKTVSEAVAAAPINSNKRYIIRIKAGVYKENVDVSKKKKNIMFVGDGRK  328

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    EGF+ RD+T +NTAG  K QAVALR+ +D + 
Sbjct  329   NTIITGSRNVVDGST--TFHSATVAAVGEGFLARDITFQNTAGPSKHQAVALRVGSDKSA  386

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY  C I GTVDFIFGNA  VFQ+C + AR+P  GQ  M+
Sbjct  387   FYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDFIFGNAAAVFQNCDIHARRPNSGQKNML  446

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ+C I A   L+A       +LGRPWKE+SRT+IM S I +++ 
Sbjct  447   TAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSSFPTYLGRPWKEYSRTVIMQSTISDVIH  506

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL T +YAEY+N GPGA+T  RV WKGYK   S   A +FT   F+ A 
Sbjct  507   PAGWHEWSGNFALTTLYYAEYQNTGPGAATANRVSWKGYKVITSATEALRFTVSNFI-AG  565

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  566   GSWLGSTGFPFSSG  579



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   329 bits (843),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 216/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVA+DGS ++KTIN A+  IP   +   VI IK G+YKE V +     +I+ +G+G  
Sbjct  256   DIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKEQVTISRSVTHIMMIGDGAT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N A GV   T ++ TV+V    F+ +D+  ENTAGA+  QAVALR+ +DM++
Sbjct  316   KTRITGDLNYAAGV--QTLQTSTVSVSGNHFIAKDIGFENTAGAIGHQAVALRVQSDMSI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTL+ H++RQFYR CTI+GT+DFIFG+A  VFQ+CK++ RKPLE Q C+V
Sbjct  374   FYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCVV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R A   V+Q+C+I A+P        NK +LGRPWKE+SRT+ M   ID+++ 
Sbjct  434   TAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLID  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+FALDT  Y+EY+NRGPG+ T  RV WKG K+ +S + A  FT   F+  D
Sbjct  494   PKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSAQDAAAFTVAKFIGGD  552

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    + ++ G +
Sbjct  553   -LWIPATGVSYASGMM  567



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   328 bits (842),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 216/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDG+ +FKTI  AL+++P  N    +I IK G+YKE V V  K  ++ F+G+GP KT
Sbjct  259   VVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKT  318

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG+ N   G V  T+ + T+T+E + F  +++ IENTAG    QAVALR+SAD AV H
Sbjct  319   LITGSLNFGIGKVK-TFLTATITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFH  377

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP +GQ CMVTA
Sbjct  378   SCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQTCMVTA  437

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R +  +V+  C I  +PA       NK +LGRPWKEFSRT+IM + ID+++ P 
Sbjct  438   QGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPA  497

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPG++  +RVKW G K+ ++P+ A  +T   FL  D  
Sbjct  498   GWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRGD-T  555

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  556   WIPQTQVPYT  565



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   328 bits (842),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 217/313 (69%), Gaps = 3/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS ++K+IN AL ++P  N    VI IK GVYKE V+V  +  ++ F+G+GP 
Sbjct  258   NVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N A G V  TY + ++TVE + FV +++ IENTAG    QAVALR+SAD  V
Sbjct  318   KTKITGSVNFAIGKVR-TYLTSSLTVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             + NC ++ YQDTLY HS+RQFYR  TISGTVDFIFG++  +FQ+C ++ RKP+ GQ CMV
Sbjct  377   IFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R   AIV+ +C I+ EPA       NK +LGRPWKEF+RT++M + I +++ 
Sbjct  437   TAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVID  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW+ W G+FAL T +YAEY+N GPG++  +RVKW G +R   P+ A  F PG FL   
Sbjct  497   PAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGG  555

Query  1612  EQWLGRAQIPFSP  1574
               W+ +  +P+ P
Sbjct  556   S-WIPQTGVPYLP  567



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   328 bits (842),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 217/313 (69%), Gaps = 3/313 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS ++K+IN AL ++P  N    VI IK GVYKE V+V  +  ++ F+G+GP 
Sbjct  258   NVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPT  317

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N A G V  TY + ++TVE + FV +++ IENTAG    QAVALR+SAD  V
Sbjct  318   KTKITGSVNFAIGKVR-TYLTSSLTVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVV  376

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             + NC ++ YQDTLY HS+RQFYR  TISGTVDFIFG++  +FQ+C ++ RKP+ GQ CMV
Sbjct  377   IFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMV  436

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D R   AIV+ +C I+ EPA       NK +LGRPWKEF+RT++M + I +++ 
Sbjct  437   TAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVID  496

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW+ W G+FAL T +YAEY+N GPG++  +RVKW G +R   P+ A  F PG FL   
Sbjct  497   PAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGG  555

Query  1612  EQWLGRAQIPFSP  1574
               W+ +  +P+ P
Sbjct  556   S-WIPQTGVPYLP  567



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   328 bits (841),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 207/315 (66%), Gaps = 3/315 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT+ AA+ + P  + +R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  253   NVVVAADGSGDFKTVAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRM  312

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+KNV DG    T++S TV    E F+ RD+T +NTAG  K QAVALR+ +D + 
Sbjct  313   KTIITGSKNVKDGST--TFRSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSA  370

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFYR C I GTVDFIFGNA  V Q+C ++AR+P  GQ  MV
Sbjct  371   FYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNAAAVLQNCDILARRPNSGQKNMV  430

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D      I I  C I A+  L         +LGRPWKE+SRT+IM S I +++ 
Sbjct  431   TAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRTVIMQSTISDVIN  490

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +Y EY+N G GA T  RVKWKGYK   S   AKQFT G F+   
Sbjct  491   PAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEAKQFTVGDFINGG  550

Query  1612  EQWLGRAQIPFSPGY  1568
               WLG    PF+ G+
Sbjct  551   -SWLGSTGFPFTAGF  564



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   329 bits (843),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT++ A+   P  + +R +I IKAGVY+E V VP KK+NI+F+G+G  
Sbjct  271   NVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG++NV DG    T+ S TV V  E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  331   KTIITGSRNVVDG--STTFHSATVAVVGEKFLARDITFQNTAGPSKHQAVALRVGSDLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY HS RQFY  C ++GTVDFIF NA  VFQ+C + ARKP  GQ  MV
Sbjct  389   FYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFENAAAVFQNCDIHARKPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQ  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ A 
Sbjct  509   PAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  568   GSWLSSTGFPFALG  581



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   328 bits (841),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 216/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDG+ +FKTI  AL+++P  N    +I IK G+YKE V V  K  ++ F+G+GP KT
Sbjct  259   VVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKT  318

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG+ N   G V  T+ + T+T+E + F  +++ IENTAG    QAVALR+SAD AV H
Sbjct  319   LITGSLNFGIGKVK-TFLTATITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFH  377

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP +GQ CMVTA
Sbjct  378   SCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQTCMVTA  437

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R +  +V+  C I  +PA       NK +LGRPWKEFSRT+IM + ID+++ P 
Sbjct  438   QGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPA  497

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPG++  +RVKW G K+ ++P+ A  +T   FL  D  
Sbjct  498   GWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRGD-T  555

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  556   WIPQTQVPYT  565



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   328 bits (841),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 216/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDG+ +FKTI  AL+++P  N    +I IK G+YKE V V  K  ++ F+G+GP KT
Sbjct  253   VVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKT  312

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG+ N   G V  T+ + T+T+E + F  +++ IENTAG    QAVALR+SAD AV H
Sbjct  313   LITGSLNFGIGKVK-TFLTATITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFH  371

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP +GQ CMVTA
Sbjct  372   SCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQTCMVTA  431

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R +  +V+  C I  +PA       NK +LGRPWKEFSRT+IM + ID+++ P 
Sbjct  432   QGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPA  491

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPG++  +RVKW G K+ ++P+ A  +T   FL  D  
Sbjct  492   GWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRGD-T  549

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  550   WIPQTQVPYT  559



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   332 bits (852),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL  +P   +   V+ IKAG+Y+EYV +     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPE  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAG  K QAVA+R+ +D ++
Sbjct  315   KTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSRT+IM SF+ + V 
Sbjct  433   TAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  + E+ K FTP  F+   
Sbjct  493   PQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   328 bits (842),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT++ A+   P  + +R +I IKAGVY E V VP KK+NI+F+G+G  
Sbjct  271   NVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPKKKSNIMFIGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG++NV DG    T+ S TV    E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  331   KTIITGSRNVVDG--STTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ+C + ARKP  GQ  MV
Sbjct  389   FYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQ  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ A 
Sbjct  509   PAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  568   GSWLSSTGFPFALG  581



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   331 bits (849),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+G  
Sbjct  255   DIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGAD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVALR+ +D A+
Sbjct  315   KTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAGAIKHQAVALRVQSDEAI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  433   TAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +S E    FTP  ++  D
Sbjct  493   PQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   328 bits (840),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 216/317 (68%), Gaps = 9/317 (3%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D++VA+DGS K+KT+N AL  IP  N  +T VI IK GVY E V++     N++F+G+GP
Sbjct  257   DVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGVYSEQVVLDKHMTNVMFIGDGP  316

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT ITGNKN ADGV   T+K+ TV V  + F+ +D+  ENTAGA   QAVALR+ +D++
Sbjct  317   TKTKITGNKNYADGV--QTFKTATVAVIGDYFIAKDIGFENTAGARGHQAVALRVQSDLS  374

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC ++ YQDTLYT ++RQFYR C ISGT+DFIFG+A  VFQ+CKMI RKP   Q+CM
Sbjct  375   IFYNCQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDAAAVFQNCKMIVRKPGPNQSCM  434

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGR D+R    IV+Q+C I  E    AA      +LGRPWK +SRT++M S IDN++
Sbjct  435   VTAQGRLDKREPTGIVLQNCTISGEKGFDAAT--TMAYLGRPWKMYSRTIVMQSQIDNVI  492

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              P GW  W G    +T W+ E+ NRG GA+T++RVKW  YK   +PE A  F PG  L+ 
Sbjct  493   NPLGWMEWTGTTNHETSWFGEFSNRGLGAATNQRVKW--YKL-ATPEEAGAFAPGSILLG  549

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  550   D-KWIMPSGVPYVAGMM  565



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   322 bits (825),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  F+T++AA+ + P    RR VI IKAGVY+E V +P +K N++F+G+G  
Sbjct  87    DVTVAADGSGNFRTVSAAVAAAPEGRSRRYVIRIKAGVYRENVEIPRRKTNLMFVGDGRM  146

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITGN+NV DG    T+ S TV V  + F+ RD+T +N+AG  K QAVALR++AD+  
Sbjct  147   TTIITGNRNVVDGST--TFNSATVAVVGDRFLARDITFQNSAGPSKHQAVALRVNADLCA  204

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C++ AYQDTLY HS RQFY GC I GT+DFIFGNA VV Q+C + AR+P   Q  MV
Sbjct  205   FYRCNMLAYQDTLYVHSLRQFYTGCNIVGTIDFIFGNAAVVLQNCDIQARRPNPRQRNMV  264

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   LK        +LGRPWK++SRT++M + I N++ 
Sbjct  265   TAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKKYSRTIVMQTDISNVIN  324

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +YAEY+NRG GA T  RV W+G++   S   A+ FT G F+ A 
Sbjct  325   PAGWYEWDGNFALNTLFYAEYQNRGAGARTSNRVTWRGFRVLTSAAEAQPFTAGRFI-AG  383

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  384   GNWLGATGFPFSLG  397



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   332 bits (851),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL  +P   +   V+ IKAG+Y+EYV +     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPE  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAG  K QAVA+R+ +D ++
Sbjct  315   KTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSRT+IM SF+ + V 
Sbjct  433   TAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  + E+ K FTP  F+   
Sbjct  493   PQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   328 bits (840),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 204/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  +KT+  A+ S P  + +R +I IKAGVYKE V VP KK NI+F+G+G  
Sbjct  267   DVTVAADGSGNYKTVGEAVASAPERSSKRYIIRIKAGVYKENVEVPKKKTNIMFVGDGRT  326

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV V  +GF+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  327   NTIITASRNVVDGST--TFHSATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGSDLSA  384

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQF+ GC ++GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  385   FYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNAAAVLQDCDIHARRPNSGQRNMV  444

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   LK        +LGRPWKE+SRT++M + I +++ 
Sbjct  445   TAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVVMQTSISDVIN  504

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW GNFALDT +YAEY+N G GA T KRV WKG+K   S   A+ FT G F+   
Sbjct  505   PAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASEAQAFTAGSFI-GG  563

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  564   SSWLPSTGFPFSLG  577



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   327 bits (838),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 205/297 (69%), Gaps = 2/297 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K+KT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  236   NVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  295

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              TVITG+ NV DG    T++S T+    +GF+ +DL I+NTAG  K QAVALR+SAD  V
Sbjct  296   ATVITGSLNVVDG--STTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  353

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  MV
Sbjct  354   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  413

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       K FLGRPWK +SRT+IM +FIDN V 
Sbjct  414   TAQGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHVD  473

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             P GW PW G FAL T +Y EY N GPGA T KRVKWKG+K   + + A+QFT    +
Sbjct  474   PAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRNSKEAEQFTVAKLI  530



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   332 bits (852),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++KTIN AL  +P   +   V+ IKAG+Y+EYV +     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPE  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+G+KN  DG+   TY++ TV +  + F+ +++   NTAG  K QAVA+R+ +D ++
Sbjct  315   KTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSRT+IM SF+ + V 
Sbjct  433   TAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  + E+ K FTP  F+   
Sbjct  493   PQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   327 bits (837),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 204/297 (69%), Gaps = 2/297 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS KFKT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  239   NVVVAKDGSGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  298

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S T+    +GF+ +DL I+NTAG  K QAVALR+SAD  V
Sbjct  299   ATIITGSLNVVDG--STTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  356

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  MV
Sbjct  357   INRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  416

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       K FLGRPWK +SRT+IM +FIDN + 
Sbjct  417   TAQGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHID  476

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             P GW PW G FAL T +Y EY N GPGA T KRVKWKG+K     + A+QFT    +
Sbjct  477   PAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLI  533



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   327 bits (839),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT++ A+   P  + +R  I IKAGVY+E V VP KK++I+F+G+G  
Sbjct  271   NVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPKKKSSIMFIGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG++NV DG    T+ S TV V  E F+ R++T +NTAG  K QAVALR+ +D++ 
Sbjct  331   KTIITGSRNVVDG--STTFHSATVAVVGEKFLAREITFQNTAGPSKHQAVALRVGSDLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ+C + ARKP  GQ  MV
Sbjct  389   FYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDVIQ  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ A 
Sbjct  509   PAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  568   GSWLSSTGFPFALG  581



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   327 bits (839),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 210/312 (67%), Gaps = 4/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D VV++DGS  +KTI  AL+ +P   +   VI IK GVY E V V     N++ +G+G  
Sbjct  278   DAVVSKDGSGSYKTICEALEHVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGAN  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN N  DG    TY++  V +  + F+  D+  EN+AG  K QAVALR+SAD A+
Sbjct  338   KTRITGNHNFVDGT--PTYRTAAVAIHGDHFMAMDIGFENSAGPEKHQAVALRVSADEAI  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLYTH++RQFYR CTISGT+DF+FG+A  +FQ+C  +  KPL  Q+C+V
Sbjct  396   FYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVHKPLPDQSCIV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+ R  +AIVIQ+  I A+P        NK +LGRPWKE+SRT+IM S+ID+++ 
Sbjct  456   TAQGRKEGRQPSAIVIQNSTITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQ  515

