BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i7 len=914 path=[8281:0-45 8327:46-49 8331:50-103
8385:104-162 8444:163-189 49566:190-273 14544:274-376 3049:377-567
43851:568-625 3298:626-663 3336:664-721 3394:722-800 6632:801-808
3478:809-891 17146:892-910 3580:911-913]

Length=914
                                                                      Score     E

ref|XP_009761202.1|  PREDICTED: pectinesterase                          439   9e-148   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     437   6e-147   
emb|CDO98832.1|  unnamed protein product                                417   5e-139   
emb|CDO98833.1|  unnamed protein product                                414   3e-138   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    412   2e-137   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     407   2e-135   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     403   5e-134   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     402   2e-133   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                396   7e-131   
emb|CDO98834.1|  unnamed protein product                                392   1e-129   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     388   5e-128   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     377   1e-123   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     377   1e-123   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 374   3e-122   Ricinus communis
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     370   1e-120   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             367   9e-120   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     366   1e-119   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    367   2e-119   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     366   2e-119   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                367   2e-119   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    367   2e-119   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    366   3e-119   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    366   6e-119   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    365   6e-119   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                366   6e-119   
ref|XP_002314364.1|  putative pectinesterase family protein             364   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     362   7e-118   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     362   1e-117   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     362   2e-117   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     360   1e-116   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    359   1e-116   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     358   3e-116   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    352   4e-116   Petunia integrifolia [violet-flowered petunia]
ref|XP_002872255.1|  pectinesterase family protein                      360   5e-116   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    362   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    357   3e-115   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     355   3e-115   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    359   4e-115   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    355   4e-115   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                359   4e-115   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             355   8e-115   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          355   9e-115   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                353   1e-114   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         354   2e-114   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    357   3e-114   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    352   5e-114   
gb|EPS72184.1|  pectinesterase family protein                           351   1e-113   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    352   1e-113   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     352   3e-113   
emb|CDY19737.1|  BnaA09g03900D                                          349   3e-113   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          351   4e-113   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                350   5e-113   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    354   5e-113   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    350   5e-113   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     349   7e-113   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    358   7e-113   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                350   8e-113   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    355   1e-112   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    343   1e-112   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         349   1e-112   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    352   1e-112   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             349   2e-112   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    349   2e-112   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    349   2e-112   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     348   3e-112   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    353   4e-112   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             352   5e-112   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    350   5e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     347   6e-112   
emb|CDX99968.1|  BnaC09g03330D                                          350   1e-111   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             351   1e-111   
gb|EPS70728.1|  pectinesterase                                          346   1e-111   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    347   2e-111   
ref|XP_002884519.1|  pectinesterase family protein                      349   2e-111   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    347   2e-111   
emb|CDP21547.1|  unnamed protein product                                348   4e-111   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    346   5e-111   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    348   5e-111   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     348   7e-111   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             345   1e-110   
dbj|BAC42986.1|  putative pectinesterase                                346   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         343   4e-110   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             343   4e-110   
emb|CBI39537.3|  unnamed protein product                                348   7e-110   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    344   8e-110   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 342   8e-110   Ricinus communis
ref|XP_002865716.1|  pectinesterase family protein                      342   1e-109   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    342   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    342   1e-109   
emb|CDX80613.1|  BnaC07g28310D                                          345   1e-109   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             345   3e-109   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     340   3e-109   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                350   6e-109   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    340   6e-109   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             340   6e-109   
emb|CDY27751.1|  BnaA05g31600D                                          341   8e-109   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             339   1e-108   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    342   1e-108   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          340   1e-108   
emb|CDY05188.1|  BnaC05g46150D                                          340   2e-108   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             338   3e-108   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    338   4e-108   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    338   6e-108   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    338   7e-108   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    336   2e-107   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    340   2e-107   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    340   2e-107   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          338   3e-107   
emb|CDX74137.1|  BnaA03g29100D                                          339   3e-107   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    339   3e-107   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    338   5e-107   
emb|CDY68790.1|  BnaAnng28400D                                          338   5e-107   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    335   5e-107   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    335   7e-107   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    334   1e-106   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    336   2e-106   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    332   3e-106   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          333   4e-106   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    331   2e-105   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     330   2e-105   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             330   4e-105   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             330   4e-105   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    329   8e-105   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    328   1e-104   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     328   2e-104   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    328   3e-104   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     328   3e-104   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    328   3e-104   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     324   3e-104   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    327   5e-104   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    327   7e-104   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    327   8e-104   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    327   8e-104   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    326   1e-103   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    326   2e-103   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     325   2e-103   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    325   2e-103   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     324   3e-103   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     325   4e-103   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    325   6e-103   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     325   6e-103   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             325   6e-103   Populus trichocarpa [western balsam poplar]
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    324   8e-103   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     318   1e-102   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    324   1e-102   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    323   1e-102   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          323   2e-102   
ref|XP_006382447.1|  pectin methylesterase family protein               323   2e-102   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    323   3e-102   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    321   5e-102   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     319   5e-102   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    322   5e-102   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    321   1e-101   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    321   2e-101   
emb|CBI22967.3|  unnamed protein product                                334   3e-101   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    320   5e-101   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    319   7e-101   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    319   9e-101   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    318   1e-100   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     318   1e-100   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    318   2e-100   
gb|EPS69059.1|  hypothetical protein M569_05708                         331   2e-100   
emb|CDY33925.1|  BnaA02g30620D                                          318   2e-100   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    318   2e-100   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             314   2e-100   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    318   7e-100   
ref|XP_003591166.1|  Pectinesterase                                     317   9e-100   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    314   3e-99    
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    315   3e-99    
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             315   4e-99    
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     314   4e-99    
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    314   7e-99    
ref|XP_003591168.1|  Pectinesterase                                     314   8e-99    
ref|XP_003626199.1|  Pectinesterase                                     314   8e-99    
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    313   1e-98    
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    314   1e-98    
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 312   1e-98    
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    313   2e-98    
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    308   3e-98    Medicago sativa [alfalfa]
ref|XP_003591164.1|  Pectinesterase                                     312   4e-98    
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    312   5e-98    
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    311   8e-98    
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    311   1e-97    
ref|XP_003604119.1|  Pectinesterase                                     312   2e-97    
ref|XP_010667122.1|  PREDICTED: pectinesterase                          310   3e-97    
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    309   5e-97    
gb|AAF63815.1|  pectin methylesterase, putative                         308   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AGT17860.1|  pollen-specific pectin methylesterase                   309   6e-97    
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 308   1e-96    
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             308   2e-96    
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     308   2e-96    
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     307   2e-96    
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    308   3e-96    
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    307   3e-96    
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   307   3e-96    
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    307   4e-96    
gb|EPS59322.1|  pectinesterase                                          305   5e-96    
dbj|BAC42959.2|  putative pectin methylesterase                         306   6e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             306   7e-96    
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    306   7e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    306   8e-96    
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     305   8e-96    
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             305   1e-95    
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    308   1e-95    
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             305   2e-95    
ref|XP_002882495.1|  pectinesterase family protein                      305   2e-95    
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    305   3e-95    
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    304   5e-95    
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    303   5e-95    
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    305   5e-95    
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 304   6e-95    
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             307   6e-95    
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             307   6e-95    
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             307   6e-95    
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             307   8e-95    
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    302   1e-94    
emb|CAB65291.1|  pectin methyl-esterase PEF1                            303   1e-94    Medicago truncatula
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 303   1e-94    
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    303   1e-94    
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                303   1e-94    
ref|XP_002324181.2|  pectinesterase family protein                      303   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    295   2e-94    
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    302   2e-94    
gb|AEL79481.1|  pectin methylesterase-like protein                      301   3e-94    
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    302   3e-94    
ref|XP_007031044.1|  Pectinesterase, putative                           303   5e-94    
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 301   6e-94    
emb|CDY71928.1|  BnaCnng75130D                                          295   6e-94    
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    300   9e-94    
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    301   1e-93    
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             300   2e-93    
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    303   2e-93    
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             299   2e-93    
ref|XP_003604120.1|  Pectinesterase                                     301   2e-93    
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    299   3e-93    
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    298   4e-93    
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    302   4e-93    
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    298   6e-93    
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    298   7e-93    
gb|EPS66234.1|  hypothetical protein M569_08543                         299   7e-93    
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          298   8e-93    
gb|EPS65387.1|  pectinesterase                                          296   2e-92    
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             300   2e-92    
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    297   3e-92    
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    296   3e-92    
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    296   4e-92    
gb|KFK22175.1|  hypothetical protein AALP_AAs39369U000100               299   4e-92    
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    293   5e-92    
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    305   8e-92    
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    296   9e-92    
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             295   1e-91    
emb|CDY57858.1|  BnaC08g47740D                                          292   1e-91    
ref|XP_002868170.1|  predicted protein                                  298   2e-91    
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    295   2e-91    
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              294   3e-91    
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    297   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    294   3e-91    
emb|CDY66111.1|  BnaAnng21510D                                          298   5e-91    
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          293   5e-91    Sorghum bicolor [broomcorn]
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...    298   6e-91    
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             293   6e-91    
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    293   8e-91    
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    292   9e-91    
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     292   1e-90    
emb|CDY24663.1|  BnaA05g30620D                                          292   1e-90    
emb|CDY34927.1|  BnaA01g32580D                                          292   1e-90    
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 291   2e-90    
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 293   3e-90    
emb|CAB65290.2|  pectin methyl-esterase PER                             292   3e-90    Medicago truncatula
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 293   3e-90    
emb|CDY05295.1|  BnaC05g45080D                                          291   3e-90    
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             292   3e-90    
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               291   5e-90    Ricinus communis
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    291   7e-90    
ref|NP_001049858.1|  Os03g0300500                                       290   9e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    291   1e-89    
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     289   2e-89    
dbj|BAA89480.1|  pectin methylesterase                                  290   2e-89    Salix gilgiana
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    285   2e-89    
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     288   4e-89    
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     289   4e-89    
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          289   4e-89    
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     287   8e-89    
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    287   1e-88    
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    288   2e-88    
emb|CDP19930.1|  unnamed protein product                                287   2e-88    
emb|CDO99718.1|  unnamed protein product                                286   3e-88    
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     286   3e-88    
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     286   3e-88    
dbj|BAC67662.1|  pectin methylesterase                                  285   4e-88    
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     285   5e-88    
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     285   5e-88    
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     285   5e-88    
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          285   6e-88    
gb|ACF79975.1|  unknown                                                 285   8e-88    
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         285   9e-88    
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                285   1e-87    
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             289   1e-87    
ref|XP_007012506.1|  Pectinesterase                                     285   1e-87    
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    285   1e-87    
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    285   1e-87    
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    284   2e-87    
gb|EAY94391.1|  hypothetical protein OsI_16158                          282   9e-87    
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               282   9e-87    
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     282   1e-86    
gb|EAY94388.1|  hypothetical protein OsI_16156                          282   1e-86    
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     283   1e-86    
ref|NP_001052981.1|  Os04g0458900                                       282   1e-86    
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     283   2e-86    
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     282   2e-86    
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             281   2e-86    
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    282   2e-86    
emb|CAH67075.1|  OSIGBa0097P08.5                                        281   2e-86    
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              281   2e-86    
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     281   3e-86    
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    281   4e-86    
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    280   4e-86    
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    280   5e-86    
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    281   7e-86    
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     280   8e-86    
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     280   9e-86    
ref|XP_003622696.1|  Pectinesterase                                     279   9e-86    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 277   9e-86    
gb|ABQ42392.1|  pectin methylesterase-like protein                      280   1e-85    
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     280   1e-85    
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     280   1e-85    
gb|EAZ09211.1|  hypothetical protein OsI_31486                          274   2e-85    
dbj|BAK06954.1|  predicted protein                                      278   3e-85    
ref|XP_002275000.1|  PREDICTED: pectinesterase                          278   3e-85    
emb|CBI23178.3|  unnamed protein product                                276   3e-85    
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          280   4e-85    
emb|CBI26012.3|  unnamed protein product                                278   4e-85    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          278   6e-85    
emb|CAC09455.2|  H0423H10.1                                             281   6e-85    
dbj|BAK05856.1|  predicted protein                                      278   7e-85    
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    277   8e-85    
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     278   8e-85    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          276   9e-85    
gb|AAC14742.1|  pectin methylesterase                                   276   2e-84    
emb|CAA47810.1|  pectinesterase                                         276   2e-84    
dbj|BAC67661.1|  pectin methylesterase                                  276   2e-84    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    275   3e-84    
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     275   4e-84    
ref|NP_001105487.1|  pectin methylesterase1                             275   4e-84    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  273   5e-84    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     274   6e-84    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                275   7e-84    
ref|XP_010267745.1|  PREDICTED: pectinesterase                          274   7e-84    
ref|XP_003627458.1|  Pectinesterase                                     275   8e-84    
ref|XP_010687597.1|  PREDICTED: pectinesterase                          275   9e-84    
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    275   9e-84    
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    276   1e-83    
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     274   1e-83    
ref|XP_002273396.2|  PREDICTED: probable pectinesterase/pectinest...    274   1e-83    
emb|CAA96434.1|  pectin methylesterase                                  266   1e-83    
gb|EAY95754.1|  hypothetical protein OsI_17629                          282   1e-83    
emb|CAH68135.1|  B0414F07.5                                             282   1e-83    
ref|NP_001054042.1|  Os04g0641200                                       282   1e-83    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     273   1e-83    
gb|AHC69829.1|  pectin methylesterase PME2.1                            273   2e-83    
ref|NP_001063246.1|  Os09g0433700                                       275   2e-83    
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    271   2e-83    
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 273   2e-83    
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             273   2e-83    
gb|AFW03480.1|  pectin methylesterase 1                                 273   2e-83    
gb|AFB77929.1|  pectin methylesterase                                   273   2e-83    
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-83    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          273   3e-83    
gb|AFQ23194.1|  pectin methylesterase                                   273   3e-83    
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               273   3e-83    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  273   4e-83    
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg                273   5e-83    
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   273   5e-83    
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     271   6e-83    
ref|XP_002317208.1|  pectin methylesterase family protein               272   6e-83    
emb|CAA96435.1|  pectin methylesterase                                  265   6e-83    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             272   6e-83    
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     272   7e-83    
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         272   7e-83    
gb|KHG08631.1|  Pectinesterase 3                                        272   7e-83    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     271   7e-83    
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          275   8e-83    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     271   8e-83    
gb|AFW03475.1|  pectin methylesterase 1                                 272   1e-82    
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     273   1e-82    
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    271   1e-82    
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     272   1e-82    
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       271   1e-82    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            271   1e-82    
gb|AFC98398.1|  pectin methylesterase                                   271   2e-82    
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    271   2e-82    
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     280   2e-82    
gb|AFK35109.1|  unknown                                                 271   2e-82    
ref|XP_003622688.1|  Pectinesterase                                     270   2e-82    
ref|XP_008439965.1|  PREDICTED: pectinesterase                          270   2e-82    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     270   3e-82    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     270   3e-82    
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    270   3e-82    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    270   3e-82    
ref|NP_001060715.1|  Os07g0691100                                       270   4e-82    
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    270   4e-82    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    270   4e-82    
gb|KHN30453.1|  Pectinesterase 2.2                                      267   4e-82    
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     270   4e-82    
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    270   4e-82    
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    276   4e-82    
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         269   5e-82    
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          270   5e-82    
gb|ACN40984.1|  unknown                                                 271   5e-82    
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                270   6e-82    
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             269   6e-82    
ref|XP_003622699.1|  Pectinesterase                                     269   6e-82    
emb|CAB95025.1|  pectin methylesterase                                  270   7e-82    
emb|CDO99717.1|  unnamed protein product                                268   7e-82    
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    269   8e-82    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     269   8e-82    
tpg|DAA64233.1|  TPA: pectinesterase                                    269   9e-82    
gb|ACJ85768.1|  unknown                                                 269   9e-82    
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     268   1e-81    
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 268   1e-81    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                270   1e-81    
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    269   1e-81    
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   1e-81    
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     269   2e-81    
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          268   2e-81    
gb|ABK94644.1|  unknown                                                 261   2e-81    
ref|NP_172624.1|  methylesterase PCR A                                  268   2e-81    
emb|CAA64217.1|  pectinmethylesterase                                   261   2e-81    
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              262   2e-81    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   2e-81    
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          268   2e-81    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     269   2e-81    
gb|AAK59760.1|  At1g11580/T23J18_33                                     268   2e-81    
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             268   2e-81    
emb|CDO97788.1|  unnamed protein product                                270   2e-81    
gb|ACR34431.1|  unknown                                                 263   2e-81    
gb|ABZ89800.1|  pectin methylesterase-like protein                      268   3e-81    
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     276   3e-81    
ref|XP_010240510.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-81    
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    268   3e-81    
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    268   4e-81    
gb|AAO85706.1|  pectin methyl-esterase                                  268   4e-81    
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        268   4e-81    
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          268   4e-81    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   4e-81    
gb|AFI23411.1|  pectin methylesterase                                   268   5e-81    
emb|CAD29733.1|  pectin methylesterase                                  267   5e-81    
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    267   6e-81    
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                267   6e-81    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   6e-81    
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   268   6e-81    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     267   7e-81    
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   7e-81    
emb|CDY34642.1|  BnaC08g42010D                                          263   7e-81    
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    274   8e-81    
gb|EPS69324.1|  hypothetical protein M569_05439                         267   8e-81    
gb|AFI23414.1|  pectin methylesterase                                   267   8e-81    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     266   8e-81    
emb|CAN80988.1|  hypothetical protein VITISV_008223                     266   9e-81    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   9e-81    
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    266   1e-80    
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             266   1e-80    
emb|CBI27741.3|  unnamed protein product                                260   1e-80    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             266   1e-80    
dbj|BAK06157.1|  predicted protein                                      275   1e-80    
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             266   1e-80    
ref|XP_002889876.1|  At1g11580/T23J18_33                                266   1e-80    
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          266   1e-80    
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     266   2e-80    
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     266   2e-80    
ref|XP_010489680.1|  PREDICTED: probable pectinesterase/pectinest...    259   2e-80    
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               265   2e-80    
ref|XP_002518523.1|  Pectinesterase precursor, putative                 265   2e-80    
ref|XP_004289016.1|  PREDICTED: probable pectinesterase/pectinest...    266   3e-80    
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    265   3e-80    
ref|XP_006342896.1|  PREDICTED: pectinesterase 3-like                   265   3e-80    
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     265   3e-80    
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    266   3e-80    
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    265   3e-80    
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             265   4e-80    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   266   4e-80    
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310          269   4e-80    
ref|XP_008224789.1|  PREDICTED: pectinesterase                          265   4e-80    
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             264   4e-80    
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                        265   5e-80    
ref|XP_002314796.1|  pectin methylesterase 6 family protein             264   5e-80    
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             264   5e-80    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   264   5e-80    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     265   5e-80    
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    265   6e-80    
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    263   6e-80    
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    265   6e-80    
emb|CAA66360.1|  pectin methylesterase                                  253   7e-80    
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            264   7e-80    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     265   7e-80    
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                        264   8e-80    
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...    266   8e-80    
gb|AAF23891.1|  pectin methyl esterase                                  263   9e-80    
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    264   9e-80    
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    264   1e-79    



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   439 bits (1128),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 249/304 (82%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLKTA EL+SNGLAM++ F E+L +L IP      RRLLT +++          
Sbjct  181  GEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPG---ISRRLLTTDSE------YTSA  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+A +RRLL  + A  K +AVVA+DGSGQYK++ EALKAVP KNN+T+VI IKAG Y E
Sbjct  232  FVEAGSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKE  289

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++PR M  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDGF+AR+IGFEN+AG
Sbjct  290  MVDIPRSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAG  349

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVSAD T+F+NC+ID YQDTLYTH+YRQ+Y+DCTITGTIDFIFGDA+AVFQ
Sbjct  350  AKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQ  409

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  NQACMVTAQGRK+HRGVGA+VLQNCDI  +PA  S  PP+K YLGRPWK
Sbjct  410  NCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWK  469

Query  13   EYSR  2
            EYSR
Sbjct  470  EYSR  473



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   437 bits (1123),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/304 (67%), Positives = 248/304 (82%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLKTA EL+SNGLAM+T F E+L +L +P      RRLLT +++          
Sbjct  181  GEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPG---ISRRLLTTDSE------YTSA  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+A +RRLL  + A  K +AVVA+DGSGQYK++ EALKAVP KNN+T+VI IKAG Y E
Sbjct  232  FVEAGSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKE  289

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++PR +  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDGF+AR+IGFEN+AG
Sbjct  290  MVDIPRSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAG  349

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVSAD T+F+NC+ID YQDTLYTH+YRQ+Y+DCTITGTIDFIFGDA+ VFQ
Sbjct  350  AKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQ  409

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  NQACMVTAQGRK+HRGVGA+VLQNCDI  +PA  S  PP+K YLGRPWK
Sbjct  410  NCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWK  469

Query  13   EYSR  2
            EYSR
Sbjct  470  EYSR  473



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   417 bits (1071),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 191/304 (63%), Positives = 242/304 (80%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE+MK LLKTA EL+SNGLAM+T  +E+L +  I     FKRRL+++  +        P 
Sbjct  181  GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQG---FKRRLMSSSVE--------PD  229

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FVDA  R+L+  + AS+K +AVVA+DGSGQ+KS++ A+  VP KNN+TFVIFIKAG+Y E
Sbjct  230  FVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKE  289

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V +P+ +N IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAG
Sbjct  290  YVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAG  349

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVS D TI +NC IDAYQDTLYTH YRQYYR+CTI+GTIDFIFGDA+AVFQ
Sbjct  350  AVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQ  409

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            +CKMVVRKP++NQ CMVTAQGRKE RG+GA+VLQNC I+ DPA  +V PP+K YLGRPWK
Sbjct  410  DCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWK  469

Query  13   EYSR  2
            E+SR
Sbjct  470  EFSR  473



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 240/304 (79%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE+MK LLKTA EL+SNGLAM+T  +E+L +  I     FKRRL+++  +        P 
Sbjct  165  GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQG---FKRRLMSSSVE--------PD  213

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FVDA  R+L+  + AS+K +AVVA+DGSGQ+KS++ A+  VP KNN+TFVIFIKAG+Y E
Sbjct  214  FVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKE  273

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V +P+ +N IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAG
Sbjct  274  YVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAG  333

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVS D TI +NC IDAYQDTLYTH YRQYYR+CTI+GTIDFIFGD +AVFQ
Sbjct  334  AVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQ  393

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
             CKMVVRKP++NQ CMVTAQGRKE RG+GA+VLQNC I+ DPA  +V PP+K YLGRPWK
Sbjct  394  GCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWK  453

Query  13   EYSR  2
            E+SR
Sbjct  454  EFSR  457



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   412 bits (1059),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 240/304 (79%), Gaps = 14/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLKTA EL+SNGLAMIT F ++L S+ IP      RRLL  +         +  
Sbjct  180  GEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPG---ISRRLLAND---------YTS  227

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+  +RRLL    +S K +AVVA DGSGQ+K++ EALK VP KN + +VI IKAG Y E
Sbjct  228  FVEDGSRRLLQV--SSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKE  285

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+VPR +  +VF+GEGPTKT+ITG+++  DG  T+HTATVA+ GDGF+AR+IGFEN+AG
Sbjct  286  IVDVPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGFVARDIGFENTAG  345

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVSAD  +F+NC+ID YQDTLYTH+YRQ+Y+DC+I+GTIDFIFGDA+AVFQ
Sbjct  346  AMKHQAVALRVSADKAVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQ  405

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  NQACMVTAQGRK+HRGVGA+VL+NC+I  +PA  S  PP+K YLGRPWK
Sbjct  406  NCKMIVRKPGNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWK  465

Query  13   EYSR  2
            EYSR
Sbjct  466  EYSR  469



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 241/304 (79%), Gaps = 14/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLKTA EL+SNGLAMIT F ++L ++ IP      RRLL  +         +  
Sbjct  176  GEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPG---ISRRLLADD---------YTS  223

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+  +RRLL    ++ K +AVVA DGSGQ+K++ EALK VP KN + +VI IKAG Y E
Sbjct  224  FVEDGSRRLLQV--SNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKE  281

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++PR +  +VF+GEGPTKT+ITG+++  DG  T+HT+TVA+ GDGF+A++IGFEN+AG
Sbjct  282  MVDIPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGFVAKDIGFENTAG  341

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RVSAD T+F+NC+ID YQDTLYTH+YRQ+Y+DC+I+GTIDFIFGDA+AVFQ
Sbjct  342  AMKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQ  401

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  NQACMVTAQGRK+HRGVGA++L+NC+I  +PA  +  PP+K YLGRPWK
Sbjct  402  NCKMIVRKPGANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWK  461

Query  13   EYSR  2
            EYSR
Sbjct  462  EYSR  465



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 231/304 (76%), Gaps = 24/304 (8%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLK A EL+SNGLAM++ F E++ +L IP G+N  RRLL A             
Sbjct  177  GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIP-GVN--RRLLDAH------------  221

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
                   R+L+    S+K + VVA DGSGQYKS+ EAL AVP  N + +VIFIKAGVYNE
Sbjct  222  ------ERMLSD---SLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNE  272

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+PRKMN IVF+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG
Sbjct  273  HVEIPRKMNNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAG  332

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVS DM IFHNC ID YQDTLY H+YRQ++RDCTITGTIDFIFGDAAAVFQ
Sbjct  333  PVKHQAVALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQ  392

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP+ NQACMVTAQGRK+HRGVG +V+QNC I  +    +  PP+K YLGRPWK
Sbjct  393  NCKMIVRKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWK  452

Query  13   EYSR  2
            E+SR
Sbjct  453  EFSR  456



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 232/304 (76%), Gaps = 24/304 (8%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLK A EL+SNGLAM++ F E++ +L IP G+N  RRLL A             
Sbjct  177  GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIP-GVN--RRLLDAH------------  221

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
                   R+L+    S+K + +VA DGSGQYKS+ EAL AVP KN + +VIFIKAGVYNE
Sbjct  222  ------ERMLSD---SLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNE  272

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+PRKMN I+F+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG
Sbjct  273  HVEIPRKMNNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAG  332

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVS DM IFHNC ID YQDTLY H+YRQ++RDCTITGTIDFIFGDAAAVFQ
Sbjct  333  PVKHQAVALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQ  392

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC+M+VRKP+ NQACMVTAQGRK+HRGVG +V+QNC I  +    +  PP+K YLGRPWK
Sbjct  393  NCQMIVRKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWK  452

Query  13   EYSR  2
            E+SR
Sbjct  453  EFSR  456



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   396 bits (1018),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 238/319 (75%), Gaps = 19/319 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETK----------  764
            GEKMK+LL+T+ EL SNGLAM+T F+ +L SL    G    RRLL+ E +          
Sbjct  182  GEKMKNLLQTSGELLSNGLAMVTDFSSILSSL----GGFSSRRLLSDEGRSLYHLDPTDY  237

Query  763  --GeeqeeEF---PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN  599
              GE+ +  F   P FVD+  R+LL   PA++K +AVVAKDGSGQY ++  ALK +P K 
Sbjct  238  APGEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKKT  297

Query  598  NETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  419
            N+TFVI++KAGVY E V +PR +N IV +G+GP KTRI G+++  DG+ T+HTA +A+ G
Sbjct  298  NQTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQTFHTAVLAVNG  357

Query  418  DGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTIT  239
            DGF+A++IG EN+AGAAKHQAVA+RVS D  IF+N H+D YQDTLY HAYRQ+YRDC IT
Sbjct  358  DGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYAHAYRQFYRDCQIT  417

Query  238  GTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALK  59
            GTIDFIFGDA A+FQ C++VVR+P+ +QACMVTAQGRK+ R VG  VLQ CDI+ DPA  
Sbjct  418  GTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQRSVGVTVLQGCDIVADPAFL  477

Query  58   SVNPPVKVYLGRPWKEYSR  2
            +V PP+  YLGRPWKEYSR
Sbjct  478  AVKPPLDAYLGRPWKEYSR  496



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 234/304 (77%), Gaps = 10/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK L++TA +LSSNGLA++T F+E+L +L IP      RRLL+AE +  ++E     
Sbjct  184  GEKMKQLMRTAVQLSSNGLAIVTDFSEILGTLAIPG---LSRRLLSAEKRKLDEE----N  236

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+   RRLL  +P+SIK +A++A+DGSG +K++ +A+  VP  N   FVI IKAGVY E
Sbjct  237  FVE---RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKE  293

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             + +PR++N +V +GEGP  T+IT +++  DGIGT+HTATVAI GDG I R+IG ENSAG
Sbjct  294  VILIPRRINNVVIMGEGPNVTKITANKNYVDGIGTFHTATVAINGDGCILRDIGIENSAG  353

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVS D TI +NC ID YQDTLY+H YRQ+YRD TI+GTIDFIFGDAAAVFQ
Sbjct  354  PEKHQAVALRVSGDRTIVYNCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQ  413

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VR PL NQACMVTAQGR   R  GA+VLQNC I+ DPAL S +PPV+ YLGRPWK
Sbjct  414  NCKLIVRMPLVNQACMVTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWK  473

Query  13   EYSR  2
            EYSR
Sbjct  474  EYSR  477



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 231/306 (75%), Gaps = 22/306 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQ--SLEIPAGLNFKRRLLTAETKGeeqeeEF  740
            GEKM+ LLK A EL+SN LAM++ F ++L   +L+IP G+N  RRLL A           
Sbjct  179  GEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIP-GVN--RRLLNAHE---------  226

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
                    R L   N   +K + VVA DGSGQYKS+ EAL+AVP KN + FVIFIKAG+Y
Sbjct  227  --------RMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAGIY  278

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E +++P+KMN IVF+GEGPTKT+ITG+++  DGIGT+ TATVAI GD F+A++IG EN+
Sbjct  279  KEYIDIPKKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAINGDNFMAKDIGIENT  338

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RVS D  IFHNC  D YQDTLY HAYRQ++RDCTITGTIDFIFGDA++V
Sbjct  339  AGAIKHQAVALRVSGDKAIFHNCQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGDASSV  398

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQ+CKM+VRKP+ NQACMVTAQGRK+ RGVGA+V+QNC+I  +    S  P +K YLGRP
Sbjct  399  FQSCKMIVRKPMANQACMVTAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRP  458

Query  19   WKEYSR  2
            WKE+SR
Sbjct  459  WKEFSR  464



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 229/304 (75%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I  GL+  R+LL+ E            
Sbjct  168  GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQI-GGLS-SRKLLSEEEGAL--------  217

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    RRLL    +S+K +AVVA DGSGQ+ ++  A+ +VP KNN+TFVI++KAG+Y E
Sbjct  218  FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKE  275

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  D F+A++IGFEN+AG
Sbjct  276  YVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTAG  335

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  +F N HID YQDTLY H YRQYYRDC+I+GTIDFIFGDA A+FQ
Sbjct  336  PQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQ  395

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E R +GA V+QN DI+ +PAL    PPVKVYLGRPWK
Sbjct  396  NCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWK  455

Query  13   EYSR  2
              SR
Sbjct  456  LLSR  459



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 229/304 (75%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I  GL+  R+LL+ E            
Sbjct  168  GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQI-GGLS-SRKLLSEEEGAL--------  217

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    RRLL    +S+K +AVVA DGSGQ+ ++  A+ +VP KNN+TFVI++KAG+Y E
Sbjct  218  FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKE  275

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  D F+A++IGFEN+AG
Sbjct  276  YVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTAG  335

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  +F N HID YQDTLY H YRQYYRDC+I+GTIDFIFGDA A+FQ
Sbjct  336  PQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQ  395

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E R +GA V+QN DI+ +PAL    PPVKVYLGRPWK
Sbjct  396  NCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWK  455

Query  13   EYSR  2
              SR
Sbjct  456  LLSR  459



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 225/307 (73%), Gaps = 6/307 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGe---eqeeE  743
            GEKMK  LKTA E+SSNGL +++  + +L  L+IP      RRLL  +       +  + 
Sbjct  190  GEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPG---VSRRLLQDDIPVAGHGDISQA  246

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
            FP ++D  TRRLL+  P++IK D VVAKDGSG YK+++EAL  +P K+NETFV++IK G+
Sbjct  247  FPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKEGI  306

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E VE  R M  +V +G+GP KTRITGS++  DGI TY TATVA+ GD F+ARNIGFEN
Sbjct  307  YEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATVAVIGDNFVARNIGFEN  366

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAGA KHQAVA+RVS+D  +F+NC +D YQDTLYTHA RQ+YRDCT++GTIDF+FGDA  
Sbjct  367  SAGAIKHQAVALRVSSDYAVFYNCSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPV  426

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNC  +VRKPL+NQ C+VTAQGRK  R   A+++QN  I   P L+ V    K YLGR
Sbjct  427  VFQNCTFLVRKPLENQQCIVTAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLGR  486

Query  22   PWKEYSR  2
            PWKE+SR
Sbjct  487  PWKEFSR  493



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 229/309 (74%), Gaps = 7/309 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK+LLKTA E+SSNGLAM+   +  L SL++    + K  L      G +  +  PG
Sbjct  178  GEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLLLSGKIGYGGDPTDYAPG  237

Query  733  -----FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKA  569
                  +D+  RRLL+    S+K +AVVA+DGSGQ+ ++  A+ +VP KNN+TFVI +KA
Sbjct  238  EEPHFNLDSNRRRLLSA--TSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQTFVIHVKA  295

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  389
            GVY E V++P+K+NKIV +G+GP KTRI+G ++  +G+ TYHTATVA+  D F+A++IGF
Sbjct  296  GVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVAVNADDFLAKDIGF  355

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AGAA HQAVA+RVS D  +F+N HID YQDTLY H YRQYYRDC+I+GTIDFIFGD+
Sbjct  356  ENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDS  415

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
             A+FQNCK VVRKP+ NQACMVTAQGR E   +GA ++QN D + +PAL   +PP KVYL
Sbjct  416  QALFQNCKFVVRKPMANQACMVTAQGRVERHSLGATIIQNGDFVAEPALLQASPPHKVYL  475

Query  28   GRPWKEYSR  2
            GRPWK  SR
Sbjct  476  GRPWKLLSR  484



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   367 bits (943),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 224/304 (74%), Gaps = 6/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK  LKTA EL+SNGLAM+T  + LL SL     LN  RRLL+A +K     +  P 
Sbjct  178  GDKMKGFLKTAQELTSNGLAMVTQISSLLGSL----NLNSHRRLLSAHSK--RNYQAVPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++ A   +LLT  P S+K + VVA+DGSG+YK++ EALK VP K+NETFVI+IK GVY E
Sbjct  232  WMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKEGVYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             + + R+M  +  +G+GPTKT+I+GS++  DG  T HTAT A  GD F+A++I FEN+AG
Sbjct  292  EIIIDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGDYFVAKDIRFENTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV +D +IF+NCH+DAYQDTLYT  YRQYYRDCTITGT+DFIFGD  A+FQ
Sbjct  352  HIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  +Q+CMVTAQGR +   + A+VLQNC I  +P   +V    K YLGRPWK
Sbjct  412  NCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWK  471

Query  13   EYSR  2
            +++R
Sbjct  472  DFAR  475



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 223/304 (73%), Gaps = 15/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK++L+TA ++SSNGLAM+++ + +  SL++  G +  R+LL+ E            
Sbjct  169  GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV--GSSASRKLLSEEEADL--------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    R L+   P     +AVVA+DGSGQ+K++  A+ +VP KNN+ FVI +KAGVY E
Sbjct  219  FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+P+K+NKIV +G+GP KTRI+G ++  +G+ TYHTATV++  D F A++IGFEN+AG
Sbjct  274  YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVSVNADEFFAKDIGFENTAG  333

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  IFHN HID YQDTLY H YRQYYRDC+I+GTIDFIFGDA A+FQ
Sbjct  334  PQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQ  393

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E   +GA V+QN D + +PAL    PPVKVYLGRPWK
Sbjct  394  NCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWK  453

