BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i6 len=2691 path=[31329:0-343 25007:344-369 25033:370-1432
26095:1433-1533 26196:1534-1593 15876:1594-1669 47072:1670-1693
49376:1694-1707 49390:1708-1711 49394:1712-1712 49395:1713-1717
47119:1718-1741 26397:1742-1767 44013:1768-1780 49435:1781-1783
49438:1784-1872 14227:1873-1901 14256:1902-1903 14258:1904-1913
26565:1914-1946 49538:1947-1951 40162:1952-1956 40167:1957-1957
8444:1958-1984 48131:1985-1985 26637:1986-1997 26649:1998-2009
2887:2010-2033 49607:2034-2045 2923:2046-2054 2932:2055-2068
49666:2069-2092 49690:2093-2095 16861:2096-2118 16884:2119-2146
15953:2147-2176 15983:2177-2202 40407:2203-2264 44349:2265-2344
40547:2345-2397 9137:2398-2442 9182:2443-2448 40649:2449-2478
12399:2479-2515 50076:2516-2519 12440:2520-2545 12466:2546-2549
12470:2550-2597 12518:2598-2627 12548:2628-2690]

Length=2691
                                                                      Score     E

ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     491   9e-160   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          488   2e-158   
emb|CDO98832.1|  unnamed protein product                                484   9e-157   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     478   1e-154   
emb|CDO98833.1|  unnamed protein product                                475   1e-153   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    475   2e-153   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     474   4e-153   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     468   8e-151   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     455   6e-146   
emb|CDO98834.1|  unnamed protein product                                447   1e-142   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     427   5e-135   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    425   7e-134   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 424   1e-133   Ricinus communis
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     423   2e-133   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                421   2e-132   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     419   1e-131   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     417   3e-131   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     416   1e-130   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     414   5e-130   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     415   8e-130   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          412   3e-129   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     412   3e-129   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    414   2e-128   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    409   1e-127   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    400   3e-127   Petunia integrifolia [violet-flowered petunia]
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    407   3e-127   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                407   4e-127   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     405   2e-126   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         404   6e-126   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    404   1e-125   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                403   1e-125   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     402   2e-125   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    403   2e-125   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     401   2e-125   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    401   7e-125   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    401   7e-125   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     400   7e-125   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     399   1e-124   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     399   2e-124   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     398   5e-124   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    402   7e-124   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     397   1e-123   
gb|EPS70728.1|  pectinesterase                                          397   1e-123   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     397   2e-123   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     399   2e-123   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    397   3e-123   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    396   5e-123   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     394   3e-122   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    394   4e-122   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                393   6e-122   
gb|EPS59322.1|  pectinesterase                                          392   7e-122   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                393   8e-122   
gb|EPS72184.1|  pectinesterase family protein                           392   1e-121   
emb|CDY19737.1|  BnaA09g03900D                                          390   2e-121   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    392   3e-121   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    393   4e-121   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    395   4e-121   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    392   4e-121   
ref|XP_002314364.1|  putative pectinesterase family protein             390   1e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    392   1e-120   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    389   6e-120   
emb|CBI39537.3|  unnamed protein product                                394   1e-119   
emb|CDX99968.1|  BnaC09g03330D                                          391   1e-119   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    388   2e-119   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             387   4e-119   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             390   6e-119   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    389   6e-119   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    390   7e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    388   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             390   1e-118   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    386   1e-118   
gb|AEL79481.1|  pectin methylesterase-like protein                      384   2e-118   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             384   2e-118   
ref|XP_002872255.1|  pectinesterase family protein                      386   2e-118   
ref|XP_002884519.1|  pectinesterase family protein                      387   4e-118   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    384   4e-118   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                382   5e-118   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                394   6e-118   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     382   6e-118   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    382   2e-117   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    384   2e-117   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    382   2e-117   
dbj|BAC42986.1|  putative pectinesterase                                384   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    381   3e-117   
emb|CDY27751.1|  BnaA05g31600D                                          382   3e-117   
emb|CDY05188.1|  BnaC05g46150D                                          382   4e-117   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    381   4e-117   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    381   4e-117   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    389   9e-117   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          380   1e-116   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    384   3e-116   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    378   6e-116   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             377   7e-116   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    377   2e-115   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    379   2e-115   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          376   4e-115   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             375   4e-115   
ref|XP_006382447.1|  pectin methylesterase family protein               375   4e-115   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             375   5e-115   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             379   5e-115   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 375   7e-115   Ricinus communis
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    378   7e-115   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    374   1e-114   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             374   1e-114   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                378   1e-114   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             374   2e-114   
ref|XP_002865716.1|  pectinesterase family protein                      374   2e-114   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    377   2e-114   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         373   3e-114   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         372   4e-114   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             372   4e-114   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    372   5e-114   
emb|CDP21547.1|  unnamed protein product                                375   6e-114   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             373   6e-114   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    371   6e-114   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    377   7e-114   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    377   9e-114   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    372   9e-114   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    371   1e-113   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    371   1e-113   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          371   3e-113   
emb|CDX80613.1|  BnaC07g28310D                                          374   4e-113   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    374   4e-113   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    370   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    377   4e-113   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    370   5e-113   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    370   6e-113   
emb|CDY68790.1|  BnaAnng28400D                                          373   1e-112   
emb|CBI22967.3|  unnamed protein product                                385   3e-112   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    368   4e-112   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    367   5e-112   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    366   7e-112   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          366   7e-112   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    367   1e-111   
emb|CDX74137.1|  BnaA03g29100D                                          370   1e-111   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    366   2e-111   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    367   3e-111   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             365   3e-111   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    364   5e-111   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             365   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    364   6e-111   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    364   1e-110   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     366   2e-110   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    362   4e-110   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    362   4e-110   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    362   5e-110   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     361   9e-110   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    361   9e-110   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    361   9e-110   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             360   1e-109   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          361   2e-109   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    360   2e-109   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-108   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-108   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    362   2e-108   
gb|EPS69059.1|  hypothetical protein M569_05708                         374   2e-108   
emb|CDY24663.1|  BnaA05g30620D                                          357   3e-108   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    356   6e-108   
ref|XP_002882495.1|  pectinesterase family protein                      356   7e-108   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    355   1e-107   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 356   1e-107   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    355   1e-107   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    359   1e-107   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    355   1e-107   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    356   2e-107   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    355   2e-107   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     351   3e-107   
ref|XP_003591164.1|  Pectinesterase                                     355   3e-107   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    358   4e-107   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     353   5e-107   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    347   5e-107   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    357   6e-107   
dbj|BAC42959.2|  putative pectin methylesterase                         353   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591166.1|  Pectinesterase                                     354   6e-107   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    353   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    353   1e-106   
emb|CDY33925.1|  BnaA02g30620D                                          353   1e-106   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    353   1e-106   
gb|AAF63815.1|  pectin methylesterase, putative                         352   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    352   2e-106   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    352   2e-106   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          355   3e-106   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    352   3e-106   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     352   3e-106   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     352   3e-106   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    352   3e-106   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     345   5e-106   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     352   6e-106   
ref|XP_003604119.1|  Pectinesterase                                     353   6e-106   
emb|CDY57858.1|  BnaC08g47740D                                          348   6e-106   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    351   8e-106   
emb|CDY34927.1|  BnaA01g32580D                                          349   3e-105   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    342   4e-105   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    345   4e-105   Medicago sativa [alfalfa]
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             348   5e-105   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 349   5e-105   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     348   5e-105   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    349   5e-105   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     348   6e-105   
emb|CDY05295.1|  BnaC05g45080D                                          348   6e-105   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          348   1e-104   Sorghum bicolor [broomcorn]
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    348   1e-104   
ref|XP_007031044.1|  Pectinesterase, putative                           349   1e-104   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    348   1e-104   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-104   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             348   1e-104   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     347   1e-104   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-104   
ref|NP_001049858.1|  Os03g0300500                                       347   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             348   2e-104   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          348   2e-104   Sorghum bicolor [broomcorn]
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     347   3e-104   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    347   3e-104   
gb|EPS66234.1|  hypothetical protein M569_08543                         347   4e-104   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    347   5e-104   
gb|AFB77929.1|  pectin methylesterase                                   346   7e-104   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          347   8e-104   Vitis vinifera
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     346   9e-104   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    346   9e-104   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    345   1e-103   
ref|XP_007012506.1|  Pectinesterase                                     346   1e-103   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             341   1e-103   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             345   1e-103   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    345   1e-103   
emb|CBI27741.3|  unnamed protein product                                337   3e-103   
gb|AFW03475.1|  pectin methylesterase 1                                 344   3e-103   
gb|KHG08631.1|  Pectinesterase 3                                        344   3e-103   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    344   3e-103   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          343   3e-103   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     344   4e-103   
gb|AFI23411.1|  pectin methylesterase                                   344   4e-103   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              343   4e-103   
gb|EPS65387.1|  pectinesterase                                          343   5e-103   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    344   6e-103   
ref|XP_003591168.1|  Pectinesterase                                     343   6e-103   
ref|XP_002324181.2|  pectinesterase family protein                      343   7e-103   Populus trichocarpa [western balsam poplar]
gb|AFW03480.1|  pectin methylesterase 1                                 343   8e-103   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             343   8e-103   
dbj|BAK06954.1|  predicted protein                                      342   1e-102   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    353   1e-102   
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    340   1e-102   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     342   1e-102   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    343   2e-102   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     342   2e-102   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 342   2e-102   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    342   3e-102   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     341   3e-102   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          342   3e-102   
ref|XP_003627458.1|  Pectinesterase                                     342   3e-102   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     341   4e-102   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    342   4e-102   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     340   4e-102   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    341   4e-102   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     335   4e-102   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    341   4e-102   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     341   5e-102   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          341   5e-102   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                340   5e-102   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   341   6e-102   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     340   7e-102   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    341   8e-102   
ref|XP_003604120.1|  Pectinesterase                                     341   8e-102   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    341   9e-102   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    340   9e-102   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     340   1e-101   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    339   1e-101   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               339   1e-101   Ricinus communis
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     336   2e-101   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          340   2e-101   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    340   2e-101   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    339   2e-101   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     338   2e-101   
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    340   3e-101   
gb|ABZ89800.1|  pectin methylesterase-like protein                      339   3e-101   Taiwania cryptomerioides
emb|CDY71928.1|  BnaCnng75130D                                          332   3e-101   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    338   3e-101   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     338   4e-101   
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                335   5e-101   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    338   5e-101   Citrus sinensis [apfelsine]
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             341   5e-101   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          338   7e-101   
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 340   8e-101   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    338   8e-101   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    337   8e-101   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          337   9e-101   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             338   9e-101   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         337   1e-100   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     337   1e-100   
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 337   1e-100   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              330   1e-100   
ref|XP_003626199.1|  Pectinesterase                                     338   1e-100   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    337   1e-100   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   338   1e-100   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          336   2e-100   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     337   2e-100   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    337   2e-100   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  337   2e-100   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    337   2e-100   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    337   2e-100   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    327   3e-100   
gb|EAY94391.1|  hypothetical protein OsI_16158                          336   3e-100   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   3e-100   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               337   3e-100   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  327   3e-100   
gb|AGG23325.1|  pectin methylesterase 1                                 336   3e-100   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   4e-100   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     335   4e-100   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     336   4e-100   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    338   4e-100   
gb|EAY94388.1|  hypothetical protein OsI_16156                          335   5e-100   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             336   5e-100   
ref|NP_001052981.1|  Os04g0458900                                       335   5e-100   
gb|AHC69829.1|  pectin methylesterase PME2.1                            335   5e-100   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            335   5e-100   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 335   5e-100   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   6e-100   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   6e-100   
gb|ACQ85264.1|  pectin methylesterase                                   335   6e-100   
ref|NP_001274969.1|  pectin methyl esterase                             335   7e-100   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    335   7e-100   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     334   7e-100   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    334   8e-100   
emb|CAH67075.1|  OSIGBa0097P08.5                                        335   8e-100   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    335   8e-100   
gb|AFQ23194.1|  pectin methylesterase                                   335   9e-100   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     334   9e-100   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   329   1e-99    
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    332   1e-99    
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             333   1e-99    
emb|CAB95025.1|  pectin methylesterase                                  334   1e-99    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     335   1e-99    
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          334   1e-99    
dbj|BAA89480.1|  pectin methylesterase                                  335   1e-99    
gb|AAO85706.1|  pectin methyl-esterase                                  334   2e-99    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    334   2e-99    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     334   3e-99    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             333   3e-99    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     330   3e-99    
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     333   3e-99    
emb|CDY66111.1|  BnaAnng21510D                                          338   3e-99    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     333   4e-99    
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...    338   4e-99    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     332   4e-99    
ref|XP_010687597.1|  PREDICTED: pectinesterase                          334   4e-99    
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    333   5e-99    
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             333   6e-99    
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    333   6e-99    
ref|XP_002304257.2|  pectinesterase family protein                      333   6e-99    
ref|NP_001042866.1|  Os01g0312500                                       327   7e-99    
gb|ACF79975.1|  unknown                                                 332   8e-99    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    332   9e-99    
ref|XP_002868170.1|  predicted protein                                  336   1e-98    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          332   1e-98    
gb|AFC98398.1|  pectin methylesterase                                   331   1e-98    
emb|CAC01624.1|  putative pectin methylesterase                         332   1e-98    
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    332   1e-98    
emb|CDO99718.1|  unnamed protein product                                331   1e-98    
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     332   1e-98    
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    332   1e-98    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             332   1e-98    
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    331   2e-98    
emb|CDY34642.1|  BnaC08g42010D                                          327   2e-98    
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     331   2e-98    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   330   2e-98    
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              330   2e-98    
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    330   3e-98    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            330   3e-98    
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    331   3e-98    
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 330   4e-98    
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     330   4e-98    
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             330   4e-98    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     331   5e-98    
gb|ACN40984.1|  unknown                                                 331   5e-98    
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    330   5e-98    
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    331   5e-98    
ref|NP_001275859.1|  pectinesterase 1 precursor                         330   6e-98    
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     330   6e-98    
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                331   6e-98    
dbj|BAK05856.1|  predicted protein                                      331   6e-98    
gb|EEC70505.1|  hypothetical protein OsI_01594                          330   6e-98    
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             330   7e-98    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    330   7e-98    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    329   7e-98    
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    329   7e-98    
ref|XP_002889876.1|  At1g11580/T23J18_33                                329   7e-98    
gb|EPS74082.1|  hypothetical protein M569_00674                         327   9e-98    
ref|NP_172624.1|  methylesterase PCR A                                  329   9e-98    
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    333   1e-97    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     328   1e-97    
gb|AHB84678.1|  pectin methylesterase                                   329   1e-97    
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        328   1e-97    
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             329   1e-97    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    328   1e-97    
gb|AAK59760.1|  At1g11580/T23J18_33                                     328   1e-97    
emb|CAA96435.1|  pectin methylesterase                                  320   1e-97    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 325   2e-97    
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     329   2e-97    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     328   2e-97    
gb|ABK94644.1|  unknown                                                 320   2e-97    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                329   2e-97    
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    329   2e-97    
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    328   2e-97    
emb|CAA96434.1|  pectin methylesterase                                  319   3e-97    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     327   3e-97    
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     328   3e-97    
emb|CDP19930.1|  unnamed protein product                                328   4e-97    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          326   4e-97    
ref|XP_007012502.1|  Pectin methylesterase 3                            327   6e-97    
ref|XP_002275000.1|  PREDICTED: pectinesterase                          327   6e-97    
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     327   7e-97    
emb|CAB65290.2|  pectin methyl-esterase PER                             328   7e-97    
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    328   7e-97    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     327   8e-97    
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     328   8e-97    
gb|EAZ09211.1|  hypothetical protein OsI_31486                          322   8e-97    
emb|CBI26012.3|  unnamed protein product                                327   9e-97    
emb|CDP19933.1|  unnamed protein product                                325   1e-96    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                326   1e-96    
emb|CDY11322.1|  BnaA03g01580D                                          326   1e-96    
ref|XP_009122673.1|  PREDICTED: putative pectinesterase/pectinest...    326   1e-96    
emb|CDX80932.1|  BnaC03g01860D                                          326   1e-96    
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             330   1e-96    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          326   1e-96    
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    325   1e-96    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             325   2e-96    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          326   2e-96    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     324   2e-96    
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             330   2e-96    
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 327   2e-96    
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             330   2e-96    
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                326   2e-96    
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             330   2e-96    
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    325   2e-96    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     325   2e-96    
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     326   3e-96    
ref|XP_002516192.1|  Pectinesterase PPE8B precursor, putative           324   3e-96    
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   3e-96    
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    326   3e-96    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             324   4e-96    
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     325   4e-96    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    324   4e-96    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     325   4e-96    
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    324   4e-96    
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    325   4e-96    
ref|XP_009130851.1|  PREDICTED: probable pectinesterase/pectinest...    325   4e-96    
ref|XP_002317208.1|  pectin methylesterase family protein               324   4e-96    
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             325   4e-96    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          325   5e-96    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          325   5e-96    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             325   5e-96    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     323   6e-96    
ref|NP_001275846.1|  putative thermostable pectinesterase               326   7e-96    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     324   7e-96    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    324   8e-96    
ref|XP_006289946.1|  hypothetical protein CARUB_v10003572mg             324   8e-96    
emb|CDY36269.1|  BnaA01g31490D                                          323   8e-96    
ref|NP_196115.1|  putative pectinesterase/pectinesterase inhibito...    324   8e-96    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    324   9e-96    
ref|XP_006398953.1|  hypothetical protein EUTSA_v10013108mg             324   1e-95    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   319   1e-95    
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                323   1e-95    
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    324   1e-95    
gb|EPS62329.1|  pectinesterase                                          323   1e-95    
ref|NP_001060715.1|  Os07g0691100                                       323   1e-95    
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   1e-95    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     320   1e-95    
emb|CDY08206.1|  BnaA05g14130D                                          323   2e-95    
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             328   2e-95    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     322   2e-95    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    322   2e-95    
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     323   2e-95    
ref|XP_010656075.1|  PREDICTED: probable pectinesterase/pectinest...    322   2e-95    
gb|ABJ99595.1|  pectinesterase inhibitor                                323   2e-95    
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    323   2e-95    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   324   2e-95    
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                324   2e-95    
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     323   2e-95    
ref|NP_001265901.1|  pectinesterase 3-like                              323   3e-95    
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     322   3e-95    
gb|KHN43418.1|  Putative pectinesterase/pectinesterase inhibitor 13     319   3e-95    
gb|AAL24278.1|  AT3g14310/MLN21_9                                       317   3e-95    
emb|CDY51798.1|  BnaC06g41940D                                          323   3e-95    
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 322   3e-95    
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             323   3e-95    
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   322   3e-95    
emb|CDY33229.1|  BnaC01g37020D                                          322   3e-95    
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 322   3e-95    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          321   3e-95    
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...    325   3e-95    
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     323   3e-95    
dbj|BAD95369.1|  pectin methylesterase like protein                     316   4e-95    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    320   4e-95    
gb|EPS67019.1|  pectinesterase                                          314   4e-95    
ref|XP_011078158.1|  PREDICTED: pectinesterase/pectinesterase inh...    321   4e-95    
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        323   4e-95    
ref|NP_001105487.1|  pectin methylesterase1                             322   4e-95    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          322   4e-95    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            322   4e-95    
dbj|BAF42038.1|  pectin methylesterase 1                                323   5e-95    
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     322   5e-95    