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW G + L TC+Y E++N GP A+  +RV W+G K+ I+   A QFTPG F   D
Sbjct  516   PEGWLPWAGQWGLRTCFYTEFRNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGD  574

Query  1612  EQWLGRAQIPFS  1577
             E W+  + +P+S
Sbjct  575   E-WIKLSGVPYS  585



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   327 bits (837),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDG+ K+KTI  AL  +P  ++   VI IK GVYKE +I+  +  N+  +G+GP 
Sbjct  250   NVVVAQDGTGKYKTITEALKEVPKKSNETFVIYIKEGVYKEQIIIDRQMTNVFMIGDGPT  309

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+GNKN ADG    T  + T     + FV +D+  ENTAG +K QAVALR+ +D ++
Sbjct  310   KTKISGNKNKADGT--ATMHTATFAAVGDYFVAKDIRFENTAGHIKHQAVALRVQSDFSI  367

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++AYQDTLYT +YRQ+YR CTI+GTVDFIFG+   +FQ+CKM+ RKP + Q+CMV
Sbjct  368   FYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKPGDSQSCMV  427

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+    AIV+Q+C I  EP   A    NK +LGRPWK+F+R ++M S ID  + 
Sbjct  428   TAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMQSQIDEAIQ  487

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W G+   +TC+  EY N+GP A   +RVKW   K+ ++ + A  FTP      D
Sbjct  488   PEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQRVKWPSLKK-LTADQAATFTPAKLFEGD  546

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+  G V
Sbjct  547   -RWIKPSGVPYVSGMV  561



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   327 bits (837),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 212/312 (68%), Gaps = 4/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS +FKTI AAL + P     R +I +KAGVY EYV V   + N+   G+GP KT
Sbjct  256   VVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQVNVFMYGDGPRKT  315

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TG+K+ ADG+   T  + T      GF+ + +  +NTAGA K QAVALR+ ++M+   
Sbjct  316   MVTGSKSFADGIT--TQNTATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFF  373

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++P + Q+  +I RKP++ Q   VTA
Sbjct  374   NCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTA  433

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+DRR   AIVIQ+C IV E  L         +LGRPWK ++RT+IM S + + + P 
Sbjct  434   QGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPA  493

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW GNFALDT +YAEY NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +
Sbjct  494   GWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV-INRNDAVQFTAGPFLLAD-R  551

Query  1606  WLGRAQIPFSPG  1571
             WL    IP+  G
Sbjct  552   WLKTTGIPYFAG  563



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   327 bits (839),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 202/314 (64%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  FKT+  A+D+ P  + +R VI IKAGVY+E V VP KKNNI+F+G+G  
Sbjct  287   DVTVAADGSGDFKTVTEAVDAAPLKSSKRFVIRIKAGVYRENVEVPKKKNNIMFLGDGRT  346

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV V    F+ RDLT +NTAG  K QAVALR+  D++ 
Sbjct  347   NTIITASRNVVDGST--TFHSATVAVVGSNFLARDLTFQNTAGPSKHQAVALRVGGDLSA  404

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC + A+QDTLY H+ RQF+  C I+GTVDFIFGN+ VVFQ C + AR P  GQ  MV
Sbjct  405   FFNCDILAFQDTLYVHNNRQFFVKCLIAGTVDFIFGNSAVVFQDCDIHARLPSSGQKNMV  464

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L++     K +LGRPWKE+SRT+IM S I +++ 
Sbjct  465   TAQGRVDPNQNTGIVIQKCRIGATNDLESVKKNFKTYLGRPWKEYSRTVIMQSSISDVID  524

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNF L T  Y EY+N GPGA T  RV WKGYK       A+++TPG F+   
Sbjct  525   PIGWHEWSGNFGLSTLVYREYQNTGPGAGTSNRVTWKGYKVITDTAEAREYTPGSFI-GG  583

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  584   SSWLGSTGFPFSLG  597



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   330 bits (845),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+YKEYV V     ++VF+G+G  
Sbjct  255   DIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGAD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVALR+ +D A+
Sbjct  315   KTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAGAIKHQAVALRVQSDEAI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+S+T+IM +FI + + 
Sbjct  433   TAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +S E    FTP  ++  D
Sbjct  493   PQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   326 bits (836),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 204/295 (69%), Gaps = 2/295 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FK+I  A+D++P  N  R VI +KAG+Y E V++P  K NI   G+GP KT
Sbjct  252   VVAQDGSGQFKSIQQAVDAMPKGNTGRYVIYVKAGLYNEMVMIPKDKVNIFMYGDGPKKT  311

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              +TG K+ ADG+   T K+ T ++EA GF+C+++   NTAGA + QAVALR+  D+A  +
Sbjct  312   RVTGRKSFADGIT--TMKTATFSIEASGFICKNMGFHNTAGAERHQAVALRVQGDLAAFY  369

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC  +A+QDTLY H+ RQF+R C ISGT+DFIFGN+  VFQ+C +I R+P++ Q   VTA
Sbjct  370   NCRFDAFQDTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTA  429

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
              GR D    + +VIQ+C +V +  L         +LGRPWKEFSR +IM S I + + PE
Sbjct  430   HGRTDPNMKSGLVIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFIKPE  489

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             G+ PW G+F L T +YAEY NRGPGA T +RVKW GY+  I+ + A+QFT GPF+
Sbjct  490   GYMPWNGDFGLKTLYYAEYNNRGPGAGTSQRVKWPGYRGVITRQEAEQFTAGPFI  544



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   326 bits (836),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 214/312 (69%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTIN AL+++P  N    VI IK GVYKE V+V  K   + F+G+GP KT
Sbjct  250   VVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVVTRKMPYVTFIGDGPTKT  309

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VI+G+ N   G V  TY +  +TVE E F  + + +ENTAG    QAVALR+S D AV  
Sbjct  310   VISGSLNFGIGKVK-TYLTAPLTVEGEHFTAKGIGMENTAGPEGGQAVALRVSGDYAVFF  368

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG++  + Q+CK++ RKP+ GQ+CMVTA
Sbjct  369   DCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPMAGQSCMVTA  428

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R    IV+ +C IV +PA       +K +LGRPWKEFSRT+++ + +D+++ P 
Sbjct  429   QGRSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVIKTTVDDVIDPA  488

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPGA+  +RVKW G K+ ++ E A  +T   FL  +  
Sbjct  489   GWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTHEQALSYTCDRFLSGN-T  546

Query  1606  WLGRAQIPFSPG  1571
             W+ R Q+P++ G
Sbjct  547   WIPRTQVPYTAG  558



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   327 bits (838),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  FKT+ A++ + P    +R +I IKAGVY+E V V  K  NI+F+G+G  
Sbjct  273   NVVVAADGSGNFKTVAASVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRT  332

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             +T+ITG++NV DG    T+KS TV V  EGF+ RD+T +NTAG  K QAVALR+ AD++ 
Sbjct  333   RTIITGSRNVVDGST--TFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSA  390

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC + AYQDTLY HS RQF+  C I+GTVDFIFGNA  V Q+C + ARKP  GQ  MV
Sbjct  391   FYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMV  450

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   LK        +LGRPWKE+SRT+IM S I +++ 
Sbjct  451   TAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDVIH  510

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +Y E++N G GA T  RVKWKG++   S   A+ FTPG F+ A 
Sbjct  511   PAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI-AG  569

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  570   SSWLGSTGFPFSLG  583



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   326 bits (835),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/297 (53%), Positives = 204/297 (69%), Gaps = 2/297 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K+KT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  236   NVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  295

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S T+    +GF+ +DL I+NTAG  K QAVALR+SAD  V
Sbjct  296   ATIITGSLNVVDG--STTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  353

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  MV
Sbjct  354   INRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  413

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       K FLGRPWK +SRT+IM +FIDN + 
Sbjct  414   TAQGREDQNQNTAISIQRCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQTFIDNHID  473

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             P GW PW G FAL T +Y EY N GPGA T KRVKWKG+K     + A+QFT    +
Sbjct  474   PAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLI  530



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 206/316 (65%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ K+KTIN AL  +P  ++   VI IK G+Y+E VIV  +  N+V +G+GP 
Sbjct  75    NVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVIVDKEMTNVVMIGDGPT  134

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I+G+K+ ADG+   T  + T       FV + +  ENTAG VK QAVALR+ +D ++
Sbjct  135   MTRISGSKSHADGIT--TMNTATFAAVGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSI  192

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +FQ+CKM+ RKP E QACMV
Sbjct  193   FFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKPGEAQACMV  252

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR DR     I +Q+C I  EP   A    NK +LGRPWK+F+R ++M S ID  + 
Sbjct  253   TAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAIA  312

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+ W G      C++ EY NRGP     +RVKW   KR ++P+ A  FTP      D
Sbjct  313   PEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPDQAAAFTPARVFEGD  371

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+ PG +
Sbjct  372   -KWVKPSGVPYVPGMM  386



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   327 bits (837),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 213/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS ++KTIN A+ +IP   +   V+ IK GVYKE V       +I+ +G+GP 
Sbjct  266   NMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVVTFSRSLTHIMLIGDGPT  325

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ + A GV    YK+ TV+V    F+ +D+  EN+AGA   QA+AL++ +DM+V
Sbjct  326   KTKITGDLSFAGGVQ--IYKTATVSVSGSHFMAKDIGFENSAGATGHQAIALKVQSDMSV  383

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQ+TL++H+YRQFYR CTI+GT+DFI G+A  VFQ+CKM+ RKPLE Q C +
Sbjct  384   FYNCQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNCKMVVRKPLENQRCTI  443

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR + R     V+Q+C I AE         +  FLGRPWK +SRT++M S ID+I+ 
Sbjct  444   TAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDIID  503

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW+PW G F +DTC  +EY NRGPGA+   RV WKG  + +SP+ A+ FT G FL  D
Sbjct  504   PKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LSPQDAEAFTAGKFLEGD  562

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++ G +
Sbjct  563   S-WIAATGVPYTSGMM  577



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   326 bits (836),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 213/312 (68%), Gaps = 4/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS +FKTI AAL + P     R +I +KAGVY EYV V   + N+   G+GP  T
Sbjct  257   VVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNT  316

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TG+K+ ADG+   T  + T +    GF+ + +  +NTAGA K QAVALR+ ++M+   
Sbjct  317   MVTGSKSFADGIT--TQNTATFSAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFF  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++P + Q+  +I RKP++ Q   VTA
Sbjct  375   NCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+DRR   AIVIQ+C IV E  L         +LGRPWK ++RT+IM S + + + P 
Sbjct  435   QGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW GNFALDT +YAEY NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +
Sbjct  495   GWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-R  552

Query  1606  WLGRAQIPFSPG  1571
             WL  + IP+  G
Sbjct  553   WLKTSGIPYFAG  564



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   326 bits (836),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  F+T++AA+ + P  + RR VI IKAGVY+E V +P  K N++F+G+G  
Sbjct  256   DVTVAADGSGNFRTVSAAVAAAPGGSSRRYVIRIKAGVYRENVEIPRSKTNLMFVGDGRT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITGN+NV DG    T+ S TV V  + F+ RD+T +NTAG  K QAVALR++AD+  
Sbjct  316   TTIITGNRNVVDGST--TFNSATVAVVGDRFLARDITFQNTAGPSKHQAVALRVNADLCA  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY GC I+GTVDFIFGNA  V Q+C + AR+P  GQ  MV
Sbjct  374   FYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGNAAAVLQNCDIHARRPNAGQRNMV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT++M + I N++ 
Sbjct  434   TAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSRTIVMQTDISNVIN  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +YAEY+N G GA T  RV W+G++   S   A+ FT G F+ A 
Sbjct  494   PAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWRGFRVLTSAAEAQPFTAGRFI-AG  552

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  553   GNWLGATGFPFSLG  566



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   330 bits (845),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN AL  +P   +   V+ IKAG+Y EYV V     ++VF+G+GP 
Sbjct  255   DIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIYNEYVQVNKSMTHLVFIGDGPD  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+I+GNK+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVALR+ +D A+
Sbjct  315   KTIISGNKSYKDGIT--TYRTCTVAIVGDYFIAKNIGFENTAGAIKHQAVALRVQSDEAI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ+C ++ RKPL  QAC +
Sbjct  373   FFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPI  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+S+T+IM +FI + + 
Sbjct  433   TAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQ  492

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +S E    FTP  ++  D
Sbjct  493   PQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD  551

Query  1612  EQWLGRAQIPFSPGYV  1565
               W+    +P++PG +
Sbjct  552   -IWVPGKGVPYTPGLL  566



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   326 bits (835),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS K+KTI  AL  +P  ++   VI IK GVYKE +I+  +  N+  +G+GP 
Sbjct  251   NVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKEGVYKEEIIIDRQMTNVFMIGDGPT  310

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+KN ADG    T  + T     + FV +D+  ENTAG +K QAVALR+ +D ++
Sbjct  311   KTKISGSKNKADGT--ATMHTATFAAVGDYFVAKDIRFENTAGHIKHQAVALRVQSDFSI  368

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++AYQDTLYT +YRQ+YR CTI+GTVDFIFG+   +FQ+CKM+ RKP + Q+CMV
Sbjct  369   FYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKPGDSQSCMV  428

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+    AIV+Q+C I  EP   A    NK +LGRPWK+F+R ++M S ID  + 
Sbjct  429   TAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMNSQIDEAIQ  488

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW  W G+   +TC+  EY NRGP A   +RVKW   K+ ++ + A  FTP      D
Sbjct  489   PEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWPSLKK-LTADQAATFTPAKLFEGD  547

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+  G V
Sbjct  548   -RWIKPSGVPYVSGMV  562



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   326 bits (835),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 211/310 (68%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VV QDGS  FKTI  AL  +P  N    +I IK G+YKE V V  K   + F+G+GP KT
Sbjct  260   VVDQDGSGHFKTITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKT  319

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              ITGN N   G V  T+ + T+T+E E F  +++ IENTAG    QAVALR+SAD AV +
Sbjct  320   KITGNLNFGIGKVK-TFLTSTLTIEGEHFTAKNIGIENTAGPKGGQAVALRVSADYAVFY  378

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG+A  + Q+CK++ RK   GQ+CMVTA
Sbjct  379   SCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKAKRGQSCMVTA  438

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R +  +V+ +C I+ EPA       NK +LGRPWKEFSRT+IM + ID+++ P 
Sbjct  439   QGRSDVRESTGLVLHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPA  498

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PWKG+FAL T +YAE+ N G G++   RVKW G K+ +SPE A  +T G FL+ D  
Sbjct  499   GWLPWKGDFALKTLYYAEHLNAGAGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-T  556

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  557   WIPQTQVPYT  566



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   325 bits (834),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 212/312 (68%), Gaps = 4/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS +FKTI AAL + P     R +I +KAGVY EYV V   + N+   G+GP  T
Sbjct  257   VVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNT  316