Query  13   EYSR  2
            + SR
Sbjct  454  QLSR  457



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 222/304 (73%), Gaps = 6/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             +KMK +L+ + EL+SNGLAM+T  + LL SL IP   +  RRLLT E  G  +   FP 
Sbjct  192  AKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIP---DVSRRLLTEEQDGIPE---FPS  245

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   R+LL   P  IK D VVA+DGSG+YK++ EAL  VP KNN+TFVI+IK GVY E
Sbjct  246  WVDEGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKTFVIYIKEGVYKE  305

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V V +K   ++ +G+GPTKT ITGS +  DG+ T +TAT    G  FIA++I FENSAG
Sbjct  306  KVLVDKKTTNVMIIGDGPTKTVITGSLNYVDGVQTCNTATFTAIGSYFIAKDIKFENSAG  365

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV +DM++ +NCH+DA+QDTLY HA+RQ+YRDCTI+GTIDFIFGDA AVFQ
Sbjct  366  AEKHQAVALRVQSDMSVIYNCHMDAFQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQ  425

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC+M V+KPL+NQ C+VTA GR E R   A+VLQNC I  DPA   +    K YLGRPWK
Sbjct  426  NCQMFVKKPLENQQCIVTASGRSERRSASAIVLQNCTISADPAYYPLRNINKAYLGRPWK  485

Query  13   EYSR  2
            +YSR
Sbjct  486  DYSR  489



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 222/304 (73%), Gaps = 15/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK++L+TA ++SSNGLAM+++ + +  SL++  G    R+LL+ E            
Sbjct  169  GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV--GSTASRKLLSEEEADL--------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    RRL+   P     +AVVA+DGSGQ+K++  A+  VP KNN+ FVI +KAGVY E
Sbjct  219  FISIKQRRLMGLQP-----NAVVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAGVYKE  273

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A++IGFEN+AG
Sbjct  274  YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  IFHN HID YQDTLY H YRQYYRDC+I+GTIDFIFGDA A+FQ
Sbjct  334  PQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQ  393

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E   +GA V+QN D + +PAL    PPVKVYLGRPWK
Sbjct  394  NCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWK  453

Query  13   EYSR  2
            + SR
Sbjct  454  QLSR  457



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 226/305 (74%), Gaps = 12/305 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-AGLNFKRRLLTAETKGeeqeeEFPG  734
            EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ +          P 
Sbjct  184  EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSED----------PY  233

Query  733  FVDAA-TRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
            ++ +  TRRLL+   A +K +AVVA DGSGQ+K++ +A+  +P KN + FVIFIKAG+Y 
Sbjct  234  WIKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKAGLYK  293

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F+A++IGFEN+A
Sbjct  294  EHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFMAKDIGFENTA  353

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA  HQAVA+RVS D  IF N  ID YQDTLY H YRQYYRD TI+GTIDFIFGD+ A F
Sbjct  354  GAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYF  413

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK +VRKP+ NQACMVTAQGR + R VGA+V+QN DI  +PA  +  PP+  YLGRPW
Sbjct  414  QNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPW  473

Query  16   KEYSR  2
            KE SR
Sbjct  474  KELSR  478



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 223/304 (73%), Gaps = 6/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G +MK +L+++ EL+SNGLAM+T  + +L S  +P   N  RRLL++E   + +      
Sbjct  191  GLRMKAMLRSSQELTSNGLAMVTEISSILASYNLP--FNVSRRLLSSEDGDDTEL----S  244

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++    RRLL     +IK D VVAKDGSG+Y++V EALK +P K N+TFVI+IK GVY E
Sbjct  245  WLSDGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKE  304

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V   + M  ++ +G+GPTKTRITGS +  DG+ T+ TATV++ G  FIA++IGFENSAG
Sbjct  305  QVMFAKSMTHVMIIGDGPTKTRITGSLNFIDGVQTFKTATVSVIGSNFIAKDIGFENSAG  364

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV +DM+IF+NCH+D YQDTLY H +RQ+YRDC ITGTIDFIFGD+AAVFQ
Sbjct  365  PQKHQAVALRVQSDMSIFYNCHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQ  424

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKMV+RKPL NQ C+VTAQGR E R   ALVLQNC I  DPA   V    K YLGRPWK
Sbjct  425  NCKMVIRKPLDNQNCIVTAQGRTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWK  484

Query  13   EYSR  2
            E+SR
Sbjct  485  EFSR  488



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 224/305 (73%), Gaps = 10/305 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LL  +++L+SNGLAM+   T +L+ L IP GL   RRLL A+ +       FP 
Sbjct  187  GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIP-GLT-SRRLLEADDE-------FPS  237

Query  733  FVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
            +V+   R LL    PA+IK DA+VA+DGSGQYK++ EA++ +P KNNETFV++IK GVY 
Sbjct  238  WVNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYK  297

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E+V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSA
Sbjct  298  EQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSA  357

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA  HQAVA+RV ADM++F+NC ID YQDTLY H  RQ+YRDCTITGTIDFIFGDA AVF
Sbjct  358  GAIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVF  417

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK+VVRKPL+NQ C+VTAQGR E R     V+QNC I  DP    V    K YLGRPW
Sbjct  418  QNCKLVVRKPLENQQCIVTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPW  477

Query  16   KEYSR  2
            +E SR
Sbjct  478  RELSR  482



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 233/307 (76%), Gaps = 7/307 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGe---eqeeE  743
            GE M+  LKTA EL+ NGLAM+T    +L SL++P+    KRRLL++E + +     E+E
Sbjct  187  GESMRKALKTAGELTQNGLAMVTEVASILTSLQMPS----KRRLLSSEQQSQCPFAMEDE  242

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
            FP +  AA RRLL  + A+IK +  VAKDGSG+YK++ EAL+ VP  +NETFVI IKAGV
Sbjct  243  FPTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKAGV  302

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y+E+V++ R M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GDGF+A++IGFEN
Sbjct  303  YHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVAVIGDGFMAKDIGFEN  362

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAG  KHQAVA+RV +DM+IF+NC ID YQDTLY H +RQ+YR+CTI+GTIDFIFG++A 
Sbjct  363  SAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFGNSAV  422

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            V Q C++VVRKPL+NQ  +VTA GRK+ R   A++LQ+C I+ DP L  V    + YLGR
Sbjct  423  VLQKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGR  482

Query  22   PWKEYSR  2
            PWKEYSR
Sbjct  483  PWKEYSR  489



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 225/304 (74%), Gaps = 5/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK  LKTA EL+SNGLAM T  + LL SL     LN  RRLL+AE K +   +  P 
Sbjct  176  GDKMKGFLKTAQELTSNGLAMATQISSLLGSL----NLNSHRRLLSAE-KSKRNYQAVPS  230

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++ A   +LLT  P ++K + VVA+DG+G+YK++ EALK VP K+NETFVI+IK GVY E
Sbjct  231  WMGARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFVIYIKEGVYKE  290

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            ++ + R+M  +  +G+GPTKT+I+G+++  DG  T HTAT A  GD F+A++I FEN+AG
Sbjct  291  QIIIDRQMTNVFMIGDGPTKTKISGNKNKADGTATMHTATFAAVGDYFVAKDIRFENTAG  350

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV +D +IF+NCH+DAYQDTLYT  YRQYYRDCTITGT+DFIFGD  A+FQ
Sbjct  351  HIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQ  410

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM+VRKP  +Q+CMVTAQGR +   + A+VLQNC I  +P   +V    K YLGRPWK
Sbjct  411  NCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWK  470

Query  13   EYSR  2
            +++R
Sbjct  471  DFAR  474



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 229/312 (73%), Gaps = 9/312 (3%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-AGLNFKRRLLTAETK---GeeqeeE  743
            EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ E +   G +  + 
Sbjct  184  EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLYGGDPTDY  243

Query  742  FPG-----FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIF  578
             PG          +RRLL+   A +K +AVVA DGSGQ+K++ +A+  +P KN + FVIF
Sbjct  244  APGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIF  303

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            IKAG+Y E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F+A++
Sbjct  304  IKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFMAKD  363

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGFEN+AGA  HQAVA+RVS D  IF N  ID YQDTLY H YRQYYRD TI+GTIDFIF
Sbjct  364  IGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIF  423

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            GD+ A FQNCK +VRKP++NQACMVTAQGR + R VGA+V+QN DI  +PA  +  PP+ 
Sbjct  424  GDSLAYFQNCKFIVRKPMENQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATTPPID  483

Query  37   VYLGRPWKEYSR  2
             YLGRPWKE SR
Sbjct  484  AYLGRPWKELSR  495



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 222/305 (73%), Gaps = 10/305 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LL  +++L+SNGLAM+   T +L+ L IP GL   RRLL A+ +       FP 
Sbjct  187  GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIP-GLT-SRRLLEADDE-------FPS  237

Query  733  FVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
            +V+   R LL    PA+IK DA+VA+DGSGQYK++ EA++ +P K NETFVI+IK GVY 
Sbjct  238  WVNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYK  297

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E+V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSA
Sbjct  298  EQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSA  357

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA  HQAVA+RV ADM++F+NC ID YQDTLY H  RQ+YRDCTITGTIDFIFGDA AVF
Sbjct  358  GAIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVF  417

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK+VVRKPL NQ C+VTAQGR E R     V+QNC I  DP    V    K YLGRPW
Sbjct  418  QNCKLVVRKPLDNQQCIVTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPW  477

Query  16   KEYSR  2
            +E SR
Sbjct  478  RELSR  482



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 222/304 (73%), Gaps = 15/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK++L+TA ++SSNGLAM+++ + +  SL++  G +  R+LL+ E            
Sbjct  169  GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV--GSSASRKLLSEEEADL--------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    R L+   P     +AVVA+DGSGQ+K++  A+ +VP KNN+ FVI +KAGVY E
Sbjct  219  FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A++IGFEN+AG
Sbjct  274  YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  IFHN HID YQDTLY H YRQYYR C+I+GTIDFIFGDA A+FQ
Sbjct  334  PQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQ  393

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E   +GA V+QN D + +PAL    PPVKVYLGRPWK
Sbjct  394  NCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWK  453

Query  13   EYSR  2
            + SR
Sbjct  454  QLSR  457



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 222/304 (73%), Gaps = 15/304 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK++L+TA ++SSNGLAM+++ + +  SL++  G +  R+LL+ E            
Sbjct  169  GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV--GSSASRKLLSEEEADL--------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F+    R L+   P     +AVVA+DGSGQ+K++  A+ +VP KNN+ FVI +KAGVY E
Sbjct  219  FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A++IGFEN+AG
Sbjct  274  YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
               HQAVA+RVS D  IFHN HID YQDTLY H YRQYYR C+I+GTIDFIFGDA A+FQ
Sbjct  334  PQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQ  393

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP  NQACMVTAQGR E   +GA V+QN D + +PAL    PPVKVYLGRPWK
Sbjct  394  NCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWK  453

Query  13   EYSR  2
            + SR
Sbjct  454  QLSR  457



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 233/327 (71%), Gaps = 28/327 (9%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETK----------  764
            GEKMK+LLKTA E+SSNGLAM+T  + +L SL++  G    R+LL+ E +          
Sbjct  179  GEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQL--GNVASRKLLSEEGRFASKPNAGRK  236

Query  763  ---------GeeqeeEFPGF-----VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVE  626
                     G +  +  PG      +D+  R LL+    S+K +AVV++DGSGQ+ ++  
Sbjct  237  LQLSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSAT--SLKPNAVVSQDGSGQFNTISA  294

Query  625  ALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  446
            A+  VP KN++TFVI +KAGVY E+V +P+ MNKIV +G+GP KTR+TG  +  +G+ TY
Sbjct  295  AIATVPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKTRVTGRLNFAEGVKTY  354

Query  445  HTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYR  266
            HTATVA+  D F+A++IGFEN+AGA  HQAVA+R S D  +F+N HID YQDTLY H YR
Sbjct  355  HTATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFYNVHIDGYQDTLYAHTYR  414

Query  265  QYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNC  86
            QYYRDCTI+GTIDFIFGDA A+FQNC+ V+RKPL NQACM+TAQGR + R VGA+V+QN 
Sbjct  415  QYYRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITAQGRVDRRSVGAIVIQNG  474

Query  85   DIIPDPALKSVNPPVKVYLGRPWKEYS  5
            DI  +PAL   +PP K+YLGRPWK++S
Sbjct  475  DIAAEPALLQASPPHKLYLGRPWKQFS  501



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 229/323 (71%), Gaps = 21/323 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAE---------TKG  761
            GEKMK+LL ++  + SNGLAM+   + +  SL    G    RRLL  E         T G
Sbjct  163  GEKMKNLLHSSGMMLSNGLAMVGDISSIFSSLS--LGGFTSRRLLEEEGSLAYGVDQTDG  220

Query  760  eeqeeEF----------PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAV  611
            E+ +  F          P FVDA  RR++T N  ++K + VVA+DGSGQ+K++  A+ ++
Sbjct  221  EDPKTAFDGKVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSL  280

Query  610  PYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATV  431
            P K +  FVI +KAG Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA +
Sbjct  281  PKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVL  340

Query  430  AIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRD  251
             + GDGFIA++IG EN+AG  KHQAVA+RVS D +IF+N H++++QDTLY HAYRQYYRD
Sbjct  341  GVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYAHAYRQYYRD  400

Query  250  CTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPD  71
            CTITGTIDFIFGDAAAVFQNC+M+VRKPL NQ CMVTAQGRKE R  G  V+QNC I+ +
Sbjct  401  CTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAE  460

Query  70   PALKSVNPPVKVYLGRPWKEYSR  2
            PA  S  PPVK YLGRPWK++SR
Sbjct  461  PAFLSTKPPVKAYLGRPWKQFSR  483



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 223/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeE--F  740
            GEKMK  LKTA EL+SNGLAM++  + LL SL      + +RRLL + + G+ +      
Sbjct  178  GEKMKGFLKTAQELTSNGLAMVSEISSLLGSLN---SNSHRRRLLGSSSGGQSKRVYKPL  234

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P ++ A    LLT  P S+K + VVA+DG+G+YKS+ EALK VP K+ + FVI+IK GVY
Sbjct  235  PSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKEGVY  294

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V V ++M  +V +G+GPTKTRI+GS++  DG  T +TAT A  GD F+A+ IGFEN+
Sbjct  295  KEYVIVDKEMTNVVMIGDGPTKTRISGSKNYADGTATMYTATFAAVGDYFVAKGIGFENT  354

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGAAKHQAVA+RV +D +IF+NC+IDAYQDTLYT  YRQYYRDCTI+GT+DFIFGD  A+
Sbjct  355  AGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAM  414

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC+MVVRKP  +Q+CMVTAQGR +   + A+VLQNC I  +P   +V    K YLGRP
Sbjct  415  FQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRP  474

Query  19   WKEYSR  2
            WK ++R
Sbjct  475  WKGFAR  480



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 225/304 (74%), Gaps = 7/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LLKT+ EL+SNGL M++    ++ S  +PA     RRLLT E+  +E+E  + G
Sbjct  185  GEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPA---VGRRLLTEESNQQEEEPSWVG  241

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
                  R LL    A++K D VVAKDGSG+YK+V EAL  VP K+N+TFVI +KAGVY E
Sbjct  242  ----DRRGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGVYQE  297

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFENSAG
Sbjct  298  QVMVDKSMTWVMMIGDGPTKTKITAGKNYVDGTPTFKTATVSVIGSNFIAKDIGFENSAG  357

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +DM+IF+NC +D YQDTLYTHA+RQ+YRDCTITGTIDFIFG+AAAVFQ
Sbjct  358  AAKHQAVALRVQSDMSIFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQ  417

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VRKP+ NQ C+VTAQGR + +   A++LQNC I  DP    V    K YLGRPWK
Sbjct  418  NCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWK  477

Query  13   EYSR  2
            +YSR
Sbjct  478  QYSR  481



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 213/301 (71%), Gaps = 19/301 (6%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVD  725
            M  LL +  ELS N L+M+  F +++       GLN  R+LLT ++             D
Sbjct  1    MVKLLNSTRELSINALSMLNSFGDMVAQA---TGLN--RKLLTTDSS------------D  43

Query  724  AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVE  545
            A  RRLL  + A  K +A VA DGSGQYK++ EAL AVP KN E F+IFIKAGVY E ++
Sbjct  44   ATARRLLQISNA--KPNATVALDGSGQYKTIKEALDAVPKKNTEPFIIFIKAGVYKEYID  101

Query  544  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  365
            +P+ M  +V +GEGPTKT+ITG++S KDG  T+HT TV + G  F+A+NIGFEN+AG  K
Sbjct  102  IPKSMTNVVLIGEGPTKTKITGNKSVKDGPSTFHTTTVGVNGANFVAKNIGFENTAGPEK  161

Query  364  HQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCK  185
             QAVA+RVSAD  I +NC ID YQDTLY H YRQ+YRDCTITGT+DFIFG+  AV QNCK
Sbjct  162  EQAVALRVSADKAIIYNCQIDGYQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVLQNCK  221

Query  184  MVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYS  5
            ++VRKP +NQ+CMVTAQGR E    GA+VLQNC+I PD    S++PP K YLGRPWKEYS
Sbjct  222  VIVRKPAQNQSCMVTAQGRTEPIQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPWKEYS  281

Query  4    R  2
            R
Sbjct  282  R  282



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   360 bits (924),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 220/304 (72%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM++  +  L  ++IP  +N  RRLL+ E         FP 
Sbjct  183  GETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPE-MN-SRRLLSQE---------FPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D   RRLL    + +K D VVA+DGSGQYK++ EAL  VP K N TFV+ IKAG+Y E
Sbjct  232  WMDGRARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIKAGIYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT I+GS+S KDGI TY TATVAI GD FIA+NIGFEN+AG
Sbjct  292  YVQVNRSMTHLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIGFENTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  352  AIKHQAVAIRVLSDESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I+ +P   +V    K YLGRPWK
Sbjct  412  NCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWK  471

Query  13   EYSR  2
            EYSR
Sbjct  472  EYSR  475



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/304 (59%), Positives = 219/304 (72%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM+T  +  L  ++IP  +N  RRLL+ E         FP 
Sbjct  184  GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPE-MN-SRRLLSQE---------FPS  232

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++DA  RRLL    + +K D VVA+DGSGQYK++ EAL  VP K N TFV+ IK G+Y E
Sbjct  233  WMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKE  292

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT I+GS+S KDGI TY TATVAI GD FIA+NI FEN+AG
Sbjct  293  YVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIAFENTAG  352

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV AD +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  353  AIKHQAVAIRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  412

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I+ +P   +V    K YLGRPWK
Sbjct  413  NCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWK  472

Query  13   EYSR  2
            EYSR
Sbjct  473  EYSR  476



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 219/304 (72%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM+T  +  L  ++IP  +N  RRLL+ E         FP 
Sbjct  123  GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPE-MN-SRRLLSQE---------FPS  171

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D  TRRLL +  + +K D VVA+DGSGQYK++ EAL  VP K N TFV+ IK G+Y E
Sbjct  172  WMDGRTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKE  231

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT I+G ++ KDGI TY TATVAI GD FIA+N+GFEN+AG
Sbjct  232  YVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYRTATVAIVGDHFIAKNMGFENTAG  291

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  292  AIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  351

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I  +P   +V    K YLGRPWK
Sbjct  352  NCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWK  411

Query  13   EYSR  2
            EYSR
Sbjct  412  EYSR  415



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 222/306 (73%), Gaps = 18/306 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LL T  ELS NGLAM+  F E++       GL+  R+LLT +            
Sbjct  172  GEKMAKLLNTTRELSINGLAMVNSFGEMITQT---TGLS--RKLLTTDESS---------  217

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+A+ R+LL  + A  K +AVVA+DGSGQYK++ +ALKAVP KN E FVI IKAG+Y E
Sbjct  218  FVEASNRKLLQISNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKE  275

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENS  380
             V+V + M  +VF+GEG TKT+ITG+++ K+ GIG T+HT TV + G+GF+AR+IGFEN+
Sbjct  276  YVDVEKGMTNVVFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENT  335

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA K QAVA+RV+AD  + +NC ID YQDTLY H+ RQ+YRDC ITGTIDF+FGDAAAV
Sbjct  336  AGAVKEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAV  395

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK++VRKP   Q CMVTAQGR      GALV+QNC+I  +P   +  PP+K +LGRP
Sbjct  396  FQNCKLIVRKPGDGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRP  455

Query  19   WKEYSR  2
            WKEYSR
Sbjct  456  WKEYSR  461



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   359 bits (921),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 224/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq-eeEFP  737
            GEKMK  L  + +L+SN L+MIT  +++  SL   AG N +RRLL  +T       E  P
Sbjct  177  GEKMKKALNVSMQLTSNALSMITEISDVFTSLN--AGSN-RRRLLFDDTPVLGHGIELLP  233

Query  736  GFVDAATRRLLTTNPAS-IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
             ++D   RRLL  N ++ IK D VVAKDGSG+YK + +ALK +P   N+T+V++IK GVY
Sbjct  234  DWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE+VE+   M+ +V +G+GPTKTRITG++S KDGI TY T+TVAI GD F+A++IGFEN+
Sbjct  294  NEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVAIMGDYFVAKDIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQA+A+RV+AD +IF+NCH+D YQDTL  H YRQ+YRDCTI GTIDF+FGDAAAV
Sbjct  354  AGPDKHQALALRVAADKSIFYNCHVDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC + VRKP+K Q C+VTAQGR + R    LV QNC I+ D +   V   VK YLGRP
Sbjct  414  FQNCTLAVRKPMKEQHCIVTAQGRTDARQPTGLVFQNCSIVADESYNEVKGEVKTYLGRP  473

Query  19   WKEYSR  2
            WK+YSR
Sbjct  474  WKQYSR  479



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 223/308 (72%), Gaps = 8/308 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF---KRRLLTAETKGeeqeeE  743
            GEKM+  L    EL+SNGLAM+T  + +L +L     LNF    RRLL           E
Sbjct  180  GEKMRKALNATAELTSNGLAMVTEISSVLANLN----LNFLSGNRRLLQDSEVQVLGHGE  235

Query  742  FPGFVDAATRRLLTTNPA-SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
            FP ++D   RRLL      ++K D VVAKDGSG+YK++ EALK +P ++N+TFV+++K G
Sbjct  236  FPMWMDPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEG  295

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VY E++   +KM ++  +G+GPTKTRI  + +  DG+ T+ TATVA+ G+ F+A++IGFE
Sbjct  296  VYREQIIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGVNTFKTATVAVLGEQFLAKDIGFE  355

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N AGA KHQAVA+RV +D ++F+NCH+D YQDTLYTHA+RQ+YRDCTI+GTIDFIFGDA+
Sbjct  356  NDAGAIKHQAVALRVQSDFSVFYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDAS  415

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            A+FQNCKM+VRKPL NQ C+VTAQGRKE R   A++LQNC I  D +   V    + +LG
Sbjct  416  AIFQNCKMLVRKPLDNQQCIVTAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLG  475

Query  25   RPWKEYSR  2
            RPWKEYSR
Sbjct  476  RPWKEYSR  483



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   359 bits (922),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 225/315 (71%), Gaps = 16/315 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLT----AETKGee  755
            EKMK LLKT  E++SNGLAM+T  + +LQS+    GL       RRLL+     +  G  
Sbjct  177  EKMKELLKTGMEMTSNGLAMVTGISSVLQSI---GGLGSYTTTSRRLLSNNDIIQIIGNS  233

Query  754  qeeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALK----AVPYKNNETF  587
             +E  PG++D+  R LL ++   IK + VVAKDGSG Y +V EAL+     +  KNN+TF
Sbjct  234  DDE-MPGWIDSNRRNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTF  292

Query  586  VIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFI  407
            V++IK GVY E+V V   +  ++F+G+GPTKT+ITG  +  DG  TY TATVAIQGD FI
Sbjct  293  VLYIKEGVYEEKVVVNSSLTNLMFLGDGPTKTKITGRLNFIDGTNTYQTATVAIQGDHFI  352

Query  406  ARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTID  227
            AR+IGFENSAGA KHQAVA+RVSADM IF+NC +D YQDTLY H YRQ+YRDC I+GTID
Sbjct  353  ARDIGFENSAGAEKHQAVALRVSADMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISGTID  412

Query  226  FIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNP  47
            FIFGD+AAVFQ C +VVRKPL NQ C+VTAQGRK+ R    LVLQNC  +PDPA   V  
Sbjct  413  FIFGDSAAVFQGCSLVVRKPLDNQDCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYPVRN  472

Query  46   PVKVYLGRPWKEYSR  2
              K YLGRPWKE+SR
Sbjct  473  TNKAYLGRPWKEFSR  487



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   355 bits (910),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 221/307 (72%), Gaps = 6/307 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL---TAETKGeeqeeE  743
            GEKMK  LKTA EL+SNGLAM++  + LL S+        +RRLL   + + K +   + 
Sbjct  178  GEKMKGFLKTAQELTSNGLAMVSEISSLLGSVN---SNTHRRRLLGSSSGDQKSKRVYKP  234

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P ++ A    LLT  P S+K + VVA+DG+G+YKS+ EALK VP K+ + FVI+IK GV
Sbjct  235  LPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKEGV  294

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V V + M  +V +G+GPTKTRI+GS++  DG  T +TAT A  GD F+A+ IGFEN
Sbjct  295  YKEYVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTTTMYTATFAAVGDYFVAKGIGFEN  354

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AGAAKHQAVA+RV +D +IF+NC+IDAYQDTLYT  YRQYYRDCTI+GT+DFIFGD  A
Sbjct  355  TAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVA  414

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            +FQNC+MVVRKP  +Q+CMVTAQGR +   + A+VLQNC I  +P   +V    K YLGR
Sbjct  415  MFQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGR  474

Query  22   PWKEYSR  2
            PWK ++R
Sbjct  475  PWKGFAR  481



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   355 bits (910),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 227/323 (70%), Gaps = 21/323 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAE---------TKG  761
            GEKMK+LL ++  + SNGLAM+   + +  SL    G     RLL  E         T G
Sbjct  163  GEKMKNLLHSSGMILSNGLAMVGDISSIFSSLS--LGGFTSGRLLEEEGSLAYGVDQTDG  220

Query  760  eeqeeEF----------PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAV  611
            E+ +  F          P FVDA  RR++T N  ++K + VVA+DGSGQ+K++  A+ ++
Sbjct  221  EDLKTAFDGKVTDAAGPPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSL  280

Query  610  PYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATV  431
            P K +  FVI +KAG Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA +
Sbjct  281  PKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVL  340

Query  430  AIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRD  251
             + GDGFIA++IG EN+AG  KHQAVA+RVS D +IF+N H++ +QDTLY HAYRQYYRD
Sbjct  341  GVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYAHAYRQYYRD  400

Query  250  CTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPD  71
            CTITGTIDFIFGDAAAVFQNC+M+VRKPL NQ CMVTAQGRKE R  G  V+QNC I+ +
Sbjct  401  CTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAE  460

Query  70   PALKSVNPPVKVYLGRPWKEYSR  2
            PA  S  PP+K YLGRPWK++SR
Sbjct  461  PAFLSTTPPLKAYLGRPWKQFSR  483



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 221/307 (72%), Gaps = 17/307 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFK----RRLLTAETKGeeqeeE  743
            EKMK+LLKTA ELSSN LAM++  + +L  L++           RRL++ E +       
Sbjct  161  EKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGASSGRRLMSEEEE-------  213

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +      RLL  NP  +K +AVVA+DGSGQ+K++ EA+  +P KNN+TF+I+IKAG+
Sbjct  214  -PYWTKG---RLLAANP--LKPNAVVAQDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGL  267

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E VE+P+K+NK+VF+G+GP KTRITGS+S   G+ T+ TATVA+ G+ F A+NI FEN
Sbjct  268  YKEHVEIPKKVNKVVFIGDGPFKTRITGSKSFAGGVKTFQTATVAVNGEEFTAKNIAFEN  327

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AGA  HQAVA+RVSAD  IF N  ID YQDTLY H YRQYYRDCTI+GTIDFIFGD+  
Sbjct  328  TAGAEGHQAVALRVSADKAIFQNVAIDGYQDTLYAHNYRQYYRDCTISGTIDFIFGDSLC  387

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            +FQNC  +VRKP+ NQACMVTAQGR + R VGA+V+QN  I  +PA  S  P +  YLGR
Sbjct  388  LFQNCVFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGR  447

Query  22   PWKEYSR  2
            PWKE SR
Sbjct  448  PWKELSR  454



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 218/304 (72%), Gaps = 9/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G KMK +L  +++LSSNGLAMIT  + +L+ L + AGL   RRLL   ++       FP 
Sbjct  186  GAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNL-AGLT-GRRLLKDNSE-------FPS  236

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++    RRLL   P ++K D VVAKDGSGQYK++ EA+  +P   N TFVI+IK G+Y E
Sbjct  237  WLSHEKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKE  296

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V + R +  I+ +G+G TKTRITG  +   G+ T  T+TV++ G+ FIA++IGFEN+AG
Sbjct  297  QVTISRSVTHIMMIGDGATKTRITGDLNYAAGVQTLQTSTVSVSGNHFIAKDIGFENTAG  356

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  HQAVA+RV +DM+IF+NC +D YQDTL+ H +RQ+YRDCTITGTIDFIFGDAAAVFQ
Sbjct  357  AIGHQAVALRVQSDMSIFYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQ  416

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK+VVRKPL+NQ C+VTAQGR E R     VLQNC+I  DP    V    K YLGRPWK
Sbjct  417  NCKIVVRKPLENQNCVVTAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWK  476

Query  13   EYSR  2
            EYSR
Sbjct  477  EYSR  480



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   357 bits (916),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 223/306 (73%), Gaps = 9/306 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP--AGLNFKRRLLTAETKGeeqeeEF  740
            G+KM+ LLKT+ EL+SNGLAM++  + +L +L I     ++  +R L AE         F
Sbjct  298  GKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRRLFAEN-------GF  350

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P +V +  R  +   PA+IK + VVAKDGSG+Y S+ EAL+ VP  N  TFVI+IKAGVY
Sbjct  351  PMWVSSEQRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKDNPTTFVIYIKAGVY  410

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E+V V + M  ++F+G+G TKT+ITG  +  DG GT+ TATV + GDGFIA++IGFEN+
Sbjct  411  KEQVIVTKSMTNVMFIGDGRTKTKITGDLNYADGTGTFRTATVGVVGDGFIAKDIGFENT  470

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D +IF+NC +D YQDTLY H++RQ+YRDCTI+GTIDFIFGD+A V
Sbjct  471  AGAIKHQAVALRVQSDQSIFYNCQMDGYQDTLYAHSHRQFYRDCTISGTIDFIFGDSATV  530

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
             QNCK++VRKPL+NQ C+VTAQGR E R V ALVLQNC I  DP    V    K YLGRP
Sbjct  531  LQNCKIIVRKPLENQQCIVTAQGRIERREVSALVLQNCTISGDPEYLPVKDKNKAYLGRP  590

Query  19   WKEYSR  2
            WKE+SR
Sbjct  591  WKEFSR  596



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   352 bits (904),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 219/306 (72%), Gaps = 6/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqe--eEF  740
            GEKMK  LKTA EL+SNGLAM++  + L+ S +    LN  RRL+++   G+     +  
Sbjct  179  GEKMKGFLKTAQELTSNGLAMVSEISRLVGSPK----LNSHRRLMSSSKGGQRNRNYKPV  234

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            PG++      LLT  P S+K + VVAKDG+G+YK++ EALK VP K+ E FVI+IK GVY
Sbjct  235  PGWMSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYIKKGVY  294

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V V ++M  +V +G+GPT TRI+GS+S+ DG+ T  TAT A  G+ F+A+ IGFEN+
Sbjct  295  EETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVTTMKTATFAALGNYFVAKGIGFENT  354

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV +D +IF NCH+DAYQDTLYT  YRQ+YRDCTITGT+DFIFGD  A+
Sbjct  355  AGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVAL  414

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCKMVVRKP + QACMVTAQGR +H  +  + LQNC I  +P   +V    K YLGRP
Sbjct  415  FQNCKMVVRKPGETQACMVTAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRP  474

Query  19   WKEYSR  2
            WK ++R
Sbjct  475  WKNFAR  480



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 220/303 (73%), Gaps = 6/303 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            EKMK LL T +E+ SNGLA++T F+ +  SL++      +RRL+     GE +E    GF
Sbjct  178  EKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQL-GSFTSRRRLM-----GEGEENPDDGF  231

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V +A RRLL  N  +IK +  VA+DGSGQ+K++  AL  +P K+N+TFVI +KAGVY E 
Sbjct  232  VQSARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVKAGVYKET  291

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V VP+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+A++I FENSAG 
Sbjct  292  VIVPKKVNNVVIYGDGPEKTRVVNNKNYADGVQTFHTATLAVNSDGFMAKDIAFENSAGP  351

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RVS D  +F+N  +D YQDTLY H YRQ+YR+CTI+GTIDF+FGDA AVFQ 
Sbjct  352  TKHQAVAVRVSGDKAVFYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVFGDATAVFQK  411

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C+ +VRKP  NQ CMVTAQGRK+ R +G  V+QN +I+P+    +V P +  +LGRPWKE
Sbjct  412  CRFIVRKPDINQNCMVTAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKIDAFLGRPWKE  471

Query  10   YSR  2
            YSR
Sbjct  472  YSR  474



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 224/307 (73%), Gaps = 8/307 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEF--  740
            GEKM+  LKTA EL+SNGLAM++  + L+ S +    LN  RRL+++ +KG + +  +  
Sbjct  179  GEKMRGFLKTAQELTSNGLAMVSEISRLVDSPK----LNSHRRLMSS-SKGGQTKRNYKP  233

Query  739  -PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             PG++      LLT  P S+K + VVAKDG+G+YK++ EALK VP K+NE FVI+IK G+
Sbjct  234  VPGWMSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGM  293

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V V ++M  +V +G+GPT TRI+GS+S+ DGI T +TAT A  G+ F+A+ IGFEN
Sbjct  294  YEETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFEN  353

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AG  KHQAVA+RV +D +IF NCH+DAYQDTLYT  YRQ+YRDCTITGT+DFIFGD  A
Sbjct  354  TAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVA  413

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            +FQNCKMVVRKP + QACMVTAQGR +   +  + LQNC I  +P   +V    K YLGR
Sbjct  414  LFQNCKMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGR  473

Query  22   PWKEYSR  2
            PWK+++R
Sbjct  474  PWKKFAR  480



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 232/357 (65%), Gaps = 55/357 (15%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAET--KGeeqeeEF  740
            GEKMK+LLKTA E+SSNGLAM+   + L+ SL++  G    R+LL +E    G +  +  
Sbjct  178  GEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQL--GNAASRKLLLSEKIGYGGDPTDYA  235

Query  739  PG-----FVDAATRRLLTT-----------------------------------------  698
            PG      +D+  RRLL+                                          
Sbjct  236  PGEEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGYGGDPTDYAPGEEPHFNLDSN  295

Query  697  -----NPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRK  533
                 +  S+K +AVVA+DGSGQ+ ++  A+ +VP KNN+ FVI +KAGVY E V++P+K
Sbjct  296  RRHLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVYKEYVQIPKK  355

Query  532  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  353
            MNKIV +G+GP KTRI+G ++  +G+ TYHTATVA+  D F+A++IGFEN+AGA  HQAV
Sbjct  356  MNKIVLIGDGPLKTRISGRKNFAEGVKTYHTATVAVNADDFLAKDIGFENTAGALGHQAV  415

Query  352  AIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVR  173
            A+RVS D  +F+N HID YQDTLY H YRQYYRDC+I+GTIDFIFGDA A+FQNCK VVR
Sbjct  416  ALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVR  475

Query  172  KPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            KP  NQACM+TAQGR E   +G  V+QN DI+ +PAL   +PP KVYLGRPWK  SR
Sbjct  476  KPGPNQACMITAQGRVERHSLGVTVIQNGDIVAEPALLQASPPHKVYLGRPWKLLSR  532



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 216/301 (72%), Gaps = 11/301 (4%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVD  725
            MK  LKTA +L+ NGLAM++     L  +E+P  +N  RRLL+ E         FP +VD
Sbjct  1    MKKALKTAVQLTHNGLAMVSEMLNYLGQMELPE-MN-SRRLLSQE---------FPSWVD  49