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   491 bits (1265),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 236/384 (61%), Positives = 291/384 (76%), Gaps = 8/384 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLKT+ ELTSN LAMVT   E L  L +PGISRRLL   +  T      FV++ 
Sbjct  181   GEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGISRRLLTTDSEYTSA----FVEAG  236

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             +R LL V+  +P+ VVAQDGSG++KTI  AL ++P KN++  VILIKAG YKE V +PR 
Sbjct  237   SRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIPRS  296

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEGPTKT ITGN+N AD    GTY   TV V G+GF+ RD+  ENTAGA K Q
Sbjct  297   ITNVVFIGEGPTKTKITGNKNFADG--TGTYHTATVAVNGDGFVARDIGFENTAGAKKHQ  354

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+SAD  V +NC+++ YQDTLYTHSYRQFY+ CTI+GT+DFIFG+A VVFQ CKM+
Sbjct  355   AVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKMI  414

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGRKD RG  AIV+Q+CDI AEPA  +A PP K +LGRPWKE+SRT
Sbjct  415   VRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRT  474

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +I+ S+ID  + PEGW+PW GNFAL+T +YAEY+NRGPGA+ DKRVKW GYKRNISP+ A
Sbjct  475   IIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEA  534

Query  1613  KQFTPGPFLMADEQWLGRAQIPFS  1542
             +++ P  F+  D  W+ +  I ++
Sbjct  535   EKYAPAHFIDQD-NWIKKTGISYA  557



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   488 bits (1256),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 288/383 (75%), Gaps = 8/383 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLKT+ ELTSN LAMV+   E L  L IPGISRRLL   +  T      FV++ 
Sbjct  181   GEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGISRRLLTTDSEYTSA----FVEAG  236

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             +R LL V+  +P+ VVAQDGSG++KTI  AL ++P KN++  VILIKAG YKE V +PR 
Sbjct  237   SRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDIPRS  296

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEGPTKT ITGN+N AD    GTY   TV V G+GF+ RD+  ENTAGA K Q
Sbjct  297   MINVVFIGEGPTKTKITGNKNFADG--TGTYHTATVAVNGDGFVARDIGFENTAGAKKHQ  354

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+SAD  V +NC+++ YQDTLYTHSYRQFY+ CTI+GT+DFIFG+A  VFQ CKM+
Sbjct  355   AVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKMI  414

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGRKD RG  AIV+Q+CDI AEPA  +  PP K +LGRPWKE+SRT
Sbjct  415   VRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRT  474

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S+ID  + PEGW+PW GNFAL+T +YAEY+NRGPGA+ DKRVKW GYKRNISP+ A
Sbjct  475   IIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEA  534

Query  1613  KQFTPGPFLMADEQWLGRAQIPF  1545
             +++ P  F+  D  W+ +  I +
Sbjct  535   EKYAPAHFIDQD-NWIKKTGISY  556



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   484 bits (1246),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 286/389 (74%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GE+MK LLKT+ ELTSN LAMVT + E L    I G  RRL+             FVD+ 
Sbjct  181   GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLMSSSVEP------DFVDAT  234

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R L+ A     +P+ VVAQDGSG+FK+I  A+N++P+KN++  VI IKAG+YKEYV +P
Sbjct  235   ARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLP  294