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TG+K+ ADG+   T  + T      GF+ + +  +NTAGA K QAVALR+ ++M+   
Sbjct  317   MVTGSKSFADGIT--TQNTATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFF  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++P + Q+  +I RKP++ Q   VTA
Sbjct  375   NCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+DRR   AIVIQ+C IV E  L         +LGRPWK ++RT+IM S + + + P 
Sbjct  435   QGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW GNFALDT +YAEY NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +
Sbjct  495   GWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-R  552

Query  1606  WLGRAQIPFSPG  1571
             WL  + IP+  G
Sbjct  553   WLKTSGIPYFAG  564



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   326 bits (836),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 208/318 (65%), Gaps = 4/318 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA+DGS  +KTIN AL+ +P   + R VI +K GVY E V V  K  N+   G+G  
Sbjct  281   NVTVAKDGSGNYKTINEALEKMPQKYEGRYVIYVKEGVYDETVTVTKKMPNVTMYGDGSQ  340

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++ITGNKN ADGV   T+++       EGF+ + +   NTAG  K QAVA R+ AD A+
Sbjct  341   KSIITGNKNFADGVR--TFQTAPFAALGEGFMAKSMGFRNTAGPEKRQAVAARVQADRAI  398

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC    YQ+TLY  ++RQFY+ C ISGTVDFIFG+A  +FQ+C +  RKPLE Q   V
Sbjct  399   FLNCRFEGYQETLYVQTHRQFYKSCVISGTVDFIFGDAATIFQNCLIYVRKPLENQQNTV  458

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+R    IV+Q+C I+ +  L+      K +LGRPWKEFSRT++M S I++++ 
Sbjct  459   TAQGRTDKRETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIH  518

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK+ I+ E A Q+T GPFL   
Sbjct  519   PDGWTPWEGDFALKTLYYAEYNNKGPGAKTDNRVKWDGYKK-INKEEAMQYTVGPFLKG-  576

Query  1612  EQWLGRAQIPFSPGYV*N  1559
               WL    +P   G   N
Sbjct  577   HAWLKVEGVPVRFGLFEN  594



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   317 bits (811),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 207/314 (66%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS K+KTI  A+ S+P  ++ R VI +K G+YKE V +  KK N++ +G+G  
Sbjct  5     NVVVANDGSGKYKTIKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMD  64

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITGN NV DG    T+ S TV    +GF+ +D+  +NTAGA K QAVALR+ AD +V
Sbjct  65    ATIITGNLNVVDGAT--TFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSV  122

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++A+QDTLYTHS RQFYR C I+GTVDFIFGNA VVFQ+ K+ ARKP  GQ  MV
Sbjct  123   INRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMV  182

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D        IQ+CDI+    L       K +LGRPWK +SRT+ M S I + + 
Sbjct  183   TAQGREDPNQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHID  242

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGWS W G+FAL T +Y EY N+GPGA T KRVKW GY   +S   A +FT G  L+  
Sbjct  243   PEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGY-HILSAAEATKFTVGQ-LIQG  300

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + ++ G
Sbjct  301   GVWLKSTGVAYTEG  314



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   332 bits (850),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 156/315 (50%), Positives = 213/315 (68%), Gaps = 4/315 (1%)
 Frame = -3

Query  2509  IVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAK  2330
             +VVA+DGS KF+TIN AL  IP   D   V+ IK GVY+E V V S   +++F+G+GP K
Sbjct  252   LVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYEERVQVNSSLTHLLFIGDGPTK  311

Query  2329  TVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVV  2150
             T ITG  N  DG    TY++ TV V+ + F+  ++  EN+AG  K QAVALR+SAD A+ 
Sbjct  312   TRITGKLNFIDGT--NTYRTATVAVQGDNFMAVNIGFENSAGPQKHQAVALRVSADKAIF  369

Query  2149  HNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVT  1970
             +NCH++ YQDTLYTH+YRQFYR C ISGT+DFIFG++  VFQ C ++ RKPL+ Q C+VT
Sbjct  370   YNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQGCTLLVRKPLDNQQCIVT  429

Query  1969  AQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVP  1790
             AQGRKD R    +VIQ+C I A+ A        K +LGRPWK++SRT+IM SF+D+++ P
Sbjct  430   AQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWKQYSRTIIMESFLDDLIQP  489

Query  1789  EGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADE  1610
             +GW PW   FAL T +Y E+ NRGP A   +RVKW G  R +     ++FT   FL    
Sbjct  490   QGWLPWNETFALQTLFYTEFNNRGPAAPKSERVKWAGI-RELPSNRIRRFTLEEFLDG-H  547

Query  1609  QWLGRAQIPFSPGYV  1565
             +W+ + ++P + G++
Sbjct  548   RWIPQTKVPHASGFI  562



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   323 bits (828),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  ++T++AA+ + P  + RR VI IKAGVY+E V +P  K N++F+G+G A
Sbjct  182   DVTVAADGSGNYRTVSAAVAAAPERSSRRYVIRIKAGVYRENVEIPKSKTNLMFVGDGQA  241

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV V  +GF+ RDLT +N+AG  K QAVALR++AD++ 
Sbjct  242   TTIITGSRNVVDGST--TFNSATVAVVGDGFLARDLTFQNSAGPSKHQAVALRVNADLSA  299

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              H C + AYQDTLY HS RQFY GC ++GTVDFIFGNA  V Q+C + AR+P  GQ  MV
Sbjct  300   FHRCGMIAYQDTLYVHSLRQFYTGCYVAGTVDFIFGNAAAVLQNCDIHARRPNPGQKNMV  359

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L         +LGRPWKE+SRT++M + I N++ 
Sbjct  360   TAQGRDDPNQNTGIVIQKCRIGATADLVPVQSSFPTYLGRPWKEYSRTVVMQTQISNVIN  419

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +YAEYKN G GA T  RV WKG++   S   A+ FT G F+ + 
Sbjct  420   PAGWFEWDGNFALNTLFYAEYKNTGAGAGTANRVTWKGFRVLKSDAEAQPFTAGRFI-SG  478

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  479   GSWLAATGFPFTLG  492



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   330 bits (846),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 212/314 (68%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             DIVVAQDGS ++ TIN A++ +P   +   V+ IKAG+YKE+V V     ++VF+G+GP 
Sbjct  254   DIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIKAGIYKEFVQVNRSMTHLVFIGDGPD  313

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVI+G+K+  DG+   TY++ TV +  + F+ +++  ENTAGA+K QAVA+R+ +D ++
Sbjct  314   KTVISGSKSFKDGIT--TYRTTTVAIVGDHFIAKNMGFENTAGAIKHQAVAIRVLSDESI  371

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C  + RKPL  QAC +
Sbjct  372   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTFLVRKPLPNQACPI  431

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GRKD R     V+Q C I  E    A    +K +LGRPWKE+SRT+IM +FI + + 
Sbjct  432   TAHGRKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIP  491

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW  NF L+T +Y+E +N GPGA    RV W G K+    E+ K FTP  ++  D
Sbjct  492   PEGWQPWLDNFGLETLFYSEVRNTGPGAPAMNRVTWPGIKKLGEEEILK-FTPAQYIQGD  550

Query  1612  EQWLGRAQIPFSPG  1571
               W+    +P++PG
Sbjct  551   -AWIPGKGVPYTPG  563



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   325 bits (833),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 214/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTIN AL++IP  N    VI IK G+YKE V+V  K   + F+G+G  KT
Sbjct  256   VVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGQTKT  315

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VITGN+N   G V  T+++  + VE + F  +++ +ENTAG    QAVALR+SAD AV H
Sbjct  316   VITGNQNYGIGKVK-TFQTAPLIVEGDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFH  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C  + YQDTLY HS+R F+R CT+SGTVDFIFG+A  + Q+CK++ RKP  GQ+CMVTA
Sbjct  375   SCQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKLGQSCMVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R +  +V+ +C I  +PA       +K +LGRPWK+FSRT++M + ID+++ P 
Sbjct  435   QGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVIDPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W G+FAL T +YAEY N GPG++  +RVKW G  R I+P+ A  +T   FL  +  
Sbjct  495   GWLEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWPGI-RKITPQDALSYTGDRFLGGN-T  552

Query  1606  WLGRAQIPFSP  1574
             W+ + Q+P++P
Sbjct  553   WIPQTQVPYTP  563



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   324 bits (830),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 203/297 (68%), Gaps = 2/297 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS K+KT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  236   NVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  295

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S T+    +GF+ +DL I+NTAG  K QAVALR+SAD  V
Sbjct  296   ATIITGSLNVVDG--STTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRVSADQTV  353

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  MV
Sbjct  354   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNMV  413

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       + FLGRPWK +SRT+IM SFIDN + 
Sbjct  414   TAQGREDQNQNTAISIQKCKITASSDLAPVKGSVQTFLGRPWKLYSRTVIMQSFIDNHIN  473

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
             P GW PW G FAL T +Y EY N GPGA T KRV WKG+K     + A+QFT    +
Sbjct  474   PAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVTWKGFKVIRDAKEAEQFTVAKLI  530



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   316 bits (809),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 208/314 (66%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VA+DGS K+KT+  A+ S+P  ++ R VI +K G+YKE V +  KK N++ +G+G  
Sbjct  5     NVIVAKDGSGKYKTVKEAVASVPDNSNSRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMD  64

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITGN NV DG    T+ S TV    +GF+ +D+  +NTAGA K QAVALR+ AD +V
Sbjct  65    ATIITGNLNVVDGAT--TFNSATVAAVGDGFIAQDVQFQNTAGAAKHQAVALRVGADQSV  122

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++A+QDTLYTHS RQFYR C I+GTVDFIFGNA VVFQ+ K+ ARKP  GQ  MV
Sbjct  123   INRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGSGQKNMV  182

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D        IQ+CDI+    L       K +LGRPWK +SRT+ M S I + + 
Sbjct  183   TAQGREDPNQNTGTSIQNCDIIPSSDLAPVKGSVKTYLGRPWKAYSRTVFMQSNIGDHID  242

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGWS W G+FAL T +Y EY N+GPGA T KRVKW GY   +S   A +FT G  L+  
Sbjct  243   PEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGY-HILSAAEATKFTVGQ-LIQG  300

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + ++ G
Sbjct  301   GVWLKSTGVAYTEG  314



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   324 bits (831),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 209/312 (67%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS ++KTI AAL + P     R +I +KAG+Y EYV V   + N+   G+GP KT
Sbjct  257   VVAKDGSGQYKTIGAALAAYPKGLKGRYIIYVKAGIYNEYVTVTKDQVNVFMYGDGPRKT  316

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TG+K+ ADG+   T  + T      GF+ + +  +NTAGA K QAVALR+ ++M+   
Sbjct  317   MVTGSKSWADGIT--TQNTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFF  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++P + Q+C +I RKP++GQ   VTA
Sbjct  375   NCRMDAYQDTLYVQTHRQFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+D+R    IVIQ+C IV E AL       K +LGRPWK +SR +IM S + + + P 
Sbjct  435   QGRQDKRETTGIVIQNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFALDT ++AEY NRGPGA T+ RV+WKG+    +   A QFT GPFL+ D Q
Sbjct  495   GWLEWSGNFALDTLYFAEYGNRGPGAVTNGRVRWKGFHVIRNRNEALQFTTGPFLLGD-Q  553

Query  1606  WLGRAQIPFSPG  1571
             WL    +P+  G
Sbjct  554   WLRNTGVPYFTG  565



>ref|XP_004303758.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   325 bits (832),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VA DGS  +KT++ A+ + P+ +  R VI IKAGVY+E V VP  K NI+F+G+G  
Sbjct  267   NVIVAADGSGNYKTVSEAVAAAPSKSTSRYVIRIKAGVYRENVDVPKAKTNIMFLGDGRT  326

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV     GF+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  327   TTIITGSRNVVDG--DTTFNSATVAAVGAGFLARDITFQNTAGPSKHQAVALRVGSDLSA  384

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQF+ GC I+GTVDFIFGNA VV Q+C + ARKP  GQ  M+
Sbjct  385   FYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGNAAVVLQNCDIHARKPNSGQKNML  444

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+A     K +LGRPWKE+SRT+IM S I +I+ 
Sbjct  445   TAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITDIID  504

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G FALDT +YAEY N G GAST  RV WKGYK   S   A+ FTPG F+ A 
Sbjct  505   PAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFI-AG  563

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  564   GSWLSATGFPFTLG  577



>ref|XP_010687597.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   325 bits (833),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 195/298 (65%), Gaps = 2/298 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +I VA+DGS  F TIN  L S+P     R  I IK G Y+EYV V  K  NI   GEG  
Sbjct  288   NITVAKDGSGNFTTINDCLKSLPENRTERIYIYIKGGFYEEYVTVTKKMKNITMFGEGSQ  347

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K+VITGNKN  DGV   TY++ T  V  +GFV   L   NTAG  K QAVALR+ AD ++
Sbjct  348   KSVITGNKNFVDGV--RTYETATFAVMGDGFVGIALGFNNTAGPEKHQAVALRVQADRSI  405

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC + AYQDTLY  ++RQFYR C ISGT+DFIFG+A  +FQ+C +I RKP+E Q  +V
Sbjct  406   FLNCRMEAYQDTLYAQTHRQFYRSCYISGTIDFIFGDASAIFQNCMIIVRKPMENQQNIV  465

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+     I++ +C I  +  L       K +LGRPWK++SRT++M S I  ++ 
Sbjct  466   TAQGRADKHENTGIILHNCRIYPDKDLFPVKHKYKTYLGRPWKQYSRTIVMESTIGELIA  525

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1619
             PEGW PW+G FAL T +YAEY N GPG+ T KRVKW GYK++IS + A+ FT  PFL 
Sbjct  526   PEGWMPWQGEFALKTLYYAEYNNHGPGSDTSKRVKWGGYKKSISKQEAQNFTVTPFLQ  583



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   324 bits (831),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 209/312 (67%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS ++KTI AAL + P     R +I +KAG+Y EY+ V   + N+   G+GP KT
Sbjct  257   VVAKDGSGQYKTIGAALAAYPKGLKGRYIIYVKAGIYNEYITVTKDQVNVFMYGDGPRKT  316

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             ++TG+K+ ADG+   T  + T      GF+ + +  +NTAGA K QAVALR+ ++M+   
Sbjct  317   MVTGSKSWADGIT--TQNTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFF  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++P + Q+C +I RKP++GQ   VTA
Sbjct  375   NCRMDAYQDTLYVQTHRQFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+D+R    IVIQ+C IV E AL       K +LGRPWK +SR +IM S + + + P 
Sbjct  435   QGRQDKRETTGIVIQNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFALDT ++AEY NRGPGA T+ RV+WKG+    +   A QFT GPFL+ D Q
Sbjct  495   GWLEWSGNFALDTLYFAEYGNRGPGAVTNGRVRWKGFHVIRNRNEALQFTAGPFLLGD-Q  553

Query  1606  WLGRAQIPFSPG  1571
             WL    +P+  G
Sbjct  554   WLRNTGVPYFTG  565



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   325 bits (833),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 210/314 (67%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA+DGS  FKTI+ AL ++PA  + R +I +K GVY E VIV  K  N+   G+G  
Sbjct  283   NVTVAKDGSGNFKTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQ  342

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++ITGNKN ADGV   T+++ +     EGF+ + +   NTAG  K QAVA R+ AD A+
Sbjct  343   KSIITGNKNFADGVR--TFQTASFAALGEGFMAKSMGFRNTAGPEKHQAVAARVQADRAI  400