Query  724  AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVE  545
               RRLL    + +K D VVA+DGSGQYK++ EAL+ VP KNN TFV+ IK+G Y E V+
Sbjct  50   GRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQ  109

Query  544  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  365
            V R M  +VF+G+GPTK+ I+G++S KDGI TY TATVAI GD FIA+N+GFEN+AGA  
Sbjct  110  VNRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALN  169

Query  364  HQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCK  185
            +QAVA+RV +D +IF+NC  D YQDTLY H++RQ+YRDCTITGTIDF+FGDAAAVFQNC 
Sbjct  170  YQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCT  229

Query  184  MVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYS  5
            ++VRKPL NQAC +TA GRK+ R     VLQ C I  +    +V    K YLGRPWKEYS
Sbjct  230  LLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYS  289

Query  4    R  2
            +
Sbjct  290  K  290



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 223/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq-eeEFP  737
            GEKMK  L  + +L+SN L+MIT  +++  SL   AG N +RRLL  +T       E  P
Sbjct  177  GEKMKKALNVSMQLTSNALSMITEISDVFTSLN--AGSN-RRRLLFDDTPVLGHGIELLP  233

Query  736  GFVDAATRRLLTTNPAS-IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
             ++D   RRLL  N ++ IK D VVAKDGSG+YK + +ALK +P   N+T+V++IK GVY
Sbjct  234  DWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            +E+VE+   M+ +V +G+GPTKTRITG++S K G+ TY T+TVAI GD F+A++IGFEN+
Sbjct  294  DEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAIMGDYFVAKDIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQA+A+RV+AD +IF+NCH+D YQDTL  H YRQ+YRDCTI GTIDF+FGDAAAV
Sbjct  354  AGPDKHQALALRVAADKSIFYNCHMDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC + VRKP+K Q C+VTAQGR + R    +VLQNC I+ D +   V    K YLGRP
Sbjct  414  FQNCTLAVRKPMKEQHCIVTAQGRTDLRQPSGIVLQNCSIVADESYNEVKGEAKTYLGRP  473

Query  19   WKEYSR  2
            WK+YSR
Sbjct  474  WKQYSR  479



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 218/306 (71%), Gaps = 18/306 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP---AGLNFKRRLLTAETKGeeqeeEF  740
            EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +          
Sbjct  185  EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND----------  234

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
                D   RR+L    A  K +AVVA+DGSGQ+K++ EA+ +VP  N +TFVI+IKAGVY
Sbjct  235  ----DWIKRRVLR-GKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVY  289

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+NIGFEN+
Sbjct  290  KEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEFTAKNIGFENT  349

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA  HQAVA+RVS D  +F+N  ID YQDTLY H YRQ+Y DC+I+GTIDFIFGD+ ++
Sbjct  350  AGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDSLSL  409

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK +VRKP+ NQACMVTAQGR + R VGA+V+QN  I  + A  +  P +  YLGRP
Sbjct  410  FQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGRP  469

Query  19   WKEYSR  2
            WKE SR
Sbjct  470  WKELSR  475



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   354 bits (908),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 218/304 (72%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA +L+ NGLAM++     L  +E+P  +N  RRLL+ E         FP 
Sbjct  183  GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPE-MN-SRRLLSQE---------FPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   RRLL    + +K D VVA+DGSGQYK++ EAL+ VP KNN TFV+ IK+G Y E
Sbjct  232  WVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GPTK+ I+G++S KDGI TY TATVAI GD FIA+N+GFEN+AG
Sbjct  292  YVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  +QAVA+RV +D +IF+NC  D YQDTLY H++RQ+YRDCTITGTIDF+FGDAAAVFQ
Sbjct  352  ALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I  +    +V    K YLGRPWK
Sbjct  412  NCTLLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWK  471

Query  13   EYSR  2
            EYS+
Sbjct  472  EYSK  475



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 218/308 (71%), Gaps = 7/308 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeE---  743
            GEKMK LL +  EL+SNGLAM++  T +L S  +      +RRLL A   G  ++     
Sbjct  182  GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQS---QRRLLAAGAGGGTKKNTPKV  238

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN-NETFVIFIKAG  566
             P ++D  T  +    P S+K D  VAKDGSGQ KS+ EA+K +P  N ++TFVI++K G
Sbjct  239  IPVWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEG  298

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VYNE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFE
Sbjct  299  VYNEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFE  358

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            NSAGA  HQAVA+RV +D++IF+NC +D YQDTLYT  +RQ+YRDCTI+GTIDFIFGDAA
Sbjct  359  NSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  418

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             VFQNCKM+VRKP+ NQACMVTAQGR + R   A+VLQNC I  DP    V    K YLG
Sbjct  419  VVFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLG  478

Query  25   RPWKEYSR  2
            RPWK  +R
Sbjct  479  RPWKALAR  486



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 222/307 (72%), Gaps = 22/307 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK+LLK A+ELS+N L +++ F + ++ L+I  G+N  RRLLT              
Sbjct  177  GEKMKNLLKNAHELSTNALDIVSSFEKQVEDLQI-LGIN-NRRLLT--------------  220

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
             V+A  RRLL   P  +K + VVA+DGSGQ+KS+ EALK VP  N + +VIFIKAG+YNE
Sbjct  221  -VEAGNRRLLQVAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNE  277

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V   M  +VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG
Sbjct  278  YVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAG  337

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVSA+M +F NC ID YQ TL TH  RQ+YRDCTITGTIDFIFGDA AVFQ
Sbjct  338  PLKHQAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQ  397

Query  193  NCKMVVRKP--LKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV-KVYLGR  23
            NCK++ RKP  ++ QA  + AQGR +  G GA+++QNC I  +PAL ++NPP  K YLGR
Sbjct  398  NCKLIARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGR  457

Query  22   PWKEYSR  2
            PWK YSR
Sbjct  458  PWKLYSR  464



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   358 bits (919),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 219/304 (72%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM+T  +  L  ++IP  +N  RRLL+ E         FP 
Sbjct  184  GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPE-MN-SRRLLSQE---------FPS  232

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D  TRRLL    + +K D VVA+DGSGQYK++ EAL  VP K N TFV+ IK G+Y E
Sbjct  233  WMDGRTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKE  292

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT I+G ++ KDGI TY TATVAI GD FIA+N+GFEN+AG
Sbjct  293  YVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYKTATVAIVGDHFIAKNMGFENTAG  352

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  353  AIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  412

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            +C ++VRKPL NQAC +TA GRK+ R     VLQ C I+ +P   +V    K YLGRPWK
Sbjct  413  SCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWK  472

Query  13   EYSR  2
            EYSR
Sbjct  473  EYSR  476



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   350 bits (897),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 218/307 (71%), Gaps = 18/307 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP---AGLNFKRRLLTAETKGeeqeeEF  740
            EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +          
Sbjct  185  EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND----------  234

Query  739  PGFVDAATRRLLT-TNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
                D   RR+L     A  K +AVVA+DGSGQ+K++ EA+ +VP  N +TFVI+IKAGV
Sbjct  235  ----DWINRRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGV  290

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+NIGFEN
Sbjct  291  YKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEEFTAKNIGFEN  350

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AGA  HQAVA+RVS D  +F+N  ID YQDTLY H YRQ+Y DC+I+GTIDFIFGD+ +
Sbjct  351  TAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDSLS  410

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            +FQNCK +VRKP+ NQACMVTAQGR + R VGA+V+QN  I  + A  +  P +  YLGR
Sbjct  411  LFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGR  470

Query  22   PWKEYSR  2
            PWKE SR
Sbjct  471  PWKELSR  477



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 220/304 (72%), Gaps = 2/304 (1%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM+  L  A +++SN LAM+   +  ++SL I +  +  RRLL+        ++E P 
Sbjct  174  GEKMRVSLTKAMQMTSNALAMMAELSTYIKSLGIESSTS--RRLLSENEAVVGHDDELPN  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D   RRLL+ +P  I+   VVAKDGSG+++++ EALK +P K +E FV++IK GVY E
Sbjct  232  WMDLNKRRLLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYEE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            RV+V   +  ++F+G+GPTKTRITG  +  DG  TY TATVA+QGD F+A NIGFENSAG
Sbjct  292  RVQVNSSLTHLLFIGDGPTKTRITGKLNFIDGTNTYRTATVAVQGDNFMAVNIGFENSAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVSAD  IF+NCH+D YQDTLYTH YRQ+YRDC I+GTIDFIFGD+AAVFQ
Sbjct  352  PQKHQAVALRVSADKAIFYNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
             C ++VRKPL NQ C+VTAQGRK+ R    LV+QNC I  D A   +   +K YLGRPWK
Sbjct  412  GCTLLVRKPLDNQQCIVTAQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWK  471

Query  13   EYSR  2
            +YSR
Sbjct  472  QYSR  475



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 219/303 (72%), Gaps = 6/303 (2%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqe--eEFPGF  731
            M+  LKTA EL+SNGLAM++  + L+ S +    LN  RRL+++   G+ +   +  PG+
Sbjct  1    MRGFLKTAQELTSNGLAMVSEISRLVDSPK----LNSHRRLMSSSKGGQTKRNYKPVPGW  56

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            +      LLT  P S+K + VVAKDG+G+YK++ EALK VP K+NE FVI+IK G+Y E 
Sbjct  57   MSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEET  116

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V ++M  +V +G+GPT TRI+GS+S+ DGI T +TAT A  G+ F+A+ IGFEN+AG 
Sbjct  117  VIVDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFENTAGH  176

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RV +D +IF NCH+DAYQDTLYT  YRQ+YRDCTITGT+DFIFGD  A+FQN
Sbjct  177  VKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQN  236

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            CKMVVRKP + QACMVTAQGR +   +  + LQNC I  +P   +V    K YLGRPWK+
Sbjct  237  CKMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKK  296

Query  10   YSR  2
            ++R
Sbjct  297  FAR  299



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 217/304 (71%), Gaps = 9/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G KMK +L  +++LSSNGLA+IT  +  L+ L + AG    RRLL   ++       FP 
Sbjct  186  GAKMKEILTLSSQLSSNGLALITGLSSTLKDLNL-AGFT-GRRLLKDNSE-------FPS  236

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++    RRLL   P +IK D VVAKDGSGQYK++ EA+  +P K N TFVI+IK G+Y +
Sbjct  237  WLSHEKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQ  296

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V + R ++ I+ +G+G TKT+ITG  +   G+ T+ T+TV++ G  FIA++IGFEN+AG
Sbjct  297  QVTISRSLSHIMMIGDGATKTKITGDLNYAAGVQTFKTSTVSVSGSHFIAKDIGFENTAG  356

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  HQAVA+RV +DM+IF+NC +D YQDTLY H +RQ+YRDCTITGTIDFIFGDAAAVFQ
Sbjct  357  AIGHQAVALRVQSDMSIFYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQ  416

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK+VVRKPL+NQ C+VTAQGR E R     VLQNC+I  D     V    K YLGRPWK
Sbjct  417  NCKIVVRKPLENQNCIVTAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWK  476

Query  13   EYSR  2
            EYSR
Sbjct  477  EYSR  480



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 218/304 (72%), Gaps = 10/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA +L+ NGLA++T  ++ +  ++I +GLN  RRLL++          +P 
Sbjct  188  GETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQI-SGLN-SRRLLSSN--------GYPS  237

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VDA  RRLL      +K D VVA+DGSGQY ++ EAL+ VP K N TFV+ IKAGVY E
Sbjct  238  WVDARARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIKAGVYKE  297

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             ++V + M  +VF+G+GP KT I+G +  KDGI TY T TVAI GD FIA++IGFEN+AG
Sbjct  298  YIQVNKSMTDLVFIGDGPDKTIISGDKGFKDGITTYRTQTVAIVGDRFIAKDIGFENTAG  357

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV +DM++F+NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGDAAAVFQ
Sbjct  358  AIKHQAVAVRVQSDMSVFYNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQ  417

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR++ R     V Q C I  +P   SV    K YLGRPWK
Sbjct  418  NCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWK  477

Query  13   EYSR  2
             YSR
Sbjct  478  AYSR  481



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 218/308 (71%), Gaps = 7/308 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeE---  743
            GEKMK LL +  EL+SNGLAM++  T +L S  +      +RRLL A   G+ ++     
Sbjct  182  GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQS---QRRLLAAGAGGDTKKNTPKI  238

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN-NETFVIFIKAG  566
             P ++D     +    P S+K D  VAKDGSGQ KS+ EA+K +P  N ++TFVI++K G
Sbjct  239  IPVWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEG  298

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VYNE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFE
Sbjct  299  VYNEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFE  358

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            NSAGA  HQAVA+RV +D++IF+NC +D YQDTLYT  +RQ+YRDCTI+GTIDFIFGDAA
Sbjct  359  NSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  418

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             VFQNCKM+VRKP+ NQACMVTAQGR + R   A+VLQNC I  DP    V    K YLG
Sbjct  419  VVFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLG  478

Query  25   RPWKEYSR  2
            RPWK  +R
Sbjct  479  RPWKALAR  486



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 223/304 (73%), Gaps = 7/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LL+T+ EL+ NGL M++  T +L S  +PA     RRL+T E+  + +E   P 
Sbjct  185  GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPA---IGRRLMTEESNEQREE---PS  238

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    R LL    A+IK DAVVAKDGSG+YK+V  AL  VP K+N+TFVI++KAGVY E
Sbjct  239  WV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQE  297

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFENSAG
Sbjct  298  QVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFENSAG  357

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +DM++F+NC +D YQDTLYTHA+RQ+YRDCTITGTIDFIFG+ A VFQ
Sbjct  358  AAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQ  417

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VRKP+ NQ C+VTAQGR + +   A++LQNC I   P    +    K +LGRPWK
Sbjct  418  NCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWK  477

Query  13   EYSR  2
            +YSR
Sbjct  478  QYSR  481



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 223/304 (73%), Gaps = 7/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LL+T+ EL+ NGL M++  T +L S  +PA     RRL+T E+  + +E   P 
Sbjct  188  GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPA---IGRRLMTEESNEQREE---PS  241

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    R LL    A+IK DAVVAKDGSG+YK+V  AL  VP K+N+TFVI++KAGVY E
Sbjct  242  WV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQE  300

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFENSAG
Sbjct  301  QVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFENSAG  360

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +DM++F+NC +D YQDTLYTHA+RQ+YRDCTITGTIDFIFG+ A VFQ
Sbjct  361  AAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQ  420

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VRKP+ NQ C+VTAQGR + +   A++LQNC I   P    +    K +LGRPWK
Sbjct  421  NCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWK  480

Query  13   EYSR  2
            +YSR
Sbjct  481  QYSR  484



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 221/307 (72%), Gaps = 22/307 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK+LLK A+ELS+N L +++ F E +++L+I  G+N  RRLLT              
Sbjct  177  GEKMKNLLKNAHELSTNALDIVSSFEEQVENLQI-LGIN-NRRLLT--------------  220

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
             V+A  RRLL   P  +K + VVA+DGSGQ+KS+ EALK VP  N + +VI IKAG+YNE
Sbjct  221  -VEAGNRRLLQVAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNE  277

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V   M  +VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG
Sbjct  278  YVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAG  337

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RVSA+M +F NC ID YQ TL TH  RQ YRDCTITGTIDFIFGDA AVFQ
Sbjct  338  PLKHQAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQ  397

Query  193  NCKMVVRKP--LKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV-KVYLGR  23
            NCK++ RKP  ++ QA  + AQGR +  G GA+++QNC I  +PAL ++NPP  K YLGR
Sbjct  398  NCKLIARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGR  457

Query  22   PWKEYSR  2
            PWK YSR
Sbjct  458  PWKLYSR  464



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   353 bits (905),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 216/304 (71%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM+T  +  L  ++IP  LN  RRLL+ E         FP 
Sbjct  186  GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPE-LN-SRRLLSQE---------FPS  234

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D   R+LLT   + +K D VVA+DGSGQY ++ EA+  VP K N TFV+ IKAG+Y E
Sbjct  235  WMDGRARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIKAGIYKE  294

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT I+GS+S KDGI TY T TVAI GD FIA+N+GFEN+AG
Sbjct  295  FVQVNRSMTHLVFIGDGPDKTVISGSKSFKDGITTYRTTTVAIVGDHFIAKNMGFENTAG  354

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  355  AIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  414

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC  +VRKPL NQAC +TA GRK+ R     VLQ C I  +    +V    K YLGRPWK
Sbjct  415  NCTFLVRKPLPNQACPITAHGRKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWK  474

Query  13   EYSR  2
            EYSR
Sbjct  475  EYSR  478



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   352 bits (904),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 216/304 (71%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM++  +  L  L+IP   +  RRLL+ +         FP 
Sbjct  182  GETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMSS--RRLLSQD---------FPS  230

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++DA  RRLL    + +K D VVA+DGSGQYK++ EAL  VP K N TFV+ IK G+Y E
Sbjct  231  WMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIKGGIYKE  290

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+G  KT ITG ++ KDGI TY TATVAI GD FIA+NIGFEN+AG
Sbjct  291  YVQVNRSMTHLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGDHFIAKNIGFENTAG  350

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVAIRV AD +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  351  PIKHQAVAIRVLADQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  410

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I+ +P   +V    K YLGRPWK
Sbjct  411  NCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWK  470

Query  13   EYSR  2
            E+SR
Sbjct  471  EFSR  474



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   350 bits (899),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 220/306 (72%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  RRLL          E FP 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIP-GLN-SRRLL---------AEGFPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R+LL    A   +K D VVA+DGSGQYK++ EAL+ VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M+ +VF+G+GP KT I+G+++ KDGI TY TATVAI G+ FIA+NIGFEN+
Sbjct  294  KEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D +IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGDAAAV
Sbjct  354  AGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 219/306 (72%), Gaps = 18/306 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LL T  ELS NGLAM+  F E++       GL+  R+LLT +            
Sbjct  172  GEKMVKLLNTTRELSINGLAMVNSFGEMITQT---TGLS--RKLLTTDESS---------  217

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            FV+A+ R+LL  + A  K +AVVA+DGSGQYK++ +ALKAVP KN E FVI IKAG+Y E
Sbjct  218  FVEASNRKLLQISNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKE  275

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENS  380
             VEV + M  +VF+GEG TKT+ITG++S K  GIG T+HT TV + G+GF+AR+IGFEN+
Sbjct  276  YVEVEKGMTNVVFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENT  335

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG A+ QAVA+RV+AD  + +NC ID YQDTLY H+ RQ+YRDC I+GTIDF+FGDAAAV
Sbjct  336  AGPAQEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAV  395

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK++VR+P   Q CMVTAQGR      GA V+QNC+I  +P   +  P +K +LGRP
Sbjct  396  FQNCKLIVRRPGDGQNCMVTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRP  455

Query  19   WKEYSR  2
            WKEYSR
Sbjct  456  WKEYSR  461



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 216/304 (71%), Gaps = 11/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA +L+ NGLAM++     L  +E+P  +N  RRLL+ E         FP 
Sbjct  183  GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPE-MN-SRRLLSQE---------FPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   RRLL    + +K D VVA+DGSGQYK++ EAL+ VP KNN TFVI IK+G Y E
Sbjct  232  WVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIKSGTYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP K+ I+G++S KDGI TY TATVAI GD FIA+N+GFEN+AG
Sbjct  292  YVQVNRTMPNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  +QAVA+RV +D +IF+NC  D YQDTLY H++RQ+YRDCTITGTIDF+FGDAAAVFQ
Sbjct  352  ALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR + R     VLQ C I  +    +V    K YLGRPWK
Sbjct  412  NCTLLVRKPLANQACPITAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWK  471

Query  13   EYSR  2
            EYS+
Sbjct  472  EYSK  475



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 216/306 (71%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  RRLL          E FP 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIP-GLN-SRRLL---------AEGFPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   RRLL    A   +K D VVA+DGSGQY ++ +AL  VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVVHIKAGIY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+
Sbjct  294  KEYVQVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D  IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGDAAAV
Sbjct  354  AGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 221/307 (72%), Gaps = 11/307 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             EKMK +L   +E+ SNGLA++T F+ +  SL++ +   F  R L  E + ++     PG
Sbjct  176  AEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQLGS---FTSRRLMGEDEQQQ-----PG  227

Query  733  ---FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
               FV+ A R+LL  N  S+K +A VA+DGSG +K++  AL  +P K+N TFVI +KAGV
Sbjct  228  IDSFVEFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATFVIHVKAGV  287

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V +P+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+A++I FEN
Sbjct  288  YKETVIIPKKVNNVVIYGDGPNKTRVVNNKNYADGVETFHTATLAVNSDGFMAKDIAFEN  347

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAGA+KHQAVA+RVS D  IF+N  +D YQDTLY H YRQ YR+CTI+GTIDFIFGDA A
Sbjct  348  SAGASKHQAVAVRVSGDKAIFYNVVMDGYQDTLYAHGYRQLYRNCTISGTIDFIFGDATA  407

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQ C+M+VRKP  NQ CMVTAQGRK+ R +G  V+Q+ +I+P+P   +V P +  +LGR
Sbjct  408  VFQKCRMIVRKPDINQNCMVTAQGRKDQRSIGITVIQDSEIVPEPGFTAVVPKIDAFLGR  467

Query  22   PWKEYSR  2
            PWKEYSR
Sbjct  468  PWKEYSR  474



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 219/308 (71%), Gaps = 7/308 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAET-KGeeqeeE--  743
            GEKMK LLK+A EL+SNGLAMI   + +L +L+IP      RRLL+ E+ KGE + +E  
Sbjct  192  GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPG---ISRRLLSDESGKGEYRSDEGG  248

Query  742  -FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
             +P +     R+L    P +IK + +VA+DGSG+YK++ EAL  +P   N TFV+++K G
Sbjct  249  LYPSWASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEG  308

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VY E+V   + M  ++ +G+GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFE
Sbjct  309  VYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFE  368

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AGA+KHQAVA+RV +DM IF+NC +D YQDTLY HA+RQ+YRDCTITGTIDFIFGD+A
Sbjct  369  NNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSA  428

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             VFQNC ++VRKPL NQ C+VTAQGR E R    +VLQNC I             K YLG
Sbjct  429  VVFQNCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLG  488

Query  25   RPWKEYSR  2
            RPWK +SR
Sbjct  489  RPWKAFSR  496



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 219/306 (72%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  RRLL          E FP 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIP-GLN-SRRLL---------AEGFPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            ++D   R+LL    A   +K D VVA+DGSGQY ++ EAL+ VP K N TFV+ IKAG+Y
Sbjct  234  WLDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTFVVHIKAGLY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI G+ FIA+NIGFEN+
Sbjct  294  KEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D +IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGDAAAV
Sbjct  354  AGAIKHQAVALRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R V   V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAE--TKGeeqeeEF  740
            GEKM+ +LKT+ ELSSNGLA++   + +L +L++    N  RRLL+ +        ++EF
Sbjct  186  GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLA---NLNRRLLSDDPADPDNHIDDEF  242

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P +  +  R+LL  N + +K +  VAKDGSG +K++ EA++ +P  +N+TF+++IK G+Y
Sbjct  243  PYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIY  302

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E+V++ +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENS
Sbjct  303  EEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENS  362

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGAAKHQAVA+RV +D +IF+NC +D YQDTLYTH  RQ+YRDCTI+GTIDFIFGDAA +
Sbjct  363  AGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVI  422

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL NQ C+VTAQGRKE R   A+++QN     DP        +K YLGRP
Sbjct  423  FQNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRP  482

Query  19   WKEYSR  2
            WKE+SR
Sbjct  483  WKEFSR  488



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   348 bits (893),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/304 (55%), Positives = 214/304 (70%), Gaps = 3/304 (1%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM+  L+T+ EL+SNGLAMI   + +L SLE+PA  N  RRLL+ +  G   +   P 
Sbjct  177  GEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFTN--RRLLSDDILGHGMDI-LPS  233

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D   RRLL   P  +K D +VAKDGSG + ++ EAL  +     + FV++IK GVY E
Sbjct  234  WIDEGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEKEFVLYIKEGVYEE  293

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V   + +  +  +G+GPTKTRITG  +  DG+ TYHTATVA+ GD FIA++IGFEN+AG
Sbjct  294  KVTFHKNLLHLTVIGDGPTKTRITGKLNFIDGVPTYHTATVAVLGDFFIAKDIGFENAAG  353

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV AD TIF+NCH D +QDTLY H YRQ+YR+C I+GTIDF+FGD+AAV Q
Sbjct  354  PEKHQAVAVRVGADKTIFYNCHFDGFQDTLYAHTYRQFYRNCKISGTIDFVFGDSAAVLQ  413

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC + VRKPL NQ C+VTAQGRK+ R    LVLQNC  + DPA       +K YLGRPWK
Sbjct  414  NCTLEVRKPLDNQQCIVTAQGRKDVRQPTGLVLQNCSFVADPAYFPYRFQLKSYLGRPWK  473

Query  13   EYSR  2
            E+SR
Sbjct  474  EFSR  477



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 215/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  RRLL  E          P 
Sbjct  187  GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIP-GLN-SRRLLAQE---------IPS  235

Query  733  FVDAATRRLL--TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   RRLL   +  +  K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  236  WVDQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIY  295

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+
Sbjct  296  KEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNT  355

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVAIRV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  356  AGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAV  415

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  416  FQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  475

Query  19   WKEYSR  2
            WKEYSR
Sbjct  476  WKEYSR  481



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 215/304 (71%), Gaps = 13/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA +L+ NGLAM++  +  +  L+IP GLN  RRLL+++         +P 
Sbjct  188  GETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIP-GLN-SRRLLSSD---------YPS  236

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V   +R LL      +K D VVA+DGSGQYK++ EAL  +P K N TFV+ IKAG+Y E
Sbjct  237  WVGPRSRHLLAAT--EVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKE  294

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             ++V R M  +VF+G+GP KT I+G +  KDGI T+ T TVAI GD FIA+NIGFEN+AG
Sbjct  295  YIQVNRSMTNLVFIGDGPDKTIISGDKGFKDGITTFRTQTVAIIGDNFIAKNIGFENTAG  354

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV +DM +FHNC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGD+A VFQ
Sbjct  355  AIKHQAVAVRVQSDMAVFHNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQ  414

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR++ R     V Q C I  +P   +V    K YLGRPWK
Sbjct  415  NCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWK  474

Query  13   EYSR  2
            EYSR
Sbjct  475  EYSR  478



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   348 bits (892),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 212/305 (70%), Gaps = 6/305 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq--eeEFP  737
            EKMK  L ++ EL+SN L MIT  + +  SL   AG + +RR L  +         E  P
Sbjct  178  EKMKRALNSSMELTSNALYMITEISSVFTSLN--AGSSSRRRRLLFDEAPVLGHGNELLP  235

Query  736  GFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
             +VD   RRLL      IK D VVAKDGSG+YK++ EALK +P   N+T+V++IK G+YN
Sbjct  236  DWVDMRRRRLLAAK--EIKPDIVVAKDGSGKYKTINEALKNIPNNRNQTYVLYIKQGIYN  293

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E+VE    M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ GD FIA++IGFENSA
Sbjct  294  EKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFIAKDIGFENSA  353

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  KHQAVA+RV+AD +IF+NCHID YQDTL  H YRQ+YRDC I GTIDF+FGD AAVF
Sbjct  354  GPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVF  413

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC + VRKPLK Q C+VTAQGR + R    LV QNC I+ D +   V   VK YLGRPW
Sbjct  414  QNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYNEVKGEVKTYLGRPW  473

Query  16   KEYSR  2
            KEYSR
Sbjct  474  KEYSR  478



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   345 bits (886),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 214/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  +EIP GLN  RRLL  E          P 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSNFVGQMEIP-GLN-SRRLLAQE---------IPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   RRLL    A    K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVVHIKAGLY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI GD FIA+NIGF N+
Sbjct  294  KEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGDYFIAKNIGFVNT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV +D +IF NC  D YQDTLYTH++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  354  AGPIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 219/306 (72%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  RRLL          E FP 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIP-GLN-SRRLL---------AEGFPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R+LL    A   +K D VVA+DGSGQYK++ EAL+ VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M+ +VF+G+GP KT I+G+++ KDGI  Y TATVAI G+ FIA+NIGFEN+
Sbjct  294  KEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITAYRTATVAIVGNYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D +IF NC  D YQ+TLYTH++RQ++RDCTI+GTIDF+FGDAAAV
Sbjct  354  AGAIKHQAVAVRVQSDESIFFNCRFDGYQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 222/309 (72%), Gaps = 8/309 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTA-ETKG-eeqeeEF  740
            GEKMK  +K A E+S+NGL +I   +  L  L+I  G+N  RRLL   E  G ++   +F
Sbjct  187  GEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQI-TGVN--RRLLQEDEVLGHDDVPSKF  243

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYK---NNETFVIFIKA  569
            P +VDA TRRLL   P+ IK +  VAKDGSG +K++  AL ++P     + +TFV++IKA
Sbjct  244  PSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFVLYIKA  303

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  389
            GVY E VE  + M+ ++ +G+GP KTRITG+++  DG+ TYHTATV + GD FIA+NIGF
Sbjct  304  GVYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGVNTYHTATVVVLGDNFIAKNIGF  363

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            ENSAGA KHQAVA+RVSAD  +F+NC +D YQDTLYTHA RQ+YR+C+I+GTIDF+FGDA
Sbjct  364  ENSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLYTHAKRQFYRECSISGTIDFVFGDA  423

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              VFQNCK +VRKPL+NQ C+VTAQGRK+ R    +++QN      P L  V    K YL
Sbjct  424  PVVFQNCKFLVRKPLENQQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQYKSYL  483

Query  28   GRPWKEYSR  2
            GRPWK++SR
Sbjct  484  GRPWKQFSR  492



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 223/312 (71%), Gaps = 16/312 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTA-----ETKGeeqe  749
            GEKM+  LKT+ EL+SNGLAM++  + L +SL I  G    RRLL A     + K  ++ 
Sbjct  181  GEKMRQFLKTSQELTSNGLAMVSEVSTLFKSLNIKTG----RRLLQAAATATDEKRFQRA  236

Query  748  eEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET--FVIFI  575
            +  P ++D     L T  P ++K D VV+K G G+YK++ EALK +P KNNE   FVI++
Sbjct  237  KIIPAWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIP-KNNEVKVFVIYV  295

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E V   + M  ++ +G+GPTKT ITG R+  DG  TY TATV + GD FIA+++
Sbjct  296  KEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQTYLTATVGVVGDYFIAKDV  355

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFEN+AGA  HQAVA+RV +D++IF+NC++D YQDTLYT  +RQ+YRDCTI+GTIDFIFG
Sbjct  356  GFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFG  415

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPVK  38
            DAAAVFQNCKM+VRKPL+NQACMVTAQGR + R   AL+LQNC I  +    K +N   K
Sbjct  416  DAAAVFQNCKMIVRKPLENQACMVTAQGRLDRRSPSALILQNCTISGERGYDKELN---K  472

Query  37   VYLGRPWKEYSR  2
             YLGRPWK Y+R
Sbjct  473  AYLGRPWKSYAR  484



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   348 bits (892),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 222/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAE--TKGeeqeeEF  740
            GEKM+ +LKT+ ELSSNGLA++   + +L +L++    N  RRLL+ +        ++EF
Sbjct  186  GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLA---NLNRRLLSDDPADPDNHIDDEF  242

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P +  +  R+LL  N + +K +  VAKDGSG +K++ EA++ +P  +N+TF+++IK G+Y
Sbjct  243  PYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIY  302

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E+V++ +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENS
Sbjct  303  EEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENS  362

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGAAKHQAVA+RV +D +IF+NC +D YQDTLYTH  RQ+YRDCTI+GTIDFIFGDAA +
Sbjct  363  AGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVI  422

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL NQ C+VTAQGRKE R   A+++QN     DP        +K YLGRP
Sbjct  423  FQNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRP  482

Query  19   WKEYSR  2
            WKE+SR
Sbjct  483  WKEFSR  488



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   344 bits (882),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 215/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  +++P GLN  RRLL  E          P 
Sbjct  186  GETMKKALKTAIELTHNGLAIISEMSNYVGQMQMP-GLN-SRRLLADEV---------PS  234

Query  733  FVDAATRRLLTTNP--ASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   RRLL      +  K D VVA+DGSGQY ++ +A+K VP K N TFV+ IKAG+Y
Sbjct  235  WVDQRGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVHIKAGIY  294

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V R M  +VF+G+GP KT I+G+++ KDGI TY TATVAI GD FIA+NIGFEN+
Sbjct  295  KEYVQVNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIVGDHFIAKNIGFENT  354

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D  IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGDAAAV
Sbjct  355  AGAIKHQAVAVRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAV  414

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GR++ R     V Q C I  +P   +V    K YLGRP
Sbjct  415  FQNCTLLVRKPLPNQACPITAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRP  474

Query  19   WKEYSR  2
            WKEYSR
Sbjct  475  WKEYSR  480



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 213/304 (70%), Gaps = 8/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK +L T+++L+SNGLAM+T  + +LQ L++ +GL  ++ L             FP 
Sbjct  195  GQKMKEILSTSSQLTSNGLAMVTGLSSILQDLDL-SGLTGRKLLAQGNDN-------FPS  246

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++  A RRLL   PA+IK + VVA+DGSGQYK++ EA+K +P   N TFV++IK GVY E
Sbjct  247  WLSPAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKE  306

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V   R +  I+ +G+GPTKT+ITG  S   G+  Y TATV++ G  F+A++IGFENSAG
Sbjct  307  VVTFSRSLTHIMLIGDGPTKTKITGDLSFAGGVQIYKTATVSVSGSHFMAKDIGFENSAG  366

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  HQA+A++V +DM++F+NC ID YQ+TL++H YRQ+YR+CTITGTIDFI GDAAAVFQ
Sbjct  367  ATGHQAIALKVQSDMSVFYNCQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQ  426

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKMVVRKPL+NQ C +TAQGR   R     VLQNC I  +     V      +LGRPWK
Sbjct  427  NCKMVVRKPLENQRCTITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWK  486

Query  13   EYSR  2
             YSR
Sbjct  487  PYSR  490



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 217/309 (70%), Gaps = 15/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + KT+ EL+SNGLAMIT+ + LL    I  GL     N+ R+LL+ E       +
Sbjct  186  QDMHKIFKTSRELTSNGLAMITNISNLLGEFNI-TGLTGDLGNYARKLLSTE-------D  237

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V   TR+L+ T    +K + VVA+DGSGQYK++ EAL  VP  N + FVI+IK G
Sbjct  238  GIPSWVGPNTRQLMATK-GGVKANVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQG  296

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            VYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD F A+NIGF
Sbjct  297  VYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNFYIGKVKTYHTATVAINGDHFTAKNIGF  356

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVS D  +F+NC ID YQDTLY H++RQ++RDCTI+GT+DFIFGDA
Sbjct  357  ENTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFGDA  416

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              V QNC +VVRKP+K Q+CM+TAQGR + R    LVLQNC I  +PA   V    K YL
Sbjct  417  KVVLQNCNIVVRKPMKGQSCMITAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKAYL  476

Query  28   GRPWKEYSR  2
            GRPWKE+SR
Sbjct  477  GRPWKEFSR  485



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 217/308 (70%), Gaps = 13/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            + M+ + KT+ EL+SNGLAMIT+ + LL    +         + R+LL+AE       + 
Sbjct  185  QDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLGKYARKLLSAE-------DG  237

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +V   TRRL+ T    +K + VVA DGSGQYK++ EAL AVP  N + FVI+IK GV
Sbjct  238  IPSWVGPNTRRLMATK-GGVKANVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGV  296

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            YNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TY TATVAI GD F A+NIGFE
Sbjct  297  YNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYLTATVAINGDNFTAKNIGFE  356

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG   HQAVA+RVSAD+ +F+NC ID YQDTLY H++RQ++RDCT++GT+DFIFGD  
Sbjct  357  NTAGPEGHQAVALRVSADLAVFYNCQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFGDGI  416