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +  N IV VGEGPTKT ITGN+N  D    GT++  T+ V G+  I +DL IEN+AGAVK
Sbjct  295   KHVNGIVLVGEGPTKTKITGNKNFVDGV--GTFQTPTLSVNGDATILKDLGIENSAGAVK  352

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+S D  +V+NC ++AYQDTLYTH+YRQ+YR CTISGT+DFIFG+A  VFQ CK
Sbjct  353   HQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCK  412

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             MVVRKP+ NQ CMVTAQGRK+RRG  AIV+Q+C IVA+PA  A  PP K +LGRPWKEFS
Sbjct  413   MVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFS  472

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM + ID  + PEGWSPW GNF +DTC+YAEY NRGPGA T KRV+WKG K+ I+P+
Sbjct  473   RTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQ  531

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +A+ FTPG ++  D  W+  + +P++PG 
Sbjct  532   IAQSFTPGAYIQGDA-WITASGVPYAPGM  559



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   478 bits (1230),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 281/388 (72%), Gaps = 19/388 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLK + ELTSN LAMV+   E +  L IPG++RRLL                 A
Sbjct  177   GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLL----------------DA  220

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
                +L    +P++VVA DGSG++K+I  ALN++P+ N +R VI IKAGVY E+V +PRK 
Sbjct  221   HERMLSDSLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNEHVEIPRKM  280

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
             NNIVF+GEGPTKT ITG+ N AD    GT++  T  V G+ F+ +D+  ENTAG VK QA
Sbjct  281   NNIVFIGEGPTKTKITGSLNYADG--TGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQA  338

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR+S DMA+ HNC ++ YQDTLY HSYRQF+R CTI+GT+DFIFG+A  VFQ CKM+V
Sbjct  339   VALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIV  398

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP+ NQACMVTAQGRKD RG   IV+Q+C I AE    AA PP K +LGRPWKEFSRT+
Sbjct  399   RKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTI  458

Query  1790  IMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM S ID  + PEGWSPW GNFALDT +YAEY+NRGPG+ T  RV WKGY++ I+P+VA 
Sbjct  459   IMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAA  518

Query  1610  QFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             QFTPG F+M DE W+  + +P+ PG ++
Sbjct  519   QFTPGVFIMGDE-WVKLSGVPYEPGMIR  545



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   475 bits (1222),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 283/389 (73%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GE+MK LLKT+ ELTSN LAMVT + E L    I G  RRL+             FVD+ 
Sbjct  165   GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLMSSSVEP------DFVDAT  218

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R L+ A     +P+ VVAQDGSG+FK+I  A+N++P+KN++  VI IKAG+YKEYV +P
Sbjct  219   ARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLP  278

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +  N IV VGEGPTKT ITGN+N  D    GT++  T+ V G+  I +DL IEN+AGAVK
Sbjct  279   KHVNGIVLVGEGPTKTKITGNKNFVDGV--GTFQTPTLSVNGDATILKDLGIENSAGAVK  336

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+S D  +V+NC ++AYQDTLYTH+YRQ+YR CTISGT+DFIFG+   VFQ CK
Sbjct  337   HQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCK  396

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             MVVRKP+ NQ CMVTAQGRK+RRG  AIV+Q+C IVA+PA  A  PP K +LGRPWKEFS
Sbjct  397   MVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFS  456

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM + ID  + PEGWSPW GNF +DTC+YAEY NRGPGA T KRV+WKG K+ I+P+
Sbjct  457   RTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQ  515

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +A+ FTPG ++  D  W+  + + ++ G 
Sbjct  516   IAQSFTPGAYIQGDA-WITASGVTYASGM  543



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   475 bits (1222),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 284/383 (74%), Gaps = 11/383 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLKT+ ELTSN LAM+T   + L ++ IPGISRRLL             FV+  
Sbjct  180   GEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGISRRLLANDYT-------SFVEDG  232

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             +R LL V+  +P+ VVA DGSG+FKTI  AL  +P KN +  VILIKAG YKE V VPR 
Sbjct  233   SRRLLQVSSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEIVDVPRG  292

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEGPTKT ITGN+N AD     T+   TV V G+GF+ RD+  ENTAGA+K Q
Sbjct  293   VTNVVFIGEGPTKTKITGNKNYADG--TATFHTATVAVNGDGFVARDIGFENTAGAMKHQ  350

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+SAD AV +NC+++ YQDTLYTHSYRQFY+ C+ISGT+DFIFG+A  VFQ CKM+
Sbjct  351   AVALRVSADKAVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMI  410

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGRKD RG  AIV+++C+I AEPA  +  PP K +LGRPWKE+SRT
Sbjct  411   VRKPGNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRT  470

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + ID  + PEGW+PW GNFAL+T +YAEY+NRGPGA+TDKRVKW GYKRNISP+ A
Sbjct  471   IIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEA  530

Query  1613  KQFTPGPFLMADEQWLGRAQIPF  1545
             +++ P  F+  D  W+ +  I +
Sbjct  531   EKYAPNIFIDQD-SWIKKTGISY  552



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   474 bits (1219),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 281/388 (72%), Gaps = 19/388 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLK + ELTSN LAMV+   E +  L IPG++RRLL                 A
Sbjct  177   GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLL----------------DA  220

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
                +L    +P+++VA DGSG++K+I  ALN++P+KN ++ VI IKAGVY E+V +PRK 
Sbjct  221   HERMLSDSLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNEHVEIPRKM  280

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
             NNI+F+GEGPTKT ITG+ N AD    GT++  T  V G+ F+ +D+  ENTAG VK QA
Sbjct  281   NNIIFIGEGPTKTKITGSLNYADG--TGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQA  338

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR+S DMA+ HNC ++ YQDTLY HSYRQF+R CTI+GT+DFIFG+A  VFQ C+M+V
Sbjct  339   VALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIV  398

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP+ NQACMVTAQGRKD RG   IV+Q+C I AE    AA PP K +LGRPWKEFSRT+
Sbjct  399   RKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTI  458

Query  1790  IMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM S ID  + PEGWSPW GNFALDT +YAEY+NRGPG+ T  RV WKGY++ I+P+VA 
Sbjct  459   IMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAA  518

Query  1610  QFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             QFTP  F+M DE W+  + +P+ PG ++
Sbjct  519   QFTPAVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   468 bits (1204),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 225/383 (59%), Positives = 283/383 (74%), Gaps = 11/383 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLKT+ ELTSN LAM+T   + L  + IPGISRRLL +           FV+  
Sbjct  176   GEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGISRRLLADDYT-------SFVEDG  228

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             +R LL V+  +P+ VVA DGSG+FKTI  AL  +P KN +  VILIKAG YKE V +PR 
Sbjct  229   SRRLLQVSNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEMVDIPRG  288

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEGPTKT ITGN+N AD     T+   TV V G+GF+ +D+  ENTAGA+K Q
Sbjct  289   VTNVVFIGEGPTKTKITGNKNYADGT--ATFHTSTVAVNGDGFVAKDIGFENTAGAMKHQ  346

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+SAD  V +NC+++ YQDTLYTHSYRQFY+ C+ISGT+DFIFG+A  VFQ CKM+
Sbjct  347   AVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMI  406

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP ANQACMVTAQGRKD RG  AI++++C+I AEPA     PP K +LGRPWKE+SRT
Sbjct  407   VRKPGANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRT  466

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S ID  + PEGW+PW GNFAL+T +YAEY+NRGPGA+TD+RVKW GYK++ISP+ A
Sbjct  467   IIMQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEA  526

Query  1613  KQFTPGPFLMADEQWLGRAQIPF  1545
             +++ P  F+  D  W+ +  I +
Sbjct  527   EKYAPNIFIDQD-SWIKKTGISY  548



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   455 bits (1171),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 213/390 (55%), Positives = 286/390 (73%), Gaps = 17/390 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLK--TLEIPGISRRLLeeptpttdeeiPQFVD  2517
             GEKM+ LLK + ELTSN+LAMV+   + L    L+IPG++RRLL            + ++
Sbjct  179   GEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVNRRLLNAHE--------RMLN  230

Query  2516  SATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
                 + L    +P++VVA DGSG++K+I  AL ++P+KN ++ VI IKAG+YKEY+ +P+
Sbjct  231   EVNSNGL----KPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAGIYKEYIDIPK  286

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
             K N+IVF+GEGPTKT ITGN+N AD    GT++  TV + G+ F+ +D+ IENTAGA+K 
Sbjct  287   KMNHIVFIGEGPTKTKITGNKNFADGI--GTFQTATVAINGDNFMAKDIGIENTAGAIKH  344

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+S D A+ HNC  + YQDTLY H+YRQF+R CTI+GT+DFIFG+A  VFQ CKM
Sbjct  345   QAVALRVSGDKAIFHNCQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKM  404

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ANQACMVTAQGRKDRRG  AIV+Q+C+I AE    +  P  K +LGRPWKEFSR
Sbjct  405   IVRKPMANQACMVTAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSR  464

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM S ID  + P+GWS W G+FAL T +YAEY+NRG GA+++ RV W+GYK+NI  E+
Sbjct  465   TIIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEI  524

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             A  F PG F++ADE W+  + +P+  G ++
Sbjct  525   AAGFAPGVFILADE-WVRLSGVPYESGLMK  553



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   447 bits (1151),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 283/391 (72%), Gaps = 12/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK L++T+++L+SN LA+VT   E L TL IPG+SRRLL       DEE   FV+  
Sbjct  184   GEKMKQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLSRRLLSAEKRKLDEE--NFVE--  239

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   P   +P+ ++AQDGSG FKTI  A+N++P+ N    VILIKAGVYKE +++P
Sbjct  240   -RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKEVILIP  298

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R+ NN+V +GEGP  T IT N+N  D    GT+   TV + G+G I RD+ IEN+AG  K
Sbjct  299   RRINNVVIMGEGPNVTKITANKNYVDGI--GTFHTATVAINGDGCILRDIGIENSAGPEK  356

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+S D  +V+NC ++ YQDTLY+H+YRQFYR  TISGT+DFIFG+A  VFQ CK
Sbjct  357   HQAVALRVSGDRTIVYNCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCK  416

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VR PL NQACMVTAQGR + R   AIV+Q+C IVA+PAL +A+PP + +LGRPWKE+S
Sbjct  417   LIVRMPLVNQACMVTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYS  476

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S ID  + P+GWSPW G F L T +YAEY+NRGPGA+TD+RV W G + +I+P+
Sbjct  477   RTIIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQ-HITPQ  535

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             VA+ FTPG + + D  W+  +  P+ PG L+
Sbjct  536   VAESFTPGKYFIGDS-WITASGFPYVPGMLK  565



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   427 bits (1098),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 271/392 (69%), Gaps = 13/392 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LL T+ EL+ N LAMV    E +   +  G+SR+LL             FV+++
Sbjct  172   GEKMAKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLLTTDES-------SFVEAS  222

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              R LL ++  +P+ VVAQDGSG++KTIT AL ++P+KN    VILIKAG+YKEYV V + 
Sbjct  223   NRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVDVEKG  282

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEG TKT ITGN+ V +   G T+   TV V GEGF+ RD+  ENTAGAVKEQ
Sbjct  283   MTNVVFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENTAGAVKEQ  342