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC    YQDTLY  ++RQFY+ C ISGTVDFIFG+A  +FQ+C +  RKP+E Q  +V
Sbjct  401   FLNCRFEGYQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIV  460

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+R    IV+Q+C I+ +  L+      K +LGRPWKEFSRT++M S I++++ 
Sbjct  461   TAQGRTDKRETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMGSTIEDLIH  520

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK  I  + A ++T GPFL  +
Sbjct  521   PDGWTPWQGDFALKTLYYAEYNNKGPGAKTDNRVKWSGYKV-IDKQEAMKYTVGPFLKGN  579

Query  1612  EQWLGRAQIPFSPG  1571
               WL    +P   G
Sbjct  580   A-WLRVKGVPVRFG  592



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   324 bits (831),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 214/316 (68%), Gaps = 3/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDG+  F+TI  AL  +P  N+   VI +KAGVYKE  +V      +  +G+GP 
Sbjct  253   NVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKAGVYKERFLVDKHMTKVTMIGDGPT  312

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGN +V  G +  T+K+ TV V  E FV   L  ENTAG  K QAVALR++AD +V
Sbjct  313   KTKITGNVSVIAGEIS-TFKTATVAVAGEWFVGIGLGFENTAGPEKHQAVALRVNADRSV  371

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY HS RQFYR CTI+GT+DFIFG++  +FQ+C +IARKP++ Q  +V
Sbjct  372   FYNCRMDGYQDTLYAHSERQFYRDCTITGTIDFIFGDSATIFQNCMIIARKPMDNQQNIV  431

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+R+G  AIV+Q+C I ++PA          +LGRPWK +SRTLI+ S +D+++ 
Sbjct  432   TAQGRKERQGNGAIVLQNCTITSDPAYYPHRKVLPTYLGRPWKPYSRTLILQSQLDDLIH  491

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+  LDTC+YAE  NRGPGA   KRV W G K N++   A+++T   +L   
Sbjct  492   PDGWLPWTGDVGLDTCFYAELDNRGPGADLTKRVTWPGIK-NLTYVEAQEYTIENYLYG-  549

Query  1612  EQWLGRAQIPFSPGYV  1565
             + W+ RA +PF PG +
Sbjct  550   QTWISRAGVPFIPGLL  565



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   324 bits (830),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 215/316 (68%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +I VA+DGS   KTI  A+  +P  ++   VI IK GVY+E V V     N++ +G+G +
Sbjct  239   NITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIKEGVYEEQVQVNRSLTNVMMIGDGTS  298

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG  N  DG    T+K+ TV +  +GF+ +DL IEN+AGA K QAVALR+ +D +V
Sbjct  299   KTKITGKLNYIDGT--ATFKTATVAIVGDGFIGKDLWIENSAGAAKHQAVALRVQSDKSV  356

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +N  ++ YQDTLY H+ RQFYR CTISGT+DFIFG++P VFQ+C + ARKPL+ Q  +V
Sbjct  357   FYNVRMDGYQDTLYVHTKRQFYRECTISGTIDFIFGDSPTVFQNCLIQARKPLDNQQNIV  416

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR A+AI++ +C I A+PA   A      FLGRPWKEFSRT ++ S +D+++ 
Sbjct  417   TAQGRKDRRQASAIILHNCTISADPAYFPARKKLPTFLGRPWKEFSRTFVLQSQLDDLID  476

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L++C+Y E  NRGPGA   +RV WKG K +I    A++FT   F+  +
Sbjct  477   PKGWLPWSGDFGLNSCFYTELDNRGPGADMSQRVNWKGVK-SIDYAHAQKFTVEHFIQGN  535

Query  1612  EQWLGRAQIPFSPGYV  1565
               WL +  +PF PG +
Sbjct  536   A-WLPKTGVPFIPGLL  550



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   325 bits (832),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 213/318 (67%), Gaps = 10/318 (3%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS KFK IN AL  +P  N +  VI IK GVY EYV V  K  ++VF+G+G  
Sbjct  271   NVVVAKDGSGKFKKINDALKQVPKKNQKPFVIHIKEGVYHEYVEVTKKMTHVVFLGDGGN  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DG+   TY++ TV +E + FV  ++  EN+AG  K QAVA+R+ AD A+
Sbjct  331   KTRITGNKNFIDGI--NTYQTPTVAIEGDNFVAINIGFENSAGPQKHQAVAIRVQADKAI  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLY H+ RQFYR CTISGT+DFIFG+A  VFQ+C  + +KPLE Q C+V
Sbjct  389   FYKCSMDGYQDTLYVHTMRQFYRDCTISGTIDFIFGDAISVFQNCTFLVKKPLENQQCIV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+R   + IVIQ+C IVA+         NK +L RPWK FSRT+ M ++I +++ 
Sbjct  449   TAQGRKERHQPSGIVIQNCHIVADT--HNVKFDNKAYLARPWKNFSRTVFMKTYIGDLIQ  506

Query  1792  PEGWSPWKGN----FALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1625
             P+G+ PW+G       +DTC+YAEY N+GPG+   KRVKW G K  ++ + A  F P  F
Sbjct  507   PDGFMPWQGPNGTVSGIDTCFYAEYNNKGPGSDKSKRVKWPGIK-TLTSQSASHFLPSMF  565

Query  1624  LMADEQWLGRAQIPFSPG  1571
                D+ W+   +IP+S G
Sbjct  566   FHGDD-WIKVTKIPYSSG  582



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   324 bits (831),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 208/314 (66%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DG+  ++T++AA+ + P  + RR VI IKAGVY+E V VP KK N++FMG+   
Sbjct  275   DVTVAADGTGNYRTVSAAVAAAPEGSARRYVIKIKAGVYRENVEVPKKKVNLMFMGDDRK  334

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+KS TV V  +GF+ RD+T +NTAG  K QAVALR+ AD + 
Sbjct  335   TTIITGSRNVVDG--STTFKSATVAVVGDGFLARDITFQNTAGPSKHQAVALRVGADFSA  392

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              H C + AYQDTLY HS RQFY GC ++GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  393   FHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGNAAAVLQDCDIHARRPNPGQRNMV  452

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L A     + +LGRPWK +SRT+IM + I +++ 
Sbjct  453   TAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSRTVIMQTAISDVIN  512

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFALDT +YAE+ N GPGAST  RV WKGY+   +PE A+ FT   F++A 
Sbjct  513   PAGWYEWNGNFALDTLYYAEHANTGPGASTANRVTWKGYRVISAPE-AQPFTANQFIVAG  571

Query  1612  EQWLGRAQIPFSPG  1571
               WL     P+ PG
Sbjct  572   S-WLKPTGFPYYPG  584



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   324 bits (830),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++ A+   P  + +R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  271   DVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTNIMFLGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             +T+ITG++NV DG    T+ S TV V  E F+ RD+T +NTAG  K QAVALR+ AD++ 
Sbjct  331   ETIITGSRNVVDGST--TFHSATVAVVGERFLARDITFQNTAGPSKHQAVALRVGADLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY  C I+GTVDFIFGNA  VFQ+C + AR+P  GQ  MV
Sbjct  389   FYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAAVFQNCDIHARRPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L++       +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQSVRSNFPTYLGRPWKEYSRTVVMQSVISDVIH  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W  +FAL T +Y EY+N G GA T  RVKW+GYK   S   A+ ++PG F+ A 
Sbjct  509   PAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASEAQAYSPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  568   GSWLSSTGFPFSLG  581



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   323 bits (828),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 210/316 (66%), Gaps = 3/316 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS +FKTI AAL + P  N+ R VI +KAGVY+EY+ V  ++ N+   G+GP KT
Sbjct  251   VVAKDGSGQFKTIAAALAAYPKKNNGRYVIYVKAGVYEEYITVTKEQVNVFMYGDGPTKT  310

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG KN   GV   T+++ + T   +GF+ + +  +NTAG    QAVALR+ +DM+   
Sbjct  311   IITGRKNNRQGVP--TFQTASFTAIGKGFIAKSIGFQNTAGPEGHQAVALRVQSDMSAFF  368

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQDTLY  ++RQFYR C I+GT+DFIFG++  V Q+  +I RKP++ Q   VTA
Sbjct  369   NCRMDGYQDTLYVQTHRQFYRNCVITGTIDFIFGDSSTVIQNSLIIVRKPMDNQQNTVTA  428

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
              GRKD+     +VIQ+C IV E  L       + +LGRPWKE+SRT+IM S I +++ PE
Sbjct  429   HGRKDKGERTGLVIQNCRIVPEEKLFPQRFKIRSYLGRPWKEYSRTVIMESTIGDLIQPE  488

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FALDT +YAEY NRGPGA+T KRV WKG+K   +   A QFT GPFL  D +
Sbjct  489   GWMPWSGDFALDTLFYAEYGNRGPGAATGKRVNWKGFKVITNKREALQFTAGPFLEGD-K  547

Query  1606  WLGRAQIPFSPGYV*N  1559
             WL     PF  G   N
Sbjct  548   WLPGTTTPFDLGLTQN  563



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   323 bits (828),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 209/314 (67%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ KFKT+N A+ + P  ++ R V+ +K GVYKE + +  KK N++ +G+G  
Sbjct  245   NVVVAKDGTGKFKTVNEAVTAAPENSNSRYVVYVKKGVYKETIDIGKKKKNLMLVGDGKD  304

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S TV    +GF+ +D+ I+NTAG  K QAVALR+SAD +V
Sbjct  305   LTIITGSLNVVDG--STTFRSATVAANGDGFMAQDIWIQNTAGPAKHQAVALRVSADQSV  362

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR C I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  M+
Sbjct  363   INRCRIDAYQDTLYTHTLRQFYRDCFITGTVDFIFGNSAVVFQNCDIVARKPDAGQKNML  422

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D     AI IQ C+I     L       K +LGRPWK +SRT+IM SFIDN + 
Sbjct  423   TAQGREDPNQNTAISIQKCNIKPSSELAPVKESVKTYLGRPWKLYSRTVIMQSFIDNHID  482

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G FAL T +Y EY N GPGA T KRV WKGY+     + A +FT    L+  
Sbjct  483   PAGWFPWDGEFALSTLYYGEYANNGPGAGTSKRVTWKGYRVIKDSKEAAKFTVAN-LIQG  541

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + F  G
Sbjct  542   GLWLKPTGVAFQEG  555



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   323 bits (828),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 213/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDG+   KTIN AL  +P  ++   VI IK GVYKE V V     N++ +G+G  
Sbjct  239   NVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKEKVQVNRSLTNVIMVGDGTN  298

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG    T+K+ TV V  +GF+ +DL IEN+AGA K QAVALR+ +D +V
Sbjct  299   KTKITGSLNYIDGT--ATFKTATVAVIGDGFIGKDLWIENSAGAAKHQAVALRVQSDKSV  356

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +N  ++ YQDTLY H+ RQFYR C ISGT+DFIFG+   V Q+C ++ARKP++ Q  +V
Sbjct  357   FYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQNCLILARKPMDNQQNIV  416

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKDRR A AIV+ +C I A+PA          FLGRPWKEFSRT ++ S +D+++ 
Sbjct  417   TAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQSQLDDLID  476

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW  NF L+TC+Y E  NRGPGA+T +RVKWKG K  I    A++FT   F+  +
Sbjct  477   PKGWLPWFENFGLNTCFYTELDNRGPGANTSQRVKWKGVK-TIGYAHAQKFTVEHFIQGN  535

Query  1612  EQWLGRAQIPFSPGYV  1565
               WL ++ +P+ PG +
Sbjct  536   -TWLPKSGVPYIPGLL  550



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   323 bits (828),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 211/312 (68%), Gaps = 4/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS   KTI  A+  +P       +I IK G YKE V V     N++ +G+GP 
Sbjct  239   NVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKEKVHVNKSATNVMLIGDGPT  298

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ N  DG    T+ + TV V  +GFV +DL IEN+AGA K QAVALR+ +DM+V
Sbjct  299   KTKITGSLNYVDGT--RTFDTATVAVVGDGFVAKDLWIENSAGAEKHQAVALRVQSDMSV  356

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H++RQFYR CTISGT+DFIFG++  +FQ+C ++ARKPL+ Q  +V
Sbjct  357   FYNCRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCLILARKPLDNQQNIV  416

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK R+ A+AI++ +C I A+PA          FLGRPWK +SRT I+ S ID+++ 
Sbjct  417   TAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQSQIDDLIH  476

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW G+F L+TC+Y E  NRGPGA   KRV WKG K NI    AK+F+   FL   
Sbjct  477   PDGWLPWFGDFGLNTCFYTEVDNRGPGADKSKRVTWKGVK-NIDYAHAKKFSVQQFLHGG  535

Query  1612  EQWLGRAQIPFS  1577
              +WL R  +PF+
Sbjct  536   -KWLPRTGVPFT  546



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   323 bits (828),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 205/316 (65%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ K+KTIN AL  +P  +    VI IK GVY+E VIV  +  N+V +G+GP 
Sbjct  256   NVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYIKKGVYEETVIVDKQMTNVVMIGDGPT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I+G+K+ ADGV   T K+ T       FV + +  ENTAG VK QAVALR+ +D ++
Sbjct  316   MTRISGSKSHADGVT--TMKTATFAALGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +FQ+CKM+ RKP E QACMV
Sbjct  374   FFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKPGETQACMV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      I +Q+C I  EP   A    NK +LGRPWK F+R ++M S ID  + 
Sbjct  434   TAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKNFARVVVMQSSIDEAIA  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+ W G      C++ EY N GPG+   +RVKW   KR ++P+ A  FTP      D
Sbjct  494   PEGWTEWTGEEYHQNCFFGEYGNTGPGSDVTQRVKWSTVKR-LTPDQAAAFTPARVFEGD  552

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+ PG +
Sbjct  553   -KWIKPSGVPYVPGMM  567



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   322 bits (826),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS  +KT+  A+ S P  +  R VI +K G YKE V V  KK N++ +G+G  
Sbjct  245   NVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMD  304

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T+KS T+ V  +GF+ +DL I+NTAG  K QAVALR+SAD +V
Sbjct  305   LTIITGSLNVVDG--STTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSV  362

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLY H+ RQFYR C I+GTVDFIFGNA VV Q+CK+ ARKP+  Q+ MV
Sbjct  363   INRCRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMV  422

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D        IQ CD++A   L+      + +LGRPWKE+SRT++M S I + + 
Sbjct  423   TAQGRTDPNQNTGTSIQKCDVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHID  482

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GWS W G+FAL T +Y EY NRGPGA T KRVKW GY     PE AK+FT    L+  
Sbjct  483   PAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAE-LIGG  541

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + ++ G
Sbjct  542   GSWLKSTGVAYTEG  555



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   323 bits (828),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 204/312 (65%), Gaps = 3/312 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DG+  +KT++ A+ + P  +  R VI IKAG+Y+E V VP KK NI+F+G+G  
Sbjct  274   NVVVAADGTGNYKTVSEAVAAAPEKSSSRYVIKIKAGIYRENVDVPKKKTNIMFLGDGRV  333

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV    E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  334   NTIITASRNVVDGST--TFNSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDLSA  391