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             V QNC +VVRKP+K+Q+CM+TAQGR + R    LVLQNC I  +PA   V    K YLG
Sbjct  417  VVLQNCNIVVRKPMKSQSCMITAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLG  476

Query  25   RPWKEYSR  2
            RPWKE+SR
Sbjct  477  RPWKEFSR  484



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 216/304 (71%), Gaps = 4/304 (1%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G KM+  LK++ EL+SN LAM+   +  L  + +    NF R+LL+ +       ++F  
Sbjct  187  GHKMREALKSSEELTSNVLAMVDEISLALAKMNLT---NFNRKLLS-DDNVIGHGDDFSM  242

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +  +  R+LL+   A +K + VVAKDGSG+++++ EALK +P  + +TFV+ IKAGVY E
Sbjct  243  WATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTFVLHIKAGVYKE  302

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V    KM  ++ VG+GPTKTRI+ +++  DG  T+ TATV++ GD FIAR+IGFENSAG
Sbjct  303  QVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFGDNFIARDIGFENSAG  362

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+ V +DM IFHNCH+D YQDTLY H+ RQ+YRDCTITGTIDF+ GDAAAVFQ
Sbjct  363  AIKHQAVALMVRSDMAIFHNCHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQ  422

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCKM++RKPL NQ C+VTAQGR + R   AL+LQNC I  DP+       +  YLGRPWK
Sbjct  423  NCKMLIRKPLDNQQCIVTAQGRSKRREASALILQNCTITADPSYTPFKGQILSYLGRPWK  482

Query  13   EYSR  2
             YSR
Sbjct  483  AYSR  486



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 214/304 (70%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ NGLAM+T  +  L  ++    LN  RRLL  E          P 
Sbjct  170  GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTE-LN-SRRLLAQE----------PS  217

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   RRLLT   + +K D VVA+DGSGQYK++ EA++ VP   N TFV++IK GVY E
Sbjct  218  WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKE  277

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD FIA+N+GFEN+AG
Sbjct  278  FVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFENTAG  337

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAV IRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  338  AAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  397

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR++ +     VLQ C I  +    +V    K YLGRPWK
Sbjct  398  NCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKESSKAYLGRPWK  457

Query  13   EYSR  2
             YS+
Sbjct  458  AYSK  461



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   345 bits (884),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 214/304 (70%), Gaps = 10/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA +L+ NGLAM++  +  L  ++ P  LN  RRLL+ +        +FP 
Sbjct  184  GETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPE-LN-SRRLLSQD--------QFPS  233

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++D   R LL    +  K D VVA+DGSGQYK++ EAL+ VP K N TFV+ IK G+Y E
Sbjct  234  WLDVRARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIKEGIYKE  293

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M  +VF+G+GP KT ++G +S KDGI TY TATV I GD FIA+N+GFEN+AG
Sbjct  294  YVQVNRSMPDLVFIGDGPDKTVLSGDKSFKDGITTYRTATVGIIGDHFIAKNMGFENTAG  353

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVAIRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  354  AIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  413

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GRK+ R     VLQ C I  +    +V    K YLGRPWK
Sbjct  414  NCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWK  473

Query  13   EYSR  2
            EYS+
Sbjct  474  EYSK  477



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 217/306 (71%), Gaps = 18/306 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM  LL T  ELS NGLAM+  F E++       GL+  R+LLT   +          
Sbjct  172  GEKMVKLLNTTRELSINGLAMVNSFGEMITQT---TGLS--RKLLTTTEESS--------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            F++A+ R+LL  + A  K +AVVA+DGSGQYK++ +ALKAVP KN E FVI IKAG+Y E
Sbjct  219  FIEASNRKLLQISSA--KPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKE  276

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENS  380
             VEV + M  +VF+GEG TKT+ITG++  K  GIG T+HT TV + G+GF+AR+IGFEN+
Sbjct  277  YVEVEKGMTNVVFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENT  336

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG    QAVA+RV+AD  + +NC ID YQDTLY H+ RQ+YRDC I+GTIDF+FGDAAAV
Sbjct  337  AGPTLEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAV  396

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK++VRKPL +Q CMVTAQGR      GA+V+QNC+I  DP   +  P    YLGRP
Sbjct  397  FQNCKLIVRKPLDSQNCMVTAQGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYLGRP  455

Query  19   WKEYSR  2
            WKEYSR
Sbjct  456  WKEYSR  461



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   350 bits (898),  Expect = 6e-109, Method: Composition-based stats.
 Identities = 168/304 (55%), Positives = 217/304 (71%), Gaps = 18/304 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK  LK + EL+SN LAM+   +  L+++                  G +   E P 
Sbjct  174  GQKMKDALKISMELTSNALAMVAEISTFLEAM------------------GMQSFSELPD  215

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            + D   R+LLT +P  +K D VVAKDGSG+Y+++ EALK +P K+N+TFV++IK GVY E
Sbjct  216  WADFNKRKLLTASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEE  275

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V++   +  ++ VG+GPTKTRITG  +  DG GTY TATVA+QGD FIA+ IGFENSAG
Sbjct  276  KVQINSSLTHLMMVGDGPTKTRITGHLNFIDGTGTYQTATVAVQGDDFIAKEIGFENSAG  335

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RVSAD +IF+NCH+D YQDTLY H YRQ+Y+DC I+GT+DFIFGD+AAVFQ
Sbjct  336  AAKHQAVALRVSADKSIFYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQ  395

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
             C +VVRKP+ NQ C+VTAQGRK+ R    +V+QNC  + DP L  V   +  YLGRPWK
Sbjct  396  GCTLVVRKPMDNQQCIVTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWK  455

Query  13   EYSR  2
            EYSR
Sbjct  456  EYSR  459



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   340 bits (871),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 223/312 (71%), Gaps = 16/312 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTA-----ETKGeeqe  749
            GEKM+  LKT+ EL+SNGLAM++  + L ++L I  G    RRLL A     + K  ++ 
Sbjct  182  GEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTG----RRLLQAAATATDEKRFQKA  237

Query  748  eEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET--FVIFI  575
            +  P ++D     L T  P ++K D VV+K G G+YK++ EALK +P KNNE   FVI++
Sbjct  238  KIIPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIP-KNNEVKVFVIYV  296

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++I
Sbjct  297  KEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDI  356

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFEN+AGA  HQAVA+RV +D++IF+NC++D YQDTLYT  +RQ+YRDCTI+GTIDFIFG
Sbjct  357  GFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFG  416

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPVK  38
            DAAAVFQNCKM+VRKPL+NQACMVTA GR + R   AL+LQNC I  +    K +N   K
Sbjct  417  DAAAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTALILQNCTISGESGYDKELN---K  473

Query  37   VYLGRPWKEYSR  2
             YLGRPWK Y+R
Sbjct  474  AYLGRPWKSYAR  485



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 215/310 (69%), Gaps = 7/310 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq--eeEF  740
            GE+MK LLKT+  LSSNGLAM+      L  L  P   + +RRLL+ +        + E 
Sbjct  194  GEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNP-DPSHRRRLLSFDGLPILGHGDLEL  252

Query  739  PGFVDAATRRLLT--TNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
            P + +A  R+LLT  T PA   H  DAVV+KDGSG YK++ EAL+ VP   NETFVI+IK
Sbjct  253  PEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALEHVPKYGNETFVIYIK  312

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             GVYNE V V R M  ++ +G+G  KTRITG+ +  DG  TY TA VAI GD F+A +IG
Sbjct  313  EGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTPTYRTAAVAIHGDHFMAMDIG  372

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            FENSAG  KHQAVA+RVSAD  IF+ C +D YQDTLYTH +RQ+YRDCTI+GTIDF+FGD
Sbjct  373  FENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFGD  432

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            AAA+FQNC  VV KPL +Q+C+VTAQGRKE R   A+V+QN  I  DP    V    K Y
Sbjct  433  AAAIFQNCTFVVHKPLPDQSCIVTAQGRKEGRQPSAIVIQNSTITADPDYFLVKNVNKAY  492

Query  31   LGRPWKEYSR  2
            LGRPWKEYSR
Sbjct  493  LGRPWKEYSR  502



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   341 bits (874),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 214/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN   RLL  E          P 
Sbjct  187  GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIP-GLN-SCRLLAQE---------IPS  235

Query  733  FVDAATRRLL--TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +V+   RRLL   +  +  K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  236  WVNQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIY  295

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+
Sbjct  296  KEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNT  355

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVAIRV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  356  AGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAV  415

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  416  FQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  475

Query  19   WKEYSR  2
            WKEYSR
Sbjct  476  WKEYSR  481



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 216/308 (70%), Gaps = 12/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSL---EIPAGL-NFKRRLLTAETKGeeqeeE  743
            + MK++ KT+ EL+SN LAMIT  + LL  +   E+   L N+ R+LL+ E       E 
Sbjct  180  QDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDLGNYARKLLSTE-------EG  232

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +V   TRRL+      +K + VVA+DGSGQYKS+ EALKAVP  N   FVI+IK G+
Sbjct  233  IPSWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALKAVPQNNRWPFVIYIKQGI  292

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            Y E V+V +KM  + F+G+GPT+T+ITG+ + + G + TY TATVAI GD F A+NIGFE
Sbjct  293  YKENVDVTKKMTHVTFIGDGPTRTKITGNLNFRIGKVKTYQTATVAINGDNFTAKNIGFE  352

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG   HQAVA+RVSAD  +FHNC +D YQDTLY HA+RQ+YRDCTI+GT+DFIFGDA 
Sbjct  353  NTAGPEGHQAVALRVSADYAVFHNCQMDGYQDTLYVHAHRQFYRDCTISGTVDFIFGDAK  412

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            ++FQNC +VVRKP+  Q+C+VTAQGR + R    +VL NC I  +PA   V    K YLG
Sbjct  413  SLFQNCNIVVRKPMGGQSCIVTAQGRTDVRESTGIVLHNCRITGEPAYIPVKAVNKAYLG  472

Query  25   RPWKEYSR  2
            RPWK +SR
Sbjct  473  RPWKVFSR  480



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 215/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP+ LN  RRLL+         E  P 
Sbjct  185  GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPS-LN-SRRLLS---------EGIPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R+LL    A    K D VVA+DGSGQY ++ EALK VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE V+V + M  +VF+G+GP KT I+G++S KDGI TY T TVAI GD FIA+NIGFEN+
Sbjct  294  NEYVQVNKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D  IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGD+AAV
Sbjct  354  AGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYS+
Sbjct  474  WKEYSK  479



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 212/310 (68%), Gaps = 8/310 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEF--  740
             E+MK++LKT+  LSSN LAM++        L  P   +  RRLL  +        EF  
Sbjct  195  AEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPSH--RRLLQFDAFPVIGHSEFED  252

Query  739  PGFVDAATRRLLTTNPASI----KHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
            P +     R+LLTT+  S     K D +VAKDGSG YK++ EALK VP   NETF+I+IK
Sbjct  253  PKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVPKYGNETFIIYIK  312

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             G+YNE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVAIQGD F+  +IG
Sbjct  313  EGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDGTTTYHTATVAIQGDHFMVMDIG  372

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            FENSAG  KHQAVA+RVSAD  IF+ C +D YQDTLYTHA RQ+YRDCTI+GTIDF+FGD
Sbjct  373  FENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLYTHAQRQFYRDCTISGTIDFVFGD  432

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            A A+FQNC  ++RKPL NQ+C+VTAQGRKE R   A+++QN  I  DP    V    K Y
Sbjct  433  ATAIFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITADPDYFPVKDENKAY  492

Query  31   LGRPWKEYSR  2
            LGRPWKEYSR
Sbjct  493  LGRPWKEYSR  502



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 213/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP GLN  R LL  E          P 
Sbjct  187  GETMKKALKTAIELTHNGLAIISEMSNFVGQMDIP-GLN-SRGLLAQE---------IPS  235

Query  733  FVDAATRRLL--TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL   +  +  K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  236  WVDQRGPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIY  295

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+
Sbjct  296  KEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNT  355

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVAIRV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  356  AGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAV  415

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  416  FQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRP  475

Query  19   WKEYSR  2
            WKEYSR
Sbjct  476  WKEYSR  481



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 213/309 (69%), Gaps = 15/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + KT+ EL+SNGLAMIT  +  L    +  GL     ++ R+LL+ +       +
Sbjct  185  QDMHKIFKTSKELTSNGLAMITSISSFLGGFNM-TGLTGDLGHYARKLLSTK-------D  236

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V   TRRL+ T    +K + VVA+DGSGQYK++ EAL  VP  N   FVI+IK G
Sbjct  237  GIPSWVGPNTRRLMATQ-GVVKPNVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQG  295

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            VYNE+V V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVA+ GD F A+NIGF
Sbjct  296  VYNEKVNVTKKMTHVTFIGDGPTKTKITGSLNYHIGKVKTYHTATVAVNGDNFTAKNIGF  355

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD  +FHNC ID YQDTLY H++RQ+YRDCTI+GT+DFIFGD 
Sbjct  356  ENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDG  415

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              V QNC +VVRKP+KNQ+CM+TAQGR + R    LVL NC I+ +P    V    K YL
Sbjct  416  KVVLQNCNIVVRKPMKNQSCMITAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYL  475

Query  28   GRPWKEYSR  2
            GRPWKE+SR
Sbjct  476  GRPWKEFSR  484



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   338 bits (866),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 219/311 (70%), Gaps = 12/311 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAE---TKGeeqeeE  743
            GEKMKH L T  +L+SNGLAM+T  T +L SL + A    +RRLL      +  +   + 
Sbjct  184  GEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKAN---RRRLLAGGGGGSNAKNAPKV  240

Query  742  FPGFVDAATRRLL---TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN-NETFVIFI  575
             P +++   +R L   T  P SIK DAVVAKDGSGQY+++ EA+K +P  N ++TFVI++
Sbjct  241  IPTWIN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYV  298

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E V + + M  ++ +G+G TKT++TGS++   G+ T+ TATV + GD FIA++I
Sbjct  299  KEGVYSEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDI  358

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            G ENSAGA  HQAVA+RV +D++IF+ C +D YQDTLYT  +RQ+YRDCTI+GTIDFIFG
Sbjct  359  GIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFG  418

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DAA VFQNCKM+VRKP+ NQACMVTAQGR + R    ++LQNC I  DP    V    K 
Sbjct  419  DAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKS  478

Query  34   YLGRPWKEYSR  2
            YLGRPWK  +R
Sbjct  479  YLGRPWKNLAR  489



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   338 bits (868),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 212/306 (69%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  + IP  LN  RRLL+ +          P 
Sbjct  185  GETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPE-LN-SRRLLSQD---------IPS  233

Query  733  FVDAATRRLLTTNP--ASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R LL      +  K D VVA+DGSGQY ++ +A+K VP K N TFV+ IKAGVY
Sbjct  234  WVDQRGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVHIKAGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+
Sbjct  294  KEYVQVNKSMTHLVFIGDGPDKTIISGSKNYKDGITTYRTATVAIIGDYFIAKNIGFVNT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  354  AGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GRK+ R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   338 bits (867),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 214/312 (69%), Gaps = 9/312 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqe----e  746
            G++MK LLKT+  LSSNGLAM++     L  L  P      RR       G         
Sbjct  194  GQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSR-HRRRRLLSLDGLPILGHGDL  252

Query  745  EFPGFVDAATRRLLTTN----PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIF  578
            EFP + +A  R+LLT +    P + K DAVVAKDGSG YK++ EAL+ VP   NETFVI+
Sbjct  253  EFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEALEHVPKYGNETFVIY  312

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            IK GVYNE V V R M  ++ +G+G  KTRITG+++  DG  TY TATVAI GD F+A +
Sbjct  313  IKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTPTYRTATVAIHGDHFMAMD  372

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGF+NSAG  KHQAVA+RVSAD  IF+ C +D YQDTLYTH +RQ+YRDCTI+GTIDF+F
Sbjct  373  IGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFVF  432

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            GDAAA+FQNC  VVRKPL +Q+C+VTAQGRKE R   A+V+QN  I  DP    V    +
Sbjct  433  GDAAAIFQNCTFVVRKPLPDQSCIVTAQGRKERRQPSAIVIQNSTITADPDYFPVKNVNR  492

Query  37   VYLGRPWKEYSR  2
             YLGRPWKEYSR
Sbjct  493  AYLGRPWKEYSR  504



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 220/312 (71%), Gaps = 16/312 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq-----e  749
            GEKM+  LKT+ EL+SNGLAM++  + L ++L I  G    RRLL A     ++      
Sbjct  182  GEKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIKTG----RRLLQAAATATDENRFQRA  237

Query  748  eEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET--FVIFI  575
            +  P ++D     L T  P ++K D VV+  G G+YK++ EALK +P KNNE   FVI++
Sbjct  238  KIIPAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIP-KNNEVKVFVIYV  296

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++I
Sbjct  297  KEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDI  356

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFEN+AGA  HQAVA+RV +D++IF+NC++D YQDTLYT  +RQ+YRDCTI+GTIDFIFG
Sbjct  357  GFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFG  416

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPVK  38
            DAAAVFQNCKM+VRKPL+NQACMVTA GR + R   AL+LQNC I  +    K +N   K
Sbjct  417  DAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYNKELN---K  473

Query  37   VYLGRPWKEYSR  2
             YLGRPWK Y+R
Sbjct  474  AYLGRPWKSYAR  485



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   340 bits (872),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 211/307 (69%), Gaps = 15/307 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFK-RRLLTAETKGeeqeeEFP  737
            GE MK  LKTA EL+ NGLA+I+  +  +  + IP    F  RRLL+ E          P
Sbjct  185  GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIP---EFSSRRLLSQE---------IP  232

Query  736  GFVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             +VD   RRLL    A    K D VVA+DGSGQYK++ EALK VP K N TFV++IKAG+
Sbjct  233  SWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGI  292

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N
Sbjct  293  YQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVN  352

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AG AK QAVA+RV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAA
Sbjct  353  TAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAA  412

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGR
Sbjct  413  VFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGR  472

Query  22   PWKEYSR  2
            PW+E+SR
Sbjct  473  PWREFSR  479



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 211/307 (69%), Gaps = 15/307 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFK-RRLLTAETKGeeqeeEFP  737
            GE MK  LKTA EL+ NGLA+I+  +  +  + IP    F  RRLL+ E          P
Sbjct  185  GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIP---EFSSRRLLSQE---------IP  232

Query  736  GFVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             +VD   RRLL    A    K D VVA+DGSGQYK++ EALK VP K N TFV++IKAG+
Sbjct  233  SWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGI  292

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N
Sbjct  293  YQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVN  352

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AG AK QAVA+RV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAA
Sbjct  353  TAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAA  412

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGR
Sbjct  413  VFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGR  472

Query  22   PWKEYSR  2
            PW+E+SR
Sbjct  473  PWREFSR  479



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 207/303 (68%), Gaps = 2/303 (1%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            EKMK  L ++ EL+SN L MIT  + +  SL   +    +  LL          E  P +
Sbjct  178  EKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILGHGNELLPDW  237

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            VD   RRLL      IK D VVAKDGS +YK++ EALK +P   N+T+V++IK GVYNE+
Sbjct  238  VDMRRRRLLAAK--EIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYVLYIKQGVYNEK  295

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            VE    M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ GD F+A++IGFENSAG 
Sbjct  296  VEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFVAKDIGFENSAGP  355

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RV+AD +IF+NCHID YQDTL  H YRQ+YRDC I GTIDF+FGD AAVFQN
Sbjct  356  EKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQN  415

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C + VRKPLK Q C+VTAQGR + R    LV QNC I+ D +   V   VK YLGRPWKE
Sbjct  416  CTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYDEVKGEVKTYLGRPWKE  475

Query  10   YSR  2
            YSR
Sbjct  476  YSR  478



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   339 bits (870),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 212/306 (69%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  + IP   +  RRLL+ E         FP 
Sbjct  185  GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSS--RRLLSQE---------FPS  233

Query  733  FVDAATRRLL--TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   RRLL      +  K D VVA+DGSGQYK++ EALK VP K N TFV++IKAG+Y
Sbjct  234  WVDQRGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N+
Sbjct  294  QEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG AK QAVA+RV +D +IF NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAV
Sbjct  354  AGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRP  473

Query  19   WKEYSR  2
            W+E+SR
Sbjct  474  WREFSR  479



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 212/304 (70%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ N LAM+T  +  L  ++     +  RRLL  E          P 
Sbjct  184  GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSS--RRLLAQE----------PS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   RRLLT   + +K D VVA+DGSGQYK++ EA++ VP   N TFV++IK GVY E
Sbjct  232  WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD FIA+N+GF+N+AG
Sbjct  292  FVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAV IRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  352  AAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR++ +     VLQ C I  +    +V    K YLGRPWK
Sbjct  412  NCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWK  471

Query  13   EYSR  2
             YS+
Sbjct  472  AYSK  475



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   338 bits (866),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 213/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP+ LN  RRLL          +  P 
Sbjct  185  GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPS-LN-SRRLLA---------QGIPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R+LL    A    K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+G  KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+
Sbjct  294  KEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D  IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGD+AAV
Sbjct  354  AGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYSR
Sbjct  474  WKEYSR  479



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   338 bits (868),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 212/304 (70%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE +K  LKTA +L+ N LAM+T  +  L  ++     +  RRLL  E          P 
Sbjct  184  GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSS--RRLLAQE----------PS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD   RRLLT   + +K D VVA+DGSGQYK++ EA++ VP   N TFV++IK GVY E
Sbjct  232  WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD FIA+N+GF+N+AG
Sbjct  292  FVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAG  351

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAV IRV +D +IF+NC  D YQDTLY H++RQ+YRDCTI+GTIDF+FGDAAAVFQ
Sbjct  352  AAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  411

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQAC +TA GR++ +     VLQ C I  +    +V    K YLGRPWK
Sbjct  412  NCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWK  471

Query  13   EYSR  2
             YS+
Sbjct  472  AYSK  475



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   335 bits (858),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 211/303 (70%), Gaps = 6/303 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            + M   L +++ L+SN LA+I   + +L S ++ +     RRLL+ +   E +  EFP +
Sbjct  193  DNMSKALNSSSALTSNALAIIDGISSVLASFQLSS---LGRRLLSDD---EGERGEFPSW  246

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V    R+LL  +   IK D  VA+DGSG+YK++ +AL AVP K N TFVI+IK GVY E 
Sbjct  247  VGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKEGVYKEN  306

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V R M  ++  G+GPTKT+ITGS +  DG  T+ TAT+A+ GDGFI +N+G EN+AGA
Sbjct  307  VMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGDGFIGKNLGVENTAGA  366

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
            AKHQAVA+RV +D ++F+ C +D YQDTLYTH  RQ+YR+CTI+GTIDF+FGDAA VFQN
Sbjct  367  AKHQAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQN  426

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C M+VRKP+ NQ C+VTAQGRK+      +VL NC I  DP L S +     YLGRPWKE
Sbjct  427  CLMLVRKPMANQQCIVTAQGRKDRHEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKE  486

Query  10   YSR  2
            YSR
Sbjct  487  YSR  489



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   335 bits (859),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 209/306 (68%), Gaps = 5/306 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEF--  740
             E+MK +L T+  LSSN LAM++        L  P   +  RRLL  +        EF  
Sbjct  195  AEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSSH--RRLLQFDAFPVIGHSEFED  252

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P + +   R+L ++ P   K D +VAKDGSG YK++ EAL  VP   NETF+I+IK GVY
Sbjct  253  PKWYEGGVRKL-SSAPKINKPDIIVAKDGSGSYKTITEALDHVPKYGNETFIIYIKEGVY  311

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVAIQGD F+AR+IGFENS
Sbjct  312  NEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTPTYHTATVAIQGDHFMARDIGFENS  371

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RVSAD  IF+ C +D YQDTLYTHA RQ+Y DCTI+GTIDF+FGDA AV
Sbjct  372  AGPEKHQAVALRVSADEAIFYRCSMDGYQDTLYTHAQRQFYCDCTISGTIDFVFGDATAV  431

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  ++RKPL NQ+C+VTAQGRKE R   A+++QN  I  +P    V    K YLGRP
Sbjct  432  FQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENKAYLGRP  491

Query  19   WKEYSR  2
            WKEYSR
Sbjct  492  WKEYSR  497



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 210/309 (68%), Gaps = 16/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + +T+ EL+SN LAMIT  +  L   E   GL     N  R+LL+ E       +
Sbjct  185  QDMHKIFETSKELTSNALAMITSISSFLG--EHITGLIGDHGNHARKLLSTE-------D  235

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V   TRRL+      +K D VVA+DGSGQYK++ EAL  VP  N + FVI+IK G
Sbjct  236  GIPSWVGPNTRRLMAEQ-GVVKPDVVVAQDGSGQYKTINEALSVVPKANQKPFVIYIKQG  294

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            VYNE+V+VP+KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD F A+NIGF
Sbjct  295  VYNEKVDVPKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTAKNIGF  354

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD  +FHNC ID YQDTLY H++RQ+YRDCTI+GT+DFIFGD 
Sbjct  355  ENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDG  414

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              V Q C +VVRKP+K Q+CM+TAQGR + R    LVL NC I  +P    V    K YL
Sbjct  415  KVVLQKCNIVVRKPMKGQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYL  474

Query  28   GRPWKEYSR  2
            GRPWK++SR
Sbjct  475  GRPWKQFSR  483



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 213/306 (70%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE MK  LKTA EL+ NGLA+I+  +  +  ++IP+ LN  RRLL          +  P 
Sbjct  185  GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPS-LN-SRRLL---------AQGIPS  233

Query  733  FVDAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD   R+LL    A    K D VVA+DGSGQY ++ +ALK VP K N TFV+ IKAG+Y
Sbjct  234  WVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+G  KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+
Sbjct  294  KEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENT  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV +D  IF NC  D YQDTLYTH++RQ++RDCTI+GTIDF+FGD+AAV
Sbjct  354  AGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC ++VRKPL NQAC +TA GR + R     V Q C I  +P   +V    K YLGRP
Sbjct  414  FQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRP  473

Query  19   WKEYSR  2
            WKEYS+
Sbjct  474  WKEYSK  479



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 220/307 (72%), Gaps = 10/307 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAET--KGeeqeeEF  740
            G KMK+ LKT+ EL+ N LAM T    L ++    + L  +RRLL A+T    ++  +  
Sbjct  181  GAKMKNFLKTSQELTKNALAMATEIGNLFRT----SSLKSQRRLL-ADTPMDPKKAPKII  235

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNN-ETFVIFIKAGV  563
            P +++     + T NP S+K D +VAKDGSG+YK+V EALK +P  N  +TFVI+IK GV
Sbjct  236  PSWIEGRKLDIATANPISLKPDVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGV  295

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y+E+V + + M  ++F+G+GPTKT+ITG+++  DG+ T+ TATVA+ GD FIA++IGFEN
Sbjct  296  YSEQVVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQTFKTATVAVIGDYFIAKDIGFEN  355

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AGA  HQAVA+RV +D++IF+NC ID YQDTLYT  +RQ+YRDC I+GTIDFIFGDAAA
Sbjct  356  TAGARGHQAVALRVQSDLSIFYNCQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDAAA  415

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNCKM+VRKP  NQ+CMVTAQGR + R    +VLQNC I  +    +       YLGR
Sbjct  416  VFQNCKMIVRKPGPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFDAAT--TMAYLGR  473

Query  22   PWKEYSR  2
            PWK YSR
Sbjct  474  PWKMYSR  480



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 213/305 (70%), Gaps = 10/305 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE+MK ++KTA +L+SN LA++T  +++  S +IP   NF RRLL+   +G      FP 
Sbjct  197  GEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIP---NFNRRLLSTSNEG------FPE  247

Query  733  FVDAATRRLLTTN-PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
            +V  + RRL T + PA    D VVA+DGSG   +V EAL  VP    + FVI++K G+Y 
Sbjct  248  WVSQSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYK  307

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E V + + M  +  +G+GPTK+ IT   +  DG+ T++TATV + G+GF+A+N+GFENSA
Sbjct  308  ENVNIEKNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNGFVAKNMGFENSA  367

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA KHQAVA+RV +D +IF+NC +D YQDTLY H +RQ+YR+CTI+GTIDFIFG++A VF
Sbjct  368  GAEKHQAVALRVESDFSIFYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVF  427

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC++VVRKPL NQ   +TAQGR + R   AL+L NC I+ DP    +   +  YLGRPW
Sbjct  428  QNCQIVVRKPLDNQQNTITAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLPTYLGRPW  487

Query  16   KEYSR  2
            KEYSR
Sbjct  488  KEYSR  492



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 216/311 (69%), Gaps = 12/311 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAET---KGeeqeeE  743
            G+KMK  L T  +L+SNGLAM+T  T +L SL + A    +RRLL         +   + 
Sbjct  184  GDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKAN---RRRLLAGGGGGGNAKNAPKV  240

Query  742  FPGFVDAATRRLL---TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN-NETFVIFI  575
             P +++   +R L   T  P SIK DAVVAKDGSGQY+++ EA+K +P  N ++TFVI++
Sbjct  241  IPTWIN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYV  298

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E V + + M  ++ +G+G  KT++TGS++   G+ T+ TATV + GD FIA++I
Sbjct  299  KEGVYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDI  358

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            G ENSAGA  HQAVA+RV +D++IF+ C +D YQDTLYT  +RQ+YRDCTI+GTIDFIFG
Sbjct  359  GIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFG  418

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DAA VFQNCKM+VRKP+ NQACMVTAQGR + R    ++LQNC I  DP    V    K 
Sbjct  419  DAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKS  478

Query  34   YLGRPWKEYSR  2
            YLGRPWK  +R
Sbjct  479  YLGRPWKNLAR  489



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 211/304 (69%), Gaps = 18/304 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            ++M  L+ T  ELSSN L+M+ +F E+     I       R+LL+              F
Sbjct  173  DEMMKLMSTTRELSSNALSMVNNFGEM-----ITQNTGLTRKLLSNSD----------SF  217

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V+A+ R+LL  + +  K +AVV+  G GQYK++ EAL+AVP  +   FVI IKAG Y E 
Sbjct  218  VEASNRKLLQISAS--KPNAVVSTSGGGQYKTIQEALQAVPRSSPTPFVILIKAGTYKEH  275

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +E+ + M  +V +GEGPTKT ITG ++   + I T+HTAT+ + GDGF+ +++G EN+AG
Sbjct  276  IEIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVMKDMGIENTAG  335

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              K QAVA+R++AD  + +NC+ID YQDTLY H+ RQ+YRDCTITGTIDF+FGDA+AVFQ
Sbjct  336  PTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQ  395

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VRKP  NQACM+TAQGR     +G  V+QNCDI  D AL S NPPVKVYLGRPWK
Sbjct  396  NCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADQALTSANPPVKVYLGRPWK  455

Query  13   EYSR  2
            E+S+
Sbjct  456  EFSK  459



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   330 bits (846),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 220/313 (70%), Gaps = 18/313 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL------TAETKGeeq  752
            G KM+  LKT+ EL+SNGLAM++  + L ++L I  G    RRLL      T E +  ++
Sbjct  184  GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTG----RRLLQDAATATDENR-FQR  238

Query  751  eeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET--FVIF  578
             +  P ++D     L T  P ++K D VV+K G G+YK++ EALK +P KNNE   FVI+
Sbjct  239  AKIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIP-KNNEVKVFVIY  297

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            +K GVY+E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA++
Sbjct  298  VKEGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKD  357

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            +GFEN+AGA  HQAVA+RV +D++IF+NC++D YQDTLYT  +RQ+YRDCTI+GTIDFIF
Sbjct  358  VGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  417

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPV  41
            GDAAAVFQNCKM+VRKPL+NQACMVTA GR + R   AL+LQNC I  +    K +N   
Sbjct  418  GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYDKELN---  474

Query  40   KVYLGRPWKEYSR  2
            K YLGRPW   +R
Sbjct  475  KAYLGRPWTSLAR  487



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   330 bits (846),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 220/313 (70%), Gaps = 18/313 (6%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL------TAETKGeeq  752
            G KM+  LKT+ EL+SNGLAM++  + L ++L I  G    RRLL      T E +  ++
Sbjct  181  GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTG----RRLLQDAATATDENR-FQR  235

Query  751  eeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET--FVIF  578
             +  P ++D     L T  P ++K D VV+K G G+YK++ EALK +P KNNE   FVI+
Sbjct  236  AKIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIP-KNNEVKVFVIY  294

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            +K GVY+E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA++
Sbjct  295  VKEGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKD  354

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            +GFEN+AGA  HQAVA+RV +D++IF+NC++D YQDTLYT  +RQ+YRDCTI+GTIDFIF
Sbjct  355  VGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPV  41
            GDAAAVFQNCKM+VRKPL+NQACMVTA GR + R   AL+LQNC I  +    K +N   
Sbjct  415  GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYDKELN---  471

Query  40   KVYLGRPWKEYSR  2
            K YLGRPW   +R
Sbjct  472  KAYLGRPWTSLAR  484



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 214/309 (69%), Gaps = 14/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            ++M  + KT+ EL+SNGLAM++  + LL    I  G+     ++ R+LL+ E       +
Sbjct  184  QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNI-TGVRGDLGSYARKLLSTE-------D  235

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
             FP ++    R+L+      +K +AVVA DGSGQ+KS+  ALK VP KN   FVI+IK G
Sbjct  236  GFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQG  295

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            +Y E+V+V + M+ + F+G+GPTKTRITG+ +   G + TY TATVA+ G+ F A++IGF
Sbjct  296  IYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQTATVAVNGEHFTAKDIGF  355

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD  +FHNC ID YQDTLY H++RQ+YRDCTI+GTID+IFGDA
Sbjct  356  ENTAGPKGHQAVALRVSADYAVFHNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDA  415

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
             + FQNC MVVRKP+  Q+CMVTAQGR + R    +VL NC I  DPA   V    K YL
Sbjct  416  KSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYL  475

Query  28   GRPWKEYSR  2
            GRPWK++SR
Sbjct  476  GRPWKQFSR  484



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/309 (54%), Positives = 207/309 (67%), Gaps = 16/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + +T+ EL+SN LAMIT  +  L   E   GL     N  R+LL+ E        
Sbjct  185  QDMHKIFETSKELTSNALAMITSISTFLG--EHITGLIGDHGNHGRKLLSTED-------  235

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V   TRRL+      +K D VVA+DGSGQYK++ EAL  VP  N + FVI+IK G
Sbjct  236  GIPSWVGPNTRRLMAEQ-GVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIKQG  294

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            VYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD F A+NIGF
Sbjct  295  VYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTAKNIGF  354

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD  +FHNC ID YQDTLY H++RQ+YRDCTI+GT+DFIFGD 
Sbjct  355  ENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDG  414

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              V Q C +VVRKP+K Q+CM+TAQGR   R    LVL NC I  +P    V    K YL
Sbjct  415  KVVLQKCNIVVRKPMKGQSCMITAQGRTNERESTGLVLDNCHITGEPEYIPVKSINKAYL  474

Query  28   GRPWKEYSR  2
            GRPWK++SR
Sbjct  475  GRPWKQFSR  483



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 210/304 (69%), Gaps = 18/304 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            ++M  L+ T  ELSSN L+M+  F E+     I       R+LL+              F
Sbjct  173  DEMMKLMSTTRELSSNALSMVNSFGEM-----ITQNTGLTRKLLSNSD----------SF  217

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V+A+ R+LL  + +  K +AVV+  G GQYK++ EAL+AVP  +   FVI IKAG Y E 
Sbjct  218  VEASNRKLLQISAS--KPNAVVSASGGGQYKTIQEALQAVPKSSPTPFVILIKAGTYKEH  275

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +++ + M  +V +GEGPTKT ITG ++   + I T+HTAT+ + GDGF+ +++G EN+AG
Sbjct  276  IQIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVMKDMGIENTAG  335

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              K QAVA+R++AD  + +NC+ID YQDTLY H+ RQ+YRDCTITGTIDF+FGDA+AVFQ
Sbjct  336  PTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQ  395