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR++AD AV++NC ++ YQDTLY HS RQFYR C I+GT+DF+FG+A  VFQ CK++
Sbjct  343   AVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLI  402

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP   Q CMVTAQGR       A+V+Q+C+I AEP   A  PP K FLGRPWKE+SRT
Sbjct  403   VRKPGDGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRT  462

Query  1793  LIMFSFIDNIVVPEGWSPWKGN-FALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPE  1620
             +IM S+ID  + P GW+PW    F + TCWYAEY+NRGPGAS DKR+  W+GY++ IS +
Sbjct  463   IIMQSYIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGD  522

Query  1619  VAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             VA  FT G F+   D  +L +A IP+  G ++
Sbjct  523   VANSFTAGLFINPTDSSFLPKADIPYEAGMMK  554



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   425 bits (1092),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 207/392 (53%), Positives = 271/392 (69%), Gaps = 11/392 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              +KMK +L+ S ELTSN LAMVT++   L +L IP +SRRLL E      E    +VD  
Sbjct  192   AKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVSRRLLTEEQDGIPEFP-SWVDEG  250

Query  2510  TRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL A P+   PD+VVAQDGSGK+KTI  ALN +P+KN++  VI IK GVYKE V+V 
Sbjct  251   RRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKTFVIYIKEGVYKEKVLVD  310

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVE--GEGFICRDLTIENTAGA  2166
             +K  N++ +G+GPTKTVITG+ N  D    G   C T      G  FI +D+  EN+AGA
Sbjct  311   KKTTNVMIIGDGPTKTVITGSLNYVD----GVQTCNTATFTAIGSYFIAKDIKFENSAGA  366

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
              K QAVALR+ +DM+V++NCH++A+QDTLY H++RQFYR CTISGT+DFIFG+A  VFQ 
Sbjct  367   EKHQAVALRVQSDMSVIYNCHMDAFQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQN  426

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C+M V+KPL NQ C+VTA GR +RR ASAIV+Q+C I A+PA       NK +LGRPWK+
Sbjct  427   CQMFVKKPLENQQCIVTASGRSERRSASAIVLQNCTISADPAYYPLRNINKAYLGRPWKD  486

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM S ID+++ P+GW  W GNFAL+TC+YAEY NRG G++T  R KW+G K   +
Sbjct  487   YSRTIIMQSQIDDLIQPQGWLAWMGNFALNTCFYAEYGNRGAGSATTGRAKWRGIKSMTA  546

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +   FTP  F   D+ W+    +P+SP  +
Sbjct  547   QHIV-DFTPKAFFKGDDAWITATGVPYSPKLM  577



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   424 bits (1091),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 209/397 (53%), Positives = 273/397 (69%), Gaps = 12/397 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeep-----tpttdeeiPQ  2526
             GEKMK  LKT+ME++SN L +V+ +   L  L+IPG+SRRLL++           +  P 
Sbjct  190   GEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVSRRLLQDDIPVAGHGDISQAFPA  249

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
             ++D  TR LL APP   +PD+VVA+DGSG +KTI  AL  IP+K++   V+ IK G+Y+E
Sbjct  250   WIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKEGIYEE  309

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
             YV   R   N+V +G+GP KT ITG++N  D     TYR  TV V G+ F+ R++  EN+
Sbjct  310   YVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGI--NTYRTATVAVIGDNFVARNIGFENS  367

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AGA+K QAVALR+S+D AV +NC ++ YQDTLYTH+ RQFYR CT+SGT+DF+FG+APVV
Sbjct  368   AGAIKHQAVALRVSSDYAVFYNCSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVV  427

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C  +VRKPL NQ C+VTAQGRK RR  SAI+IQ+  I A P L+      K +LGRP
Sbjct  428   FQNCTFLVRKPLENQQCIVTAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLGRP  487

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WKEFSRT+IM +FID+++ PEGWSPW G+F L TCWY EY N GPG+    RVKW G K 
Sbjct  488   WKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGIKP  547

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              +S + A  FTPG FL  D  W+    +P++P   +P
Sbjct  548   -VSRQHAIDFTPGRFLRGD-SWIKPTGVPYAPYLTRP  582



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   423 bits (1087),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 268/392 (68%), Gaps = 13/392 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LL T+ EL+ N LAMV    E +   +  G+SR+LL             FV+++
Sbjct  172   GEKMVKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLLTTDES-------SFVEAS  222

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              R LL ++  +P+ VVAQDGSG++KTIT AL ++P+KN    VILIKAG+YKEYV V + 
Sbjct  223   NRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVEVEKG  282

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEG TKT ITGN++V     G T+   TV V GEGF+ RD+  ENTAG  +EQ
Sbjct  283   MTNVVFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPAQEQ  342

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR++AD AV++NC ++ YQDTLY HS RQFYR C ISGT+DF+FG+A  VFQ CK++
Sbjct  343   AVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLI  402

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR+P   Q CMVTAQGR       A VIQ+C+I AEP   AA P  K FLGRPWKE+SRT
Sbjct  403   VRRPGDGQNCMVTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRT  462

Query  1793  LIMFSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPE  1620
             +IM SFID  + P GW+PW   +F + TCWYAEY+NRG GAS DKRV  W+GY+R IS +
Sbjct  463   IIMQSFIDGFIDPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGD  522

Query  1619  VAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             VA  FT G F+   D  +L +A IP+  G ++
Sbjct  523   VANSFTAGVFINPTDNSFLPKADIPYEAGMMK  554



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   421 bits (1083),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/409 (51%), Positives = 274/409 (67%), Gaps = 27/409 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdee-------  2535
             GEKMK+LL+TS EL SN LAMVT     L +L   G S RRLL +   +           
Sbjct  182   GEKMKNLLQTSGELLSNGLAMVTDFSSILSSL--GGFSSRRLLSDEGRSLYHLDPTDYAP  239

Query  2534  ----------iPQFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDR  2394
                        P FVDS  R LL A P   +P+ VVA+DGSG++ TI  AL ++P+K ++
Sbjct  240   GEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKKTNQ  299

Query  2393  RIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEG  2214
               VI +KAGVYKE V++PR  NNIV +G+GP KT I GN+N AD     T+    + V G
Sbjct  300   TFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQ--TFHTAVLAVNG  357

Query  2213  EGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTIS  2034
             +GF+ +D+ IENTAGA K QAVA+R+S D A+ +N H++ YQDTLY H+YRQFYR C I+
Sbjct  358   DGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYAHAYRQFYRDCQIT  417

Query  2033  GTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALK  1854
             GT+DFIFG+A  +FQKC++VVR+P+ +QACMVTAQGRKD+R     V+Q CDIVA+PA  
Sbjct  418   GTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQRSVGVTVLQGCDIVADPAFL  477

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGA  1674
             A  PP   +LGRPWKE+SRT++M S ID  + PEGWSPW GN+AL T +Y EY+NRG G+
Sbjct  478   AVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAGS  537

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
                 RV WKG K+ I+P +A+ FTPG  +  ++ W+  + IP+  G LQ
Sbjct  538   GLSGRVTWKGIKK-ITPAIAQSFTPG-VVYKNDTWVSTSGIPYVSGMLQ  584



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   419 bits (1077),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/399 (52%), Positives = 274/399 (69%), Gaps = 15/399 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-PGISRRLLeeptpttdeeiPQF---  2523
             GEKMK+LLKT+ E++SN LAMV ++  FL +L++    SR+LL         +   +   
Sbjct  178   GEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLLLSGKIGYGGDPTDYAPG  237

Query  2522  ------VDSATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGV  2364
                   +DS  R LL A   +P+ VVAQDGSG+F TI+ A+ S+P KN++  VI +KAGV
Sbjct  238   EEPHFNLDSNRRRLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQTFVIHVKAGV  297

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +P+K N IV +G+GP KT I+G +N A+     TY   TV V  + F+ +D+  
Sbjct  298   YKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TYHTATVAVNADDFLAKDIGF  355

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA   QAVALR+S D AV +N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG++
Sbjct  356   ENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDS  415

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               +FQ CK VVRKP+ANQACMVTAQGR +R    A +IQ+ D VAEPAL  A+PP+KV+L
Sbjct  416   QALFQNCKFVVRKPMANQACMVTAQGRVERHSLGATIIQNGDFVAEPALLQASPPHKVYL  475

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK  SRT+IM S I   + PEGW+ W G FALDT +YAEY+NRGPG+    RVKWKG
Sbjct  476   GRPWKLLSRTIIMQSNIGGFIAPEGWAEWSGTFALDTLYYAEYQNRGPGSDLKNRVKWKG  535

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              +  +SP++A+ +T G F   DE W+  + +P+ P  +Q
Sbjct  536   IQ-TLSPQMAESWTGGKFYGGDE-WVKNSGVPYIPTMMQ  572



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   417 bits (1072),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/392 (53%), Positives = 268/392 (68%), Gaps = 13/392 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LL T+ EL+ N LAMV    E +   +  G+SR+LL     +       F++++
Sbjct  172   GEKMVKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLLTTTEES------SFIEAS  223

Query  2510  TRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              R LL ++  +P+ VVAQDGSG++KTI  AL ++P+KN    VILIKAG+YKEYV V + 
Sbjct  224   NRKLLQISSAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKEYVEVEKG  283

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+GEG TKT ITGN+       G T+   TV V GEGF+ RD+  ENTAG   EQ
Sbjct  284   MTNVVFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPTLEQ  343

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR++AD AV++NC ++ YQDTLY HS RQFYR C ISGT+DF+FG+A  VFQ CK++
Sbjct  344   AVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLI  403

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPL +Q CMVTAQGR       AIVIQ+C+I A+P   AA P    +LGRPWKE+SRT
Sbjct  404   VRKPLDSQNCMVTAQGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYLGRPWKEYSRT  462

Query  1793  LIMFSFIDNIVVPEGWSPWKG-NFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPE  1620
             +IM SFID  + P GWSPW   +F L TCWYAEY+NRGPGAS DKRV  W+GY+R IS +
Sbjct  463   IIMQSFIDGFIDPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGD  522

Query  1619  VAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             VA  FT G F+  +   +L +A IP+  G ++
Sbjct  523   VANSFTAGQFINPSGSSFLPKADIPYEAGMMK  554



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   416 bits (1070),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/412 (49%), Positives = 277/412 (67%), Gaps = 29/412 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKMK+LL +S  + SN LAMV  +     +L + G + R L E   +    + Q     
Sbjct  163   GEKMKNLLHSSGMMLSNGLAMVGDISSIFSSLSLGGFTSRRLLEEEGSLAYGVDQTDGED  222

Query  2525  -----------------FVDSATRHLLVA---PPRPDIVVAQDGSGKFKTITGALNSIPE  2406
                              FVD+  R ++ A     + +IVVAQDGSG+FKTITGA+NS+P+
Sbjct  223   PKTAFDGKVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPK  282

Query  2405  KNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTV  2226
             K D   VI +KAG YKE V+ P+K NN+V +G+GP KT I+G++N  D     T+    +
Sbjct  283   KGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQ--TFHTAVL  340

Query  2225  IVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRG  2046
              V G+GFI +D+ IENTAG +K QAVA+R+S D ++ +N H+N++QDTLY H+YRQ+YR 
Sbjct  341   GVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYAHAYRQYYRD  400

Query  2045  CTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAE  1866
             CTI+GT+DFIFG+A  VFQ C+M+VRKPLANQ CMVTAQGRK+RR     VIQ+C I+AE
Sbjct  401   CTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAE  460