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQF+ GC ++GTVDFIFGNA VV Q+C + ARKP  GQ  MV
Sbjct  392   FYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAVVLQNCDIHARKPDSGQKNMV  451

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+A+    K FLGRPWKE+SRT+IM S I +I+ 
Sbjct  452   TAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTFLGRPWKEYSRTVIMQSSITDIID  511

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G FALDT +Y EY N G GA T  RV WKG+K   SP  A+ +TPG F+ A 
Sbjct  512   PAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWKGFKVITSPTEAEAYTPGNFI-AG  570

Query  1612  EQWLGRAQIPFS  1577
               WL     PFS
Sbjct  571   GSWLSSTGFPFS  582



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   317 bits (812),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA DGS  FK+IN AL  +P  N +  VI IK GVY+EYV V  K  ++VF+GEG  
Sbjct  67    NVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGK  126

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+GNKN  DG    TY++ TV ++ + FV  ++  EN+AG  K QAVALR+ AD ++
Sbjct  127   KTRISGNKNFIDGT--NTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVALRVQADKSI  184

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ+C  + RKP+E Q C+V
Sbjct  185   FYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMENQQCIV  244

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+ +  + IVIQ   IV++P   +    NK +L RPWK +SRT+IM ++ID+++ 
Sbjct  245   TAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLID  304

Query  1792  PEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ + A+ F+P  F 
Sbjct  305   ADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFF  363

Query  1621  MADEQWLGRAQIPFSPG  1571
                + W+    IP+ PG
Sbjct  364   HGTD-WIEVTGIPYFPG  379



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   322 bits (826),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 213/310 (69%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  AL+++P  +    +I IK G+YKE VIV  K  ++ F+G+GP KT
Sbjct  256   VVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEGIYKEKVIVTKKMPHVTFIGDGPTKT  315

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VITG+ N   G V  T+ + T+T++   F  + + IENT+G    QAVALR+SAD AV +
Sbjct  316   VITGSLNFRIGKVK-TFLTATITIQGNHFTAKSIGIENTSGPKGGQAVALRVSADYAVFY  374

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC ++ YQ+TLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP   Q+CMVTA
Sbjct  375   NCQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKRSQSCMVTA  434

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D R    IV+ +C IV +PA       NK +LGRPW++FSRT+IM + ID+++ P 
Sbjct  435   QGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYLGRPWRQFSRTIIMKTTIDDVIDPA  494

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W+G  AL T +YAE+ N GPG++  +RVKW G K+ +SPE A  FT   FL+ D  
Sbjct  495   GWLLWQGESALKTLFYAEHLNIGPGSNQAQRVKWPGLKK-LSPEEALMFTGNRFLLGD-T  552

Query  1606  WLGRAQIPFS  1577
             W+ +  +P++
Sbjct  553   WIPQTHVPYT  562



>ref|XP_008439965.1| PREDICTED: pectinesterase [Cucumis melo]
Length=555

 Score =   322 bits (825),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVA+DGS  FKT+  A++S+P  +  R VI +K G YKE V V  KK N++ +G+G  
Sbjct  244   NIVVAKDGSGNFKTVQEAVESVPDKSKNRIVIYVKKGTYKENVEVGKKKKNVMIVGDGMD  303

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T+KS TV    +GF+ +D+  +NTAG  K QAVALR+ AD +V
Sbjct  304   STIITGSLNVVDGST--TFKSATVAAVGDGFIAQDIWFQNTAGPAKHQAVALRVGADQSV  361

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTHS RQFYR  TI+GTVDFIFGNA VV Q+CK+  R+P+  QA MV
Sbjct  362   INRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIEPRRPMNNQANMV  421

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D        IQ CDIVA   L+      K +LGRPWKE+SRT++M S I +++ 
Sbjct  422   TAQGRIDPNQNTGTSIQQCDIVASFDLEPVKKSIKTYLGRPWKEYSRTVVMQSRIGDLIQ  481

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW+ W G+FAL T +Y EY N GPG+   KRVKW GY    SP  A++FT    +   
Sbjct  482   PAGWAEWSGDFALKTLYYGEYSNTGPGSDVSKRVKWAGYHVITSPSEAQKFTVNSLIQGG  541

Query  1612  EQWLGRAQIPFSPG  1571
             E WLG +   F PG
Sbjct  542   E-WLGPSGASFIPG  554



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   323 bits (828),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  F+T++ A+   P  + +R VI IKAGVY+E V VP KK NI+FMG+G +
Sbjct  278   DVVVAADGSGNFRTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRS  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    E F+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  338   NTIITGSRNVKDGST--TFNSATVAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSA  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQ++  C I+GTVDFIFGNA  V Q+C + AR+P  GQ  MV
Sbjct  396   FYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNAAAVLQNCDIHARRPGSGQKNMV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ+C I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  456   TAQGRTDPNQNTGIVIQNCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIN  515

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
               GW  W GNFAL+T +Y EY+N G GA T  RVKW+G+K   S   A+ +TPG F+ A 
Sbjct  516   SAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWRGFKVITSATEAQAYTPGRFI-AG  574

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  575   GSWLGSTGFPFSLG  588



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   323 bits (827),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 207/314 (66%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DG+  ++T++AA+ + P  + RR VI IKAGVYKE V VP KK N++F+G+   
Sbjct  268   DVTVAADGTGDYRTVSAAVAAAPEGSARRYVIKIKAGVYKENVEVPKKKVNLMFVGDDRT  327

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV V  EGF+ RD+T +NTAG  K QAVALR+ AD + 
Sbjct  328   TTIITGSRNVVDG--STTFHSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADFSA  385

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              H C + AYQDTLY HS RQFY GC ++GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  386   FHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGNAAAVLQDCDIHARRPNPGQRNMV  445

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L A     + +LGRPWK +SRT+IM + I +++ 
Sbjct  446   TAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSRTVIMQTEISDVIN  505

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFALDT +YAE+ N GPGAST  RV WKGY+   +PE A+ FT   F++A 
Sbjct  506   PTGWYEWDGNFALDTLYYAEHANTGPGASTANRVTWKGYRVISAPE-AQPFTANQFIVAG  564

Query  1612  EQWLGRAQIPFSPG  1571
               WL     P+ PG
Sbjct  565   S-WLKPTGFPYYPG  577



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   323 bits (827),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D+VVA+ G  K+ T+N AL  IP  N  +  VI +K GVY+E+V+      N++ +G+GP
Sbjct  261   DVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVKEGVYEEHVLFDKHMTNVMLIGDGP  320

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT+ITG KN A+G    T ++ TV V  + F+ +D+  ENTAGAV  QAVALR+ +D++
Sbjct  321   TKTIITGRKNFAEGT--KTMQTATVGVVGDYFIAKDIGFENTAGAVGHQAVALRVQSDLS  378

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A  VFQ+CKMI RKPLE QACM
Sbjct  379   IFYNCKMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACM  438

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTA GR DRR    I++Q+C I  EP  +     NK +LGRPWK ++R ++M S ID+++
Sbjct  439   VTAHGRLDRRSPTGIILQNCTISGEPGYE--KDLNKAYLGRPWKNYARAIVMQSQIDDVI  496

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              PEGW  W G+    +CW+ E+ NRG GA   KR  W+G K  ++ + A  FT G F+  
Sbjct  497   APEGWMEWIGSNNHQSCWFGEFGNRGLGADQTKRATWRGIKE-LTAQHAADFTAGRFVFG  555

Query  1615  DEQWLGRAQIPFSPGYV  1565
             D +W+  + +P+  G +
Sbjct  556   D-RWIQPSGVPYVAGMM  571



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   322 bits (825),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 210/318 (66%), Gaps = 6/318 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D++VA+DGS  FKTIN AL  +P  +++  V+ IK G+Y+E V + S   N++ +G+GP 
Sbjct  240   DLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIKEGIYEEQVKINSSFTNLLVVGDGPL  299

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG  N  +G    TY+S TV V  + F   D+  EN AG    QAVALR+SAD+AV
Sbjct  300   KTRITGKLNFVNGTT--TYQSATVAVHGDRFTAMDVGFENAAGPEGHQAVALRVSADLAV  357

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NCH++ YQDTLY H+YRQFYR CTISGT+D+IFG+A  +FQ C M+ RKPL  Q C+V
Sbjct  358   FYNCHMDGYQDTLYAHTYRQFYRDCTISGTIDYIFGDAAALFQGCTMVVRKPLANQYCIV  417

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD      +V+Q+C +V +PA       NK +L RPWK +SR +IM S+ID I+ 
Sbjct  418   TAQGRKDVHQPTGLVLQNCSVVGDPAYYPVMDVNKAYLARPWKLYSRAVIMESYIDRIIQ  477

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+G+  W G FALDT +Y E+ NRGPGA   +R+KW G K  ++ +  K+FT   F+   
Sbjct  478   PDGYLEWNGTFALDTLFYTEFNNRGPGADKSRRLKWTGIK-ELTGKRMKRFTGDDFIDG-  535

Query  1612  EQWL--GRAQIPFSPGYV  1565
              +W    + +IP+  G+V
Sbjct  536   SRWTKHNKMKIPYKGGFV  553



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   322 bits (826),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 211/316 (67%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDG+ K+K+I  AL  +P  + +  VI IK GVYKEYVIV  +  N+V +G+GP 
Sbjct  256   NVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKEGVYKEYVIVDKEMTNVVMIGDGPT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+KN ADG    T  + T     + FV + +  ENTAGA K QAVALR+ +D ++
Sbjct  316   KTRISGSKNYADGT--ATMYTATFAAVGDYFVAKGIGFENTAGAAKHQAVALRVQSDFSI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC+++AYQDTLYT +YRQ+YR CTISGTVDFIFG+   +FQ+C+M+ RKP + Q+CMV
Sbjct  374   FYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKPGDSQSCMV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+    AIV+Q+C I  EP   A    NK +LGRPWK F+R +++ S ID+ + 
Sbjct  434   TAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDDAIA  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+ W G     +C+ AE  NRG GA   KRVKW+  K+ ++PE A  FTP      D
Sbjct  494   PEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLKK-LTPEQAAAFTPARLFEGD  552

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+  G +
Sbjct  553   -KWVKPSGVPYVSGMM  567



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   322 bits (825),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 206/316 (65%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ K+KTIN AL  +P  ++   VI IK G+Y+E VIV  +  N+V +G+GP 
Sbjct  256   NVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVIVDKEMTNVVMIGDGPT  315

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T I+G+K+ ADG+   T  + T       FV + +  ENTAG VK QAVALR+ +D ++
Sbjct  316   MTRISGSKSHADGIT--TMNTATFAAVGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSI  373

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +FQ+CKM+ RKP E QACMV
Sbjct  374   FFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKPGEAQACMV  433

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR DR     I +Q+C I  EP   A    NK +LGRPWK+F+R ++M S ID  + 
Sbjct  434   TAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAIA  493

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+ W G      C++ EY NRGP     +RVKW   KR ++P+ A  FTP      D
Sbjct  494   PEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPDQAAAFTPARVFEGD  552

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+ PG +
Sbjct  553   -KWVKPSGVPYVPGMM  567



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   322 bits (826),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 205/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  FKT++ A+   P  + +R VI IKAGVY+E V VP KK NI+FMG+G +
Sbjct  268   DVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRS  327

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    E F+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  328   NTIITGSRNVKDGST--TFHSATVAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSA  385

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQ++  C I+GTVDFIFGNA  V Q+C + AR+P  GQ  MV
Sbjct  386   FYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNAAAVLQNCDIHARRPGSGQKNMV  445

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  446   TAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIN  505

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
               GW  W GNFAL+T +Y EY+N G GA T  RVKWKG+K   S   A+ +TPG F+ A 
Sbjct  506   SAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI-AG  564

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  565   GSWLSSTGFPFSLG  578



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   322 bits (825),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 213/316 (67%), Gaps = 3/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VAQDG+  FKTI+ AL  +P  N+   VI +KAGVYKE V+V     ++  +G+GP 
Sbjct  251   NVTVAQDGTGDFKTISEALKHVPKQNNDTFVIYVKAGVYKEGVLVDKHMTHVTMIGDGPT  310

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITG+ +V  G +  T+K+ TV V  E F    L  ENTAG    QAVALR++AD +V
Sbjct  311   KTKITGDVHVIQGKIS-TFKTATVAVAGEWFTGMGLGFENTAGPQNHQAVALRVNADRSV  369

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY HS RQFYR CTI+GT+DFIFG++  + Q+C +I RKP++ Q  +V
Sbjct  370   FYNCRMDGYQDTLYAHSGRQFYRDCTITGTIDFIFGDSATMLQNCMIIVRKPMDNQQNIV  429

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR DR+G  A+VIQ+C I ++PA   +      +LGRPWK +SRTLI+ S +D++V 
Sbjct  430   TAHGRIDRQGNGALVIQNCTITSDPAYYPSRKKLPTYLGRPWKPYSRTLILQSQLDDLVH  489

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW PW GN  LDTC+YAE  NRGPGA+  KRV W G K+ +S + A++FT   +L   
Sbjct  490   PDGWMPWNGNIGLDTCFYAELDNRGPGANLTKRVTWPGIKK-LSYDEAQRFTVEHYLFG-  547

Query  1612  EQWLGRAQIPFSPGYV  1565
             + W+ R  +PF PG +
Sbjct  548   QTWIPRTGVPFIPGLL  563



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   318 bits (815),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ K+KT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  140   NVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  199

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S TV    +GF+ +D+  +NTAG  K QAVALR+SAD +V
Sbjct  200   VTIITGSLNVVDG--STTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQSV  257

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++ARKP  GQ  M+
Sbjct  258   INRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGAGQKNML  317

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D     AI  Q C + A   L       K FLGRPWK +SRT+IM SFIDN + 
Sbjct  318   TAQGREDPNQNTAISFQKCRLTASSYLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHID  377

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FAL T +Y EY N GPGA T KRVKWKG+K     + A +FT    L+  
Sbjct  378   PAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDSKEADKFTVAK-LIQG  436

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + F  G
Sbjct  437   GLWLKPTGVTFQEG  450



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   323 bits (827),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 210/314 (67%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA+DGS  FKTI+ AL ++PA  + R +I +K GVY E VIV  K  N+   G+G  
Sbjct  283   NVTVAKDGSGNFKTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQ  342

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             K++ITGNKN ADGV   T+++ +     EGF+ + +   NTAG  K QAVA R+ AD A+
Sbjct  343   KSIITGNKNFADGVR--TFQTASFAALGEGFMAKSMGFRNTAGPEKHQAVAARVQADRAI  400

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC    YQDTLY  ++RQFY+ C ISGTVDFIFG+A  +FQ+C +  RKP+E Q  +V
Sbjct  401   FLNCRFEGYQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIV  460

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D++    IV+Q+C I+ +  L+      K +LGRPWKEFSRT++M S I++++ 
Sbjct  461   TAQGRTDKQETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMDSTIEDLIH  520

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK  I  + A ++T GPFL  +
Sbjct  521   PDGWTPWQGDFALKTLYYAEYNNKGPGAKTDNRVKWSGYKV-IDKQEAMKYTVGPFLKGN  579