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VRKP  NQACM+TAQGR     +G  V+QNCDI  D AL S NPPVKVYLGRPWK
Sbjct  396  NCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADKALTSANPPVKVYLGRPWK  455

Query  13   EYSR  2
            E+S+
Sbjct  456  EFSK  459



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 213/307 (69%), Gaps = 14/307 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G +M+  LK+A E+++NGL ++   + +L SL+IP      RRLL  +        E P 
Sbjct  193  GTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMTG--RRLLEDDDH------EMPS  244

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++    RRL+    A +K D +VA+DGSG+YK++  AL  VP K+N+TFVI++KAG+Y E
Sbjct  245  WISDGKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKE  304

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V +P+ M  +   G+GPTKT +TGS +  DGI T+ TAT +  G  F AR++GFEN+AG
Sbjct  305  IVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAG  364

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            +AKHQAVA+RV +D +IF+NC ID YQDTLY HA+RQ+YRDCTI+GTIDF+FG+AA  FQ
Sbjct  365  SAKHQAVALRVQSDRSIFYNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQ  424

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSVNPPVKVYLGR  23
            NCK+VVRKP+ NQ C+VTA GR   +   AL+ Q C  + DPA    KS+N   K YLGR
Sbjct  425  NCKLVVRKPMDNQQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSIN---KAYLGR  481

Query  22   PWKEYSR  2
            PWK+YSR
Sbjct  482  PWKQYSR  488



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 213/305 (70%), Gaps = 8/305 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             E M+  ++ + +++SN LAM+     L++SL I + L  +R+LL+     +    EFP 
Sbjct  181  AETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSLL--RRKLLS-----DAGANEFPS  233

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++ AA RRLL   PA I  +  VA+DG+G ++++ EAL  VP  NN TFVI++KAGVY E
Sbjct  234  WMPAAQRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKAGVYKE  293

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSA  377
            R  V + M K+  +G+GPTKT+ITG+ S   G I T+ TATVA+ G+ F+   +GFEN+A
Sbjct  294  RFLVDKHMTKVTMIGDGPTKTKITGNVSVIAGEISTFKTATVAVAGEWFVGIGLGFENTA  353

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  KHQAVA+RV+AD ++F+NC +D YQDTLY H+ RQ+YRDCTITGTIDFIFGD+A +F
Sbjct  354  GPEKHQAVALRVNADRSVFYNCRMDGYQDTLYAHSERQFYRDCTITGTIDFIFGDSATIF  413

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC ++ RKP+ NQ  +VTAQGRKE +G GA+VLQNC I  DPA       +  YLGRPW
Sbjct  414  QNCMIIARKPMDNQQNIVTAQGRKERQGNGAIVLQNCTITSDPAYYPHRKVLPTYLGRPW  473

Query  16   KEYSR  2
            K YSR
Sbjct  474  KPYSR  478



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 215/305 (70%), Gaps = 7/305 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             EKMK  LKT+ +LSSNGLAM++ F+ +L  L+IP G++ +RRLL     G +    +P 
Sbjct  188  AEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIP-GIS-RRRLLEIPVLGHDD---YPD  242

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVP-YKNNETFVIFIKAGVYN  557
            + +   RRLL    + +K + VVAKDGSGQ++++  AL  VP  KNN T+VI IKAGVY 
Sbjct  243  WANPGMRRLLAAG-SRVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQ  301

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E +++ + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  + F+AR+IGFEN+A
Sbjct  302  EYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAVTAEHFMARDIGFENTA  361

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  KHQAVA+RV AD  +F+NC +  YQDTLY H  RQ+YRDCT++GTIDFIFGDAAA+F
Sbjct  362  GPQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIF  421

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            Q C  +VRKPL NQ C+VTA GRKE R   AL++QNC I  D  L  V    + +LGRPW
Sbjct  422  QGCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPW  481

Query  16   KEYSR  2
            KEYSR
Sbjct  482  KEYSR  486



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  65   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  114

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  115  WVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  172

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  173  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  232

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  233  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  292

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  293  FQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  352

Query  19   WKEYSR  2
            WK YSR
Sbjct  353  WKNYSR  358



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 214/310 (69%), Gaps = 13/310 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAET----KGeeqee  746
            GEKM+  LKT+ EL++NGLAM+   + +  +L + +G    RRLL A      K  ++ +
Sbjct  182  GEKMREFLKTSQELTNNGLAMVDQVSTMFGALNVKSG----RRLLEATAGTGAKKFQKAK  237

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNN-ETFVIFIKA  569
              P ++D     L T  P ++K D VVAK G G+Y +V EALK +P  N  + FVI++K 
Sbjct  238  VIPAWIDNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVKE  297

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  389
            GVY E V   + M  ++ +G+GPTKT ITG ++  +G  T  TATV + GD FIA++IGF
Sbjct  298  GVYEEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTKTMQTATVGVVGDYFIAKDIGF  357

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AGA  HQAVA+RV +D++IF+NC +D YQDTLYT  +RQ+YRDCTI+GTIDFIFGDA
Sbjct  358  ENTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  417

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL-KSVNPPVKVY  32
            AAVFQNCKM+VRKPL+NQACMVTA GR + R    ++LQNC I  +P   K +N   K Y
Sbjct  418  AAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTGIILQNCTISGEPGYEKDLN---KAY  474

Query  31   LGRPWKEYSR  2
            LGRPWK Y+R
Sbjct  475  LGRPWKNYAR  484



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   327 bits (838),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 214/304 (70%), Gaps = 7/304 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            EKMK  LKT+ +LSSNGLAM++  + +L  L+IP G++ +RRLL     G +    +P +
Sbjct  189  EKMKKALKTSMKLSSNGLAMVSQISSMLSELQIP-GIS-RRRLLEIPVLGHDD---YPDW  243

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVP-YKNNETFVIFIKAGVYNE  554
             +   RRLL    + +K + VVAKDGSGQ+K++ EA+  VP  KNN T+VI IKAGVY E
Sbjct  244  ANPGMRRLLAAG-SKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQE  302

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  + F+AR+IGFEN+AG
Sbjct  303  YVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAVTAEHFMARDIGFENTAG  362

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV AD  +F+NC +  YQDTLY H  RQ+YRDCT++GTIDFIFGDAAA+FQ
Sbjct  363  PQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQ  422

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            +C  +VRKPL NQ C+VTA GRKE R   AL++QNC   P   L  V    + +LGRPWK
Sbjct  423  SCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWK  482

Query  13   EYSR  2
            EYSR
Sbjct  483  EYSR  486



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 213/304 (70%), Gaps = 8/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G +M+  LK+A ++++NGL ++   + +L SL++P G++  RRLL  + +      E P 
Sbjct  194  GVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLP-GMS-GRRLLEDDDR------EMPS  245

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRL+    A++K D VVA+DGSG+YK++  AL  VP K+N+TFVI +KAG+Y E
Sbjct  246  WVSDGKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVKAGIYKE  305

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V +P+ M  +   G+GPTKT +TGS +  DGI T+ TAT +  G  F AR++GFEN+AG
Sbjct  306  IVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAG  365

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +D +IF NC ID YQDTLY HA+RQ+YRDCTI+GTIDF+FG+AA  FQ
Sbjct  366  AAKHQAVALRVQSDRSIFFNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQ  425

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK+VVRKPL NQ C+VTA GR   +   AL+ Q+C  + DPA        K YLGRPWK
Sbjct  426  NCKLVVRKPLDNQQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWK  485

Query  13   EYSR  2
            EYSR
Sbjct  486  EYSR  489



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   327 bits (838),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 212/307 (69%), Gaps = 4/307 (1%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGe---eqeeEF  740
            E M+ + KTA +L+SNGLA+ T+   LL+   IP       R  T E   E    Q  EF
Sbjct  194  EIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIPIPFLTTSRDSTDEDSIEPVGRQLTEF  253

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P +V   +RRLL      I+ +AVVAKDGSGQY+++ EAL AVP  N   FVI+IK+GVY
Sbjct  254  PDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNERRFVIYIKSGVY  313

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYHTATVAIQGDGFIARNIGFEN  383
             E VE+ +KM  ++F+G+GPTKT +TG+ S + + I TY T+TVA+ GD F+A+++ FEN
Sbjct  314  AENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRISTYRTSTVAVNGDWFMAKDMAFEN  373

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AG   HQAVA+RVSAD  +F+NC +D YQDTLY H +RQ+YRDC I+GTIDF+FGDA A
Sbjct  374  TAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKA  433

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNC+ VVR+P++NQ C+VTAQGRK+ R    +V+    I+ DP    V    + YLGR
Sbjct  434  VFQNCQFVVRRPMENQQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYLPVKTKNRAYLGR  493

Query  22   PWKEYSR  2
            PWKEYSR
Sbjct  494  PWKEYSR  500



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 209/309 (68%), Gaps = 16/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + +T+ EL+SN LAMIT  +  L   E   GL     N  R+LL+ E       +
Sbjct  185  QDMHKIFETSKELTSNALAMITSISSFLG--EHITGLIGDHGNHARKLLSTE-------D  235

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V   TRRL+      +K + VVA+DGSG+YK++ EAL  VP  N + FVI+IK G
Sbjct  236  GIPSWVGPNTRRLMAEQ-GVVKPNVVVAQDGSGEYKTINEALSVVPKANQKPFVIYIKQG  294

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            VYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD   A+NIGF
Sbjct  295  VYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNLTAKNIGF  354

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD  +FHNC ID YQDTLY H++RQ+YRDCTI+GT+DFIFGD 
Sbjct  355  ENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDG  414

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              V Q C +VVRKP+K+Q+CM+TAQGR + R    LVL NC I  +P    V    K YL
Sbjct  415  KVVLQKCNIVVRKPMKSQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYL  474

Query  28   GRPWKEYSR  2
            GRPWK++SR
Sbjct  475  GRPWKQFSR  483



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 208/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  186  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  235

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N + +K   +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  236  WVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  294  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  354  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL+NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  414  FQNCTFVVRKPLENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  473

Query  19   WKEYSR  2
            WK YSR
Sbjct  474  WKNYSR  479



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 204/303 (67%), Gaps = 18/303 (6%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFV  728
            +M  L+ T  ELS N L+M+  F E++       GL   R+LL+              FV
Sbjct  174  QMVKLMNTTRELSINALSMVNSFGEMITQT---TGLT--RKLLSDSD----------SFV  218

Query  727  DAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERV  548
            +A+ R+L+  + +  K +AVV+  G GQYK++ EA+ AVP  N   FVI IKAG Y E +
Sbjct  219  EASNRKLVQISAS--KPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFVILIKAGTYKEHI  276

Query  547  EVPRKMNKIVFVGEGPTKTRITGSRSNK-DGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            E+ +    +VF+GEGPTKT ITG R  K DG  T+HT  + + G+GF+ ++IG EN+AG 
Sbjct  277  EIDKNKPNVVFIGEGPTKTIITGDRGVKHDGYATWHTCALGVAGEGFVIKDIGIENTAGP  336

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
            AK QAVA+R++AD  + HNC ID YQDTLY H++RQ+YRDCTITGT+DFIFGDA+AVFQN
Sbjct  337  AKEQAVALRINADKAVVHNCKIDGYQDTLYAHSFRQFYRDCTITGTVDFIFGDASAVFQN  396

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            CK++VRKP   QACM+TAQGR      G  V+QNCDI  DPA  S  PP+K YLGRPWKE
Sbjct  397  CKLIVRKPGNAQACMITAQGRTVPTSFGGFVIQNCDIKADPAFTSTTPPIKAYLGRPWKE  456

Query  10   YSR  2
            YS+
Sbjct  457  YSK  459



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 208/293 (71%), Gaps = 6/293 (2%)
 Frame = -2

Query  877  ELSSNGLAMITHFTELLQSLEIPAGLNFK-RRLLTAETKGeeqeeEFPGFVDAATRRLLT  701
            ELS+N L +++  +  + SLE     +F  RRLL  +       ++FP + D  TRRLL 
Sbjct  201  ELSANLLDIVSGISSAIPSLE-----SFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLA  255

Query  700  TNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKI  521
               + IK D VVAKDGSG + ++ EALK VP K+ + FV+ IKAGVY E +E+ + M  +
Sbjct  256  APVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINL  315

Query  520  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRV  341
            V +G+G   TRI G+++  DGI T+HTATVA+ GD F+A+NIGFEN+AGA KHQAVA+RV
Sbjct  316  VVIGDGRENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRV  375

Query  340  SADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLK  161
            SAD  +F+NC +D +QDTLYTHA RQ+YRDC+I+GTIDF+FGDA+AVFQNCK +VRKPL+
Sbjct  376  SADYAVFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLE  435

Query  160  NQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            NQ C+VTAQGRK  R   AL++QN  I   P L       K YLGRPWKEYSR
Sbjct  436  NQQCIVTAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSR  488



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  162  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  211

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  212  WVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  269

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  270  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  329

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  330  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  389

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  390  FQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  449

Query  19   WKEYSR  2
            WK YSR
Sbjct  450  WKNYSR  455



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T+  + +    +       RR L  ++K        P 
Sbjct  181  GKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVT---ELSRRRLLQDSK-------LPV  230

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N + ++H  +  VA DGSG +KS+ EALK VP +N + FVI+IK GVY
Sbjct  231  WVDQ--HRLLNENESLLRHKPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVY  288

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  289  QEYVEVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENS  348

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A A+
Sbjct  349  AGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAI  408

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL+NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  409  FQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  468

Query  19   WKEYSR  2
            WK YSR
Sbjct  469  WKNYSR  474



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 208/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  186  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  235

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N + +K   +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  236  WVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  294  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  354  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  414  FQNCTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  473

Query  19   WKEYSR  2
            WK YSR
Sbjct  474  WKNYSR  479



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  186  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  235

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  236  WVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  294  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  354  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  414  FQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  473

Query  19   WKEYSR  2
            WK YSR
Sbjct  474  WKNYSR  479



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 208/293 (71%), Gaps = 6/293 (2%)
 Frame = -2

Query  877  ELSSNGLAMITHFTELLQSLEIPAGLNFK-RRLLTAETKGeeqeeEFPGFVDAATRRLLT  701
            ELS+N L +++  +  + SLE     +F  RRLL  +       ++FP + D  TRRLL 
Sbjct  201  ELSANLLDIVSGISSAIPSLE-----SFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLA  255

Query  700  TNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKI  521
               + IK D VVAKDGSG + ++ EALK VP K+ + FV+ IKAGVY E +E+ + M  +
Sbjct  256  APVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINL  315

Query  520  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRV  341
            V +G+G   TRI G+++  DGI T+HTATVA+ GD F+A+NIGFEN+AGA KHQAVA+RV
Sbjct  316  VVIGDGKENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRV  375

Query  340  SADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLK  161
            SAD  IF+NC +D +QDTLYTHA RQ+YRDC+I+GTIDF+FGDA+AVFQNCK +VRKPL+
Sbjct  376  SADYAIFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLE  435

Query  160  NQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            NQ C+VTAQGRK  R   AL++Q+  I   P L       K YLGRPWKEYSR
Sbjct  436  NQQCIVTAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSR  488



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  186  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDYELPS  235

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  236  WVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  294  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  354  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  414  FQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  473

Query  19   WKEYSR  2
            WK YSR
Sbjct  474  WKNYSR  479



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 202/303 (67%), Gaps = 14/303 (5%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVD  725
            MK LL     +SSN LA++T   + +    I    +F RRLL           E P +VD
Sbjct  1    MKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLLQDS--------ELPSWVD  50

Query  724  AATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
                RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY E 
Sbjct  51   Q--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  108

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENSAG 
Sbjct  109  VEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGP  168

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AVFQN
Sbjct  169  HKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQN  228

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C  VVRKP++NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RPWK 
Sbjct  229  CTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKN  288

Query  10   YSR  2
            YSR
Sbjct  289  YSR  291



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  191  GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK--SFGRRLL--------QDSELPS  240

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA DGSG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  241  WVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  298

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  299  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  358

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  359  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  418

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL+NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  419  FQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  478

Query  19   WKEYSR  2
            WK YSR
Sbjct  479  WKNYSR  484



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 207/306 (68%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T+  + +    +       RR L  ++K        P 
Sbjct  181  GKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVT---ELSRRRLLQDSK-------LPV  230

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N + ++H  +  VA DGSG ++S+ EALK VP +N + FVI+IK GVY
Sbjct  231  WVDQ--HRLLNENESLLRHKPNVTVAIDGSGDFESINEALKQVPKENRKPFVIYIKEGVY  288

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  289  QEYVEVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENS  348

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A A+
Sbjct  349  AGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAI  408

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL+NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  409  FQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  468

Query  19   WKEYSR  2
            WK YSR
Sbjct  469  WKNYSR  474



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/308 (54%), Positives = 212/308 (69%), Gaps = 24/308 (8%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF-KRRLLTAETKGeeqeeEFP  737
            GEKMK++LKTA+ELSS  L +++ F E +  L+   GL    RRLL AE           
Sbjct  178  GEKMKNILKTASELSSVALDIVSSFEEQMVGLQ---GLGITNRRLLVAE-----------  223

Query  736  GFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
                A  RRLL    A++K + VVA+DGSGQ+KS+ EALK VP  N + +VIFIKAG+YN
Sbjct  224  ----AGNRRLLQI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYN  277

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E +EV   M  +VF+GEG  KT+IT +++  DG+  + TATV+I G GF+A++I FENSA
Sbjct  278  ENIEVANTMTNVVFIGEGSNKTKITSNKNYLDGLPIFQTATVSISGQGFVAKDIAFENSA  337

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  K +AVA+RVSA+MT F NC ID YQ TL TH  RQ+YRDCTI+GTIDFIFGDA AV 
Sbjct  338  GPLKKEAVALRVSAEMTAFQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVL  397

Query  196  QNCKMVVRKP--LKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV-KVYLG  26
            QNCK++ RKP  ++ QA  + AQGR E  G G +++QNC I  +PAL ++NPP  K +LG
Sbjct  398  QNCKIIARKPEEMQTQAITIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRNKAFLG  457

Query  25   RPWKEYSR  2
            RP K YSR
Sbjct  458  RPAKMYSR  465



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 215/305 (70%), Gaps = 5/305 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq-eeEFP  737
            G++MK  LK + ELS+N LA+++  +  + SLE       +RRLL  +       ++ FP
Sbjct  189  GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG----QRRLLQDDLPVLGHGDQIFP  244

Query  736  GFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
             + D   RRLL    + IK D VVAKDGSG + ++ +AL  VP K+++TFV++IKAG+Y 
Sbjct  245  TWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKAGIYQ  304

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + GD F+A+NIGFEN+A
Sbjct  305  EYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFENNA  364

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA KHQAVA+RVSAD  +F+NC +D +QDT+YTHA RQ+YRDC+I+GTIDF+FGDA+AVF
Sbjct  365  GAIKHQAVALRVSADYALFYNCSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVF  424

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK ++RKPL+NQ C+VTAQGRK  R   A+++QN  I   P L       K YLGRPW
Sbjct  425  QNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPW  484

Query  16   KEYSR  2
            KE+SR
Sbjct  485  KEFSR  489



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 207/306 (68%), Gaps = 6/306 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG-  734
            EKMK  LKT+  LSSNGL M++  + +   L++ +     RRL + E + E         
Sbjct  189  EKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSS---MGRRLFSDEEESELPVLGHSDE  245

Query  733  --FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
              +     RRL+  +P  +K + VVAKDGSG+Y ++ EALK +P ++  TFVI+IK GVY
Sbjct  246  AEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKEGVY  305

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V + R M  ++ +G+G  KTRITG ++  DG  T  TATV + GD F AR+IGFEN+
Sbjct  306  KEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTATVVVLGDHFRARDIGFENT  365

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV+AD  IF+ C +D YQDTLYTHA RQ+YRDC ++GTIDF+FGDAAAV
Sbjct  366  AGAHKHQAVALRVNADEAIFYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAV  425

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC+ +VR+P+ NQ C+VTAQGRKE R   A+++QN   + DP    V   +  YLGRP
Sbjct  426  FQNCRFIVRRPMDNQQCIVTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRP  485

Query  19   WKEYSR  2
            WKE+SR
Sbjct  486  WKEFSR  491



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   321 bits (823),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 208/304 (68%), Gaps = 13/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE M+ +L +++EL+SN LA++ +F + L SL +P      R+LL            +P 
Sbjct  173  GESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLP----INRKLLAE---------GYPS  219

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL T+ A +K + VVA+DGSG  K++ EA+  VP K  + F+I IK G Y E
Sbjct  220  YVTPGKRRLLATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKE  279

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V V +    ++ +G+GPTKT+ITGS +  DG  T+ TATVA+ GDGF+A+++  ENSAG
Sbjct  280  KVHVNKSATNVMLIGDGPTKTKITGSLNYVDGTRTFDTATVAVVGDGFVAKDLWIENSAG  339

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV +DM++F+NC ID YQDTLY H +RQ+YRDCTI+GTIDFIFGD+A++FQ
Sbjct  340  AEKHQAVALRVQSDMSVFYNCRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQ  399

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++ RKPL NQ  +VTAQGRK  +   A++L NC I  DPA       +  +LGRPWK
Sbjct  400  NCLILARKPLDNQQNIVTAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWK  459

Query  13   EYSR  2
             YSR
Sbjct  460  MYSR  463



>gb|KHN20255.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=475

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 214/311 (69%), Gaps = 13/311 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq----ee  746
            G KMK+LL ++  +SSN LA+I+   +++  + +        R L  +++G E     EE
Sbjct  76   GNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKD---GHRELVEDSRGGEHVFGHEE  132

Query  745  EFPGFVD---AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V+      RRLL  +P  +K + VVAKDGSG+YKS+ +ALK VP +N + FVI+I
Sbjct  133  VIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYI  192

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA+VAI GD FIA NI
Sbjct  193  KEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINI  252

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFENSAG  KHQAVAIRV AD +IF+ C +D YQDTLY HA RQ+YRDCTI+GTIDF+FG
Sbjct  253  GFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDFVFG  312

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DA  VFQNC  VVRK L+NQ C+VTAQGRKE       V+Q   I+ +   K  N   KV
Sbjct  313  DAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKFDN---KV  369

Query  34   YLGRPWKEYSR  2
            YL RPWK +SR
Sbjct  370  YLARPWKNHSR  380



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 215/312 (69%), Gaps = 19/312 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSL---EIPAGL-NFKRRLLTAETKGeeqeeE  743
            + M  + KT+ EL+SNGLAM++  +  L      EI   L ++ R+LL+ E         
Sbjct  184  QDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDLGSYARKLLSTED-------G  236

Query  742  FPGFVDAATRRLL--TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKA  569
            FP ++   TR+L+   T P  +K +AVVA DGSGQ+KS+ +ALK VP  N   FVI+IK 
Sbjct  237  FPTWMRPETRKLMAAVTGP-KVKPNAVVALDGSGQFKSINDALKTVPKNNKFPFVIYIKQ  295

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG---TYHTATVAIQGDGFIARN  398
            G+Y E+V+V + M  + F+G+GPTKT +TG+ +   GIG   TY TATVA+ G+ F A++
Sbjct  296  GIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNF--GIGNVKTYQTATVAVNGENFTAKD  353

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGFEN+AG   HQAVA+RVSAD  +F+NC ID YQDTLY H++RQ+YRDCTI+GTID+IF
Sbjct  354  IGFENTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIF  413

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            GDA + FQNCKMVVRKP+  Q+CMVTAQGR + R    ++L NC I+ DPA   V    K
Sbjct  414  GDAKSFFQNCKMVVRKPMGGQSCMVTAQGRTDKRESTGIILHNCRIMGDPAYIPVKSTNK  473

Query  37   VYLGRPWKEYSR  2
             YLGRPWKE+SR
Sbjct  474  AYLGRPWKEFSR  485



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 206/306 (67%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL     +SSN LA++T   + +    I    +F RRLL        Q+ E P 
Sbjct  186  GKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITK--SFGRRLL--------QDSELPS  235

Query  733  FVDAATRRLLTTN--PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +VD    RLL  N  P   K +  VA D SG +KS+ EALK VP KN + FVI+IK GVY
Sbjct  236  WVDQ--HRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  293

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENS
Sbjct  294  QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENS  353

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  354  AGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAV  413

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPL+NQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RP
Sbjct  414  FQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARP  473

Query  19   WKEYSR  2
            WK YSR
Sbjct  474  WKNYSR  479



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 214/306 (70%), Gaps = 12/306 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            E M+  L ++  L+SN LA+I   + +L ++ +P     KRR L+ E +G  +   +P +
Sbjct  197  ESMREALNSSQALTSNALAIIDEISSVLSTVRVPF---LKRRFLSHEEEGSGE---YPSW  250

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V    RRLL      IK + +VA+DGSG YK++ EAL A+P  +N  FVI+IK GVY E+
Sbjct  251  VANGKRRLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSIFVIYIKEGVYKEQ  310

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V + + M  ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ GDGFIA+N+GFENSAGA
Sbjct  311  VWLDKSMMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGDGFIAKNLGFENSAGA  370

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RV +D +IF+NC +D +QDTLY+H  RQ+YRDCTITGTIDFIFGDAA++FQN
Sbjct  371  EKHQAVALRVQSDRSIFYNCQMDGFQDTLYSHTKRQFYRDCTITGTIDFIFGDAASIFQN  430

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDP---ALKSVNPPVKVYLGRP  20
            C + VRKPL NQ C+VTA GRK+ R   A++L NC I  DP    L++ NP    YLGRP
Sbjct  431  CIIRVRKPLANQQCIVTASGRKDRREATAIILHNCTIGADPDYLPLRARNPS---YLGRP  487

Query  19   WKEYSR  2
            WK YSR
Sbjct  488  WKPYSR  493



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   334 bits (856),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 208/304 (68%), Gaps = 21/304 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK LLK+A EL+SNGLAMI   + +L +L+IP      RRLL  +            
Sbjct  174  GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPG---ISRRLLVGQ------------  218

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
                  R+L    P +IK + +VA+DGSG+YK++ EAL  +P   N TFV+++K GVY E
Sbjct  219  ------RKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKE  272

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V   + M  ++ +G+GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFEN+AG
Sbjct  273  QVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAG  332

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A+KHQAVA+RV +DM IF+NC +D YQDTLY HA+RQ+YRDCTITGTIDFIFGD+A VFQ
Sbjct  333  ASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQ  392

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++VRKPL NQ C+VTAQGR E R    +VLQNC I             K YLGRPWK
Sbjct  393  NCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWK  452

Query  13   EYSR  2
             +SR
Sbjct  453  AFSR  456



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 213/322 (66%), Gaps = 27/322 (8%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            ++M  + KT+ EL+SNGLAM++  + LL    I  G+     ++ R+LL+ E        
Sbjct  184  QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNI-TGVRGDLGSYARKLLSTED-------  235

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
             FP ++    R+L+      +K +AVVA DGSGQ+KS+  ALK VP KN   FVI+IK G
Sbjct  236  GFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQG  295

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            +Y E+V+V + M+ + F+G+GPTKTRITG+ +   G + TY TATVA+ G+ F A++IGF
Sbjct  296  IYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQTATVAVNGEHFTAKDIGF  355

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAY-------------QDTLYTHAYRQYYRDC  248
            EN+AG   HQAVA+RVSAD  +FHNC ID Y             QDTLY H++RQ+YRDC
Sbjct  356  ENTAGPKGHQAVALRVSADYAVFHNCQIDGYVDSFYANCQIDGYQDTLYAHSHRQFYRDC  415

Query  247  TITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDP  68
            TI+GTID+IFGDA + FQNC MVVRKP+  Q+CMVTAQGR + R    +VL NC I  DP
Sbjct  416  TISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDP  475

Query  67   ALKSVNPPVKVYLGRPWKEYSR  2
            A   V    K YLGRPWK++SR
Sbjct  476  AYIPVKKTNKAYLGRPWKQFSR  497



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   319 bits (818),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 214/311 (69%), Gaps = 13/311 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq----ee  746
            G KMK+LL ++  +SSN LA+I+   +++  + +        R L  +++G E     EE
Sbjct  186  GNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKD---GHRELVEDSRGGEHVFGHEE  242

Query  745  EFPGFVD---AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V+      RRLL  +P  +K + VVAKDGSG+YKS+ +ALK VP +N + FVI+I
Sbjct  243  VIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYI  302

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA+VAI GD FIA NI
Sbjct  303  KEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINI  362

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFENSAG  KHQAVAIRV AD +IF+ C +D YQDTLY HA RQ+YRDCTI+GTIDF+FG
Sbjct  363  GFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDFVFG  422

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DA  VFQNC  VVRK L+NQ C+VTAQGRKE       V+Q   I+ +   K  N   KV
Sbjct  423  DAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKFDN---KV  479

Query  34   YLGRPWKEYSR  2
            YL RPWK +SR
Sbjct  480  YLARPWKNHSR  490



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   319 bits (817),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 207/309 (67%), Gaps = 10/309 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq---eeE  743
            GEKMK +L+TA  +SSNGL++I   ++    ++ PAG    RRLL  + +       + E
Sbjct  185  GEKMKEILQTAMHMSSNGLSIINELSKTFTEMK-PAG----RRLLKDDGELHVVGRGDFE  239

Query  742  FPGFVD--AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKA  569
            FP +VD     R+LL      ++   VVAKDG+G + ++ EALK VP KN   FVI+IK 
Sbjct  240  FPEWVDDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALKHVPKKNLRPFVIYIKE  299

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  389
            G+YNE VEV R M  +VF+G+G  K+RITG+++  DG+GTY TATVAI GD F+   IGF
Sbjct  300  GIYNEYVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGVGTYRTATVAILGDFFVGIGIGF  359

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            ENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H  RQ+YRDC ITGTIDF+FGD+
Sbjct  360  ENSAGPEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCVITGTIDFVFGDS  419

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
             AV QNC  VVRKPL+NQ C+VTAQGRKE      L++Q   I+ DP    V    K YL
Sbjct  420  VAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLIIQGGSIVSDPKYFPVRFDNKAYL  479

Query  28   GRPWKEYSR  2
             RPWK +SR
Sbjct  480  ARPWKNFSR  488



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 205/304 (67%), Gaps = 13/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             E M+  L ++ EL+SN LA++T+F   L SL     L F R+LL  E         +P 
Sbjct  173  AESMRKALNSSAELTSNILAIVTNFDSALDSL----NLGFNRKLLAEE---------YPS  219

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++    RRLL  +PA +K +  VAKDGSG  K++ EA+  VP K+N TFVI+IK GVY E
Sbjct  220  WISPGNRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIKEGVYEE  279

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V+V R +  ++ +G+G +KT+ITG  +  DG  T+ TATVAI GDGFI +++  ENSAG
Sbjct  280  QVQVNRSLTNVMMIGDGTSKTKITGKLNYIDGTATFKTATVAIVGDGFIGKDLWIENSAG  339

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +D ++F+N  +D YQDTLY H  RQ+YR+CTI+GTIDFIFGD+  VFQ
Sbjct  340  AAKHQAVALRVQSDKSVFYNVRMDGYQDTLYVHTKRQFYRECTISGTIDFIFGDSPTVFQ  399

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC +  RKPL NQ  +VTAQGRK+ R   A++L NC I  DPA       +  +LGRPWK
Sbjct  400  NCLIQARKPLDNQQNIVTAQGRKDRRQASAIILHNCTISADPAYFPARKKLPTFLGRPWK  459

Query  13   EYSR  2
            E+SR
Sbjct  460  EFSR  463



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 211/309 (68%), Gaps = 10/309 (3%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETK-GeeqeeEFPG  734
            EKM   +K   EL+ NGLA+   F++LL   +  AG    RRLL    K G   + ++ G
Sbjct  172  EKMMEFMKLGKELTINGLALANGFSDLLLPNDHGAG----RRLLADSNKMGLINKADYIG  227

Query  733  --FVDAATR--RLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              +++ ATR  RLL   P  IK    VAKDGSG + ++ EALK+VP   N+T++I+IKAG
Sbjct  228  EHWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVPLSCNDTYIIYIKAG  287

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VY E + V   M  ++F+G+GP  T+ITG++S   G  T+ TATV + GD FIA++IGFE
Sbjct  288  VYQENIIVGTSMWSVMFIGDGPNATKITGNKSKVGGTETFWTATVGVDGDNFIAKDIGFE  347

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            NSAGA+ HQAVA+R S D +IF NC ID YQDT++ H +RQ++RDCTI+GTIDFIFG+A 
Sbjct  348  NSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFAHNHRQFFRDCTISGTIDFIFGNAR  407

Query  205  AVFQNCKMVVRKPLKNQ-ACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
            AVFQNC ++VRKPL+NQ AC+VTA+GR       A+VLQNC I+P P     +P  K YL
Sbjct  408  AVFQNCTLLVRKPLENQKACLVTAEGRTTINETSAIVLQNCRILPAPEYPVNDPTYKTYL  467

Query  28   GRPWKEYSR  2
            GRPWK YSR
Sbjct  468  GRPWKPYSR  476



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 213/312 (68%), Gaps = 8/312 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKMK  L  + EL+SNGL + T  +   +SL I    +  +R+L  E    + +EE P 
Sbjct  189  GEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLEEQGEAKNKEEIPH  248

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN--------NETFVIF  578
            +VD   ++LL     ++K D VVAKDGSG +K++ EALK  P  +        N+TFVI+
Sbjct  249  WVDTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDATKVEKGTNKTFVIY  308

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            IK GVY E V+V   M  ++ +G+GPTKT+ITG ++  DG   + TATV+I G  FIA++
Sbjct  309  IKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFVLFKTATVSIFGHNFIAKD  368

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGFENSAGA KHQA+A+ V +D ++F+NCHI+ YQDTLY H+YRQ+YR CT++GTIDFIF
Sbjct  369  IGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYAHSYRQFYRHCTVSGTIDFIF  428

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            G+AAAVFQNCK+V+RKPL+++ C++TAQ R+  R     +LQNC I+ DP    +    K
Sbjct  429  GNAAAVFQNCKLVIRKPLEDEGCVITAQARQHVREPTGFILQNCTIMADPLYYPLRLKSK  488

Query  37   VYLGRPWKEYSR  2
             +LG PWK++SR
Sbjct  489  AFLGHPWKKFSR  500



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   331 bits (849),  Expect = 2e-100, Method: Composition-based stats.
 Identities = 163/308 (53%), Positives = 213/308 (69%), Gaps = 11/308 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF---KRRLLTAETKGeeqeeE  743
            G +M+ +L+ + E++SN L M+   +  L S+    G       RRLL+ +         
Sbjct  172  GNRMRQVLRESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAVTSRRLLSTDE-------F  224

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYK-NNETFVIFIKAG  566
             P +VDA  R+LL   P  +  D +VAKDG+G Y ++ EALK +P    N+T V++I+ G
Sbjct  225  LPEWVDAGKRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPKSGKNKTIVLYIREG  284

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            VY E+++    M  +  +G+GPTKTRITG  +  DG  TY TATVA+QGD FIAR+IGFE
Sbjct  285  VYEEKLQFNSSMKNLFVIGDGPTKTRITGKSNFIDGTNTYQTATVAVQGDDFIARDIGFE  344

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG  KHQAVA+RVSAD  IF+NCH+DAYQDTLY HAYRQ+YR+C I+GTIDFIFGD+A
Sbjct  345  NTAGPEKHQAVALRVSADKAIFYNCHMDAYQDTLYAHAYRQFYRNCRISGTIDFIFGDSA  404

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            AVFQNC ++VRKPL+NQ C+VTAQGRKE R     +LQNC I PD  L ++   +K YLG
Sbjct  405  AVFQNCTLLVRKPLENQQCVVTAQGRKEIRQPTGFILQNCSIRPDRDLYAIRKNIKTYLG  464

Query  25   RPWKEYSR  2
            RPWK+YSR
Sbjct  465  RPWKQYSR  472



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/308 (52%), Positives = 206/308 (67%), Gaps = 12/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            + MK + K + EL+SN LAMIT  + +     I        N  R+LL AE         
Sbjct  183  QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNARKLLNAED-------G  235