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNR  1686
             PA  +  PP K +LGRPWK+FSRT+IM + ID  + PEGW+PW+GNFALDT +Y E+KNR
Sbjct  461   PAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNR  520

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GPG+   +RV+WKG +  I+P +A+ FTPG     DE W+ ++ +P+  G +
Sbjct  521   GPGSDMSRRVRWKGIQ-TITPAIAESFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   414 bits (1064),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 271/396 (68%), Gaps = 23/396 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GEKMK+LLK + EL++NAL +V+  +E ++ L+I GI+ RRLL              V++
Sbjct  177   GEKMKNLLKNAHELSTNALDIVSSFEEQVENLQILGINNRRLLT-------------VEA  223

Query  2513  ATRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
               R LL VAP +P++VVAQDGSG+ K+I  AL ++P  N +  VILIKAG+Y EYV V  
Sbjct  224   GNRRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNEYVQVAN  283

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                N+VF+GEGP KT ITGN+N  D  P   +   TV + G+GF+ +D+  EN+AG +K 
Sbjct  284   TMTNVVFIGEGPNKTKITGNKNYLDGLP--VFSTATVAISGQGFVAKDIGFENSAGPLKH  341

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+SA+MAV  NC ++ YQ TL TH  RQ YR CTI+GT+DFIFG+A  VFQ CK+
Sbjct  342   QAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQNCKL  401

Query  1976  VVRKP--LANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKE  1806
             + RKP  +  QA  + AQGR  + G  AI+IQ+C I AEPAL A NPP NK +LGRPWK 
Sbjct  402   IARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKL  461

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM S ID  + PEGW+PW G FALDT ++ EY+NRGPGA+TDKRV WK Y +N +
Sbjct  462   YSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPT  521

Query  1625  PEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             P+V  +FTPG  L   +    W+ +  +P+ PG ++
Sbjct  522   PDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   415 bits (1066),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 209/416 (50%), Positives = 276/416 (66%), Gaps = 32/416 (8%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiP-----  2529
             GEKMK+LLKT+ E++SN LAMVT +   L +L++  + SR+LL E      +        
Sbjct  179   GEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQLGNVASRKLLSEEGRFASKPNAGRKLQ  238

Query  2528  --------------------QF-VDSATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNS  2415
                                  F +DS  RHLL A   +P+ VV+QDGSG+F TI+ A+ +
Sbjct  239   LSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSATSLKPNAVVSQDGSGQFNTISAAIAT  298

Query  2414  IPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRC  2235
             +P+KND+  VI +KAGVYKE V++P+  N IV +G+GP KT +TG  N A+     TY  
Sbjct  299   VPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKTRVTGRLNFAEGVK--TYHT  356

Query  2234  GTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQF  2055
              TV V  + F+ +D+  ENTAGA   QAVALR S D AV +N H++ YQDTLY H+YRQ+
Sbjct  357   ATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFYNVHIDGYQDTLYAHTYRQY  416

Query  2054  YRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDI  1875
             YR CTISGT+DFIFG+A  +FQ C+ V+RKPL NQACM+TAQGR DRR   AIVIQ+ DI
Sbjct  417   YRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITAQGRVDRRSVGAIVIQNGDI  476

Query  1874  VAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEY  1695
              AEPAL  A+PP+K++LGRPWK+FS T+IM S I   + PEGWSPW G FALDT +YAEY
Sbjct  477   AAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIGGFIAPEGWSPWAGTFALDTLYYAEY  536

Query  1694  KNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             KNRGPG+    RV+WKG +  +SP++A+ +T G     DE W+  + +P+ P  +Q
Sbjct  537   KNRGPGSDVKNRVQWKGIQ-TLSPQMAESWTGGKIYGGDE-WIRISGVPYVPTMMQ  590



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   412 bits (1060),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/412 (49%), Positives = 274/412 (67%), Gaps = 29/412 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKMK+LL +S  + SN LAMV  +     +L + G +   L E   +    + Q     
Sbjct  163   GEKMKNLLHSSGMILSNGLAMVGDISSIFSSLSLGGFTSGRLLEEEGSLAYGVDQTDGED  222

Query  2525  -----------------FVDSATRHLLVA---PPRPDIVVAQDGSGKFKTITGALNSIPE  2406
                              FVD+  R ++ A     + +IVVAQDGSG+FKTITGA+NS+P+
Sbjct  223   LKTAFDGKVTDAAGPPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPK  282

Query  2405  KNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTV  2226
             K D   VI +KAG YKE V+ P+K NN+V +G+GP KT I+G++N  D     T+    +
Sbjct  283   KGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQ--TFHTAVL  340

Query  2225  IVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRG  2046
              V G+GFI +D+ IENTAG +K QAVA+R+S D ++ +N H+N +QDTLY H+YRQ+YR 
Sbjct  341   GVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYAHAYRQYYRD  400

Query  2045  CTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAE  1866
             CTI+GT+DFIFG+A  VFQ C+M+VRKPLANQ CMVTAQGRK+RR     VIQ+C I+AE
Sbjct  401   CTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAE  460

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNR  1686
             PA  +  PP K +LGRPWK+FSRT+IM + ID  + PEGW+PW+GNFALDT +Y E+KNR
Sbjct  461   PAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGEFKNR  520

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GPG+   +RV+WKG +  I+P +A  FTPG     DE W+ ++ +P+  G +
Sbjct  521   GPGSDMSRRVRWKGIQ-TITPAIADSFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   412 bits (1059),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 271/396 (68%), Gaps = 23/396 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GEKMK+LLK + EL++NAL +V+  ++ ++ L+I GI+ RRLL              V++
Sbjct  177   GEKMKNLLKNAHELSTNALDIVSSFEKQVEDLQILGINNRRLLT-------------VEA  223

Query  2513  ATRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
               R LL VAP +P++VVAQDGSG+ K+I  AL ++P  N +  VI IKAG+Y EYV V  
Sbjct  224   GNRRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNEYVQVAN  283

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                N+VF+GEGP KT ITGN+N  D  P   +   TV + G+GF+ +D+  EN+AG +K 
Sbjct  284   TMTNVVFIGEGPNKTKITGNKNYLDGLP--VFSTATVAISGQGFVAKDIGFENSAGPLKH  341

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+SA+MAV  NC ++ YQ TL TH  RQFYR CTI+GT+DFIFG+A  VFQ CK+
Sbjct  342   QAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQNCKL  401

Query  1976  VVRKP--LANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKE  1806
             + RKP  +  QA  + AQGR  + G  AI+IQ+C I AEPAL A NPP NK +LGRPWK 
Sbjct  402   IARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKL  461

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM S ID  + PEGW+PW G FALDT ++ EY+NRGPGA+TDKRV WK Y +N +
Sbjct  462   YSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPT  521

Query  1625  PEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             P+V  +FTPG  L   +    W+ +  +P+ PG ++
Sbjct  522   PDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   414 bits (1064),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/391 (52%), Positives = 271/391 (69%), Gaps = 7/391 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KM+ LLKTS ELTSN LAMV+++   L  L I  I      +     +   P +V S 
Sbjct  298   GKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRRLFAENGFPMWVSSE  357

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R  +   P   +P++VVA+DGSGK+ +I  AL  +P+ N    VI IKAGVYKE V+V 
Sbjct  358   QRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKDNPTTFVIYIKAGVYKEQVIVT  417

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   N++F+G+G TKT ITG+ N AD    GT+R  TV V G+GFI +D+  ENTAGA+K
Sbjct  418   KSMTNVMFIGDGRTKTKITGDLNYADG--TGTFRTATVGVVGDGFIAKDIGFENTAGAIK  475

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D ++ +NC ++ YQDTLY HS+RQFYR CTISGT+DFIFG++  V Q CK
Sbjct  476   HQAVALRVQSDQSIFYNCQMDGYQDTLYAHSHRQFYRDCTISGTIDFIFGDSATVLQNCK  535

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKPL NQ C+VTAQGR +RR  SA+V+Q+C I  +P        NK +LGRPWKEFS
Sbjct  536   IIVRKPLENQQCIVTAQGRIERREVSALVLQNCTISGDPEYLPVKDKNKAYLGRPWKEFS  595

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTLIM S ID+I+ PEGW PW G+FAL+T WYAE+ NRGPGA    RV W+G K+ I+  
Sbjct  596   RTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPGAVQTHRVTWRGIKK-INAA  654

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +A++FTPG FL  D+ W+ +A +P++PG ++
Sbjct  655   IARRFTPGVFLRGDD-WIPKAGVPYTPGLIR  684



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   409 bits (1050),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 271/395 (69%), Gaps = 13/395 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GE M+  LKT+ ELT N LAMVT++   L +L++P   RRLL     +      +     
Sbjct  187   GESMRKALKTAGELTQNGLAMVTEVASILTSLQMPS-KRRLLSSEQQSQCPFAMEDEFPT  245

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
             +  +A R LL A     +P+I VA+DGSGK+KTI+ AL  +P+ ++   VI IKAGVY E
Sbjct  246   WTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKAGVYHE  305

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
              V + R   +++ +G+GPTKT ITGN+N  D  P  T++  TV V G+GF+ +D+  EN+
Sbjct  306   QVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTP--TFKTATVAVIGDGFMAKDIGFENS  363

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AG  K QAVALR+ +DM++ +NC ++ YQDTLY H++RQFYR CTISGT+DFIFGN+ VV
Sbjct  364   AGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVV  423

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
              QKC++VVRKPL NQ  +VTA GRKDRR  +AI++QSC IVA+P L       + +LGRP
Sbjct  424   LQKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGRP  483

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WKE+SRT+IM + ID+++ P+GW PW G+FAL TC+YAEY NRGPGA   +RVKW+G K 
Sbjct  484   WKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKT  543

Query  1634  NI-SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +I +PE A+QFT G F+  D  W+    +P+  G 
Sbjct  544   SIMTPEKAQQFTAGRFIRGDS-WIKPTGVPYDSGL  577



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   400 bits (1028),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 266/387 (69%), Gaps = 16/387 (4%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRH  2502
             M  LL ++ EL+ NAL+M+    + +   +  G++R+LL   +           D+  R 
Sbjct  1     MVKLLNSTRELSINALSMLNSFGDMVA--QATGLNRKLLTTDSS----------DATARR  48

Query  2501  LL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNN  2325
             LL ++  +P+  VA DGSG++KTI  AL+++P+KN    +I IKAGVYKEY+ +P+   N
Sbjct  49    LLQISNAKPNATVALDGSGQYKTIKEALDAVPKKNTEPFIIFIKAGVYKEYIDIPKSMTN  108

Query  2324  IVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVA  2145
             +V +GEGPTKT ITGN++V D     T+   TV V G  F+ +++  ENTAG  KEQAVA
Sbjct  109   VVLIGEGPTKTKITGNKSVKDG--PSTFHTTTVGVNGANFVAKNIGFENTAGPEKEQAVA  166

Query  2144  LRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRK  1965
             LR+SAD A+++NC ++ YQDTLY H+YRQFYR CTI+GTVDFIFGN   V Q CK++VRK
Sbjct  167   LRVSADKAIIYNCQIDGYQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVLQNCKVIVRK  226