Query  1612  EQWLGRAQIPFSPG  1571
               WL    +P   G
Sbjct  580   A-WLRVKGVPVRFG  592



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   322 bits (826),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 205/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  FKT++ A+   P  + +R VI IKAGVY+E V VP KK NI+FMG+G +
Sbjct  268   DVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRS  327

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    E F+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  328   NTIITGSRNVKDGST--TFHSATVAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSA  385

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQ++  C I+GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  386   FYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNAAAVLQDCDIHARRPGSGQKNMV  445

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+       ++LGRPWKE+SRT+IM S I +++ 
Sbjct  446   TAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPMYLGRPWKEYSRTVIMQSSITDVIN  505

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
               GW  W GNFAL+T +Y EY+N G GA T  RVKWKG+K   S   A+ +TPG F+ A 
Sbjct  506   SAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI-AG  564

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  565   GSWLSSTGFPFSLG  578



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   322 bits (825),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 215/310 (69%), Gaps = 3/310 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  AL+++P  N    VI IK G+YKE VIV  K   + F+G+GP KT
Sbjct  259   VVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIYKEKVIVTRKMPYVTFIGDGPNKT  318

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             VITG+ N   G V  T+ +G++T+E + F  +++ IENTAG    QAVALR+SAD A   
Sbjct  319   VITGSLNFGIGKVK-TFLTGSITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAAFQ  377

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q+CK++ RKP +GQ+CMVTA
Sbjct  378   SCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKKGQSCMVTA  437

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR + R +  +V+ +C I  + A       +K +LGRPWKEFSRT++M + ID+++ P 
Sbjct  438   QGRSNVRESTGLVLHNCHITGDSAYIPVKSESKAYLGRPWKEFSRTIVMKTAIDDVIDPA  497

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW PW G+FAL T +YAE+ N GPG++   RVKW G K+ ++P+ A  +T   FL   E 
Sbjct  498   GWLPWSGDFALKTLYYAEHLNTGPGSNQAHRVKWPGIKK-LTPQDALLYTGDKFL-GGET  555

Query  1606  WLGRAQIPFS  1577
             W+ + Q+P++
Sbjct  556   WIPQTQVPYT  565



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   318 bits (816),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA DGS  FK+IN AL  +P  N +  VI IK GVY+EYV V  K  ++VF+GEG  
Sbjct  134   NVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGK  193

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+GNKN  DG    TY++ TV ++ + FV  ++  EN+AG  K QAVALR+ AD ++
Sbjct  194   KTRISGNKNFIDGT--NTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVALRVQADKSI  251

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ+C  + RKP+E Q C+V
Sbjct  252   FYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMENQQCIV  311

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+R+  + IVIQ   IV++P   +    NK +L RPWK +SRT+IM ++ID+++ 
Sbjct  312   TAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLID  371

Query  1792  PEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ + A+ F+P  F 
Sbjct  372   ADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFF  430

Query  1621  MADEQWLGRAQIPFSPG  1571
                + W+    IP  PG
Sbjct  431   HGTD-WIEVTGIPCFPG  446



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   322 bits (825),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 203/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++ A+   P  + +R VI IKAGVY+E V VP KK NI+FMG+G +
Sbjct  265   DVVVAADGSGDYKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRS  324

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV    E F+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  325   NTIITASRNVQDG--STTFHSATVAAVGEKFLARDITFQNTAGASKHQAVALRVGSDLSA  382

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQF+  C ++GTVDFIFGN   V Q C + AR+P  GQ  MV
Sbjct  383   FYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDFIFGNGAAVLQDCDIHARRPGSGQKNMV  442

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  443   TAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIQ  502

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL+T +Y EY N G GA+T  RVKWKG+K   S   A+ +TPG F+ A 
Sbjct  503   PAGWHEWNGNFALNTLFYGEYANTGAGAATSGRVKWKGHKVITSSTEAQAYTPGSFI-AG  561

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  562   GSWLSSTGFPFSLG  575



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   315 bits (806),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 197/314 (63%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  FKT+  A+ + P  + +R VI IK GVY+E V V  KK NI+F+G+G  
Sbjct  51    DVTVAADGSGDFKTVTEAVKAAPLKSSKRYVIRIKGGVYRENVEVDKKKTNIMFLGDGRT  110

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV V    F+ RD+T +NTAG  K QAVALR+  D++ 
Sbjct  111   NTIITASRNVVDGST--TFHSATVAVVGANFLARDITFQNTAGPSKHQAVALRVGGDLSA  168

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC   A+QDTLY H+ RQF+  C I+GTVDFIFGN+ VVFQ C + AR P  GQ  MV
Sbjct  169   FFNCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGNSAVVFQDCDIHARLPDSGQKNMV  228

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L++     K +LGRPWKE+SRT+IM S I +++ 
Sbjct  229   TAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSRTVIMQSSISDVID  288

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL T  Y EY+N GPGA T  RV WKGYK       A+ +TPG F+   
Sbjct  289   PIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAEARDYTPGSFI-GG  347

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  348   SSWLGSTGFPFSLG  361



>ref|XP_004134752.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
 gb|KGN49128.1| Pectinesterase [Cucumis sativus]
Length=555

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVA+DGS  FKT+  A++S+P  +  R VI +K G Y+E V V  KK N++ +G+G  
Sbjct  244   NIVVAKDGSGNFKTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVGKKKKNVMIVGDGMD  303

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T+KS TV    +GF+ +D+  +NTAG  K QAVALR+ AD +V
Sbjct  304   STIITGSLNVVDGST--TFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSV  361

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTHS RQFYR  TI+GTVDFIFGNA VV Q+CK+  R+P+  QA MV
Sbjct  362   INRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIEPRRPMNNQANMV  421

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D        IQ CDIVA   L+      K +LGRPWKE+SRT+IM S I +++ 
Sbjct  422   TAQGRIDPNQNTGTSIQQCDIVASSDLEPVKKSIKTYLGRPWKEYSRTVIMQSRIGDLIQ  481

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW+ W G+FAL T +Y EY N GPG+   KRVKW GY    SP  A++FT    +   
Sbjct  482   PAGWAEWNGDFALKTLYYGEYSNTGPGSDVSKRVKWDGYHIITSPSEAQKFTVDSLIQGG  541

Query  1612  EQWLGRAQIPFSPG  1571
             E WLG +   F PG
Sbjct  542   E-WLGPSGATFIPG  554



>ref|XP_004155595.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
Length=555

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 207/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +IVVA+DGS  FKT+  A++S+P  +  R VI +K G Y+E V V  KK N++ +G+G  
Sbjct  244   NIVVAKDGSGNFKTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVGKKKKNVMIVGDGMD  303

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T+KS TV    +GF+ +D+  +NTAG  K QAVALR+ AD +V
Sbjct  304   STIITGSLNVVDGST--TFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQSV  361

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTHS RQFYR  TI+GTVDFIFGNA VV Q+CK+  R+P+  QA MV
Sbjct  362   INRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIEPRRPMNNQANMV  421

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D        IQ CDIVA   L+      K +LGRPWKE+SRT+IM S I +++ 
Sbjct  422   TAQGRIDPNQNTGTSIQQCDIVASSDLEPVKKSIKTYLGRPWKEYSRTVIMQSRIGDLIQ  481

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW+ W G+FAL T +Y EY N GPG+   KRVKW GY    SP  A++FT    +   
Sbjct  482   PAGWAEWNGDFALKTLYYGEYSNTGPGSDVSKRVKWDGYHIITSPSEAQKFTVDSLIQGG  541

Query  1612  EQWLGRAQIPFSPG  1571
             E WLG +   F PG
Sbjct  542   E-WLGPSGATFIPG  554



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 206/314 (66%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  ++T++ A+++ P  ++RR VI IKAGVY+E V V S+K N++F+G+G  
Sbjct  254   DVTVAADGSGDYRTVSEAVEAAPERSERRYVIKIKAGVYRENVEVTSRKTNLMFVGDGRT  313

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV V  EGF+ RD+T ENTAG  K QAVALR+++D + 
Sbjct  314   TTIITGSRNVVDG--STTFNSATVAVVGEGFLARDITFENTAGPSKHQAVALRVNSDFSA  371

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY GC I+GTVDFIFGNA  V Q C + AR+P   Q  MV
Sbjct  372   FYRCCMLAYQDTLYVHSLRQFYFGCFIAGTVDFIFGNAAAVLQDCDIHARRPNPSQRNMV  431

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L  A    + +LGRPWK +SRT+IM + I +I+ 
Sbjct  432   TAQGRDDPNQNTGIVIQRCRIGATSDLLEAKDSFESYLGRPWKMYSRTVIMQTVISDIIH  491

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G+FALDT +YAE+ N G GA T  RV WKGY R IS   A+ FT  PF+   
Sbjct  492   PAGWYPWDGDFALDTLYYAEHANTGDGADTANRVTWKGY-RVISASEAQAFTVDPFITGG  550

Query  1612  EQWLGRAQIPFSPG  1571
               WL     P+ PG
Sbjct  551   -SWLDSTGFPYYPG  563



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   322 bits (825),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 204/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  FKT++ A+   P  + +R VI IKAGVY+E V VP KK NI+FMG+G +
Sbjct  278   DVVVAADGSGNFKTVSEAVAKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGRS  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    E F+ RD+T +NTAGA K QAVALR+ +D++ 
Sbjct  338   NTIITGSRNVKDGST--TFHSATVAAVGEKFLARDITFQNTAGAAKHQAVALRVGSDLSA  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQD+LY HS RQ++  C I+GTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  396   FYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGNAAAVLQDCDIHARRPGSGQKNMV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  456   TAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIN  515

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
               GW  W GNFAL+T +Y EY+N G GA T  RVKWKG+K   S   A+ +TPG F+ A 
Sbjct  516   SAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI-AG  574

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  575   GSWLSSTGFPFSLG  588



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 208/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DGS  +KT+  A+ S P  +  R VI +K G YKE V V  KK N++ +G+G  
Sbjct  245   NVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLMIVGDGMD  304

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T+KS T+ V  +GF+ +DL I+NTAG  K QAVALR+SAD +V
Sbjct  305   LTIITGSLNVVDG--STTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVSADQSV  362

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLY H+ RQFYR C I+GTVDFIFGNA VV Q+CK+ ARKP+  Q+ MV
Sbjct  363   INRCRIDAYQDTLYAHTNRQFYRDCDITGTVDFIFGNAAVVLQNCKIAARKPMSKQSNMV  422

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D        IQ C+++A   L+      + +LGRPWKE+SRT++M S I + + 
Sbjct  423   TAQGRTDPNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGDHID  482

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GWS W G+FAL T +Y EY NRGPGA T KRVKW GY     PE AK+FT    L+  
Sbjct  483   PAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAE-LIGG  541

Query  1612  EQWLGRAQIPFSPG  1571
               WL    + ++ G
Sbjct  542   GSWLKSTGVAYTEG  555



>ref|XP_002889876.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66135.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   321 bits (822),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 207/311 (67%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ KFKT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  245   NVVVAKDGTGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  304

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              TVITG+ NV DG    T++S TV    +GF+ +D+  +NTAG  K QAVALR+SAD  V
Sbjct  305   VTVITGSLNVIDG--STTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTV  362

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++AR P  GQ  M+
Sbjct  363   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNML  422

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C + A   L       K FLGRPWK +SRT+IM SFIDN + 
Sbjct  423   TAQGREDQNQNTAISIQKCKLTASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHID  482

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G FAL T +Y EY N GPGA T KRVKWKG+K     + A+QFT    L+  
Sbjct  483   PAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVKWKGFKVIKDSKEAEQFTVAK-LIQG  541

Query  1612  EQWLGRAQIPF  1580
               WL    + F
Sbjct  542   GLWLKPTGVTF  552



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   322 bits (825),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 202/314 (64%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA DGS  +KT++ A+ + P  +  R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  276   NVVVAADGSGNYKTVSEAVAAAPEKSSTRYVIRIKAGVYRENVDVPKKKTNIMFLGDGRT  335

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV    E F+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  336   STIITASRNVVDGST--TFNSATVAAVGEKFIARDITFQNTAGPSKHQAVALRVGSDLSA  393

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +   + AYQD+LY HS RQF+ GC ++GTVDFIFGNA VV Q+C + ARKP  GQ  MV
Sbjct  394   FYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAVVLQNCDIHARKPNSGQKNMV  453

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+A     K FLGRPWKE+SRT+IM S I +I+ 
Sbjct  454   TAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGRPWKEYSRTVIMQSSISDIID  513

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G FALDT +Y EY N G GA T  RV WKG+K   S   A+ FTPG F+ A 
Sbjct  514   PAGWHEWSGTFALDTLFYGEYANTGAGAGTSNRVTWKGFKVITSATEAQTFTPGSFI-AG  572

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  573   GSWLSSTGFPFSLG  586



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   322 bits (824),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 205/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++ A+   P  + +R VI IKAGVY+E V VP KK NI+F+G+G  
Sbjct  271   DVVVAADGSGNYKTVSEAVAKAPQRSSKRYVIKIKAGVYRENVEVPKKKTNIMFLGDGRT  330

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             +T+ITG++NV DG    T+ S TV V  E F+ R +T +NTAG  K QAVALR+ AD++ 
Sbjct  331   ETIITGSRNVVDGST--TFHSATVAVVGERFLARSITFQNTAGPSKHQAVALRVGADLSA  388

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQFY  C I+GTVDFIFGNA  VFQ+C + AR+P  GQ  MV
Sbjct  389   FYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGNAAAVFQNCDIHARRPNSGQKNMV  448

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L++       +LGRPWKE+SRT++M S I +++ 
Sbjct  449   TAQGRTDPNQNTGIVIQKCRIGATSDLQSVTSNFPTYLGRPWKEYSRTVVMQSVISDVIH  508

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W  +FAL T +Y EY+N G GA T  RVKW+GYK   S   A+ ++PG F+ A 
Sbjct  509   PAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASEAQAYSPGRFI-AG  567

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  568   GSWLSSTGFPFSLG  581



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   321 bits (823),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 209/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDG+ K+K+I  AL  +P  + +  VI IK GVYKEYVIV     N+V +G+GP 
Sbjct  257   NVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKEGVYKEYVIVDKDMTNVVMIGDGPT  316

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+G+KN ADG    T  + T     + FV + +  ENTAGA K QAVALR+ +D ++
Sbjct  317   KTRISGSKNYADGTT--TMYTATFAAVGDYFVAKGIGFENTAGAAKHQAVALRVQSDFSI  374

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC+++AYQDTLYT +YRQ+YR CTISGTVDFIFG+   +FQ+C+M+ RKP + Q+CMV
Sbjct  375   FYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKPGDSQSCMV  434

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D+    AIV+Q+C I  EP   A    NK +LGRPWK F+R +++ S IDN + 
Sbjct  435   TAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDNAIA  494

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW+ W G     +C+ AE  NRG GA   KRVKW+   + ++PE A  FTP      D
Sbjct  495   PEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLMK-LTPEQAAAFTPARLFEGD  553

Query  1612  EQWLGRAQIPFSPGYV  1565
              +W+  + +P+  G +
Sbjct  554   -KWVKPSGVPYVSGMM  568



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   322 bits (824),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 211/317 (67%), Gaps = 8/317 (3%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRT-VILIKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             ++ VA DGS  FK+IN AL  +P    +   VI IKAGVY+EYV V +   +IVF+G+G 
Sbjct  256   NVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKAGVYREYVEVLTNMTHIVFVGDGG  315