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
            FP +V   TRRL+      +K + VVAKDGSGQYKS+ EALKAVP  N   FVI+IK GV
Sbjct  236  FPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGV  295

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            Y E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T+++ ++GD F+A+N+G E
Sbjct  296  YKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVEGDNFVAKNMGIE  355

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG    QAVA+RVSAD  +  NC ID YQDTLY H++RQ+YRD TI+GT+DFIFGD+ 
Sbjct  356  NTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSI  415

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            A+FQNC +VVRKP+  Q CMVTAQGR + R   A+VL NC II +PA   V    K YLG
Sbjct  416  AIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLG  475

Query  25   RPWKEYSR  2
            RPWKE++R
Sbjct  476  RPWKEFAR  483



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/308 (52%), Positives = 206/308 (67%), Gaps = 12/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            + MK + K + EL+SN LAMIT  + +     I        N  R+LL AE         
Sbjct  183  QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNARKLLNAED-------G  235

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
            FP +V   TRRL+      +K + VVAKDGSGQYKS+ EALKAVP  N   FVI+IK GV
Sbjct  236  FPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGV  295

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            Y E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T+++ ++GD F+A+N+G E
Sbjct  296  YKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVEGDNFVAKNMGIE  355

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG    QAVA+RVSAD  +  NC ID YQDTLY H++RQ+YRD TI+GT+DFIFGD+ 
Sbjct  356  NTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSI  415

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            A+FQNC +VVRKP+  Q CMVTAQGR + R   A+VL NC II +PA   V    K YLG
Sbjct  416  AIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLG  475

Query  25   RPWKEYSR  2
            RPWKE++R
Sbjct  476  RPWKEFAR  483



>ref|XP_007149854.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
 gb|ESW21848.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
Length=460

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 205/306 (67%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL    E+SSN LA++T   + + +  +   L   R L  +E+         P 
Sbjct  65   GKKMKDLLMIGMEMSSNVLAIVTELADTITNSNVTNLLG-HRHLQGSES---------PS  114

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            + D    RLL  N + + H  +  VAKDG+G +K++ EALK VP KN   FVI+IK G+Y
Sbjct  115  WNDH--HRLLNENASLVNHKPNVTVAKDGNGDFKNINEALKQVPEKNKRPFVIYIKEGIY  172

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V+V + M  +VF+G+G  KTRITG+++  DGI TY T+T+AIQGD F+A N+GFEN 
Sbjct  173  QEYVQVTKDMTHVVFIGDGGKKTRITGNKNFIDGINTYKTSTIAIQGDYFVAINMGFENF  232

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  233  AGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAV  292

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC  VVRKPLKNQ C+VTAQGRKE +    +V+Q   I+ DP   S+    K YL RP
Sbjct  293  FQNCTFVVRKPLKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSIRFENKAYLARP  352

Query  19   WKEYSR  2
            WK YSR
Sbjct  353  WKNYSR  358



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 217/312 (70%), Gaps = 9/312 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqe-----  749
            GE+MK  LKT+ EL+ N LAM+   + +L  L+IPA LN +R   T E+    +      
Sbjct  193  GERMKKALKTSGELTENALAMVDEISSILNQLQIPA-LNRRRLFSTKESAESSETPTTAE  251

Query  748  eEFPGFVDAATRRLLTTNPA-SIKHDAVVAKDGSGQYKSVVEALKAVP-YKNNETFVIFI  575
            ++ P ++    R+LL T P  ++K D VVAKDG+G + +++EAL+++P  K N+T +++I
Sbjct  252  DDIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEALESLPKTKENKTIIMYI  311

Query  574  KAGVYNERVEVPRKMN-KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            K GVY+E VE+ R +    +  G+GPT+T+ITGS +  DG  T+ TATV++   GFI ++
Sbjct  312  KEGVYSEIVEISRNLTGSFIMYGDGPTRTKITGSLNFIDGTPTFKTATVSVNAHGFICKD  371

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IG EN+AGA KHQAVA++V ADM +F NC +D YQDTLY H+ R ++RDCTI+GTID+IF
Sbjct  372  IGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTLYAHSGRHFFRDCTISGTIDYIF  431

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            G+  ++FQNCKMV+RKP+ NQA +VTAQGRK  R V A+VLQ C I  DP+L       K
Sbjct  432  GNGESIFQNCKMVIRKPMVNQANIVTAQGRKTEREVSAIVLQGCTISADPSLVPEKNVFK  491

Query  37   VYLGRPWKEYSR  2
             YLGRPWKE+SR
Sbjct  492  SYLGRPWKEFSR  503



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 208/304 (68%), Gaps = 11/304 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            +KMKHLL ++  +SSN LA++++F + +  + +     F RRLL        Q+ E P +
Sbjct  193  KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL--FGRRLL--------QDSEIPSW  242

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET-FVIFIKAGVYNE  554
            V+        TN +  K +  VA DGSG +KS+ EALK VP + +ET FVI+IKAGVY E
Sbjct  243  VEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYRE  302

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQGD F A N+GFENSAG
Sbjct  303  YVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAINMGFENSAG  362

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV  D TIF NC +D YQDTLY HA RQ+YRDCTI+GTIDF+FG+A +VFQ
Sbjct  363  PQKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQ  422

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP+ NQ C+VTAQGRKE  G  A+V+Q   I+ DP    V    K YL RPWK
Sbjct  423  NCKFVVRKPMSNQQCIVTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWK  482

Query  13   EYSR  2
             +SR
Sbjct  483  NFSR  486



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 202/304 (66%), Gaps = 13/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             E M+  L ++ E++SN LA++ +    L SL     L   R+LL  E         +P 
Sbjct  173  AESMRKALNSSAEMTSNILAIVINLDNTLDSL----NLGISRKLLAEE---------YPS  219

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL  +PA +K +  VA+DG+G  K++ +AL  VP K+N TFVI+IK GVY E
Sbjct  220  WVSLGKRRLLQLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKE  279

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V+V R +  ++ VG+G  KT+ITGS +  DG  T+ TATVA+ GDGFI +++  ENSAG
Sbjct  280  KVQVNRSLTNVIMVGDGTNKTKITGSLNYIDGTATFKTATVAVIGDGFIGKDLWIENSAG  339

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            AAKHQAVA+RV +D ++F+N  ID YQDTLY H  RQ+YRDC I+GTIDFIFGD AAV Q
Sbjct  340  AAKHQAVALRVQSDKSVFYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQ  399

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC ++ RKP+ NQ  +VTAQGRK+ R   A+VL NC I  DPA       +  +LGRPWK
Sbjct  400  NCLILARKPMDNQQNIVTAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWK  459

Query  13   EYSR  2
            E+SR
Sbjct  460  EFSR  463



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 207/304 (68%), Gaps = 5/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GEKM   +  + ELSSN L MI   + L++ L I + +   RRLL+  +K E   + +P 
Sbjct  186  GEKMAKAMNASLELSSNALDMINFISGLIKDLNISSLVGNNRRLLS--SKEEALVDGYPS  243

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL    +SIK +A VAKDGSGQ+ ++ +ALK VP KN + FVI++KAGVY E
Sbjct  244  WVSEGQRRLLGL--SSIKPNATVAKDGSGQFATLTDALKTVPPKNAQAFVIYVKAGVYKE  301

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V   M  +  +G+GP KTR +GS + KDG+ T+++AT A+    F+A+++GFEN+AG
Sbjct  302  NVNVGMDMTHVTVIGDGPKKTRFSGSLNYKDGVQTFNSATFAVNAANFMAKDVGFENTAG  361

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV+AD  +F+NC +DA+QDTLY  + RQ+YRDCTITGTIDFIFGDA  VFQ
Sbjct  362  AEKHQAVALRVTADQAVFYNCQMDAFQDTLYVQSQRQFYRDCTITGTIDFIFGDAFGVFQ  421

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++VR PL NQ CMVTA GR +      LV Q+C    +P +  +   +  YLGRPW+
Sbjct  422  NCKLIVRPPLPNQQCMVTAGGRNKVDSASGLVFQSCHFSGEPQVAQLTRKI-AYLGRPWR  480

Query  13   EYSR  2
             YS+
Sbjct  481  PYSK  484



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/304 (53%), Positives = 202/304 (66%), Gaps = 10/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK  L T+  +SSN LA++T   + + +L +   L   RRLL             P 
Sbjct  187  GQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLG--RRLLQDSES--------PS  236

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +VD        T+  + K +  VA+DG+G +KS+ EALK VP KN + FVI+IK G Y E
Sbjct  237  WVDHQGLPNANTSLFNHKLNVTVAQDGNGDFKSINEALKQVPEKNKKPFVIYIKEGTYQE  296

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VEV + M  +VF+G+G  KTRI G+++  DGI TY TATVAIQGD F+A N+GFEN AG
Sbjct  297  YVEVTKDMTHVVFIGDGGKKTRIIGNKNFIDGINTYRTATVAIQGDYFVAINMGFENFAG  356

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV AD +IF+NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AVFQ
Sbjct  357  PHKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQ  416

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC  VVRKP+KNQ C+VTAQGRKE +    +V+Q   I+ DP   SV    K YL RPWK
Sbjct  417  NCTFVVRKPMKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWK  476

Query  13   EYSR  2
             YSR
Sbjct  477  NYSR  480



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 211/313 (67%), Gaps = 12/313 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL--TAETKGeeqeeEF  740
            G KMK+LLK+   +SSN LA+I+   + +  + +       R+L+  + +     Q +  
Sbjct  163  GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVI  222

Query  739  PGFVD-------AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVI  581
            P +V+          RRLL  +   IK + VVAKDGSG+YKS+ +ALK VP KN + FVI
Sbjct  223  PSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVI  282

Query  580  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  401
            +IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY TA+VA++GD F+A 
Sbjct  283  YIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGDYFVAV  342

Query  400  NIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFI  221
            NIGFENSAG  KHQAVAIRV AD +IF+ C +D YQDTLY HA RQ+YRDCTI+GT+DF+
Sbjct  343  NIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTVDFV  402

Query  220  FGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV  41
            FGDA AVFQNC  VVRK L+NQ C+VTAQGRKE       V+Q   I+ +    + N   
Sbjct  403  FGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HTENLDN  459

Query  40   KVYLGRPWKEYSR  2
            K YL RPWK +SR
Sbjct  460  KAYLARPWKNHSR  472



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 205/305 (67%), Gaps = 8/305 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             E M   +K + +++SN LAMI  F  L+ S  I +  +  R+LL+       +  EFP 
Sbjct  179  AEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISS--HAGRKLLSG-----TRANEFPW  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++ AA  R L   PA IK +  VA+DG+G +K++ EALK VP +NN+TFVI++KAGVY E
Sbjct  232  WMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFVIYVKAGVYKE  291

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSA  377
             V V + M  +  +G+GPTKT+ITG      G I T+ TATVA+ G+ F    +GFEN+A
Sbjct  292  GVLVDKHMTHVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVAGEWFTGMGLGFENTA  351

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G   HQAVA+RV+AD ++F+NC +D YQDTLY H+ RQ+YRDCTITGTIDFIFGD+A + 
Sbjct  352  GPQNHQAVALRVNADRSVFYNCRMDGYQDTLYAHSGRQFYRDCTITGTIDFIFGDSATML  411

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC ++VRKP+ NQ  +VTA GR + +G GALV+QNC I  DPA       +  YLGRPW
Sbjct  412  QNCMIIVRKPMDNQQNIVTAHGRIDRQGNGALVIQNCTITSDPAYYPSRKKLPTYLGRPW  471

Query  16   KEYSR  2
            K YSR
Sbjct  472  KPYSR  476



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 208/312 (67%), Gaps = 11/312 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAG-----LNFKRRLLTAETKGeeqee  746
            +KMK++L T+  +SSN LA+I+   + +  L           ++K   +  +   ++   
Sbjct  184  KKMKNILTTSMHMSSNALAVISDLADNVLDLNATTDGRRLIDDYKGEYVGEQVVAKDDVN  243

Query  745  EFPGFV----DAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIF  578
            + P +V        RRLL  N   +K + VVAKDGSG++K + +ALK VP KN + FVI 
Sbjct  244  DVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKINDALKQVPKKNQKPFVIH  303

Query  577  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  398
            IK GVY+E VEV +KM  +VF+G+G  KTRITG+++  DGI TY T TVAI+GD F+A N
Sbjct  304  IKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGINTYQTPTVAIEGDNFVAIN  363

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGFENSAG  KHQAVAIRV AD  IF+ C +D YQDTLY H  RQ+YRDCTI+GTIDFIF
Sbjct  364  IGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYVHTMRQFYRDCTISGTIDFIF  423

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            GDA +VFQNC  +V+KPL+NQ C+VTAQGRKE      +V+QNC I+ D    +V    K
Sbjct  424  GDAISVFQNCTFLVKKPLENQQCIVTAQGRKERHQPSGIVIQNCHIVADT--HNVKFDNK  481

Query  37   VYLGRPWKEYSR  2
             YL RPWK +SR
Sbjct  482  AYLARPWKNFSR  493



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   314 bits (805),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 209/313 (67%), Gaps = 13/313 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqee----  746
            G+KMK +L+T+  +SSNGL++I   ++  + ++ PAG    RRLL     GEE       
Sbjct  186  GKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPAG----RRLLKESVDGEEDVLGHGG  241

Query  745  --EFPGFVD--AATRRLLTTNPA-SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVI  581
              E P +VD  A  R+LL       ++   VVAKDGSG + ++ EALK VP KN + FVI
Sbjct  242  DFELPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEALKHVPKKNLKPFVI  301

Query  580  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  401
            +IK GVY E VEV + M  +VF+G+G  KTRITG+++  DG+GT+ TA+VAI GD F+  
Sbjct  302  YIKEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGVGTFKTASVAITGDFFVGI  361

Query  400  NIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFI  221
             IGFENSAG  KHQAVA+RV +D +IF+ C +D YQDTLY H  RQ+YRDC I+GTIDF+
Sbjct  362  GIGFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFV  421

Query  220  FGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV  41
            FGD+ AV QNC  VVRKPL+NQ C+VTAQGRKE      L++Q   I+ DP    V    
Sbjct  422  FGDSIAVLQNCTFVVRKPLENQQCIVTAQGRKEKNQPTGLIIQGGSIVADPKYYPVRLKN  481

Query  40   KVYLGRPWKEYSR  2
            K YL RPWK++SR
Sbjct  482  KAYLARPWKDFSR  494



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/305 (51%), Positives = 211/305 (69%), Gaps = 5/305 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeq-eeEFP  737
            G++MK  LK + ELS+N LA+++  +  + SLE       +RRLL  +       ++ FP
Sbjct  189  GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG----QRRLLQDDLPVLGHGDQIFP  244

Query  736  GFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
             + D   RRLL    + IK D VVAKDGSG + ++ EAL  VP K+++TFV++IKAG+Y 
Sbjct  245  TWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKAGIYQ  304

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + GD F+A+NIGFE +A
Sbjct  305  EYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFEKNA  364

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA KHQAVA+RVSAD  +F+NC +D +QDTLYT A RQ+ RDC+++GTIDF+FG A+AVF
Sbjct  365  GAIKHQAVALRVSADYALFYNCSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVF  424

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK ++RKPL+NQ C+VTAQGRK  R   A+V+QN  I   P L       K YLGRPW
Sbjct  425  QNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPW  484

Query  16   KEYSR  2
            KE+SR
Sbjct  485  KEFSR  489



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 211/313 (67%), Gaps = 12/313 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL--TAETKGeeqeeEF  740
            G KMK+LLK+   +SSN LA+I+   + +  + +       R+L+  + +     Q +  
Sbjct  186  GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVI  245

Query  739  PGFVD-------AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVI  581
            P +V+          RRLL  +   IK + VVAKDGSG+YKS+ +ALK VP KN + FVI
Sbjct  246  PSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVI  305

Query  580  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  401
            +IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY TA+VA++GD F+A 
Sbjct  306  YIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGDYFVAV  365

Query  400  NIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFI  221
            NIGFENSAG  KHQAVAIRV AD +IF+ C +D YQDTLY HA RQ+YRDCTI+GT+DF+
Sbjct  366  NIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTVDFV  425

Query  220  FGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPV  41
            FGDA AVFQNC  VVRK L+NQ C+VTAQGRKE       V+Q   I+ +    + N   
Sbjct  426  FGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HTENLDN  482

Query  40   KVYLGRPWKEYSR  2
            K YL RPWK +SR
Sbjct  483  KAYLARPWKNHSR  495



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 213/306 (70%), Gaps = 9/306 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPA-GLNFKRRLLTAETKGeeqeeEFP  737
            G+ M  +L  + ELS+N L ++   + L + L + +  +N  R+LL+ ET      + FP
Sbjct  156  GKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEET---ALVDGFP  212

Query  736  GFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
             +V    RRLL   +P   K D VVA+DGSGQ K++ EALK VP KN + FVI+IKAG+Y
Sbjct  213  TWVSEGQRRLLQAVDP---KPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIY  269

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE + + + +  +  +G+GPTKTRITGS++  DG+ TY+TAT  +    F+A+NIGFEN+
Sbjct  270  NEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENT  329

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV+AD  +F+NC++D +QDTLYT + RQ+YRDCT+TGTIDF+FGDA AV
Sbjct  330  AGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAV  389

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK +VR PL+NQ C+VTA GR +     ALV Q+C    +P + ++ P +  YLGRP
Sbjct  390  FQNCKFIVRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALTPKI-AYLGRP  448

Query  19   WKEYSR  2
            W+ Y++
Sbjct  449  WRLYAK  454



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 213/306 (70%), Gaps = 9/306 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPA-GLNFKRRLLTAETKGeeqeeEFP  737
            G+ M  +L  + ELS+N L ++   + L + L + +  +N  R+LL+ ET      + FP
Sbjct  183  GKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEET---ALVDGFP  239

Query  736  GFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
             +V    RRLL   +P   K D VVA+DGSGQ K++ EALK VP KN + FVI+IKAG+Y
Sbjct  240  TWVSEGQRRLLQAVDP---KPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIY  296

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE + + + +  +  +G+GPTKTRITGS++  DG+ TY+TAT  +    F+A+NIGFEN+
Sbjct  297  NEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENT  356

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV+AD  +F+NC++D +QDTLYT + RQ+YRDCT+TGTIDF+FGDA AV
Sbjct  357  AGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAV  416

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK +VR PL+NQ C+VTA GR +     ALV Q+C    +P + ++ P +  YLGRP
Sbjct  417  FQNCKFIVRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALTPKI-AYLGRP  475

Query  19   WKEYSR  2
            W+ Y++
Sbjct  476  WRLYAK  481



>sp|Q42920.1|PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=P65; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Medicago sativa]
 gb|AAA91128.1| putative pectinesterase [Medicago sativa]
Length=447

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 207/304 (68%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE M  +LKT+ ELSSN + M+   + +L+  +  +  +  RRLL+ +          P 
Sbjct  63   GETMTKVLKTSMELSSNAIDMMDAVSRILKGFDT-SQYSVSRRLLSDD--------GIPS  113

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V+   RRLL     +++ +AVVA+DGSGQ+K++ +ALK VP KN   FVI +KAGVY E
Sbjct  114  WVNDGHRRLLAG--GNVQPNAVVAQDGSGQFKTLTDALKTVPPKNAVPFVIHVKAGVYKE  171

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V ++MN +  +G+GPTKT+ TGS +  DGI TY+TAT  + G  F+A++IGFEN+AG
Sbjct  172  TVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGINTYNTATFGVNGANFMAKDIGFENTAG  231

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV+AD  IF+NC +D +QDTLY  + RQ+YRDC+I+GTIDF+FG+   VFQ
Sbjct  232  TGKHQAVALRVTADQAIFYNCQMDGFQDTLYVQSQRQFYRDCSISGTIDFVFGERFGVFQ  291

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK+V R P K Q C+VTA GR++     ALV Q+     +PAL SV P V  YLGRPWK
Sbjct  292  NCKLVCRLPAKGQQCLVTAGGREKQNSASALVFQSSHFTGEPALTSVTPKVS-YLGRPWK  350

Query  13   EYSR  2
            +YS+
Sbjct  351  QYSK  354



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 210/307 (68%), Gaps = 15/307 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK LL ++  +SSN LA+IT F + +  + +   +   RRLL        Q+ + P 
Sbjct  187  GKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKIVG--RRLL--------QDYKTPS  236

Query  733  FVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNET-FVIFIKAGV  563
            +V+   R+LL     + KH  +  VA DGSG +KS+ EALK VP++ ++T FVI+IKAGV
Sbjct  237  WVEH--RKLLDAKTNAFKHTPNVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKAGV  294

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E VEV   M  IVFVG+G  K+ ITG+++  DG+ TYHTATVAIQGD F A N+GFEN
Sbjct  295  YREYVEVLTNMTHIVFVGDGGKKSIITGNKNFMDGVTTYHTATVAIQGDHFTAINMGFEN  354

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAG  KHQAVA+RV  D  IF+NC +D YQDTLY HA RQ+YRDCTI+GTIDF+FG+A +
Sbjct  355  SAGPQKHQAVALRVQGDKAIFYNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAES  414

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNCK VVRKP+ +Q C+VTAQGRKE     A+V++   I+ DP    V    K YL R
Sbjct  415  VFQNCKFVVRKPMSDQQCIVTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKSYLAR  474

Query  22   PWKEYSR  2
            PWK +SR
Sbjct  475  PWKNFSR  481



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 209/320 (65%), Gaps = 22/320 (7%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL-------------TAE  770
            +KM+++L T+  +SSN LA+I+   + +  L +    N +RRL+               E
Sbjct  186  KKMQNILTTSMHMSSNALAIISDLAKSVLDLNLT---NNERRLIDNNNNNNNNNNNDVGE  242

Query  769  TKGeeqeeEFPGFV----DAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYK  602
                  + E P +         RRLL  N   +K + +VAKDGSG++K + +ALK VP K
Sbjct  243  QVFGHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGKFKKINDALKHVPKK  302

Query  601  NNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  422
            N + FVI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY T TVAI 
Sbjct  303  NKKIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFIDGVNTYKTPTVAIA  362

Query  421  GDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTI  242
            GD F+A NIGFENSAG  KHQAVAIRV AD +IF+ C ID YQDTLY H  RQ+YRDCTI
Sbjct  363  GDYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTLYAHTMRQFYRDCTI  422

Query  241  TGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL  62
            +GTIDF+FGDA A+FQNC  VVRKPL+NQ C+VTAQGRK+      +V+Q C I+ D   
Sbjct  423  SGTIDFVFGDAVAIFQNCTFVVRKPLENQQCIVTAQGRKDKHQPSGIVIQGCSIVSDT--  480

Query  61   KSVNPPVKVYLGRPWKEYSR  2
             +V    K YL RPWK YSR
Sbjct  481  HNVKFDNKAYLARPWKNYSR  500



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   311 bits (797),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 209/304 (69%), Gaps = 9/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+ M  +L T+ ELS+N L ++   + L + L + +  N   R L +E  G      FP 
Sbjct  184  GKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLSEVDG------FPT  237

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL    A  K D VVA+DGSGQ K++ EALK VP KN + FVI++KAGVY E
Sbjct  238  WVSEGQRRLL--QAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYVKAGVYQE  295

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             + + + +  +  +G+GPTKTRITGS++  DGI TY+TAT  +    F+A NIGFEN+AG
Sbjct  296  YIMINKHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFGVNAANFMAMNIGFENTAG  355

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV+AD  +F+NC++D +QDTLYT + RQ+YRDCT+TGTIDF+FGDA AVFQ
Sbjct  356  AEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQ  415

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK +VRKP++NQ CMVTA GR +     ALV Q+C    +P + +++P +  YLGRPW+
Sbjct  416  NCKFIVRKPMENQQCMVTAGGRTKIDSPSALVFQSCIFTGEPDVFALSPKI-AYLGRPWR  474

Query  13   EYSR  2
             Y++
Sbjct  475  VYAK  478



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 207/304 (68%), Gaps = 6/304 (2%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             E MK  L  +  L+SN LA+I   + +L + +IP      RRLL+ E   E  + E+P 
Sbjct  197  AESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPF---LSRRLLSEE---EADDGEYPS  250

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL      +K D VVA+DGSG Y+++ EAL A+P  +N TFVI+IK GVY E
Sbjct  251  WVTNGKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIYIKEGVYKE  310

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
            +V + + M  ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ G+GFIA+++GFENSAG
Sbjct  311  QVWLDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGEGFIAKDLGFENSAG  370

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV +D +IF+NC +D YQDTLY H  RQ+YRDCTITGTIDFIFGD+A++FQ
Sbjct  371  PEKHQAVALRVQSDRSIFYNCQMDGYQDTLYCHTKRQFYRDCTITGTIDFIFGDSASIFQ  430

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC + VRKPL NQ C+VTA GRK+ R   A++L NC I  D      +     YLGRPWK
Sbjct  431  NCLIKVRKPLANQQCIVTASGRKDRREATAIILHNCTISADSEYLPFHIQNPSYLGRPWK  490

Query  13   EYSR  2
             YSR
Sbjct  491  PYSR  494



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 206/304 (68%), Gaps = 11/304 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            +KMKHLL ++  +SSN LA++++F + +  + +     F RRLL        Q+ E P +
Sbjct  193  KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL--FGRRLL--------QDSEIPSW  242

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET-FVIFIKAGVYNE  554
            V+        TN +  K +  VA DGSG +KS+ EALK VP + +ET FVI+IKAGVY E
Sbjct  243  VEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYRE  302

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQGD F A N+GFENSAG
Sbjct  303  YVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAINMGFENSAG  362

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV  D  IF NC +D YQDTLY HA RQ+YRDCTI+GTIDF+FG+A +VFQ
Sbjct  363  PQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQ  422

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL RPWK
Sbjct  423  NCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWK  482

Query  13   EYSR  2
             +SR
Sbjct  483  NFSR  486



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 201/316 (64%), Gaps = 13/316 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFK------------RRLLTAE  770
            G KM++    + ELSSN L +IT    +LQ L+IP GL+              RRLL   
Sbjct  179  GTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIP-GLDLSALNGGGDGGAAHRRLLGKA  237

Query  769  TKGeeqeeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET  590
             KG     E P +V    R+++    + +K DA V++ G GQYK++ EA+  VP  N   
Sbjct  238  PKGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQSGGGQYKTISEAIAKVPMNNASP  297

Query  589  FVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  410
            F+I+IKAG Y E + + +K   ++ VG+GPTKT ITGS++   GI T+ TATV + GDGF
Sbjct  298  FIIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITGSKNFAAGINTFKTATVGVLGDGF  357

Query  409  IARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTI  230
            +AR++  ENS+G   HQAVA++V +D+ + +NC     QDTLY    RQ+YRDCT++GTI
Sbjct  358  MARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTGNQDTLYALRGRQFYRDCTVSGTI  417

Query  229  DFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVN  50
            DFIFGDA AVFQNCK++VRKP  NQ CMVTAQGR E +G GA + + C +  +P  K+V 
Sbjct  418  DFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEEKGPGAFIFEGCTVSSEPGYKAVK  477

Query  49   PPVKVYLGRPWKEYSR  2
                 YLGRPWKEYS+
Sbjct  478  AKNPAYLGRPWKEYSK  493



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 203/308 (66%), Gaps = 12/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            ++M+H+ KT  ELSSN LAM+T  + LL +           N+ R+LLT E       + 
Sbjct  179  QEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTE-------DG  231

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +V    RRL+   P  +K +AVVA+DGSGQ+K++ +AL A+P  N   FVI IK G+
Sbjct  232  IPTWVGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQGI  291

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            Y E+V V RKM  + F+G+G TKT ITG+++   G + T+ TA + ++GD F  +NIG E
Sbjct  292  YKEKVMVTRKMPYVTFIGDGQTKTVITGNQNYGIGKVKTFQTAPLIVEGDHFTMKNIGVE  351

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG    QAVA+RVSAD  +FH+C  D YQDTLY H++R ++RDCT++GT+DFIFGDA 
Sbjct  352  NTAGPEGGQAVALRVSADYAVFHSCQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGDAK  411

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             + QNCK+VVRKP   Q+CMVTAQGR + R    LVL NC I  DPA   V    K YLG
Sbjct  412  CILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLG  471

Query  25   RPWKEYSR  2
            RPWK++SR
Sbjct  472  RPWKQFSR  479



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 208/312 (67%), Gaps = 23/312 (7%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            + M  + KT+ ELSSN LAM+T  + L+ +  + A   + R+LL+ E       +  P +
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTA--KYARKLLSTE-------DSIPTW  229

Query  730  VDAATRRLLTTN---PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            V    RRL+      P  +K +AVVA+DG+GQ+K++ +AL AVP  N   F+I IK G+Y
Sbjct  230  VGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIY  289

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG---TYHTATVAIQGDGFIARNIGF  389
             E+V V +KM  + F+G+GP KT ITGS +   GIG   T+ TAT+ I+GD F A+NIG 
Sbjct  290  KEKVTVTKKMPHVTFIGDGPNKTLITGSLNF--GIGKVKTFLTATITIEGDHFTAKNIGI  347

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG    QAVA+RVSAD  +FH+C ID +QDTLY H++RQ+YRDCT++GT+DFIFGDA
Sbjct  348  ENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDA  407

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSVNPPVK  38
              + QNCK+VVRKP K Q CMVTAQGR   R    LVL  C I  DPA   +KSVN   K
Sbjct  408  KCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVN---K  464

Query  37   VYLGRPWKEYSR  2
             YLGRPWKE+SR
Sbjct  465  AYLGRPWKEFSR  476



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 205/306 (67%), Gaps = 14/306 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+KMK +L ++  +SSN LA+I+ F + + S  +     F RRLL  +T         P 
Sbjct  189  GKKMKDILTSSMHMSSNALAIISDFADTVTSWNVTK--IFGRRLLDTDT---------PS  237

Query  733  FVDAATRRLLTTNPAS--IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            +V +  R LL    +S  +K +  VA DG+G  K++ EAL  VP K+ + F I+IK GVY
Sbjct  238  WV-SEHRMLLDAKTSSFKLKPNVTVALDGTGDVKTINEALLKVPEKSEKPFFIYIKEGVY  296

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
            NE VEV + M  +VF+G+G  K+RITGS++  DG+ TY TA+VAIQGD F A N+GFENS
Sbjct  297  NEYVEVGKHMTYVVFLGDGGQKSRITGSKNFIDGVNTYKTASVAIQGDHFTAINMGFENS  356

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGA KHQAVA+RV  D +IF NC +D YQDTLY H  RQ+YRDCTI+GTIDFIFG+A +V
Sbjct  357  AGAHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFIFGNALSV  416

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL RP
Sbjct  417  FQNCKFVVRKPMANQQCIVTAQGRKERFQPSAIVIQGGSIVADPEFYPVRFDHKAYLARP  476

Query  19   WKEYSR  2
            WK +SR
Sbjct  477  WKNFSR  482



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 206/306 (67%), Gaps = 13/306 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPA---GLNFKRRLLTAETKGeeqeeEF  740
            + M  +LK + EL++N L +I   +  ++ L + +    LN  R+ L+ +          
Sbjct  185  QTMAKVLKASLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSED--------GL  236

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P +V  + R+LL   P ++K +AVVA+DGSGQ+K++ EAL  VP KN   FVI +KAG+Y
Sbjct  237  PSWVSQSQRKLLAA-PENVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGIY  295

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V V +  + +  +G+GPTKT  TGS+S  DG+ TY+TAT  +    F A N+GFENS
Sbjct  296  KEYVSVDKDRDHVTIIGDGPTKTIFTGSKSYADGVQTYNTATFGVNSAHFTALNVGFENS  355

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AGAAKHQAVA+RV+AD  +F+NC +D YQDTLYT + RQ+YRDCTI+GTIDF+FGDA  V
Sbjct  356  AGAAKHQAVALRVTADKALFYNCQMDGYQDTLYTQSKRQFYRDCTISGTIDFVFGDAVGV  415

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK+VVRKP+ NQ CMVTA GR +   V ALV QNC    +P + ++ P +  YLGRP
Sbjct  416  FQNCKLVVRKPMANQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQPKI-AYLGRP  474

Query  19   WKEYSR  2
            W+ +S+
Sbjct  475  WRNFSK  480



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 204/304 (67%), Gaps = 3/304 (1%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+ M  +L  + E+S N L ++   + L + L   +     R+LL+ E   +   + FP 
Sbjct  186  GKTMTRVLNASLEMSHNALDIVNGASALFKGLNFTSFAASNRKLLSEEPLVDGLVDGFPS  245

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    R++L    A+ K D VVA DGSGQ   + EALK VP  N + FVI+IKAG+Y E
Sbjct  246  WVTEGQRKIL--EDANPKPDVVVALDGSGQVTKIHEALKLVPKNNKKPFVIYIKAGIYQE  303

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V + + M+ +  +G+GPT+TRITG+++  DG  TY+TAT       F+A+NIGFENSAG
Sbjct  304  YVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQTYNTATFGANAANFMAKNIGFENSAG  363

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV+AD  +F+NCH+D YQDTLYT + RQ+YRDCT++GTIDF+FGDA AVFQ
Sbjct  364  AEKHQAVALRVTADKAVFYNCHMDGYQDTLYTQSQRQFYRDCTVSGTIDFVFGDAVAVFQ  423

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP++NQ CMVTA GR +     ALV Q+C    +P L +V P +  YLGRPW+
Sbjct  424  NCKFVVRKPMENQQCMVTAGGRSKIDSPSALVFQSCTFTGEPDLVAVTPKIS-YLGRPWR  482

Query  13   EYSR  2
             YS+
Sbjct  483  IYSK  486



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 201/304 (66%), Gaps = 5/304 (2%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFV  728
            KM+ LL++A  +SSNGL++IT  ++ L  + I  G   +RRLL     G +  +  P +V
Sbjct  186  KMQRLLQSAMHMSSNGLSIITELSKTLSEMHI--GKPGRRRLLNNNVLGHDYFD-LPEWV  242

Query  727  D--AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            D     R+LL           VVAKDGSG + ++ EALK VP KN   FVI++K GVYNE
Sbjct  243  DDQVGVRKLLHMTGRKRMAHVVVAKDGSGNFTTINEALKHVPKKNLRPFVIYVKEGVYNE  302

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VEV + M  +V +G+G  K+RITG+++  DG+GT+ TA+ AI GD F+   +GFENSAG
Sbjct  303  YVEVSKNMTHVVMIGDGGKKSRITGNKNFVDGVGTFRTASAAILGDFFVGIGMGFENSAG  362

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV AD +IF+ C +D YQDTLY H  RQ+YRDC I+GTIDF+FGDA AV Q
Sbjct  363  AEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVFGDAVAVLQ  422

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC  VVRKPL+NQ C+VTAQGRKE      L++Q   I+ DP    V    K YL RPWK
Sbjct  423  NCTFVVRKPLENQQCIVTAQGRKEMNQPSGLIIQGGSIVADPMYYPVRFDNKAYLARPWK  482

Query  13   EYSR  2
             +SR
Sbjct  483  NFSR  486



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 200/310 (65%), Gaps = 10/310 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PAGLNFKRRLLTAETKGeeqeeEF  740
            G+KM+ LL+TA  +SSNGL++I   ++ L  + +  P     +RRLL           +F
Sbjct  162  GQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG----RRRLLNNVDDLPVLGHDF  217

Query  739  --PGFVD--AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
              P +VD     R+LL           VVAKDGSG + ++ EALK VP KN   FVI++K
Sbjct  218  DLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYVPKKNLRPFVIYVK  277

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+   +G
Sbjct  278  EGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASAAILGDFFVGIGMG  337

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            FENSAGA KHQAVA+RV AD +IF+ C +D YQDTLY H  RQ+YRDC I+GTIDF+FGD
Sbjct  338  FENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVFGD  397

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            A AV QNC  VVRKPL+NQ C+VTAQGRKE      LV+    I+ DP    V    K Y
Sbjct  398  AVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVSDPTYYPVRFDNKAY  457

Query  31   LGRPWKEYSR  2
            L RPWK +SR
Sbjct  458  LARPWKNFSR  467



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSL----EIPAGLNFKRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L    EI  G +  R L+    K      
Sbjct  193  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  253  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G+ 
Sbjct  313  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILGEF  372

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  373  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  432

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  433  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  492

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  493  RNKIKSYLGRPWRIHSR  509



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 212/309 (69%), Gaps = 14/309 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            ++M ++ KT+ EL+SN LAM+T  + LL +  I  GL     ++ R+LL+ E        
Sbjct  179  QEMINIFKTSRELTSNSLAMVTGMSTLLPNSNI-TGLTGVLASYARKLLSTED-------  230

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
              P +V    RRL+      +K +AVVA+DGSGQ+K++ +AL AVP  +   F+I IK G
Sbjct  231  GIPTWVGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEG  290

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  389
            +Y E+V V +KM  + F+G+GPTKT ITGS + + G + T+ TAT+ IQG+ F A++IG 
Sbjct  291  IYKEKVIVTKKMPHVTFIGDGPTKTVITGSLNFRIGKVKTFLTATITIQGNHFTAKSIGI  350

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN++G    QAVA+RVSAD  +F+NC ID YQ+TLY H++RQ+YRDCT++GT+DFIFGDA
Sbjct  351  ENTSGPKGGQAVALRVSADYAVFYNCQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGDA  410

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
              + QNCK+VVRKP ++Q+CMVTAQGR + R    +VL NC I+ DPA   V    K YL
Sbjct  411  KCILQNCKIVVRKPKRSQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYL  470

Query  28   GRPWKEYSR  2
            GRPW+++SR
Sbjct  471  GRPWRQFSR  479



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSL----EIPAGLNFKRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L    EI  G +  R L+    K      
Sbjct  189  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  248

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  249  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  308

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV++ G+ 
Sbjct  309  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSVLGEF  368

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  369  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  428

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  429  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  488

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  489  RNKIKSYLGRPWRIHSR  505



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 200/310 (65%), Gaps = 10/310 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PAGLNFKRRLLTAETKGeeqeeEF  740
            G+KM+ LL+TA  +SSNGL++I   ++ L  + +  P     +RRLL           +F
Sbjct  183  GQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG----RRRLLNNVDDLPVLGHDF  238

Query  739  --PGFVD--AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
              P +VD     R+LL           VVAKDGSG + ++ EALK VP KN   FVI++K
Sbjct  239  DLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYVPKKNLRPFVIYVK  298

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+   +G
Sbjct  299  EGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASAAILGDFFVGIGMG  358

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            FENSAGA KHQAVA+RV AD +IF+ C +D YQDTLY H  RQ+YRDC I+GTIDF+FGD
Sbjct  359  FENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVFGD  418

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            A AV QNC  VVRKPL+NQ C+VTAQGRKE      LV+    I+ DP    V    K Y
Sbjct  419  AVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVSDPTYYPVRFDNKAY  478

Query  31   LGRPWKEYSR  2
            L RPWK +SR
Sbjct  479  LARPWKNFSR  488



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 205/307 (67%), Gaps = 23/307 (7%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAG--LNFKRRLLT--AETKGeeqee  746
            GEKMK LLKT  EL+SNGL M+T  T +L  L+I  G     +RRLL+  AE K      
Sbjct  162  GEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQIGIGNVSAGRRRLLSDWAEPK------  215

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
                       R+L      I+ +AVVA DGSGQYKS+  A+ A P KN   FVI +KAG
Sbjct  216  ----------MRMLA---GGIRANAVVALDGSGQYKSINAAINAAPSKNARPFVIHVKAG  262

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  386
            +Y E VEVP+    IV +G+G T+TRITG ++   G+ T+ TAT A+  D F A++IG E
Sbjct  263  LYREYVEVPKHKTNIVILGDGATRTRITGRKNLAGGVKTFATATFAVNADDFTAKDIGIE  322

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG   HQAVA+RV+ D  + +N +ID +QDTLY HA+RQ+YR+C I+GTIDF+FG+A 
Sbjct  323  NTAGPEGHQAVALRVTGDRAVLYNLNIDGFQDTLYAHAHRQFYRNCRISGTIDFVFGNAL  382

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            ++FQNC+ +VRKP+ NQACMVTAQGR +    GA+V+QN +I  + A  +  P V+ YLG
Sbjct  383  SIFQNCQFIVRKPMANQACMVTAQGRDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAYLG  442

Query  25   RPWKEYS  5
            RPWK++S
Sbjct  443  RPWKQFS  449



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 209/317 (66%), Gaps = 27/317 (9%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLN-----FKRRLLTAETKGeeqee  746
            + M  + KT+ ELSSN LAM+T  + L+ +  +  GL      + R+LL+ E       +
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNL-TGLTGALAKYARKLLSTE-------D  230

Query  745  EFPGFVDAATRRLLTTN---PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V    RRL+      P  +K +AVVA+DG+GQ+K++ +AL AVP  N   F+I I
Sbjct  231  SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG---TYHTATVAIQGDGFIA  404
            K G+Y E+V V +KM  + F+G+GP KT ITGS +   GIG   T+ TAT+ I+GD F A
Sbjct  291  KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNF--GIGKVKTFLTATITIEGDHFTA  348

Query  403  RNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDF  224
            +NIG EN+AG    QAVA+RVSAD  +FH+C ID +QDTLY H++RQ+YRDCT++GT+DF
Sbjct  349  KNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  408

Query  223  IFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSV  53
            IFGDA  + QNCK+VVRKP K Q CMVTAQGR   R    LVL  C I  DPA   +KSV
Sbjct  409  IFGDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSV  468

Query  52   NPPVKVYLGRPWKEYSR  2
            N   K YLGRPWKE+SR
Sbjct  469  N---KAYLGRPWKEFSR  482



>ref|XP_007138937.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
 gb|ESW10931.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
Length=573

 Score =   306 bits (784),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 205/304 (67%), Gaps = 8/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G KM  +L T+ EL+SN L MI   + +L+ L + +  N  RRLL+ +   +   +++P 
Sbjct  183  GAKMNKVLNTSLELTSNALDMIDVISGILKDLNMTSFGN--RRLLSQD---KVPLDDYPS  237

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    RRLL+    S K   VVA+DGSGQ+K++ EALK VP  N E +VI++KAGVY E
Sbjct  238  WVSEGKRRLLSQGTESAK--VVVAQDGSGQFKTIKEALKTVPPNNAEPYVIYVKAGVYKE  295

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V++   M  +  +G+GPTKTR +GS +  DG+ TY TAT A+    F+A+N+GFEN+AG
Sbjct  296  NVDMSMLMTHVTIIGDGPTKTRFSGSLNYDDGVQTYKTATFAVNAANFMAKNVGFENTAG  355

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            + KHQAVA+RV+AD  +F NCH+D +QDTLY  + RQ+YRDC +TGT+DF+FGDA  +FQ
Sbjct  356  SKKHQAVALRVTADQAVFVNCHMDGFQDTLYAQSQRQFYRDCIVTGTVDFVFGDAVGMFQ  415

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
             CK++VRKPL  Q CMVTA GR +     ALV Q C    DP L+S+   V  YLGRPW+
Sbjct  416  KCKLIVRKPLNKQKCMVTAGGRVKSDSPSALVFQGCHFTGDPELRSLADKV-AYLGRPWR  474

Query  13   EYSR  2
             +S+
Sbjct  475  AFSK  478



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   306 bits (783),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 209/317 (66%), Gaps = 27/317 (9%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLN-----FKRRLLTAETKGeeqee  746
            + M  + KT+ ELSSN LAM+T  + L+ +  +  GL      + R+LL+ E       +
Sbjct  179  QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNL-TGLTGALAKYARKLLSTE-------D  230

Query  745  EFPGFVDAATRRLLTTN---PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V    RRL+      P  +K +AVVA+DG+GQ+K++ +AL AVP  N   F+I I
Sbjct  231  SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG---TYHTATVAIQGDGFIA  404
            K G+Y E+V V +KM  + F+G+GP KT ITGS +   GIG   T+ TAT+ I+GD F A
Sbjct  291  KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNF--GIGKVKTFLTATITIEGDHFTA  348

Query  403  RNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDF  224
            +NIG EN+AG    QAVA+RVSAD  +FH+C ID +QDTLY H++RQ+YRDCT++GT+DF
Sbjct  349  KNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  408

Query  223  IFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSV  53
            IFGDA  + QNCK+VVRKP K Q CMVTAQGR   R    LVL  C I  DPA   +KSV
Sbjct  409  IFGDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSV  468

Query  52   NPPVKVYLGRPWKEYSR  2
            N   K YLGRPWKE+SR
Sbjct  469  N---KAYLGRPWKEFSR  482



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   306 bits (784),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 204/307 (66%), Gaps = 16/307 (5%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL-TAETKGeeqeeEFP  737
            G KMK LL ++  + SN LA+I+ F + L      A   F RRLL  +ET         P
Sbjct  188  GAKMKELLTSSMHMGSNALAIISDFADTLADWN--ATKVFGRRLLHDSET---------P  236

Query  736  GFVDAATRRLLTTNPASIKH--DAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             +VD   R+L+ T   + +H  +  VA DG+G +K++ EAL  VP K  + F+I+IK GV
Sbjct  237  SWVDH--RQLIDTKTNTFRHKPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIKEGV  294

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y+E VEV ++M  +VFVG+G  K+ ITG+++  DG+ TY TA+VAIQGD F A N+GFEN
Sbjct  295  YSEYVEVTKRMTHVVFVGDGGKKSVITGNKNFIDGVNTYRTASVAIQGDHFTAINMGFEN  354

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAG  KHQAVA+RV  D +IF NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A A
Sbjct  355  SAGPHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALA  414

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL R
Sbjct  415  VFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLAR  474

Query  22   PWKEYSR  2
            PWK +SR
Sbjct  475  PWKNFSR  481



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 201/305 (66%), Gaps = 22/305 (7%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            ++M  L+ T  ELS N L+M+  F E++       GL   R+LL+              F
Sbjct  173  DEMVKLMNTTRELSINALSMVNSFGEMITQT---TGLT--RKLLSNSDS----------F  217

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V+A+ R+LL  + A  K +AVV+  G GQYK++ EA+ AVP  N   F+I IKAG Y E 
Sbjct  218  VEASNRKLLQISAA--KPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFIILIKAGTYKEH  275

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQGDGFIARNIGFENSA  377
            +E+ +    +VF+GEG TKT ITG R  K+G G  T+HT  + + G+GF+ R+IG EN+A
Sbjct  276  IEIEKSKPNVVFIGEGATKTIITGDRGVKNGGGYATWHTCALGVAGEGFVIRDIGLENTA  335

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  K QAVA+R++AD  I +NC ID +QDTLY H++RQ+YRDC ITGTIDF+FGDA+AVF
Sbjct  336  GPEKEQAVALRINADKAIVYNCKIDGFQDTLYAHSFRQFYRDCIITGTIDFMFGDASAVF  395

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC+++VRKP   QACMVTAQGR     VG  V+QNCDI P+P   S     K YLGRPW
Sbjct  396  QNCQIIVRKPGNTQACMVTAQGRTVPTSVGGFVIQNCDIKPEPGFPST---TKAYLGRPW  452

Query  16   KEYSR  2
            KE+S+
Sbjct  453  KEFSK  457



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 208/310 (67%), Gaps = 13/310 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G +M++LL T   +SSN LA+IT     +  L   + +N KR+L+  +     Q+E    
Sbjct  183  GNRMRNLLTTTMHMSSNALAIITALANTVSEL---SDVN-KRQLVEDDEHVFGQDEVISS  238

Query  733  FV------DAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
             +          RRLL  NP  +K +A+VAKDGS ++KS+ +AL+ VP KN + FVI+I+
Sbjct  239  LIFDDDDDGGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIR  298

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             GVYNE +EV + M ++VFVG+G  KTRITG+R+  DG+ TY TA+VAI GD F+A NIG
Sbjct  299  EGVYNEYIEVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASVAIHGDYFVAINIG  358

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            FENSAG  KHQAVAIRV AD +IF+ C +D Y+DTLY HA RQ+YRDCTI+GT DF+FGD
Sbjct  359  FENSAGPHKHQAVAIRVQADRSIFYRCSMDGYEDTLYVHAMRQFYRDCTISGTTDFVFGD  418

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            A AVFQNC  VVRKPL+NQ  +VTAQGRKE      +V+Q   I+ +  +K      K Y
Sbjct  419  AVAVFQNCTFVVRKPLENQPLIVTAQGRKEKHQPSGIVIQGSSIVSNHRMKF---DKKAY  475

Query  31   LGRPWKEYSR  2
            L RP K YSR
Sbjct  476  LARPLKNYSR  485



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 202/281 (72%), Gaps = 2/281 (1%)
 Frame = -2

Query  838  TELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPA-SIKHDAVVA  662
            + L++ L+    LN  R+  ++  +   +E EFP +V   +RRLL   P+ SI+ + VVA
Sbjct  326  SSLIRPLDPLRKLNHLRKFDSSNDRHLSEEGEFPPWVTLHSRRLLARRPSNSIRANVVVA  385

Query  661  KDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRIT  482
            KDGSG++K++ +AL  VP KN   FVI IK GVY E+VEV +KM  ++FVG+GPTKT IT
Sbjct  386  KDGSGKFKTIAQALAMVPMKNKRKFVIHIKQGVYKEKVEVTKKMLNVMFVGDGPTKTIIT  445

Query  481  GSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHI  305
            G  +   + +GT+ TATVA+ GD F+A++IGFEN+AGAA+HQAVA+RVSAD  +F NCH+
Sbjct  446  GDIAFLPNRVGTFRTATVAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFALFFNCHM  505

Query  304  DAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRK  125
            + YQDTLY H +RQ+YRDC I+GTIDF+FGDA AVFQNC  V+R+P+ NQ C+VTAQGRK
Sbjct  506  NGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRK  565

Query  124  EHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            + R    +V+ N  II D +   V    + +LGRPWKEYSR
Sbjct  566  DRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSR  606



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/314 (51%), Positives = 204/314 (65%), Gaps = 21/314 (7%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M+++ +T+ ELSSN LAM++  + L  S     GL     N+ R+LL+AE        
Sbjct  179  QDMQNIFQTSKELSSNSLAMVSSMSTLFPSSN-DTGLTGTLTNYARKLLSAED-------  230

Query  745  EFPGFVDAATRRLLTTN---PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V    RRLL      P  +K +AVVA+DGSGQ+K++ +AL AVP  N   FVI I
Sbjct  231  GIPTWVRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHI  290

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG---TYHTATVAIQGDGFIA  404
            K G+Y E+V V RKM  + F+G+GP KT ITGS +   GIG   T+ T ++ I+GD F A
Sbjct  291  KQGIYKEKVIVTRKMPYVTFIGDGPNKTVITGSLNF--GIGKVKTFLTGSITIEGDHFTA  348

Query  403  RNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDF  224
            +NIG EN+AG    QAVA+RVSAD   F +C ID +QDTLY H++RQ+YRDCT++GT+DF
Sbjct  349  KNIGIENTAGPEGGQAVALRVSADYAAFQSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  408

Query  223  IFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPP  44
            IFGDA  + QNCK+VVRKP K Q+CMVTAQGR   R    LVL NC I  D A   V   
Sbjct  409  IFGDAKCILQNCKIVVRKPKKGQSCMVTAQGRSNVRESTGLVLHNCHITGDSAYIPVKSE  468

Query  43   VKVYLGRPWKEYSR  2
             K YLGRPWKE+SR
Sbjct  469  SKAYLGRPWKEFSR  482



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 207/317 (65%), Gaps = 25/317 (8%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + +T+ ELSSN LAM+T  + LL +  I  GL     N+ R+LL+ E        
Sbjct  179  QDMLKIFQTSRELSSNSLAMVTSISTLLPNSNI-TGLTGALANYARKLLSTED-------  230

Query  745  EFPGFVDAATRRLLTTNPAS-----IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVI  581
              P +V    RRL+           +K +AVVA+DGSGQ+K++ +AL  VP  N   FVI
Sbjct  231  GIPNWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALNGVPKGNTVPFVI  290

Query  580  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIA  404
             IK G+Y E+V V RKM  + F+G+GP KT ITGS +   G + T+ TAT+ ++GD F A
Sbjct  291  HIKQGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTATITVEGDHFTA  350

Query  403  RNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDF  224
            +NIG EN+AG    QAVA+RVSAD  +FH+C ID +QDTLY H++RQ+YRDCT++GT+DF
Sbjct  351  KNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  410

Query  223  IFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSV  53
            IFGDA  + QNCK+VVRKP K Q+CMVTAQGR   R    LVL  C I  DPA   +KSV
Sbjct  411  IFGDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPVKSV  470

Query  52   NPPVKVYLGRPWKEYSR  2
            N   K YLGRPWKE+SR
Sbjct  471  N---KAYLGRPWKEFSR  484



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 199/303 (66%), Gaps = 10/303 (3%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVD  725
            ++ ++K   EL+SN LAMI+       + E+P G   +RRL+T  T G       P ++D
Sbjct  214  IEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMT--TNG------VPTWMD  265

Query  724  AATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
               RR+L    A    K + VVAKDGSG++K++ EAL A+P K +  +VI++K G+Y+E 
Sbjct  266  RNQRRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDET  325

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V + +KM  +   G+G  K+ I+GS++  DG+ T+ TAT    G+GF+ + IGF N AG 
Sbjct  326  VVITKKMVNVTMYGDGSQKSMISGSKNFVDGVRTFQTATFVALGEGFLGQAIGFRNIAGP  385

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA RV AD  IF NC  + YQDTLYT A+RQ+YR C ITGTIDFIFGDAAA+FQN
Sbjct  386  EKHQAVAARVQADRAIFVNCRFEGYQDTLYTQAHRQFYRSCLITGTIDFIFGDAAAIFQN  445

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C M++RKPL NQ  MVTAQGR +      +VLQNC I+PD  L+ V    K YLGRPWKE
Sbjct  446  CNMMIRKPLDNQQNMVTAQGRTDKHETTGIVLQNCKILPDKTLEPVKSQFKSYLGRPWKE  505

Query  10   YSR  2
            +SR
Sbjct  506  FSR  508



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 197/304 (65%), Gaps = 10/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G KMK LL ++  +SSN LA+I+ F + +         N  RR L  +++        P 
Sbjct  188  GTKMKELLTSSIHMSSNALAIISDFADTVSDWN---ATNILRRHLLHDSET-------PS  237

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
             VD   +     N    K +  VA DGSG +KS+ EAL  VP K+ + FVI+IK GVY E
Sbjct  238  SVDHHKQHNAMKNVFKHKPNVTVALDGSGDFKSINEALTRVPEKSKKPFVIYIKEGVYPE  297

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VAIQGD F+A N+GFENSAG
Sbjct  298  YVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENSAG  357

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA+RV  D TIF NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AVFQ
Sbjct  358  PHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQ  417

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL RPWK
Sbjct  418  NCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPWK  477

Query  13   EYSR  2
             +SR
Sbjct  478  NFSR  481



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 203/311 (65%), Gaps = 15/311 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            ++M+H+ KT  ELSSN LAM+T  + LL +           N+ R+LL+AE         
Sbjct  179  QEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLSAED-------G  231

Query  742  FPGFVDAATRRLLTTN---PASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
             P +V    RRL+      P  +K +AVVA+DGSGQ+K++ EAL AVP  N   +VI IK
Sbjct  232  IPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVPKGNTVPYVIHIK  291

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNI  395
             G+Y E+V V RKM  + F+G+G TKT ITG+ +   G + T+ TA + I+GD F  +NI
Sbjct  292  QGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPLTIEGDHFTMKNI  351

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            G EN+AG    QAVA+RVSAD  +FH+C  D +QDTLY H++R ++R+CT++GT+DFIFG
Sbjct  352  GVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRECTVSGTVDFIFG  411

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DA  + QNCK+VVRKP K Q+CMVTAQGR + R    LVL NC I  DPA   V    K 
Sbjct  412  DAKCILQNCKIVVRKPKKGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKS  471

Query  34   YLGRPWKEYSR  2
            YLGRPWK++SR
Sbjct  472  YLGRPWKQFSR  482



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 203/305 (67%), Gaps = 12/305 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSL-EIPAGLNFKRRLLTAETKGeeqeeEFP  737
            GE M   L T+ ELSSN L +I   + LL+   E    +N  R+LL+ +         FP
Sbjct  190  GEIMAKALNTSLELSSNSLDIINAVSSLLKDAGENNVNVNLNRKLLSND--------GFP  241

Query  736  GFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
             +V    R +L     + K +AVVA+DGSGQ+K++ EAL  VP  N E FVI++KAG+YN
Sbjct  242  SWVSEGQRHILM--EGNFKPNAVVAQDGSGQFKTLSEALLTVPSYNAEPFVIYVKAGIYN  299

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E V V ++M  +  +G+GPTKTR T S +  DG+ TY+TAT  + G  F+A+++GFEN+A
Sbjct  300  ENVNVLKEMTHVTIIGDGPTKTRFTASLNYVDGVQTYNTATFGVNGANFMAKDVGFENTA  359

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA KHQAVA+RV+AD  +F+NC +D +QDTLYT + RQ+YRDC+++GTIDFIFGDA  VF
Sbjct  360  GAEKHQAVALRVTADQAVFYNCQMDGFQDTLYTQSQRQFYRDCSVSGTIDFIFGDAFGVF  419

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK++VRKP ++Q C+VTA GR +      L+ QNC    +  L  + P +  YLGRPW
Sbjct  420  QNCKLIVRKPSEDQQCLVTAGGRIKADSASGLIFQNCHFTGEAELAVMRPKIS-YLGRPW  478

Query  16   KEYSR  2
            K YS+
Sbjct  479  KPYSK  483



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 204/307 (66%), Gaps = 13/307 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPA---GLNFKRRLLTAETKGeeqeeE  743
            G+ M  +L  + ELS+N L +I   +  ++ L + +    LN  R+LL+ +         
Sbjct  184  GQTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASALNNNRKLLSED--------G  235

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +V  + R+LL   P ++K + VVA+DGSGQ+K++ EAL  VP KN   FVI +KAG+
Sbjct  236  LPSWVSQSQRKLLAA-PQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAGI  294

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  383
            Y E V +    + +  +G+GP KT  TGS+S  DG+ TY+TAT ++    F A N+GFEN
Sbjct  295  YKEYVALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQTYNTATFSVNSAHFTAFNVGFEN  354

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            SAGAAKHQAVA+RV+AD  +F+NC ++ YQDTLYT + RQ+YRDCTITGTIDF+FGDA  
Sbjct  355  SAGAAKHQAVALRVTADKALFYNCEMNGYQDTLYTQSKRQFYRDCTITGTIDFVFGDAVG  414

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            VFQNCK++VRKP+  Q CMVTA GR +   V ALV QNC    +P + ++ P +  YLGR
Sbjct  415  VFQNCKLIVRKPMATQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQPKI-AYLGR  473

Query  22   PWKEYSR  2
            PW+ +S+
Sbjct  474  PWRNFSK  480



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF----KRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L+I   +N      R L+    K      
Sbjct  193  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  253  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G+ 
Sbjct  313  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILGEF  372

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  373  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  432

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  433  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  492

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  493  RNKIKSYLGRPWRIHSR  509



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF----KRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L+I   +N      R L+    K      
Sbjct  193  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  253  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G+ 
Sbjct  313  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILGEF  372

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  373  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  432

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  433  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  492

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  493  RNKIKSYLGRPWRIHSR  509



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   307 bits (786),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF----KRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L+I   +N      R L+    K      
Sbjct  193  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  253  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G+ 
Sbjct  313  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILGEF  372

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  373  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  432

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  433  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  492

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  493  RNKIKSYLGRPWRIHSR  509



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   307 bits (787),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 211/317 (67%), Gaps = 13/317 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF----KRRLLTAETKGe----  758
            G KM+ +LKT+ EL+ N +AM++  + +L +L+I   +N      R L+    K      
Sbjct  193  GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  757  ----eqeeEFPGFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNE  593
                E  + +P ++    R+LL   + A  K D VVAKDGSG   ++ EAL  +P K+N+
Sbjct  253  IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  592  TFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  413
            T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G+ 
Sbjct  313  TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILGEF  372

Query  412  FIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGT  233
            F+A+NIGFENSAG  KHQAVA+RV ADM+IF+NC +D YQDTLYTHA RQYYRDCTITGT
Sbjct  373  FMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTITGT  432

Query  232  IDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSV  53
            IDFIFGD +A FQNCK++VRKPL NQ C+VTAQGR       A+V+QN  II D     V
Sbjct  433  IDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYWPV  492

Query  52   NPPVKVYLGRPWKEYSR  2
               +K YLGRPW+ +SR
Sbjct  493  RNKIKSYLGRPWRIHSR  509



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 203/312 (65%), Gaps = 19/312 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-------AGLNFKRRLLTAETKGeeq  752
            +KM+ +LKT+ E++SN LAM+   + +++ L IP        G+N  R+LL+AE      
Sbjct  154  QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDTTGVN--RKLLSAED-----  206

Query  751  eeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIK  572
                P ++  A R+LL   P  +K + VVAKDGSG+Y ++ +AL  VP K+ + FVI IK
Sbjct  207  ---MPEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIK  263

Query  571  AGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTATVAIQGDGFIARN  398
            AG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TATV + G GF+A++
Sbjct  264  AGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKD  323

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y +C ITGT+DFIF
Sbjct  324  IGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIF  383

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVK  38
            GDAA++FQNC ++VRKP   Q CMVTAQGR +     A+VLQNC I   P   SV    K
Sbjct  384  GDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNK  443

Query  37   VYLGRPWKEYSR  2
             YLGRPWK+++R
Sbjct  444  AYLGRPWKQFAR  455



>emb|CAB65291.1| pectin methyl-esterase PEF1 [Medicago truncatula]
Length=565

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 200/304 (66%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE M  +LKT+ ELSSN + M+   + +L+    P+     RRLL+ +          P 
Sbjct  181  GETMAKVLKTSMELSSNAIDMMDVVSRILKGFH-PSQYGVSRRLLSDD--------GIPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    R LL     ++K +AVVA+DGSGQ+K++ +ALK VP  N   FVI++KAGVY E
Sbjct  232  WVSDGHRHLLA--GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKE  289

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V ++MN +  +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG
Sbjct  290  TVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAG  349

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
             +K QAVA+RV+AD  IFHNC +D +QDTL+  + RQ+YRDC I+GTIDF+FGDA  VFQ
Sbjct  350  TSKFQAVALRVTADQAIFHNCQMDGFQDTLFVESQRQFYRDCAISGTIDFVFGDAFGVFQ  409

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++ R P K Q C+VTA GR +     ALV  +     +PAL SV P +  YLGRPWK
Sbjct  410  NCKLICRVPAKGQKCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWK  468

Query  13   EYSR  2
             YS+
Sbjct  469  LYSK  472



>gb|KEH37213.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=565

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 200/304 (66%), Gaps = 12/304 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            GE M  +LKT+ ELSSN + M+   + +++    P+     RRLL+ +          P 
Sbjct  181  GETMTKVLKTSMELSSNAIDMMDVVSHIIKGFN-PSQYGVSRRLLSDD--------GIPS  231

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V    R LL     ++K +AVVA+DGSGQ+K++ +ALK VP  N   FVI++KAGVY E
Sbjct  232  WVSDGHRHLLA--GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKE  289

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V ++MN +  +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG
Sbjct  290  TVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAG  349

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              K+QAVA+RV+AD  IFHNC +D +QDTLY  + RQ+YRDC I+GTIDF+FGDA  VFQ
Sbjct  350  TNKNQAVALRVTADQAIFHNCQMDGFQDTLYVQSQRQFYRDCAISGTIDFVFGDAFGVFQ  409

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++ R P K Q C+VTA GR +     ALV  +     +PAL SV P +  YLGRPWK
Sbjct  410  NCKLICRVPAKGQKCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWK  468

Query  13   EYSR  2
             YS+
Sbjct  469  LYSK  472



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 201/304 (66%), Gaps = 10/304 (3%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFV  728
            +M+ ++K   EL+SN LAMI+       + E+P G   +RRL+   TKG       P ++
Sbjct  214  EMEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMA--TKG------VPTWM  265

Query  727  DAATRRLLTTNPA--SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            ++  RR+L    A    K + VVAKDGSG++K++ EAL A+P K +  +VI++K G+Y+E
Sbjct  266  NSNERRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDE  325

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V + +KM  +   G+G  K+ I+GS++  DG+ T+ TAT    G+GF+ + IGF N AG
Sbjct  326  TVVITKKMVNVTMYGDGSQKSMISGSKNFVDGVRTFQTATFVALGEGFLGQAIGFRNIAG  385

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
              KHQAVA RV AD  IF NC  + YQDTLY  A+RQ+YR C ITGTIDFIFGDAAA+FQ
Sbjct  386  PEKHQAVAARVQADRAIFVNCRFEGYQDTLYAQAHRQFYRSCLITGTIDFIFGDAAAIFQ  445

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC M++RKPL NQ  +VTAQGR +      +VLQNC I+PD  L++V    K YLGRPWK
Sbjct  446  NCNMMIRKPLDNQQNIVTAQGRTDKHETTGIVLQNCKILPDKTLEAVKSQFKSYLGRPWK  505

Query  13   EYSR  2
            E+SR
Sbjct  506  EFSR  509



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/308 (52%), Positives = 203/308 (66%), Gaps = 13/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTEL-LQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            E M+ LLK + EL++NGLA+      L L +L  P     K +L  A+ K          
Sbjct  177  ETMRQLLKLSRELTTNGLAIANQIHRLFLPNLLAPPVAPTKHQL--ADRKPLSPRG----  230

Query  733  FVDAATRRLLTTNPASIKHDA---VVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
              D+   R L    +  ++D    VVAKDGSG+YK+V EALK VP ++NETFVI +K GV
Sbjct  231  --DSNYYRKLLQMASDRRYDTPNVVVAKDGSGKYKTVTEALKEVPERSNETFVIHVKEGV  288

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYHTATVAIQGDGFIARNIGFE  386
            Y E VE+   M  +V VG+GPTKTRITG +S   DG+GTY TATV I GD FI ++IGFE
Sbjct  289  YEEYVEITSGMWSVVLVGDGPTKTRITGKKSYGGDGLGTYFTATVGIDGDNFIGKDIGFE  348

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AGA  +QAVA+RVSAD  IF+NCHID YQDTLY H +RQYYRDCTI+GTIDFIFG+A 
Sbjct  349  NTAGAIGYQAVALRVSADKAIFYNCHIDGYQDTLYAHNHRQYYRDCTISGTIDFIFGNAR  408

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            A+ QNC ++VRKPL NQAC+VTA GR       A V+    ++  P     +  ++ +LG
Sbjct  409  ALIQNCTLLVRKPLDNQACVVTANGRTLSNETSAFVIHGSRVVAAPEYPVDDKRIQSFLG  468

Query  25   RPWKEYSR  2
            RPWKEYS+
Sbjct  469  RPWKEYSK  476



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/303 (49%), Positives = 199/303 (66%), Gaps = 4/303 (1%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKG-eeqeeEFPGFV  728
            M+   K + EL+SN LAM++  T  ++S   PA LN  RRLL  E       +++ PG++
Sbjct  207  MEKTFKASKELTSNSLAMVSSLTSFMKSFPFPAALN--RRLLAKEDNSPALNKDDLPGWM  264

Query  727  DAATRRLLT-TNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
                RR+L   +    K +  VAKDGSG +K++ EAL A+P K    +VIF+K G+Y+E 
Sbjct  265  SNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEALAAMPAKYEGRYVIFVKQGIYDET  324

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V +KM+ I   G+G  KT +TG+++  DG+ T+ TAT A+ GDGF+ + +GF N+AG 
Sbjct  325  VTVTKKMSNITIYGDGSQKTIVTGNKNFADGVQTFRTATFAVLGDGFLCKAMGFRNTAGP  384

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVAIRV AD  IF NC  + YQDTLY   +RQ+YR C ITGT+DFIFGDA A+FQN
Sbjct  385  EKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFYRSCVITGTVDFIFGDATAIFQN  444

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C + VRKPL+NQ  ++TAQGR +      +VLQNC I PD  L  V   ++ YLGRPWKE
Sbjct  445  CLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCRIEPDKDLVPVKTKIRSYLGRPWKE  504

Query  10   YSR  2
            +SR
Sbjct  505  FSR  507



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 177/235 (75%), Gaps = 1/235 (0%)
 Frame = -2

Query  703  TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKN-NETFVIFIKAGVYNERVEVPRKMN  527
            T  P SIK DAVVAKDGSGQY+++ EA+K +P  N ++TFVI++K GVY+E V + + M 
Sbjct  40   TVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMT  99

Query  526  KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAI  347
             ++ +G+G  KT++TGS++   G+ T+ TATV + GD FIA++IG ENSAGA  HQAVA+
Sbjct  100  NVMLIGDGAXKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVAL  159

Query  346  RVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKP  167
            RV +D++IF+ C +D YQDTLYT  +RQ+YRDCTI+GTIDFIFGDAA VFQNCKM+VRKP
Sbjct  160  RVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKP  219

Query  166  LKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            + NQACMVTAQGR + R    ++LQNC I  DP    V    K YLGRPWK  +R
Sbjct  220  MDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLAR  274



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 202/308 (66%), Gaps = 13/308 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL----NFKRRLLTAETKGeeqeeE  743
            ++M+H+ KT  ELSSN LAM+T  + LL +           N+ R+LLT E       + 
Sbjct  179  QEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTE-------DG  231

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
             P +V    RRL+   P  +K +AVVA+DGSGQ+K++ +AL AVP  N   FVI IK G+
Sbjct  232  IPTWVGREARRLMAA-PGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGI  290

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFE  386
            Y E++ V RKM  + F+G+G TKT ITG+ +   G + T+ TA + I+GD F  +NIG E
Sbjct  291  YKEKIMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPLTIEGDHFTMKNIGVE  350

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AG    QAVA+RVSAD  +FH+C  D +QDTLY H++R ++RDCT++GT+DFIFGDA 
Sbjct  351  NTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRDCTVSGTVDFIFGDAK  410

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
             + QNCK+VVRKP   Q+CMVTAQGR + R    LVL NC I  DPA   V    K YLG
Sbjct  411  CILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLG  470

Query  25   RPWKEYSR  2
            RPWK++SR
Sbjct  471  RPWKQFSR  478



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 201/305 (66%), Gaps = 19/305 (6%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            EKM  L+ T  EL+ N L M+  F +++       GL   R+LL+               
Sbjct  173  EKMAKLMNTTQELTLNVLYMVDSFGQMITQT---TGLT--RKLLSNS----------DSI  217

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            ++A+ R+LL  + A  + +AVV+ DGSGQYK++ +A+ AVP KN + FVI IK G+Y E 
Sbjct  218  IEASNRKLLQISSA--QPNAVVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEGIYKEN  275

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQGDGFIARNIGFENSA  377
            +E+ +    +V +GEGPTKT ITG  + K+G G  T+HT+T+ + G GF+ ++IG +N+A
Sbjct  276  IEIEKDKLNVVLIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIGIQNTA  335

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  K QAVA+RV+AD    +NC ID YQDTLY H+ RQ+YRDC ITGTIDF+FG AAAVF
Sbjct  336  GPEKEQAVALRVNADKAAVYNCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVF  395

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK++VRKP   Q CM+TAQG  + +  G  V+QNCDI  +P   + NP +K YLGRPW
Sbjct  396  QNCKLIVRKPGDTQNCMMTAQGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPW  455

Query  16   KEYSR  2
            K YSR
Sbjct  456  KMYSR  460



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 200/306 (65%), Gaps = 13/306 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLL-TAETKGeeqeeEFP  737
            G KMK LL ++  +SSN LA+I+ F + +        L  +RRLL  +ET         P
Sbjct  188  GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQIL--RRRLLHDSET---------P  236