Query  1964  PLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P  NQ+CMVTAQGR +     AIV+Q+C+I  +    + +PP+K +LGRPWKE+SRT+IM
Sbjct  227   PAQNQSCMVTAQGRTEPIQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPWKEYSRTIIM  286

Query  1784  FSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
              S+ID  + PEGW+PW   NF  DT +YAEY+NRGPGA+ DKR+ WKG+++  + E A++
Sbjct  287   QSYIDKFIEPEGWAPWNITNFGRDTSYYAEYQNRGPGAALDKRITWKGFQKGFTGEAAQK  346

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             FT G ++  DE WL +A +P+  G ++
Sbjct  347   FTAGVYINNDENWLQKANVPYEAGMMK  373



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   407 bits (1047),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/391 (51%), Positives = 271/391 (69%), Gaps = 8/391 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttd-eeiPQFVDS  2514
             G KM+  LK+S ELTSN LAMV ++   L  + +   +R+LL +       ++   +  S
Sbjct  187   GHKMREALKSSEELTSNVLAMVDEISLALAKMNLTNFNRKLLSDDNVIGHGDDFSMWATS  246

Query  2513  ATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL   VA  +P++VVA+DGSG+F+TI  AL  IP  + +  V+ IKAGVYKE V+ 
Sbjct  247   LKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTFVLHIKAGVYKEQVVF  306

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
               K  N++ VG+GPTKT I+ N+N AD     T++  TV V G+ FI RD+  EN+AGA+
Sbjct  307   DEKMTNVMLVGDGPTKTRISFNKNYADGTT--TFKTATVSVFGDNFIARDIGFENSAGAI  364

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVAL + +DMA+ HNCH++ YQDTLY HS RQFYR CTI+GT+DF+ G+A  VFQ C
Sbjct  365   KHQAVALMVRSDMAIFHNCHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNC  424

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             KM++RKPL NQ C+VTAQGR  RR ASA+++Q+C I A+P+          +LGRPWK +
Sbjct  425   KMLIRKPLDNQQCIVTAQGRSKRREASALILQNCTITADPSYTPFKGQILSYLGRPWKAY  484

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM S+ID+I+ P+GW PW G+F L+TC+YAEYKNRGPGAST +RVKWKG K+ I+P
Sbjct  485   SRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIKK-ITP  543

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A +FT G F+  D +W+  A +P+  G L
Sbjct  544   QHAVEFTAGRFMKGD-RWIRTAGVPYVAGML  573



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   407 bits (1045),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 210/397 (53%), Positives = 270/397 (68%), Gaps = 24/397 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI----SRRLLeeptpttdeeiPQFV  2520
             EKMK+LLKT+ EL+SN LAMV+ +   +  L++  +    SRRLL E           ++
Sbjct  184   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSEDPY--------WI  235

Query  2519  DS-ATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
              S  TR LL    AP +P+ VVA DGSG+FKTI  A+N+IP+KN +  VI IKAG+YKE+
Sbjct  236   KSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKAGLYKEH  295

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIEN  2178
             V +P+K N +V +GEGP KT ITG+++ A    GG  T+   TV V GE F+ +D+  EN
Sbjct  296   VEIPKKVNGVVMIGEGPLKTRITGSKSYA----GGVKTFHTATVAVNGEDFMAKDIGFEN  351

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAGA   QAVALR+S D A+  N  ++ YQDTLY H+YRQ+YR  TISGT+DFIFG++  
Sbjct  352   TAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLA  411

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
              FQ CK +VRKP+ NQACMVTAQGR D R   AIVIQ+ DI AEPA  A  PP   +LGR
Sbjct  412   YFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGR  471

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWKE SRT+IM + I   + PEGWSPW GNFALDTC+Y EY+NRG G+   KRV WKG K
Sbjct  472   PWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIK  531

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + I+PE+A  +T G     D+ W+  A +P++P F+Q
Sbjct  532   K-ITPEIALSWTAGLAFKGDD-WIKTAGVPYNPSFMQ  566



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   405 bits (1041),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/390 (51%), Positives = 273/390 (70%), Gaps = 9/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LLKTS ELTSN L MV++++  + +  +P + RRLL E +   +EE     D  
Sbjct  185   GEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVGRRLLTEESNQQEEEPSWVGDR-  243

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL A     + D+VVA+DGSGK+KT+T ALN +P+K+++  VI +KAGVY+E VMV 
Sbjct  244   -RGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGVYQEQVMVD  302

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +    ++ +G+GPTKT IT  +N  D  P  T++  TV V G  FI +D+  EN+AGA K
Sbjct  303   KSMTWVMMIGDGPTKTKITAGKNYVDGTP--TFKTATVSVIGSNFIAKDIGFENSAGAAK  360

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM++ +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGNA  VFQ CK
Sbjct  361   HQAVALRVQSDMSIFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQNCK  420

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ C+VTAQGR  R+  +AI++Q+C I ++P        NK +LGRPWK++S
Sbjct  421   ILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWKQYS  480

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM   ID+++ PEGW PW G+FAL T +YAE  NRGPGA+TDKRVKWKG K+ I+P+
Sbjct  481   RTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIKK-ITPQ  539

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FT G F+  D  W+    +P+S G +
Sbjct  540   HALDFTVGRFIRGDP-WIKPTGVPYSSGMM  568



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   404 bits (1038),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 204/399 (51%), Positives = 268/399 (67%), Gaps = 14/399 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttd----eeiPQF  2523
             GEKMK  +K ++E+++N L ++  L   L  L+I G++RRLL+E           + P +
Sbjct  187   GEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVNRRLLQEDEVLGHDDVPSKFPSW  246

Query  2522  VDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPE---KNDRRIVILIKAGVY  2361
             VD+ TR LL APP   +P++ VA+DGSG FKTI GAL+SIP+    + +  V+ IKAGVY
Sbjct  247   VDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFVLYIKAGVY  306

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV   +  + ++ +G+GP KT ITGN+N  D     TY   TV+V G+ FI +++  E
Sbjct  307   QEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGV--NTYHTATVVVLGDNFIAKNIGFE  364

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AGA+K QAVALR+SAD AV +NC ++ YQDTLYTH+ RQFYR C+ISGT+DF+FG+AP
Sbjct  365   NSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLYTHAKRQFYRECSISGTIDFVFGDAP  424

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VVFQ CK +VRKPL NQ C+VTAQGRK RR  S I+IQ+    A P L       K +LG
Sbjct  425   VVFQNCKFLVRKPLENQQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQYKSYLG  484

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+FSRT+IM S+ID+I+ PEGW PW G F L TCWY E+ N GPG+    RVKW G 
Sbjct  485   RPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLKTCWYTEFNNYGPGSDKKARVKWNGI  544

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             K  I  + A  FTPG FL  D  W+    IP+SP   +P
Sbjct  545   K-TIDRQHALDFTPGRFLRGD-TWIKPTGIPYSPFLTRP  581



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   404 bits (1037),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/389 (51%), Positives = 267/389 (69%), Gaps = 7/389 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              EKMK  LKTSM+L+SN LAMV++    L  L+IPGISRR L E      ++ P + +  
Sbjct  188   AEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGISRRRLLEIPVLGHDDYPDWANPG  247

Query  2510  TRHLLVAPPR--PDIVVAQDGSGKFKTITGALNSIPE-KNDRRIVILIKAGVYKEYVMVP  2340
              R LL A  R  P++VVA+DGSG+F+TI  AL+ +P+ KN+   VI IKAGVY+EY+ + 
Sbjct  248   MRRLLAAGSRVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQEYLQIK  307

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   +++ +G+GP KT+ITGN+N  D  P  T++  TV V  E F+ RD+  ENTAG  K
Sbjct  308   KTVTHLMLIGDGPKKTIITGNKNFVDGTP--TFKTATVAVTAEHFMARDIGFENTAGPQK  365

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ AD AV +NC ++ YQDTLY H+ RQFYR CT+SGT+DFIFG+A  +FQ C 
Sbjct  366   HQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCT  425

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
              +VRKPL NQ C+VTA GRK+RR  SA++IQ+C I A+  L       + FLGRPWKE+S
Sbjct  426   FLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYS  485

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S+I +++ PEGW PW G++ L TC+Y EY N GPG++  KRVKW+G K  I+P+
Sbjct  486   RTIIMESYIGDLIQPEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVKWRGIK-TITPQ  544

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A  FT G F+M D +W+    +P+  G 
Sbjct  545   HALDFTAGRFVMGD-RWIKPTGVPYVSGM  572



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   403 bits (1036),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/409 (51%), Positives = 271/409 (66%), Gaps = 29/409 (7%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI----SRRLLeeptpttdeeiPQFV  2520
             EKMK+LLKT+ EL+SN LAMV+ +   +  L++  +    SRRLL +         P   
Sbjct  184   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLYGGDP--T  241

Query  2519  DSA------------TRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIV  2385
             D A            +R LL    AP +P+ VVA DGSG+FKTI  A+N+IP+KN +  V
Sbjct  242   DYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFV  301

Query  2384  ILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGE  2211
             I IKAG+YKE+V +P+K N +V +GEGP KT ITG+++ A    GG  T+   TV V GE
Sbjct  302   IFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYA----GGVKTFHTATVAVNGE  357

Query  2210  GFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISG  2031
              F+ +D+  ENTAGA   QAVALR+S D A+  N  ++ YQDTLY H+YRQ+YR  TISG
Sbjct  358   DFMAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISG  417

Query  2030  TVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKA  1851
             T+DFIFG++   FQ CK +VRKP+ NQACMVTAQGR D R   AIVIQ+ DI AEPA  A
Sbjct  418   TIDFIFGDSLAYFQNCKFIVRKPMENQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLA  477

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGAS  1671
               PP   +LGRPWKE SRT+IM + I   + PEGWSPW GNFALDTC+Y EY+NRG G+ 
Sbjct  478   TTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSG  537

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               KRV WKG K+ I+PE+A  +T G     D+ W+  + +P++P F+QP
Sbjct  538   LAKRVTWKGIKK-ITPEIALSWTAGLAFKGDD-WIKSSGVPYNPSFMQP  584



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   402 bits (1032),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 261/388 (67%), Gaps = 10/388 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMKHL+KT+ E++SN LAMVT +   L +L+I G+S R L             F+ + 
Sbjct  168   GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEGAL-----FLSNN  222

Query  2510  TRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              R LL A   +P+ VVA DGSG+F TI+ A+ S+P KN++  VI +KAG+YKEYV +P+K
Sbjct  223   QRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQIPKK  282

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     T+   TV V  + F+ +D+  ENTAG    Q
Sbjct  283   MNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVAVSADEFMAKDIGFENTAGPQGHQ  340

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D AV  N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  341   AVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFV  400

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR + R   A VIQ+ DIVAEPAL  A PP KV+LGRPWK  SRT
Sbjct  401   VRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRT  460

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V PEGW+ W GNFALDT +YAEY+NRGPG+    RVKW G + + + ++A
Sbjct  461   IIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPGIQ-HFTQQMA  519

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + +T G     DE W+  +  P+ P  +
Sbjct  520   ESWTGGRIYGGDE-WIRISGTPYVPTMM  546



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   403 bits (1036),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 266/389 (68%), Gaps = 7/389 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              EKMK  LKTSM+L+SN LAMV+++   L  L+IPGISRR L E      ++ P + +  
Sbjct  188   AEKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGISRRRLLEIPVLGHDDYPDWANPG  247