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              K++ITGNKN  DGV   TY + TV ++ + F   ++  EN+AG  K QAVALR+  D A
Sbjct  316   KKSIITGNKNFMDGVT--TYHTATVAIQGDHFTAINMGFENSAGPQKHQAVALRVQGDKA  373

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ+CK + RKP+  Q C+
Sbjct  374   IFYNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPMSDQQCI  433

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGRK+R   +AIVI+   IVA+P        +K +L RPWK FSRT+IM +FID+++
Sbjct  434   VTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLI  493

Query  1795  VPEGWSPW---KGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1625
              P+G+ PW   +G   +DTC+YAEY N GPG+   KRVKW G   NI+ + A++F P  F
Sbjct  494   HPDGFLPWHTEEGPINMDTCYYAEYHNYGPGSDKSKRVKWAGI-YNINTKAAQKFAPSKF  552

Query  1624  LMADEQWLGRAQIPFSP  1574
                 + W+    IP+ P
Sbjct  553   FHGGD-WIKDTGIPYYP  568



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   332 bits (850),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVAQDGS KFKTI  A+  IP       +I IK GVY EY+++     N+VF+G+GP 
Sbjct  285   NVVVAQDGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMTNVVFVGDGPT  344

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT IT NKN ADG    T+K+ T++V  + F+ +D+ +EN+AGA+K QAVA R  +D ++
Sbjct  345   KTRITNNKNYADGT--KTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAFRAQSDKSI  402

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NCH + YQDTLYTH+YRQFYR C I+GT+DFIFG+A V FQ+C  + RKPLE Q C+V
Sbjct  403   FFNCHFDGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLENQNCIV  462

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR +R     I+I +    A+P        NK +LGRPWKE+S+T+IM S I +++ 
Sbjct  463   TAQGRMERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQ  522

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             PEGW PW+GNF LDT +Y EY N G GA    RVKW+G K  I    A++F P P L  +
Sbjct  523   PEGWLPWEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFMP-PILYEN  580

Query  1612  EQWLGRAQIPFSPGYV  1565
             + W+  + IP+ P  +
Sbjct  581   DDWIRDSGIPYDPALI  596



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   335 bits (859),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 216/317 (68%), Gaps = 5/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVIL-IKAGVYKEYVIVPSKKNNIVFMGEGP  2336
             D++VA+DG+  + TIN AL +IP     +T++L I+ GVY+E +   S   N+  +G+GP
Sbjct  247   DLIVAKDGTGNYPTINEALKNIPKSGKNKTIVLYIREGVYEEKLQFNSSMKNLFVIGDGP  306

Query  2335  AKTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMA  2156
              KT ITG  N  DG    TY++ TV V+ + F+ RD+  ENTAG  K QAVALR+SAD A
Sbjct  307   TKTRITGKSNFIDGT--NTYQTATVAVQGDDFIARDIGFENTAGPEKHQAVALRVSADKA  364

Query  2155  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACM  1976
             + +NCH++AYQDTLY H+YRQFYR C ISGT+DFIFG++  VFQ+C ++ RKPLE Q C+
Sbjct  365   IFYNCHMDAYQDTLYAHAYRQFYRNCRISGTIDFIFGDSAAVFQNCTLLVRKPLENQQCV  424

Query  1975  VTAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1796
             VTAQGRK+ R     ++Q+C I  +  L A     K +LGRPWK++SRT+IM SF+D+++
Sbjct  425   VTAQGRKEIRQPTGFILQNCSIRPDRDLYAIRKNIKTYLGRPWKQYSRTVIMESFLDDLI  484

Query  1795  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1616
              P GW PW G FALDT +Y E+ NRGP A   +R +W G K   S  + ++FT   FL  
Sbjct  485   CPTGWLPWNGTFALDTLFYTEFNNRGPAAPKKQRARWPGVKELPSSRI-QRFTAVEFLDG  543

Query  1615  DEQWLGRAQIPFSPGYV  1565
             +  W+ R Q+P++PG+V
Sbjct  544   N-GWIPRTQVPYTPGFV  559



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   320 bits (821),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 206/311 (66%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ KFKT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  246   NVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  305

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S TV    +GF+ +D+  +NTAG  K QAVALR+SAD  V
Sbjct  306   ATIITGSLNVIDG--STTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTV  363

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++AR P  GQ  M+
Sbjct  364   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNML  423

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       K FLGRPWK +SRT+IM SFIDN + 
Sbjct  424   TAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHID  483

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G FAL T +Y EY N GPGA T KRV WKG+K     + A+QFT    L+  
Sbjct  484   PAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAK-LIQG  542

Query  1612  EQWLGRAQIPF  1580
               WL    + F
Sbjct  543   GLWLKPTGVTF  553



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   321 bits (823),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 205/312 (66%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA DGS  FKT+ AA+ + P    +R +I IKAGVY+E V V  K  NI+F+G+G  +T
Sbjct  275   VVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRT  334

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG++NV DG    T+KS TV V  EGF+ RD+T +NTAG  K QAVALR+ AD++  +
Sbjct  335   IITGSRNVVDGST--TFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFY  392

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC + AYQDTLY HS RQF+  C I+GTVDFIFGNA  V Q+C + ARKP  GQ  MVTA
Sbjct  393   NCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTA  452

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D      IVIQ   I A   LK        +LGRPWKE+SRT+IM S I +++ P 
Sbjct  453   QGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDLIHPA  512

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFAL+T +Y E++N G GA T  RVKWKG++   S   A+ FTPG F+ A   
Sbjct  513   GWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI-AGSS  571

Query  1606  WLGRAQIPFSPG  1571
             WLG    PFS G
Sbjct  572   WLGSTGFPFSLG  583



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   321 bits (823),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++AA+ + P  + +R +I IKAGVY+E V VP  K NI+FMG+G  
Sbjct  273   DVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGDGRK  332

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV    +GF+ R +T +NTAG  K QAVALR+ +D++ 
Sbjct  333   TTIITASRNVVDG--STTFNSATVAAVGQGFLARGITFQNTAGPSKHQAVALRVGSDLSA  390

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              ++C + AYQDTLY HS RQF+  C ++GTVDFIFGNA VV Q C + AR+P  GQ  MV
Sbjct  391   FYDCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMV  450

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  451   TAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSRTVIMQSSITDVIQ  510

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL+T +YAEY+N G GA T +RV WKGY+   S   A++FTPG F+ A 
Sbjct  511   PAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATEAQRFTPGNFI-AG  569

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  570   SSWLRSTTFPFSLG  583



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   321 bits (822),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT++AA+ + P  + +R +I IKAGVY+E V VP  K NI+FMG+G  
Sbjct  269   DVVVAADGSGNYKTVSAAVAAAPKKSSKRYIIRIKAGVYRENVDVPKDKTNIMFMGDGRK  328

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV    +GF+ R +T +NTAG  K QAVALR+ +D++ 
Sbjct  329   TTIITASRNVVDG--STTFNSATVAAVGQGFLARGITFQNTAGPSKHQAVALRVGSDLSA  386

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              ++C + AYQDTLY HS RQF+  C I+GTVDFIFGNA VV Q C + AR+P  GQ  MV
Sbjct  387   FYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMV  446

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   L+        +LGRPWKE+SRT+IM S I +++ 
Sbjct  447   TAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSRTVIMQSSITDVIQ  506

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL+T +YAEY+N G GA T +RV WKGY+   S   A++FTPG F+ A 
Sbjct  507   PAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATEAQRFTPGNFI-AG  565

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  566   SSWLRSTTFPFSLG  579



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   320 bits (820),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 206/311 (66%), Gaps = 3/311 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++VVA+DG+ KFKT+N A+ + P  ++ R VI +K GVYKE + +  KK N++ +G+G  
Sbjct  246   NVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  305

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG+ NV DG    T++S TV    +GF+ +D+  +NTAG  K QAVALR+SAD  V
Sbjct  306   ATIITGSLNVIDG--STTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVALRVSADQTV  363

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
             ++ C ++AYQDTLYTH+ RQFYR   I+GTVDFIFGN+ VVFQ+C ++AR P  GQ  M+
Sbjct  364   INRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNML  423

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR+D+    AI IQ C I A   L       K FLGRPWK +SRT+IM SFIDN + 
Sbjct  424   TAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHID  483

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW PW G FAL T +Y EY N GPGA T KRV WKG+K     + A+QFT    L+  
Sbjct  484   PAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAK-LIQG  542

Query  1612  EQWLGRAQIPF  1580
               WL    + F
Sbjct  543   GLWLKPTGVTF  553



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   320 bits (821),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 206/314 (66%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS K++T++AA+ + P  + +R +I IKAGVY+E V VPS+K NI+F+G+G  
Sbjct  261   DVVVAADGSGKYRTVSAAVAAAPKHSGKRYIIKIKAGVYRENVEVPSEKTNIMFLGDGRK  320

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+IT ++NV DG  G TY S TV V  +GF+ RD+T +NTAGA K QAVALR+ +D A 
Sbjct  321   KTIITASRNVVDG--GTTYHSATVAVVGQGFLARDITFQNTAGASKYQAVALRVESDFAA  378

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQ+TLY HS RQF+  C I+GTVDFIFGN+  VFQ C + AR+P  GQ   +
Sbjct  379   FYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGNSAAVFQDCDIHARRPNPGQTITI  438

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A P L+ A      +LGRPWKE+SRT+IM S I +++ 
Sbjct  439   TAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVIS  498

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  WKG FAL+T  +AEY+N G GA T  RV WKGYK       A+ FT   F+   
Sbjct  499   PAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEAQAFTARNFITG-  557

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  558   SSWLKSTTFPFSLG  571



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   321 bits (822),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 216/324 (67%), Gaps = 10/324 (3%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VA+DGS KFK IN AL  +P  N +  VI IK GVY EYV V  K  ++VF+G+G  
Sbjct  278   NVIVAKDGSGKFKKINDALKHVPKKNKKIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGN  337

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT ITGNKN  DGV   TYK+ TV +  + FV  ++  EN+AG  K QAVA+R+ AD ++
Sbjct  338   KTRITGNKNFIDGV--NTYKTPTVAIAGDYFVAINIGFENSAGPQKHQAVAIRVQADKSI  395

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C ++ YQDTLY H+ RQFYR CTISGT+DF+FG+A  +FQ+C  + RKPLE Q C+V
Sbjct  396   FYKCSIDGYQDTLYAHTMRQFYRDCTISGTIDFVFGDAVAIFQNCTFVVRKPLENQQCIV  455

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD+   + IVIQ C IV++         NK +L RPWK +SRT+ M ++I +++ 
Sbjct  456   TAQGRKDKHQPSGIVIQGCSIVSDT--HNVKFDNKAYLARPWKNYSRTIFMKTYIGDLIE  513

Query  1792  PEGWSPWK---GNFA-LDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1625
             P+G+ PW+   G    +DTC+Y EYKN+GPG++  KRVKW+G K N++   A  F P  F
Sbjct  514   PDGYMPWQLPNGTLTGMDTCFYVEYKNKGPGSNKSKRVKWRGIK-NLTSHTASVFLPYKF  572

Query  1624  LMADEQWLGRAQIPFSPGYV*NKQ  1553
                D+ W+   ++P+S G + +K 
Sbjct  573   FHGDD-WIKVTRVPYSSGEISSKH  595



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   321 bits (822),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 201/314 (64%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D VVA DGS  F++I  A+ + P  + +R VI IKAGVY+E V V  KK N++F+GEG  
Sbjct  281   DAVVAADGSGDFRSIAEAVKAAPDKSKKRYVIRIKAGVYQENVEVGKKKMNLMFIGEGRT  340

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG KNV DG    T+ S TV +  + F+ RDLT ENTAG  K QAVALR+ AD+A 
Sbjct  341   KTIITGKKNVVDGST--TFDSATVAITGDNFLARDLTFENTAGPSKHQAVALRVGADLAA  398

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY H  RQF+  C I+GTVDFIFGNA VVFQ C + ARKP   Q  M+
Sbjct  399   FYQCDILAYQDTLYVHKNRQFFVKCLIAGTVDFIFGNAAVVFQDCDIHARKPNSNQKNMI  458

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQ R D      IVIQ C I     L+A       +LGRPWK++SRT+IM SFI ++V 
Sbjct  459   TAQSRTDINQNTGIVIQKCRIDGTSDLQATKNSFSTYLGRPWKDYSRTVIMQSFISDVVH  518

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
               GW  W+G +AL T  Y EYKN GPGA T KRV+W+G +     + A++FTPG F+ A 
Sbjct  519   ENGWHEWEGEYALKTLHYMEYKNSGPGADTSKRVQWRGVQEISEVDKAQEFTPGNFI-AG  577

Query  1612  EQWLGRAQIPFSPG  1571
               WL     P+S G
Sbjct  578   GSWLASTTFPYSLG  591



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   321 bits (822),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 201/314 (64%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS  +KT+  A+ + P  + +R VI IKAGVYKE V V  KK NI+FMG+G  
Sbjct  281   DVVVAADGSGDYKTVAEAVANAPEKSSKRYVIRIKAGVYKESVEVSKKKKNIMFMGDGRE  340

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+ITG++NV DG    T+ S TV    EGF+ RD+T ENTAG  K QAVALR+ AD++ 
Sbjct  341   NTIITGSRNVKDGST--TFHSATVAAVGEGFLARDITFENTAGHEKHQAVALRVGADLSA  398

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C +  YQDTLY HS RQF+  C ISGTVDFIFGNA  V Q C + AR+P  GQ  MV
Sbjct  399   FYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDFIFGNAAAVLQDCDIHARRPGPGQKNMV  458

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRKD      IVIQ   I A   LK+       +LGRPWKE+SRT+IM   I +++ 
Sbjct  459   TAQGRKDPNQNTGIVIQKSRIGATSDLKSVQKNFPTYLGRPWKEYSRTVIMQCSIADVIS  518

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FALDT +Y EY+N G GA T  RVKWKG+K   S   A+ +TP  F+ A 
Sbjct  519   PTGWHEWNGDFALDTLFYGEYENTGAGAGTSGRVKWKGFKVITSATEAQDYTPNKFI-AG  577

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PF+ G
Sbjct  578   NSWLSSTGFPFALG  591



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score =   320 bits (819),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 211/313 (67%), Gaps = 4/313 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS KFKTI  A++S+P  +  R VI +KAGVY+E V+VP  K NI   G+GP ++
Sbjct  253   VVAKDGSGKFKTIQDAVNSMPKDHPGRYVIYVKAGVYEEMVMVPKDKVNIFMYGDGPKQS  312

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              +TG+K+ ADG+   T K+ T ++EA GF+C+++   NTAGA K QAVALR+  D++   
Sbjct  313   RVTGSKSFADGIT--TMKTATFSIEAAGFICKNMGFHNTAGAEKHQAVALRVQGDLSAFF  370

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC  +A+QDTLY H+ RQF+R C ISGT+DFIFGN+  VFQ+C +I R+P++ Q   VTA
Sbjct  371   NCRFDAFQDTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTA  430

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
              GR D    + +VIQ+C +V +  L A       +LGRPWKEFSR +IM S I + + PE
Sbjct  431   HGRTDPNMKSGLVIQNCRLVPDQKLFADRFKIPSYLGRPWKEFSRLVIMESMIADFIKPE  490