Query  736  GFVDAATRRL-LTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
              VD   ++     N    K +  VA DGSG +KS+ EAL  VP K+ + FVI+IK GVY
Sbjct  237  SSVDHHHKQHNAKKNVFKHKPNVTVALDGSGDFKSINEALTQVPKKSKKPFVIYIKEGVY  296

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VAIQGD F+A N+GFENS
Sbjct  297  PEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENS  356

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  KHQAVA+RV  D TIF NC +D YQDTLY H  RQ+YRDCTI+GTIDF+FG+A AV
Sbjct  357  AGPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAV  416

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL RP
Sbjct  417  FQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARP  476

Query  19   WKEYSR  2
            WK +SR
Sbjct  477  WKNFSR  482



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 198/328 (60%), Gaps = 26/328 (8%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPA------------------------  806
            GEKMK  L  + ELS NGLA+ T  + +L+ LEI                          
Sbjct  188  GEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQENLPVLGHGDWSTYLDI  247

Query  805  GLNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVE  626
             +  +RRLL           +F   +    RRL+   P+ IK D VVAKDGSG + ++  
Sbjct  248  PMTRRRRLLQDNEPPVLGHGQFE--IQPGVRRLMAAPPSRIKADIVVAKDGSGNFTTINA  305

Query  625  ALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  446
            A+ ++P    + FVI+IK GVY E +E   KM  +  +G+G  KTRITG  +N DG+ T+
Sbjct  306  AMSSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITGHLNNADGVPTF  365

Query  445  HTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYR  266
             TATVA+ GD F A+NIGFENSAGAAK QAVA+ V +D ++F+NC +D YQDTLY H+ R
Sbjct  366  RTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDGYQDTLYVHSKR  425

Query  265  QYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNC  86
            Q+YRDCTITGTIDF+FGDAAAVFQNC  +VR PL  Q C+VTAQGR + R   A+V+QN 
Sbjct  426  QFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPLNGQQCIVTAQGRTDARQPTAIVIQNS  485

Query  85   DIIPDPALKSVNPPVKVYLGRPWKEYSR  2
                 P L  V      YLGRPW  +SR
Sbjct  486  TFTAAPELVPVKDKYPTYLGRPWGNFSR  513



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 202/305 (66%), Gaps = 11/305 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             +KMKHLL ++  +SSN LA++++F + +  + +     F R LL        Q+ E P 
Sbjct  174  SKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL--FGRCLL--------QDSEIPS  223

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET-FVIFIKAGVYN  557
            +V+        TN +  K +  VA DGSG +KS+ EALK VP + +ET FVI+IK GVY 
Sbjct  224  WVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYR  283

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQ D F A N+GFENSA
Sbjct  284  EYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSA  343

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  KHQAVA+RV  D  IF NC +D YQDTLY HA RQ+YRDCTI+GTIDF+FG+A +VF
Sbjct  344  GPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVF  403

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL  PW
Sbjct  404  QNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPW  463

Query  16   KEYSR  2
            K +SR
Sbjct  464  KNFSR  468



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 186/267 (70%), Gaps = 8/267 (3%)
 Frame = -2

Query  799  NFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEAL  620
            N  R+LL AE         FP +V   TRRL+      +K + VVAKDGSGQYKS+ EAL
Sbjct  25   NNARKLLYAED-------GFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEAL  77

Query  619  KAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYH  443
            KAVP  N   FVI+IK GVY E+V V ++M  + F+G+GPTKT+ITGS +   G + TY 
Sbjct  78   KAVPINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFGIGKVRTYL  137

Query  442  TATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQ  263
            T+++ ++GD F+A+N+G EN+AG    QA A+RVSAD  +  NC ID YQDTLY H++RQ
Sbjct  138  TSSLTVEGDNFVAKNMGIENTAGPPGGQAAALRVSADCVVIFNCQIDGYQDTLYVHSHRQ  197

Query  262  YYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCD  83
            +YRD TI+GT+DFIFGD+ A+FQNC +VVRKP+  Q CMVTAQGR + R   A+VL NC 
Sbjct  198  FYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVREPTAIVLHNCR  257

Query  82   IIPDPALKSVNPPVKVYLGRPWKEYSR  2
            II +PA   V    K YLGRPWKE++R
Sbjct  258  IIGEPAYLPVKNINKAYLGRPWKEFAR  284



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   300 bits (769),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 206/304 (68%), Gaps = 9/304 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
            G+ M  +L  + ELS+N + ++      ++ L + +  +   R L +E          P 
Sbjct  186  GQTMAKVLNASLELSNNAMDIVNGVAGFVKGLNLSSLTSAMSRKLLSED-------GIPS  238

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
            +V  + RRLL   P  +  + +VA+DGSGQ+K++ EAL+ VP KN   FVI++KAGVYNE
Sbjct  239  WVGQSQRRLLEA-PHDVTPNVIVAQDGSGQFKTLNEALELVPKKNKIPFVIYVKAGVYNE  297

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V + +  + +  +G+GPTKT  TG+++  DG+ TY+TAT +I    F+A N+GFENSAG
Sbjct  298  YVALDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQTYNTATFSINAADFMAINVGFENSAG  357

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A KHQAVA+RV+AD  +F+NC +D +QDTLYT + RQ+YRDCT++GTIDFIFGDAA VFQ
Sbjct  358  AEKHQAVALRVTADKAVFYNCQMDGFQDTLYTQSKRQFYRDCTVSGTIDFIFGDAAGVFQ  417

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NCK++V+KP++NQ CMVTA GR +     ALV QNC    +P + ++ P +  YLGRPW+
Sbjct  418  NCKLIVKKPMENQQCMVTAGGRTKVDSPTALVFQNCHFTGEPDVVALKPKIS-YLGRPWR  476

Query  13   EYSR  2
            EYS+
Sbjct  477  EYSK  480



>ref|XP_011015792.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45 [Populus euphratica]
Length=593

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 197/303 (65%), Gaps = 4/303 (1%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKG-eeqeeEFPGFV  728
            M+   K + E +SN LAM++  T  +++   P  LN  RRLL  E       +++ PG++
Sbjct  207  MEKTFKASKEFTSNSLAMVSSLTSFMKNFPFPGALN--RRLLAKEDNSPALNKDDLPGWM  264

Query  727  DAATRRLLT-TNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
                RR+L   +    K +  VAKDGSG +K++ EAL A+P K    +VIF+K G+Y+E 
Sbjct  265  SNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEALAAMPAKYQGRYVIFVKQGIYDET  324

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V +KM  I   G+G  KT +TG+++  DG+ T+ TAT A+ GDGF+ + +GF N+AG 
Sbjct  325  VTVTKKMANITIYGDGSQKTIVTGNKNFADGVQTFRTATFAVXGDGFLCKTMGFRNTAGP  384

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVAIRV AD  IF NC  + YQDTLY   +RQ+YR C ITGT+DFIFGDAAA+FQN
Sbjct  385  EKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFYRSCVITGTVDFIFGDAAAIFQN  444

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C + VRKPL+NQ  ++TAQGR +      +VLQNC I PD  L  V   ++ YLGRPWKE
Sbjct  445  CLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCRIEPDKDLVPVKTKIRSYLGRPWKE  504

Query  10   YSR  2
            +SR
Sbjct  505  FSR  507



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 203/311 (65%), Gaps = 10/311 (3%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETK-----Geeqe  749
            G+KM+  L+TA  ++SNGLA+I+  ++ L  + +       RRLLTA         E  +
Sbjct  184  GKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKS---GRRLLTAADDLPVLGHETDD  240

Query  748  eEFPGFVDA--ATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
             + P +V++    RRLL           VVAKDGSG + ++ +ALK VP KN   F+I+I
Sbjct  241  FDLPDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFIIYI  300

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  395
            K GVY+E VEV R M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+A  +
Sbjct  301  KEGVYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGVGTYKTASAAIIGDFFVAIGM  360

Query  394  GFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFG  215
            GFEN+AGA KHQAVA+RV +D +IF+ C +D YQDTLY HA RQ+YRDC I+GTIDF+FG
Sbjct  361  GFENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHAMRQFYRDCIISGTIDFVFG  420

Query  214  DAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKV  35
            DA AV QNC   VRKP+ NQ C+VTAQGRKE      +++    I+ DP+   V    K 
Sbjct  421  DAVAVLQNCTFEVRKPMANQQCIVTAQGRKERNQPSGIIIHGGSIVSDPSYYPVRFDNKA  480

Query  34   YLGRPWKEYSR  2
            YL RPWK +SR
Sbjct  481  YLARPWKNFSR  491



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 200/281 (71%), Gaps = 2/281 (1%)
 Frame = -2

Query  838  TELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPAS-IKHDAVVA  662
            + +++ L+    LN  R+  +   +   +E EFP +V   +RRLL   P + I+ + VVA
Sbjct  326  SSIIRPLDPLRKLNTLRKFDSPNDRHLSEEGEFPPWVTLHSRRLLARRPTNGIRANVVVA  385

Query  661  KDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRIT  482
            KDGSG++K++ +AL  VP +N   FVI IK GVY E+VEV +KM  ++FVG+GPTKT IT
Sbjct  386  KDGSGKFKTIAQALAMVPMQNKRKFVIHIKQGVYKEKVEVTKKMLNVMFVGDGPTKTIIT  445

Query  481  GSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHI  305
            G  +   + +GT+ TATVA+ GD F+A+++GFEN+AGAA+HQAVA+RVSAD  +F NCH+
Sbjct  446  GDIAFLPNRVGTFRTATVAVNGDYFMAKDVGFENTAGAARHQAVALRVSADFAVFFNCHM  505

Query  304  DAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRK  125
            + YQDTLY H +RQ+YRDC I+GTIDFIFGDA AVFQNC  V+R+P+ NQ C+VTAQGRK
Sbjct  506  NGYQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRK  565

Query  124  EHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
            + R    +V+ N  II D +   V    + +LGRPWKEYSR
Sbjct  566  DRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSR  606



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 209/315 (66%), Gaps = 23/315 (7%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGL-----NFKRRLLTAETKGeeqee  746
            + M  + KT+ ELSSN LAM+T  + +L +  I  GL     N+ R+LL+ +        
Sbjct  177  QDMLKIFKTSRELSSNSLAMVTDLSTILPNSNI-TGLTGTLANYARKLLSTKD-------  228

Query  745  EFPGFVDAATRRLLTTNPAS---IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFI  575
              P +V    RRL+         +K +AVVA+DGSGQ+K++ +AL AVP  N   FVI I
Sbjct  229  GIPTWVGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIADALNAVPKDNRLPFVIHI  288

Query  574  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARN  398
            K G+Y E+V V +KM  + F+G+GPTKT+ITGS +   G + T+ TATV I G+ F A+N
Sbjct  289  KQGIYKEKVIVTKKMPYVTFIGDGPTKTKITGSLNFGLGKVKTFLTATVTIDGEHFTAKN  348

Query  397  IGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIF  218
            I  EN+AG    QAVA+RVSAD  +F++C ID YQDTLY H+ RQ+YRDCT++GT+DFIF
Sbjct  349  IWIENTAGPEGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIF  408

Query  217  GDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPA---LKSVNP  47
            GDA  + QNCK+VVRKP   Q+CMVTAQGR + R    LVL NC I+ +PA   +KSVN 
Sbjct  409  GDAKCILQNCKIVVRKPKGGQSCMVTAQGRTDVRESTGLVLHNCHIVGEPAYIPVKSVN-  467

Query  46   PVKVYLGRPWKEYSR  2
              K YLGRPWK++SR
Sbjct  468  --KAYLGRPWKKFSR  480



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 202/305 (66%), Gaps = 11/305 (4%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPG  734
             +KMKHLL ++  +SSN LA++++F + +  + +     F R LL        Q+ E P 
Sbjct  174  SKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL--FGRCLL--------QDSEIPS  223

Query  733  FVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNET-FVIFIKAGVYN  557
            +V+        TN +  K +  VA DGSG +KS+ EALK VP + +ET FVI+IK GVY 
Sbjct  224  WVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYR  283

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQ D F A N+GFENSA
Sbjct  284  EYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSA  343

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            G  KHQAVA+RV  D  IF NC +D YQDTLY HA RQ+YRDCTI+GTIDF+FG+A +VF
Sbjct  344  GPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVF  403

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNCK VVRKP+ NQ C+VTAQGRKE     A+V+Q   I+ DP    V    K YL  PW
Sbjct  404  QNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPW  463

Query  16   KEYSR  2
            K +SR
Sbjct  464  KNFSR  468



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 196/305 (64%), Gaps = 13/305 (4%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            EKMK+ LK++ EL+ N LA++  F + L +L++P+   F RRLL  +          PG+
Sbjct  175  EKMKNALKSSQELTENILALVDQFGDTLANLDLPS---FSRRLLGDD--------GLPGW  223

Query  730  VDAATRRLLTTNPAS--IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
            +  A RRLL  +P +   K D  VA DGSG +K++ EAL  VP K   T+V+++KAG Y 
Sbjct  224  ISDAKRRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPIKATATYVMYVKAGTYK  283

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E V V R +  +V +G+G TKT ITG++S    I T  TAT+   G+GF  R IG EN+A
Sbjct  284  EYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEAIGNGFFMRGIGVENTA  343

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA  HQAVA+RV +D ++F+ C  D YQDTLYTH  RQYYR+CTITGTIDFIFG+A  VF
Sbjct  344  GAKNHQAVALRVQSDQSVFYQCQFDGYQDTLYTHTSRQYYRECTITGTIDFIFGNAQVVF  403

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC +  R+ + NQ  +VTAQGRKE    G  V+ NC I P    K+     + +LGRPW
Sbjct  404  QNCLIQARRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHADFKADAAKFRTFLGRPW  463

Query  16   KEYSR  2
            KEYSR
Sbjct  464  KEYSR  468



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 200/310 (65%), Gaps = 15/310 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLN-----FKRRLLTAETKGeeqee  746
            +KM+ +LKT+ E++SN LAM+   + +++ L IP   N     F R+LL+ E        
Sbjct  170  QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLLSTED-------  222

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
                ++  A R+LL   P  +K + VVAKDGSG+Y ++ +AL  VP K+ + FVI IKAG
Sbjct  223  -MLEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAG  281

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TATV + G GF+A++IG
Sbjct  282  TYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIG  341

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            F+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y +C ITGT+DFIFGD
Sbjct  342  FDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGD  401

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            AA++FQNC ++VRKP   Q CMVTAQGR +     A+VLQNC I   P   SV    K Y
Sbjct  402  AASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAY  461

Query  31   LGRPWKEYSR  2
            LGRPWK+++R
Sbjct  462  LGRPWKQFAR  471



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 193/269 (72%), Gaps = 2/269 (1%)
 Frame = -2

Query  802  LNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPA-SIKHDAVVAKDGSGQYKSVVE  626
            LN  R+  ++  +   +E EFP +V   +RRLL   P  SI+ + VVAKDGSG+ K++ +
Sbjct  338  LNPLRKFDSSNDRHLSEEGEFPPWVTLHSRRLLARRPTNSIRANVVVAKDGSGKCKTIAQ  397

Query  625  ALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGT  449
            AL  VP KN   FVI IK GVY E VEV +KM  ++FVG+GPTKT ITG  +   + +GT
Sbjct  398  ALAMVPMKNKRKFVIHIKQGVYKETVEVTKKMLNVMFVGDGPTKTIITGDIAFLPNRVGT  457

Query  448  YHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAY  269
            + TATVA+ GD F+A++IGFEN+AGAA+HQAVA+RVSAD  +F NCH++ YQDTLY H +
Sbjct  458  FRTATVAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTH  517

Query  268  RQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQN  89
            RQ+YRDC I+GTIDF+FGDA AVFQNC  V+R+P+ NQ C+VTAQGRK+ R    +V+ N
Sbjct  518  RQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHN  577

Query  88   CDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
              II D +   V    + +LGRPWKEYSR
Sbjct  578  SRIIGDASYLPVKAKNRAFLGRPWKEYSR  606



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   298 bits (763),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 195/305 (64%), Gaps = 13/305 (4%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFV  728
            KM+  L T+ EL+ N LA++  F+E L SL +P+   F RRLL             P ++
Sbjct  173  KMRRALNTSQELTENILALVDEFSETLASLGLPS---FHRRLLAGNGGA-------PSWM  222

Query  727  -DAATRRLLTTNPAS--IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYN  557
             D A RR+L   P S   K D  VA DGSG +K++  AL  VP K+   +V+++KAG Y 
Sbjct  223  TDDAKRRVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVPTKSATAYVMYVKAGTYK  282

Query  556  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  377
            E V VPR +  +V VG+G TKT +TGS+S    I T  TAT+ + G+GF  R +G EN+A
Sbjct  283  EYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNITTKDTATMEVIGNGFQMRGVGVENTA  342

Query  376  GAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVF  197
            GA  HQAVA+RV +DM+ F+ C  D YQDTLYTH  RQYYRDC +TGTIDFIFG+A  VF
Sbjct  343  GARNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCVVTGTIDFIFGNAQVVF  402

Query  196  QNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPW  17
            QNC + VRK + NQ  +VTAQGRKE R  G  V+ NC + P P  +S    +K YLGRPW
Sbjct  403  QNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTVEPHPEFESSAGRLKTYLGRPW  462

Query  16   KEYSR  2
            KE+SR
Sbjct  463  KEHSR  467



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   298 bits (762),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 201/307 (65%), Gaps = 17/307 (6%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHF----TELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFP  737
            M ++ K + +LSSN LAM+T      TEL  + E     N  R+LL+ E  G       P
Sbjct  179  MINIFKRSRQLSSNSLAMVTDLNSNATELTGAFE-----NNARKLLSTEEDG------VP  227

Query  736  GFVDAATRRLL-TTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
             +V    RRL+       +K +AVVA+DGSGQ+K++ +AL AVP +N   FVI IK GVY
Sbjct  228  TWVGPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVY  287

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFEN  383
             E+V V RKM  + F+G+GPTKT ITGS +   G + TY TA + ++G+ F A+ IG EN
Sbjct  288  KEKVVVTRKMPYVTFIGDGPTKTVITGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMEN  347

Query  382  SAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAA  203
            +AG    QAVA+RVS D  +F +C ID YQDTLY H+ RQ+YRDCT++GT+DFIFGD+  
Sbjct  348  TAGPEGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQC  407

Query  202  VFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGR  23
            + QNCK+VVRKP+  Q+CMVTAQGR + R    +VL NC I+ DPA   V    K YLGR
Sbjct  408  ILQNCKIVVRKPMAGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGR  467

Query  22   PWKEYSR  2
            PWKE+SR
Sbjct  468  PWKEFSR  474



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   299 bits (765),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 201/303 (66%), Gaps = 7/303 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            +KM+ LL T+ EL SN LA++T  + + ++L      + +RRLL ++          P +
Sbjct  215  DKMQKLLNTSKELGSNALAVVTQASAIFKALR--GSKSSERRLLASDD-----GFVVPDW  267

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            VD  +RR+L +  +    +A VAKDG+G + ++  AL A+P K    +VI+IK G+Y+E 
Sbjct  268  VDPESRRVLKSKESKFTPNATVAKDGTGNFTTIAAALDAIPEKFKGRYVIYIKEGIYDES  327

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V +KM  I   G+G  K+ ITG+++  DG+ TY TAT A+ GDGF+ +++GF N+AG 
Sbjct  328  VVVSKKMQNITMYGDGSQKSIITGNKNYVDGVPTYQTATFAVVGDGFLGQSLGFRNTAGP  387

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
             KHQAVA+RV +D +IF NC ++ YQDTLY   +RQ+YR C I GT+DFIFGDAAAVFQN
Sbjct  388  EKHQAVALRVQSDRSIFVNCRMEGYQDTLYAQTHRQFYRSCYIRGTVDFIFGDAAAVFQN  447

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C + V KPL+NQ  +VTAQGR + R    +VLQNC I+ D  L+ V    + YLGRPWKE
Sbjct  448  CMIYVTKPLENQKNVVTAQGRIDKRQTTGIVLQNCKILADDQLEPVKARFQTYLGRPWKE  507

Query  10   YSR  2
            YSR
Sbjct  508  YSR  510



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 202/305 (66%), Gaps = 9/305 (3%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVD  725
            M   +K A +L+SN LA+IT  + +L  L++P    F RRLL+ E    E +  FP +  
Sbjct  204  MAEAMKMATQLTSNSLAIITEASSVLSILKVPG---FSRRLLSKENHFSEGKGGFPSWFP  260

Query  724  AATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVP--YKNNETFVIFIKAGVYNER  551
            A  RRLL      +  +  VAKDGSG ++++ EAL  +P   + N  +VI+IKAGVY+E+
Sbjct  261  AGERRLLAMQ--EMTPNVAVAKDGSGDFRTITEALSKLPPAKERNGRYVIYIKAGVYDEQ  318

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V V ++M  +   G+G  KT ITGS++  DG  T+ TAT A  GD F+A+ IGF N+AGA
Sbjct  319  VTVTKEMVNVTMYGDGSRKTIITGSKNFIDGTPTFKTATFAAIGDDFMAKAIGFRNTAGA  378

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
            AKHQAVA+RV +D  +F NC +D  QDTLY HA+RQYYR C ITGTIDFIFG+AAAVFQN
Sbjct  379  AKHQAVALRVQSDRAVFLNCRMDGNQDTLYAHAHRQYYRSCVITGTIDFIFGNAAAVFQN  438

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPAL--KSVNPPVKVYLGRPW  17
            C++VVR+PL NQ  ++TAQGR + R    +V+  C I+PD  L   S     + YLGRPW
Sbjct  439  CQIVVRQPLPNQQNIITAQGRTDKRETTGVVIHKCKILPDKKLVAGSSTAKTRSYLGRPW  498

Query  16   KEYSR  2
            K+YSR
Sbjct  499  KQYSR  503



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 199/309 (64%), Gaps = 25/309 (8%)
 Frame = -2

Query  913  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNF-----KRRLLTAETKGeeqe  749
            G++M+ LL  + ++SSN LAM+T    +L S    +         +RRLL+ +       
Sbjct  176  GDRMRDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSRRRRLLSEKDD-----  230

Query  748  eEFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKA  569
               P                 +K D +VAKDGSG +K++ EAL  VP  + +TFV++IK 
Sbjct  231  --LPKL-------------NIMKPDLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIKE  275

Query  568  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  389
            G+Y E+V++      ++ VG+GP KTRITG  +  +G  TY +ATVA+ GD F A ++GF
Sbjct  276  GIYEEQVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTTTYQSATVAVHGDRFTAMDVGF  335

Query  388  ENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDA  209
            EN+AG   HQAVA+RVSAD+ +F+NCH+D YQDTLY H YRQ+YRDCTI+GTID+IFGDA
Sbjct  336  ENAAGPEGHQAVALRVSADLAVFYNCHMDGYQDTLYAHTYRQFYRDCTISGTIDYIFGDA  395

Query  208  AAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYL  29
            AA+FQ C MVVRKPL NQ C+VTAQGRK+      LVLQNC ++ DPA   V    K YL
Sbjct  396  AALFQGCTMVVRKPLANQYCIVTAQGRKDVHQPTGLVLQNCSVVGDPAYYPVMDVNKAYL  455

Query  28   GRPWKEYSR  2
             RPWK YSR
Sbjct  456  ARPWKLYSR  464



>ref|XP_006414405.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
 gb|ESQ55858.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
Length=684

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 180/248 (73%), Gaps = 1/248 (0%)
 Frame = -2

Query  742  FPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGV  563
            FP +V + +RRLL      I  + VVAKDGSG+ K++ +AL  VP +N   FVI IK GV
Sbjct  352  FPRWVTSHSRRLLAAPAKRINANVVVAKDGSGKCKTIAQALAMVPMRNTRKFVIHIKQGV  411

Query  562  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFE  386
            Y E VEV +KM  +VFVG+GPTKT ITG  +   + +GTY TATVA+ GD F+A++IGFE
Sbjct  412  YKETVEVTKKMANVVFVGDGPTKTIITGDIAFLPNRVGTYRTATVAVNGDYFMAKDIGFE  471

Query  385  NSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAA  206
            N+AGAA+HQAVA+RVSAD  +F NCH++ YQDTLY H +RQ+YRDC I+GTIDF+FGDA 
Sbjct  472  NTAGAARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAK  531

Query  205  AVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLG  26
            AVFQNC+ V+R+P+ NQ C+VTAQGRK+ R    +V+ N  I  D     V    + +LG
Sbjct  532  AVFQNCEFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRITGDATYLPVKAKNRAFLG  591

Query  25   RPWKEYSR  2
            RPWKEYSR
Sbjct  592  RPWKEYSR  599



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 199/302 (66%), Gaps = 4/302 (1%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeE-FPGFV  728
            M+   K+A EL+SN LA+++  T +L S ++  G N  R LL  E+ G        P ++
Sbjct  209  MEKTFKSAKELTSNALAIVSKVTSILSSFDL-TGAN--RHLLAQESSGPSLANNGLPIWM  265

Query  727  DAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERV  548
                RR+L    +++  +AVVAKDGSG + ++  AL A+P K    +VI++K GVY+E V
Sbjct  266  TREDRRVLKPKESNLTPNAVVAKDGSGNFTTISAALAAMPPKYPGRYVIYVKEGVYDETV  325

Query  547  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  368
             V RKM  +   GEG  KT +TG+++  DG+ T+ TA+    GDGF+A ++GF N+AG  
Sbjct  326  TVERKMQNVTMYGEGSRKTIVTGNKNFVDGVRTFQTASFVALGDGFVAVSMGFRNTAGPE  385

Query  367  KHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNC  188
            KHQAVAIRV +D +IF NC +D YQDT+Y   +RQ++R C ITGTIDFIFGDA+A+FQNC
Sbjct  386  KHQAVAIRVQSDRSIFLNCRMDGYQDTVYAQTHRQFFRGCVITGTIDFIFGDASAIFQNC  445

Query  187  KMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEY  8
             + VRKPL NQ  +VTAQGR + R    +VLQNC I+PD  L      VK YLGRPWKE+
Sbjct  446  LITVRKPLDNQQNIVTAQGRTDKRETTGIVLQNCRILPDQDLIPTKTQVKSYLGRPWKEF  505

Query  7    SR  2
            SR
Sbjct  506  SR  507



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 199/310 (64%), Gaps = 15/310 (5%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLN-----FKRRLLTAETKGeeqee  746
            +KM+ +LKT+ E++SN LAM+   + +++ L IP   N     F R+LL+ E        
Sbjct  170  QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLLSTED-------  222

Query  745  EFPGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAG  566
                ++  A R+LL   P  +K + VVAKDGSG+Y ++ +AL  VP K+ + FVI IKAG
Sbjct  223  -MLEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAG  281

Query  565  VYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTATVAIQGDGFIARNIG  392
             Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TATV + G GF+A++IG
Sbjct  282  TYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIG  341

Query  391  FENSAGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGD  212
            F+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y +C ITGT+DFIFGD
Sbjct  342  FDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGD  401

Query  211  AAAVFQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVY  32
            AA++FQNC ++VRKP   Q CMVTAQGR +     A+VLQNC I   P    V    K Y
Sbjct  402  AASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYIPVKDTNKAY  461

Query  31   LGRPWKEYSR  2
            LGRPWK+++R
Sbjct  462  LGRPWKQFAR  471



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 192/304 (63%), Gaps = 13/304 (4%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFV  728
            KMK  L  + EL+ N L+++  F + L +LE+P   N  RRLL  +          PG++
Sbjct  175  KMKKALNASQELTENILSIVDEFGDTLANLELP---NLSRRLLGDD--------GVPGWM  223

Query  727  DAATRRLLTTNPAS--IKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNE  554
                RRLL   P+    K D  VA DGSG YK++ EAL  VP K+ +TFV++IKAG Y E
Sbjct  224  SDTKRRLLQAKPSEPEFKPDITVASDGSGDYKTINEALAKVPLKSADTFVMYIKAGTYKE  283

Query  553  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  374
             V V R +  +V +G+G +KT ITG +S    I T  T+T+   G+GF  R IG EN+AG
Sbjct  284  YVSVARNVTNLVMIGDGASKTIITGDKSFMLNITTKDTSTMEAIGNGFFMRGIGVENTAG  343

Query  373  AAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQ  194
            A  HQAVA+RV +D ++F+ C  D YQDTLYTH  RQYYRDCT+TGTIDFIFG+A  VFQ
Sbjct  344  AKNHQAVALRVQSDQSVFYECQFDGYQDTLYTHTSRQYYRDCTVTGTIDFIFGNAQVVFQ  403

Query  193  NCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWK  14
            NC + VR+ + NQ  ++TAQGRKE    G  V+ NC I P P  K     ++ +LGRPWK
Sbjct  404  NCLIQVRRCMDNQQNIITAQGRKEKHSAGGTVILNCTIEPHPEFKEHAGRLRTFLGRPWK  463

Query  13   EYSR  2
            EYSR
Sbjct  464  EYSR  467



>gb|KFK22175.1| hypothetical protein AALP_AAs39369U000100 [Arabis alpina]
Length=687

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 201/294 (68%), Gaps = 11/294 (4%)
 Frame = -2

Query  865  NGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTNPA-  689
            N  + +    + L++L   A LN  R++     K     EEFP ++ + +RRLL      
Sbjct  340  NADSSVIRPLDPLRALNPLAKLNPLRKI-----KDRHLSEEFPPWLGSHSRRLLQARGRG  394

Query  688  ----SIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKI  521
                +I+ +AVV+KDGSG++K++ +AL  VP  N   FVI IK GVY E VEV +KM  +
Sbjct  395  RRGNNIRANAVVSKDGSGRFKTIAQALAMVPKNNRRKFVIHIKQGVYKETVEVTKKMLNV  454

Query  520  VFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIR  344
            +FVG+GPTKT ITG+ +   D IGTY TATVA+ GD F+A++IGFEN+AGAA+HQAVA+R
Sbjct  455  MFVGDGPTKTIITGNIAFLPDRIGTYRTATVAVNGDNFMAKDIGFENTAGAARHQAVALR  514

Query  343  VSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPL  164
            VSAD  +F NC +D YQDTLY H +RQ+YRDC I+GTIDF+FGDA AVFQNC  V+R+P+
Sbjct  515  VSADFAVFFNCRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCDFVIRRPM  574

Query  163  KNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
             NQ C+VTAQGRK+ R    +V+ N  II D   + V    + +LGRPWKE+SR
Sbjct  575  DNQQCIVTAQGRKDRRETTGIVIHNSRIIGDATYRPVKAKNRAFLGRPWKEFSR  628



>ref|XP_003534837.2| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=490

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 196/303 (65%), Gaps = 7/303 (2%)
 Frame = -2

Query  910  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPAGLNFKRRLLTAETKGeeqeeEFPGF  731
            +KM   + ++ ELSSN L M    + +L          F RRLL+ E       + F  +
Sbjct  64   QKMAMAMSSSLELSSNALDMTDTISRMLNGFRPKI---FNRRLLSEE---ATVVDGFLSW  117

Query  730  VDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNER  551
            V+   RR L     S+K +AVVA+DGSGQ+K++ EALK VP  N++ FVI +KAGVY E 
Sbjct  118  VNEGQRRFLQVALGSVKPNAVVAQDGSGQFKTLTEALKTVPANNDKPFVIQVKAGVYKEI  177

Query  550  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  371
            V+V   M  +  +GEG TKT+ TGS +  DG  T  +AT A+ G  F+A++IGFEN+AG+
Sbjct  178  VKVTNTMTHVTIIGEGATKTKFTGSLNFVDGSTTLESATFAVNGANFMAKDIGFENTAGS  237

Query  370  AKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQN  191
            +K QAVA+ V+AD  +F+NC +D +QDTL+  + RQ+YRDCTI+GTIDFIFGDA AVFQN
Sbjct  238  SKQQAVALLVTADQAVFYNCQMDGFQDTLFAQSQRQFYRDCTISGTIDFIFGDAFAVFQN  297

Query  190  CKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKE  11
            C+++VR PLK   CMVTA GR +     ALV Q+C    +P L S  P +  +LGRPW  
Sbjct  298  CQLIVRNPLKGARCMVTAGGRVKANSASALVFQSCHFTGEPELASAEPKL-AFLGRPWMP  356

Query  10   YSR  2
            YS+
Sbjct  357  YSK  359



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   305 bits (780),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 211/339 (62%), Gaps = 37/339 (11%)
 Frame = -2

Query  907  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPA---------------------GLNF-  794
            K++ +L+T+ E+SSNGLA++   + L  +L+I +                     G N  
Sbjct  171  KVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATYKVHRRLFGDDDGNNVL  230

Query  793  ---------KRRLL-TAETKG-eeqeeEFPGFVDAATRRLLT----TNPASIKHDAVVAK  659
                     +R+LL T    G    +   P +VD   R+LL     T+    K + VVA+
Sbjct  231  LSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASPMLTDDLKAKANVVVAQ  290

Query  658  DGSGQYKSVVEALKAVPYKNNETFVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG  479
            DGSG++K++ EA+K +P    ETF+I+IK GVYNE + + + M  +VFVG+GPTKTRIT 
Sbjct  291  DGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMTNVVFVGDGPTKTRITN  350

Query  478  SRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAIRVSADMTIFHNCHIDA  299
            +++  DG  T+ TAT+++ GD F+A++IG ENSAGA KHQAVA R  +D +IF NCH D 
Sbjct  351  NKNYADGTKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAFRAQSDKSIFFNCHFDG  410

Query  298  YQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAVFQNCKMVVRKPLKNQACMVTAQGRKEH  119
            YQDTLYTH YRQ+YRDC ITGTIDFIFGDAA  FQNC  VVRKPL+NQ C+VTAQGR E 
Sbjct  411  YQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLENQNCIVTAQGRMER  470

Query  118  RGVGALVLQNCDIIPDPALKSVNPPVKVYLGRPWKEYSR  2
                 +++ N     DP    V    K YLGRPWKEYS+
Sbjct  471  HQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSK  509



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   296 bits (758),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 199/306 (65%), Gaps = 17/306 (6%)
 Frame = -2

Query  904  MKHLLKTANELSSNGLAMITHFTELLQSLEIP-----AGLNFKRRLLTAETKGeeqeeEF  740
            ++ +L+T+ E +SN LAM++    LL  L++P     AG N  RRLL+ +  G      F
Sbjct  217  LEKMLQTSKEFTSNSLAMLS----LLNQLQLPSTGAAAGSN--RRLLSQDKSG------F  264

Query  739  PGFVDAATRRLLTTNPASIKHDAVVAKDGSGQYKSVVEALKAVPYKNNETFVIFIKAGVY  560
            P ++    RR+L  N   +  +  VAKDGSG YK++ EAL+ +P K    +VI++K GVY
Sbjct  265  PNWMSHEDRRMLKKNDKKLTPNVTVAKDGSGNYKTISEALEKMPQKYEGRYVIYVKEGVY  324

Query  559  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  380
             E V V +KM  +   G+G  K+ ITG+++  DG+ T+ TA  A  G+GF+A+++GF N+
Sbjct  325  XETVTVTKKMPNVTMYGDGSQKSIITGNKNXADGVRTFQTAPFAALGEGFMAKSMGFRNT  384

Query  379  AGAAKHQAVAIRVSADMTIFHNCHIDAYQDTLYTHAYRQYYRDCTITGTIDFIFGDAAAV  200
            AG  K QAVA RV AD  IF NC  + YQ+TLY   +RQ+Y+ C I+GT+DFIFGDAAA+
Sbjct  385  AGPEKRQAVAARVQADRAIFLNCRFEGYQETLYAQTHRQFYKSCXISGTVDFIFGDAAAI  444

Query  199  FQNCKMVVRKPLKNQACMVTAQGRKEHRGVGALVLQNCDIIPDPALKSVNPPVKVYLGRP  20
            FQNC + VRKPL+NQ   VTAQGR + R    +VLQNC I+PD  L+ V    K YLGRP
Sbjct  445  FQNCLIYVRKPLENQQNTVTAQGRTDKRETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRP  504

Query  19   WKEYSR  2
            WKE+SR
Sbjct  505  WKEFSR  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1944606558024