Query  2510  TRHLLVAPPR--PDIVVAQDGSGKFKTITGALNSIPE-KNDRRIVILIKAGVYKEYVMVP  2340
              R LL A  +  P++VVA+DGSG+FKTI  A++ +P+ KN+   VI IKAGVY+EYV+V 
Sbjct  248   MRRLLAAGSKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQEYVLVK  307

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   +++ +G+GP KT+ITGN+N  D  P  T++  TV V  E F+ RD+  ENTAG  K
Sbjct  308   KTLTHLMLIGDGPKKTIITGNKNFIDGTP--TFKTATVAVTAEHFMARDIGFENTAGPQK  365

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ AD AV +NC ++ YQDTLY H+ RQFYR CT+SGT+DFIFG+A  +FQ C 
Sbjct  366   HQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCT  425

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
              +VRKPL NQ C+VTA GRK+RR  SA++IQ+C       L       + FLGRPWKE+S
Sbjct  426   FLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYS  485

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S+I +++ PEGW PW G++ L TC+Y EY N GPG+   KRVKW+G K NI+P+
Sbjct  486   RTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGIK-NITPQ  544

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A  FTPG FL  D +W+    +P+  G 
Sbjct  545   HAVDFTPGRFLKGD-RWIKPTGVPYVSGL  572



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   401 bits (1031),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 260/388 (67%), Gaps = 10/388 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMKHL+KT+ E++SN LAMVT +   L +L+I G+S R L             F+ + 
Sbjct  168   GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEGAL-----FLSNN  222

Query  2510  TRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              R LL A   +P+ VVA DGSG+F TI+ A+ S+P KN++  VI +KAG+YKEYV +P+K
Sbjct  223   QRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYKEYVQIPKK  282

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     T+   TV V  + F+ +D+  ENTAG    Q
Sbjct  283   MNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVAVSADEFMAKDIGFENTAGPQGHQ  340

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D AV  N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  341   AVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFV  400

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR + R   A VIQ+ DIVAEPAL  A PP KV+LGRPWK  SRT
Sbjct  401   VRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYLGRPWKLLSRT  460

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V PEGW+ W GNFALDT +YAEY+NRGPG+    RVKW G + + + ++A
Sbjct  461   IIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPGIQ-HFTQQMA  519

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + +T G     DE W+     P+ P  +
Sbjct  520   ESWTGGRIYGGDE-WIRITGTPYVPTMM  546



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   401 bits (1030),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 201/390 (52%), Positives = 268/390 (69%), Gaps = 9/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LL+TS ELT N L MV+++   L +  +P I RRL+ E +    EE     D  
Sbjct  185   GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTEESNEQREEPSWVRDR-  243

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL A     + D VVA+DGSGK+KT+T ALN +P+K+++  VI +KAGVY+E VMV 
Sbjct  244   -RGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVMVE  302

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +    ++ +G+GPTKT IT  +N  D  P  T++  TV V G  FI +D+  EN+AGA K
Sbjct  303   KSMTWVMMIGDGPTKTKITAGKNYIDGTP--TFKTATVSVIGSNFIAKDIGFENSAGAAK  360

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+V +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGN  VVFQ CK
Sbjct  361   HQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCK  420

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ C+VTAQGR  R+  +AI++Q+C I + P        NK FLGRPWK++S
Sbjct  421   ILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYS  480

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S ID+++ PEGW PW GNFAL+T +YAE  NRGPGA+TDKRVKWKG K+ I+ E
Sbjct  481   RTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITME  539

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FT   F+  D  W+    +P++ G +
Sbjct  540   HALDFTAARFIRGDP-WIKPTGVPYTSGMM  568



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   401 bits (1030),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 201/390 (52%), Positives = 268/390 (69%), Gaps = 9/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKM  LL+TS ELT N L MV+++   L +  +P I RRL+ E +    EE     D  
Sbjct  188   GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTEESNEQREEPSWVRDR-  246

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL A     + D VVA+DGSGK+KT+T ALN +P+K+++  VI +KAGVY+E VMV 
Sbjct  247   -RGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGVYQEQVMVE  305

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +    ++ +G+GPTKT IT  +N  D  P  T++  TV V G  FI +D+  EN+AGA K
Sbjct  306   KSMTWVMMIGDGPTKTKITAGKNYIDGTP--TFKTATVSVIGSNFIAKDIGFENSAGAAK  363

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+V +NC ++ YQDTLYTH++RQFYR CTI+GT+DFIFGN  VVFQ CK
Sbjct  364   HQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCK  423

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ C+VTAQGR  R+  +AI++Q+C I + P        NK FLGRPWK++S
Sbjct  424   ILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYS  483

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S ID+++ PEGW PW GNFAL+T +YAE  NRGPGA+TDKRVKWKG K+ I+ E
Sbjct  484   RTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITME  542

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FT   F+  D  W+    +P++ G +
Sbjct  543   HALDFTAARFIRGDP-WIKPTGVPYTSGMM  571



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   400 bits (1028),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 198/389 (51%), Positives = 266/389 (68%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-PGISRRLLeeptpttdeeiPQFVDS  2514
             GEKMK++L+T+ +++SN LAMV+ +     +L++    SR+LL E           F+  
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL------FISM  222

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
               R L+    +P+ VVAQDGSG+FKTI+ A+ S+P+KN++  VI +KAGVYKEYV +P+K
Sbjct  223   KQRSLMGL--QPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKK  280

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     TY   TV V  + F  +D+  ENTAG    Q
Sbjct  281   VNKIVLIGDGPLKTRISGRKNYAEGVK--TYHTATVSVNADEFFAKDIGFENTAGPQGHQ  338

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D A+ HN H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  339   AVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFV  398

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT
Sbjct  399   VRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRT  458

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V+PEGWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A
Sbjct  459   IIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMA  517

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + +T       DE W+  + +P+ P  ++
Sbjct  518   ESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   399 bits (1026),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 266/389 (68%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-PGISRRLLeeptpttdeeiPQFVDS  2514
             GEKMK++L+T+ +++SN LAMV+ +     +L++    SR+LL E           F+  
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL------FISM  222

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
               R L+    +P+ VVAQDGSG+FKTI+ A+ S+P+KN++  VI +KAGVYKEYV +P+K
Sbjct  223   KQRSLM--GLQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKK  280

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     T+   TV V  + F  +D+  ENTAG    Q
Sbjct  281   VNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIGFENTAGPQGHQ  338

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D A+ HN H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  339   AVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFV  398

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT
Sbjct  399   VRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRT  458

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V+PEGWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A
Sbjct  459   IIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMA  517

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + +T       DE W+  + +P+ P  ++
Sbjct  518   ESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   399 bits (1025),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/389 (51%), Positives = 266/389 (68%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-PGISRRLLeeptpttdeeiPQFVDS  2514
             GEKMK++L+T+ +++SN LAMV+ +     +L++    SR+LL E           F+  
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL------FISM  222

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
               R L+    +P+ VVAQDGSG+FKTI+ A+ S+P+KN++  VI +KAGVYKEYV +P+K
Sbjct  223   KQRSLM--GLQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKEYVEIPKK  280

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     T+   TV V  + F  +D+  ENTAG    Q
Sbjct  281   VNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIGFENTAGPQGHQ  338

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D A+ HN H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  339   AVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGDAQALFQNCKFV  398

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT
Sbjct  399   VRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRT  458

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V+PEGWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A
Sbjct  459   IIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMA  517

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + +T       DE W+  + +P+ P  ++
Sbjct  518   ESWTENVMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   398 bits (1023),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/392 (50%), Positives = 270/392 (69%), Gaps = 18/392 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             ++M  L+ T+ EL+SNAL+MV    E +   +  G++R+LL             FV+++ 
Sbjct  173   DEMMKLMSTTRELSSNALSMVNSFGEMIT--QNTGLTRKLLSNSD--------SFVEASN  222

Query  2507  RHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
             R LL ++  +P+ VV+  G G++KTI  AL ++P+ +    VILIKAG YKE++ + +  
Sbjct  223   RKLLQISASKPNAVVSASGGGQYKTIQEALQAVPKSSPTPFVILIKAGTYKEHIQIEKNM  282

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
              N+V +GEGPTKT+ITG++ V    P    T+   T+ V G+GF+ +D+ IENTAG  KE
Sbjct  283   LNVVLIGEGPTKTIITGDQAVV---PNRISTWHTATLGVCGDGFVMKDMGIENTAGPTKE  339

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALRI+AD AV++NC+++ YQDTLY HS RQFYR CTI+GT+DF+FG+A  VFQ CK+
Sbjct  340   QAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKL  399

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP  NQACM+TAQGR  +      VIQ+CDI A+ AL +ANPP KV+LGRPWKEFS+
Sbjct  400   IVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADKALTSANPPVKVYLGRPWKEFSK  459

Query  1796  TLIMFSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISP  1623
             T+IM S ID  V P GWSPW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS 
Sbjct  460   TIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISG  519

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +V   FT G F+   + WL    IP+  G ++
Sbjct  520   DVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   402 bits (1032),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 264/389 (68%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT+++LT N LAMV+++  F+  L+IPG+ SRRLL    P        +V  
Sbjct  188   GETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLNSRRLLSSDYP-------SWVGP  240

Query  2513  ATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
              +RHLL A   +PDIVVAQDGSG++KTI  AL++IP+K +   V+ IKAG+YKEY+ V R
Sbjct  241   RSRHLLAATEVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKEYIQVNR  300

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                N+VF+G+GP KT+I+G++   D     T+R  TV + G+ FI +++  ENTAGA+K 
Sbjct  301   SMTNLVFIGDGPDKTIISGDKGFKDGIT--TFRTQTVAIIGDNFIAKNIGFENTAGAIKH  358

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVA+R+ +DMAV HNC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ C +
Sbjct  359   QAVAVRVQSDMAVFHNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTL  418

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKPL NQAC +TA GR+D R  +  V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  419   LVRKPLPNQACPITAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSR  478

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM +FI + V P+GW PW  +F L T +Y+E +N GPG+    RV W G K+  S ++
Sbjct  479   TIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIKKLTSKDI  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               QFTP  F+  D  W+    +P++PG L
Sbjct  539   -DQFTPAKFIQGDS-WIPATGVPYTPGLL  565



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   397 bits (1020),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 266/389 (68%), Gaps = 13/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GEKMK++L+T+ +++SN LAMV+ +     +L++    SR+LL E           F+  
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSTASRKLLSEEEADL------FISI  222

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
               R L+    +P+ VVAQDGSG+FKTI+ A+ ++P+KN++  VI +KAGVYKEYV +P+K
Sbjct  223   KQRRLMGL--QPNAVVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAGVYKEYVEIPKK  280

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
              N IV +G+GP KT I+G +N A+     T+   TV V  + F  +D+  ENTAG    Q
Sbjct  281   VNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIGFENTAGPQGHQ  338

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D A+ HN H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK V
Sbjct  339   AVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDAQALFQNCKFV  398

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP  NQACMVTAQGR +R    A VIQ+ D VAEPAL  A PP KV+LGRPWK+ SRT
Sbjct  399   VRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVYLGRPWKQLSRT  458

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I   V+PEGWS W GNFAL+T +YAEY+NRGPG+ T  RV+W G  ++ SP++A
Sbjct  459   IIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-QHFSPQMA  517