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             G+ PW G+FAL T +YAE+ NRGPGA T KRV W G+ R I  + A+QFT GPF+     
Sbjct  491   GYMPWNGDFALKTLYYAEFGNRGPGAGTSKRVTWPGF-RVIGNKEAEQFTAGPFIDG-AT  548

Query  1606  WLGRAQIPFSPGY  1568
             WL    +P   G+
Sbjct  549   WLKFTGMPNYLGF  561



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   320 bits (820),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 202/314 (64%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVA DGS K+K I  A+++ P+ + +R +I IKAGVY+E V VP  K NI+F+G+G  
Sbjct  270   DVVVAADGSGKYKKIQDAVNAAPSKSSKRYIIRIKAGVYRENVEVPKSKTNIMFLGDGRK  329

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NVADG    T+ S TV    +GF+ +D+T ENTAG  K QAVALR+ +D++ 
Sbjct  330   TTIITASRNVADGST--TFNSATVAAVGQGFLAKDITFENTAGPSKHQAVALRVGSDLSA  387

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C + AYQDTLY HS RQF+  C ++GTVDFIFGNA  V Q C + ARKP  GQ  MV
Sbjct  388   FYQCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGNAAAVLQDCDIHARKPNSGQKNMV  447

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ   I A   LK        +LGRPWKE+SRT+IM S I +++ 
Sbjct  448   TAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTYLGRPWKEYSRTVIMQSTISDVIH  507

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL+T  Y EY+N G GA T  RV WKGYK   S   A+ FTPG F+ A 
Sbjct  508   PAGWHLWTGDFALNTLTYREYQNSGAGAGTSNRVTWKGYKVITSASEAQAFTPGNFI-AG  566

Query  1612  EQWLGRAQIPFSPG  1571
               WL     PFS G
Sbjct  567   SNWLRGTTFPFSLG  580



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   319 bits (817),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 204/312 (65%), Gaps = 3/312 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS  +KT+  A+++ P     R VI +KAG YKE V +   K N++ +G+G  KT
Sbjct  239   VVAKDGSGNYKTVQEAVNAAPNNAQSRYVIYVKAGTYKEKVDIGKNKKNLMLVGDGMDKT  298

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             +ITG+ NV DG    T+ S TV   A+GF+ +DL  +NTAG  K QAVALR+ AD +V++
Sbjct  299   IITGSLNVVDGST--TFNSATVAAVADGFIAQDLGFQNTAGPQKHQAVALRVGADKSVIN  356

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
              C ++A+QDTLYTHS RQF+R C I+GTVDFIFG+A VVFQ+ K+ ARKP+  Q  MVTA
Sbjct  357   RCKIDAFQDTLYTHSLRQFFRDCYITGTVDFIFGDAAVVFQNSKLAARKPMSNQQNMVTA  416

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR D        IQ+CD++    L       K +LGRPWKE+SRT++M S IDN +VPE
Sbjct  417   QGRVDPNSNTGTSIQNCDVIPSSDLAPVKGSIKTYLGRPWKEYSRTVVMQSNIDNHIVPE  476

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GWS W G+FAL T +Y EY+NRGPGA T  RVKW GY    S   A +FT    +   E 
Sbjct  477   GWSVWSGDFALKTLYYGEYQNRGPGAGTSGRVKWPGYHVITSAAEASKFTVAQLIQGGE-  535

Query  1606  WLGRAQIPFSPG  1571
             WL    + ++ G
Sbjct  536   WLKNTGVAYTEG  547



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   320 bits (819),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA DGS  FK+IN AL  +P  N +  VI IK GVY+EYV V  K  ++VF+GEG  
Sbjct  255   NVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGK  314

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+GNKN  DG    TY++ TV ++ + FV  ++  EN+AG  K QAVALR+ AD ++
Sbjct  315   KTRISGNKNFIDGT--NTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVALRVQADKSI  372

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ+C  + RKPLE Q C+V
Sbjct  373   FYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPLENQQCIV  432

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+R+  + IVIQ   IV++P   +    NK +L RPWK +SRT+IM ++ID+++ 
Sbjct  433   TAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLID  492

Query  1792  PEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ + A+ F+P  F 
Sbjct  493   ADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFF  551

Query  1621  MADEQWLGRAQIPFSPG  1571
                + W+    IP  PG
Sbjct  552   HGTD-WIEVTGIPCFPG  567



>ref|XP_002981054.1| hypothetical protein SELMODRAFT_114014 [Selaginella moellendorffii]
 gb|EFJ17755.1| hypothetical protein SELMODRAFT_114014 [Selaginella moellendorffii]
Length=411

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 206/314 (66%), Gaps = 7/314 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VAQDGS ++ TI  A+++ P+ +    VI IKAG Y+E V VP  K N++F+G+G  
Sbjct  104   NVIVAQDGSGRYSTIKQAVEAAPSKSGSTYVIYIKAGTYRETVSVPKSKTNLMFVGDGIG  163

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+K+V+DGV   T+++ TV + A GF+ RDLTI NTAGA K QAVALR+SAD   
Sbjct  164   KTIITGSKSVSDGVT--TFRTSTVEINARGFLARDLTIRNTAGAAKHQAVALRVSADKVA  221

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C    YQDTLYTH  RQFYR C + GTVDFIFG+A  VFQSC ++ARKP+  Q   +
Sbjct  222   FYKCSFEGYQDTLYTHVARQFYRECIVYGTVDFIFGDAAAVFQSCTLLARKPMAKQKNTI  281

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      +  Q C +     LK +  P   +LGRPWK++SRT+ +  ++ ++V 
Sbjct  282   TAQGRTDPNQNTGLSFQDCSVDGTQDLKGSGTP--TYLGRPWKKYSRTVFLRCYMGSVVN  339

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+++GPG+ T  RV W    +  S  VA +FT G F+   
Sbjct  340   PAGWLEWDGSFALKTLYYAEYQSKGPGSGTGNRVGWS--SQMSSSVVANKFTAGSFISGS  397

Query  1612  EQWLGRAQIPFSPG  1571
             + WLG+   P+S G
Sbjct  398   D-WLGQTSFPYSLG  410



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   320 bits (819),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 203/314 (65%), Gaps = 3/314 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVA+DGS  + TI+AA+ + P  +  R VI IK GVY+E V +P  K+N++F+G+G   T
Sbjct  274   VVAKDGSGSYTTISAAVAAAPEKSTSRYVIHIKKGVYQENVDIPKNKHNLMFIGDGKDVT  333

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
             V+T N+NV DG    T+ S T  V  +GFV RD+T +NTAG  K QAVALR+ +D++   
Sbjct  334   VVTANRNVVDGYT--TFHSATAAVTGKGFVARDMTFKNTAGPTKHQAVALRVGSDLSAFL  391

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
              C    YQDTLY HS RQFYR C + GTVDF+FGNA VV Q+C ++ARKP   Q  M TA
Sbjct  392   RCTFEGYQDTLYVHSLRQFYRECDVYGTVDFVFGNAAVVLQNCNIMARKPSANQKIMYTA  451

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
             QGR+D      I IQ+C + A   L AA    +V+LGRPWK++SRT+I+ S +D+++ P 
Sbjct  452   QGREDPNQNTGISIQNCRLSATSDLVAAKSSFQVYLGRPWKQYSRTVILQSHLDDLIHPA  511

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             GW  W GNFAL T +Y EY NRGPGA+T  RVKW G++   S   A QFT   FL  D  
Sbjct  512   GWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHRVITSSSEANQFTVNQFLQGDS-  570

Query  1606  WLGRAQIPFSPGYV  1565
             WL    + ++ G+ 
Sbjct  571   WLPATGVQYTAGFT  584



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   322 bits (826),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 211/314 (67%), Gaps = 4/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+VVAQDGS ++KTI+ A+ ++P   +   V+ IK GVYKE+V V    +++VF+G+GP 
Sbjct  237   DMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQVDRTMSDLVFIGDGPD  296

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KTVITG K+  DG+   TY++ TV +  + F+ +++  ENTAGA K QAV +R+ +D ++
Sbjct  297   KTVITGEKSFQDGIT--TYRTATVAIIGDRFIAKNMGFENTAGAAKHQAVGIRVLSDQSI  354

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ+C ++ RKPL  QAC +
Sbjct  355   FYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRKPLPNQACPI  414

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TA GR+D +     V+Q C I  E    A    +K +LGRPWK +S+T+IM +FI + + 
Sbjct  415   TAHGREDPKETTGFVLQGCTIAGEADYLAVKESSKAYLGRPWKAYSKTIIMDTFIPDFIA  474

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
              EGW  WKGNF +DT +Y+E +N GPGA    RV W G K+ +S E    +TP  ++  D
Sbjct  475   AEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSDEDILGYTPAKYIQGD  533

Query  1612  EQWLGRAQIPFSPG  1571
             E W+    +P++PG
Sbjct  534   E-WIPSKGVPYTPG  546



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 212/317 (67%), Gaps = 7/317 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             ++ VA DGS  FK+IN AL  +P  N +  VI IK GVY+EYV V  K  ++VF+GEG  
Sbjct  231   NVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGK  290

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT I+GNKN  DG    TY++ TV ++ + FV  ++  EN+AG  K QAVALR+ AD ++
Sbjct  291   KTRISGNKNFIDGT--NTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVALRVQADKSI  348

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ+C  + RKP+E Q C+V
Sbjct  349   FYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMENQQCIV  408

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGRK+R+  + IVIQ   IV++P   +    NK +L RPWK +SRT+IM ++ID+++ 
Sbjct  409   TAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLID  468

Query  1792  PEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1622
              +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ + A+ F+P  F 
Sbjct  469   ADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFF  527

Query  1621  MADEQWLGRAQIPFSPG  1571
                + W+    IP  PG
Sbjct  528   HGTD-WIEVTGIPCFPG  543



>ref|XP_002982529.1| hypothetical protein SELMODRAFT_116557 [Selaginella moellendorffii]
 gb|EFJ16282.1| hypothetical protein SELMODRAFT_116557 [Selaginella moellendorffii]
Length=406

 Score =   314 bits (804),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 206/314 (66%), Gaps = 7/314 (2%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             +++VAQDGS ++ TI  A+++ P+ +    VI IKAG Y+E V VP  K N++F+G+G  
Sbjct  99    NVIVAQDGSGRYSTIKQAVEAAPSKSGSTYVIYIKAGTYRETVSVPKSKTNLMFVGDGIG  158

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
             KT+ITG+K+V+DGV   T+++ TV + A GF+ RDLTI NTAGA K QAVALR+SAD   
Sbjct  159   KTIITGSKSVSDGVT--TFRTSTVEINARGFLARDLTIRNTAGAAKHQAVALRVSADKVA  216

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
              + C    YQDTLYTH  RQFYR C + GTVDFIFG+A  VFQSC ++ARKP+  Q   +
Sbjct  217   FYKCSFEGYQDTLYTHVARQFYRECIVYGTVDFIFGDAAAVFQSCTLLARKPMAKQKNTI  276

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      +  Q C +     LK +  P   +LGRPWK++SRT+ +  ++ ++V 
Sbjct  277   TAQGRTDPNQNTGLSFQDCSVDGTQDLKGSGTP--TYLGRPWKKYSRTVFLRCYMGSVVN  334

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W G+FAL T +YAEY+++GPG+ T  RV W    +  S  VA +FT G F+   
Sbjct  335   PAGWLEWDGSFALKTLYYAEYQSKGPGSGTGNRVGWS--SQMSSSVVANKFTAGSFISGS  392

Query  1612  EQWLGRAQIPFSPG  1571
             + WLG+   P+S G
Sbjct  393   D-WLGQTSFPYSLG  405



>gb|EAY94391.1| hypothetical protein OsI_16158 [Oryza sativa Indica Group]
Length=568

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 209/313 (67%), Gaps = 4/313 (1%)
 Frame = -3

Query  2506  VVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPAKT  2327
             VVAQDGS +FKTI  A++S+P  +  R VI +KAG+Y E V+VP  K NI   G+GP ++
Sbjct  258   VVAQDGSGQFKTIQEAVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRS  317

Query  2326  VITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAVVH  2147
              +TG K+ ADG+   T K+ T +VEA GF+C+++   NTAGA + QAVALRI+ D+   +
Sbjct  318   RVTGRKSFADGIT--TMKTATFSVEAAGFICKNMGFHNTAGAERHQAVALRINGDLGAFY  375

Query  2146  NCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMVTA  1967
             NC  +A+QDTLY H+ RQF+R C ISGT+DFIFGN+  VFQ+C +I R+P++ Q   VTA
Sbjct  376   NCRFDAFQDTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTA  435

Query  1966  QGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPE  1787
              GR D    + +VIQ+C +V +  L         +LGRPWKE+SR +IM S I + + PE
Sbjct  436   HGRTDPNMKSGLVIQNCRLVPDQKLFPDRFKIPAYLGRPWKEYSRLVIMESTIADFIKPE  495

Query  1786  GWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQ  1607
             G+ PW G FAL+T +YAE+ NRGPGA T KRV WKG+ R I  + A+QFT GPF+     
Sbjct  496   GYMPWNGEFALNTLYYAEFNNRGPGAGTSKRVNWKGF-RVIGQKEAEQFTAGPFVDGG-T  553

Query  1606  WLGRAQIPFSPGY  1568
             WL     P   G+
Sbjct  554   WLKFTGTPHFLGF  566



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   317 bits (811),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 197/314 (63%), Gaps = 3/314 (1%)
 Frame = -3

Query  2512  DIVVAQDGSAKFKTINAALDSIPAINDRRTVILIKAGVYKEYVIVPSKKNNIVFMGEGPA  2333
             D+ VA DGS  FKT+  A+ + P  + +R VI IK GVY+E V V  KK NI+F+G+G  
Sbjct  181   DVTVAADGSGDFKTVTEAVKAAPLKSSKRYVIRIKGGVYRENVEVDKKKTNIMFLGDGRT  240

Query  2332  KTVITGNKNVADGVVGGTYKSGTVTVEAEGFVCRDLTIENTAGAVKEQAVALRISADMAV  2153
              T+IT ++NV DG    T+ S TV V    F+ RD+T +NTAG  K QAVALR+  D++ 
Sbjct  241   NTIITASRNVVDG--STTFHSATVAVVGANFLARDITFQNTAGPSKHQAVALRVGGDLSA  298

Query  2152  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQSCKMIARKPLEGQACMV  1973
               NC   A+QDTLY H+ RQF+  C I+GTVDFIFGN+ VVFQ C + AR P  GQ  MV
Sbjct  299   FFNCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGNSAVVFQDCDIHARLPDSGQKNMV  358

Query  1972  TAQGRKDRRGAAAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1793
             TAQGR D      IVIQ C I A   L++     K +LGRPWKE+SRT+IM S I +++ 
Sbjct  359   TAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSRTVIMQSSISDVID  418

Query  1792  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1613
             P GW  W GNFAL T  Y EY+N GPGA T  RV WKGYK       A+ +TPG F+   
Sbjct  419   PIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAEARDYTPGSFI-GG  477

Query  1612  EQWLGRAQIPFSPG  1571
               WLG    PFS G
Sbjct  478   SSWLGSTGFPFSLG  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8072089289920