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + +T       DE W+  + +P+ P  ++
Sbjct  518   ESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   397 bits (1021),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/387 (49%), Positives = 256/387 (66%), Gaps = 7/387 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              EKMK +L  + E+ SN LA+VT       +L++   + R L          I  FV+ A
Sbjct  176   AEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRLMGEDEQQQPGIDSFVEFA  235

Query  2510  TRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   +   +P+  VAQDGSG FKTI  AL+++P+K++   VI +KAGVYKE V++P
Sbjct  236   RRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATFVIHVKAGVYKETVIIP  295

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +K NN+V  G+GP KT +  N+N AD     T+   T+ V  +GF+ +D+  EN+AGA K
Sbjct  296   KKVNNVVIYGDGPNKTRVVNNKNYADGVE--TFHTATLAVNSDGFMAKDIAFENSAGASK  353

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVA+R+S D A+ +N  ++ YQDTLY H YRQ YR CTISGT+DFIFG+A  VFQKC+
Sbjct  354   HQAVAVRVSGDKAIFYNVVMDGYQDTLYAHGYRQLYRNCTISGTIDFIFGDATAVFQKCR  413

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             M+VRKP  NQ CMVTAQGRKD+R     VIQ  +IV EP   A  P    FLGRPWKE+S
Sbjct  414   MIVRKPDINQNCMVTAQGRKDQRSIGITVIQDSEIVPEPGFTAVVPKIDAFLGRPWKEYS  473

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM ++ID  + P GWSPW GN+AL+T +Y EY+NRGPG+ T KRV WKG K+ I+PE
Sbjct  474   RTIIMQTYIDGFIDPAGWSPWMGNYALNTLYYGEYQNRGPGSDTSKRVTWKGIKK-ITPE  532

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             +A+ FT     + D  W+  + +P++P
Sbjct  533   LAQTFTAQKVFLND-GWVTNSSVPYTP  558



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   397 bits (1019),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/392 (50%), Positives = 269/392 (69%), Gaps = 18/392 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             ++M  L+ T+ EL+SNAL+MV    E +   +  G++R+LL             FV+++ 
Sbjct  173   DEMMKLMSTTRELSSNALSMVNNFGEMIT--QNTGLTRKLLSNSD--------SFVEASN  222

Query  2507  RHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
             R LL ++  +P+ VV+  G G++KTI  AL ++P  +    VILIKAG YKE++ + +  
Sbjct  223   RKLLQISASKPNAVVSTSGGGQYKTIQEALQAVPRSSPTPFVILIKAGTYKEHIEIEKNM  282

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
              N+V +GEGPTKT+ITG++ V    P    T+   T+ V G+GF+ +D+ IENTAG  KE
Sbjct  283   LNVVLIGEGPTKTIITGDQAVV---PNRISTWHTATLGVCGDGFVMKDMGIENTAGPTKE  339

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALRI+AD AV++NC+++ YQDTLY HS RQFYR CTI+GT+DF+FG+A  VFQ CK+
Sbjct  340   QAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKL  399

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP  NQACM+TAQGR  +      VIQ+CDI A+ AL +ANPP KV+LGRPWKEFS+
Sbjct  400   IVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADQALTSANPPVKVYLGRPWKEFSK  459

Query  1796  TLIMFSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISP  1623
             T+IM S ID  V P GWSPW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS 
Sbjct  460   TIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISG  519

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +V   FT G F+   + WL    IP+  G ++
Sbjct  520   DVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   399 bits (1024),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/447 (47%), Positives = 276/447 (62%), Gaps = 63/447 (14%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI------------------------PG  2583
             GEKMK+LLKT+ E++SN LAMV ++   + +L++                        PG
Sbjct  178   GEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQLGNAASRKLLLSEKIGYGGDPTDYAPG  237

Query  2582  IS---------RRLLeeptpttdeeiPQFV-------------------------DSATR  2505
                        RRLL   +   +  + Q V                         DS  R
Sbjct  238   EEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGYGGDPTDYAPGEEPHFNLDSNRR  297

Query  2504  HLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKN  2328
             HLL A   +P+ VVAQDGSG+F TI+ A+ S+P KN++  VI +KAGVYKEYV +P+K N
Sbjct  298   HLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVYKEYVQIPKKMN  357

Query  2327  NIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAV  2148
              IV +G+GP KT I+G +N A+     TY   TV V  + F+ +D+  ENTAGA+  QAV
Sbjct  358   KIVLIGDGPLKTRISGRKNFAEGVK--TYHTATVAVNADDFLAKDIGFENTAGALGHQAV  415

Query  2147  ALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVR  1968
             ALR+S D AV +N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+A  +FQ CK VVR
Sbjct  416   ALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVR  475

Query  1967  KPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP  NQACM+TAQGR +R      VIQ+ DIVAEPAL  A+PP+KV+LGRPWK  SRT+I
Sbjct  476   KPGPNQACMITAQGRVERHSLGVTVIQNGDIVAEPALLQASPPHKVYLGRPWKLLSRTII  535

Query  1787  MFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M S I   + PEGW+PW G FALDT +YAEY+NRGPG+    RV WKG ++ +SP++A+ 
Sbjct  536   MQSNIGGFIAPEGWAPWAGTFALDTLYYAEYQNRGPGSDLKARVTWKGIQK-LSPQMAES  594

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +T G     DE W+  + +P+ P  +Q
Sbjct  595   WTGGKLFGGDE-WIRGSGVPYVPTMMQ  620



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   397 bits (1020),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/391 (50%), Positives = 266/391 (68%), Gaps = 10/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G +MK +L++S ELTSN LAMVT++   L +  +P  +SRRLL        E    ++  
Sbjct  191   GLRMKAMLRSSQELTSNGLAMVTEISSILASYNLPFNVSRRLLSSEDGDDTEL--SWLSD  248

Query  2513  ATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL A  +    D+VVA+DGSGK++T+  AL  IP+K ++  VI IK GVYKE VM 
Sbjct  249   GKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKEQVMF  308

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              +   +++ +G+GPTKT ITG+ N  D     T++  TV V G  FI +D+  EN+AG  
Sbjct  309   AKSMTHVMIIGDGPTKTRITGSLNFIDGVQ--TFKTATVSVIGSNFIAKDIGFENSAGPQ  366

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ +DM++ +NCH++ YQDTLY H++RQFYR C I+GT+DFIFG++  VFQ C
Sbjct  367   KHQAVALRVQSDMSIFYNCHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNC  426

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             KMV+RKPL NQ C+VTAQGR +RR A+A+V+Q+C I  +PA       NK +LGRPWKEF
Sbjct  427   KMVIRKPLDNQNCIVTAQGRTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEF  486

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM S ID+++ PEGW PW G+FAL+TC+Y E  NRGPG+  D RVKW+G K+ +  
Sbjct  487   SRTIIMNSRIDDVIAPEGWLPWAGDFALNTCFYTEILNRGPGSKLDGRVKWRGIKK-VPA  545

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A ++TPG F+  D  W+  A +P+  G L
Sbjct  546   QRAVEYTPGRFIRGD-WWIKAAGVPYVSGML  575



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   396 bits (1017),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 198/395 (50%), Positives = 266/395 (67%), Gaps = 12/395 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--RRLLeeptpttdeeiP--QF  2523
             GEKM+  L  + ELTSN LAMVT++   L  L +  +S  RRLL++             +
Sbjct  180   GEKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGNRRLLQDSEVQVLGHGEFPMW  239

Query  2522  VDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
             +D   R LL A      +PD+VVA+DGSGK+KTIT AL  IP ++++  V+ +K GVY+E
Sbjct  240   MDPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVYRE  299

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
              ++  +K   +  +G+GPTKT I  N N  D     T++  TV V GE F+ +D+  EN 
Sbjct  300   QIIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGV--NTFKTATVAVLGEQFLAKDIGFEND  357

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AGA+K QAVALR+ +D +V +NCH++ YQDTLYTH++RQFYR CTISGT+DFIFG+A  +
Sbjct  358   AGAIKHQAVALRVQSDFSVFYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAI  417

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ CKM+VRKPL NQ C+VTAQGRK+RR  SAI++Q+C I A+ +        + FLGRP
Sbjct  418   FQNCKMLVRKPLDNQQCIVTAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRP  477

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WKE+SRT+IM SFID+I+ PEGW PW G+F + TC+Y+E+ NRGPG+S   RVKWKG K 
Sbjct  478   WKEYSRTIIMQSFIDDIIQPEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-  536

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              I+P  A  FT G FL  +  WL +  +PFS G +
Sbjct  537   TITPAHAVDFTVGTFLRGN-TWLPKFGVPFSAGMV  570



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   394 bits (1011),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 264/389 (68%), Gaps = 14/389 (4%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATR  2505
             +M  L+ T+ EL+ NAL+MV    E +   +  G++R+LL +           FV+++ R
Sbjct  174   QMVKLMNTTRELSINALSMVNSFGEMI--TQTTGLTRKLLSDSD--------SFVEASNR  223

Query  2504  HLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKN  2328
              L+ ++  +P+ VV+  G G++KTI  A+N++P+ N    VILIKAG YKE++ + + K 
Sbjct  224   KLVQISASKPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFVILIKAGTYKEHIEIDKNKP  283

Query  2327  NIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAV  2148
             N+VF+GEGPTKT+ITG+R V        + C  + V GEGF+ +D+ IENTAG  KEQAV
Sbjct  284   NVVFIGEGPTKTIITGDRGVKHDGYATWHTCA-LGVAGEGFVIKDIGIENTAGPAKEQAV  342

Query  2147  ALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVR  1968
             ALRI+AD AVVHNC ++ YQDTLY HS+RQFYR CTI+GTVDFIFG+A  VFQ CK++VR
Sbjct  343   ALRINADKAVVHNCKIDGYQDTLYAHSFRQFYRDCTITGTVDFIFGDASAVFQNCKLIVR  402

Query  1967  KPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP   QACM+TAQGR         VIQ+CDI A+PA  +  PP K +LGRPWKE+S+T+I
Sbjct  403   KPGNAQACMITAQGRTVPTSFGGFVIQNCDIKADPAFTSTTPPIKAYLGRPWKEYSKTII  462

Query  1787  MFSFIDNIVVPEGWSPWKG-NFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEVA  1614
             M S ID  + P GW+PW   +F L TC+YAEY+NRGPGA+  KRV  W+GY++ IS +  
Sbjct  463   MQSNIDAFIDPTGWAPWNSTDFGLHTCFYAEYQNRGPGAALGKRVSTWRGYQKGISGDAI  522

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              ++T G F+   + WL +  IP+  G ++
Sbjct  523   NKYTAGKFINTQQPWLPKFDIPYDAGMMK  551



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   394 bits (1011),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/392 (49%), Positives = 261/392 (67%), Gaps = 14/392 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GEKMK LL  S +LTSN LAMV  +   LK L IPG+ SRRLLE            +V+ 
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEADDEFP-----SWVNG  241

Query  2513  ATRHLLV----APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
               R LL+    A  + D +VAQDGSG++KTI  A+  IP+KN+   V+ IK GVYKE V 
Sbjct  242   GKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKEQVS  301

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             + R   +++ +G+GPTKT ITGN N A+     T++  TV + G+ F+ +D+  EN+AGA
Sbjct  302   LARSHTHVLMIGDGPTKTKITGNLNYANGVQ--TFKTATVSISGDHFMAKDIGFENSAGA  359

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
             +  QAVALR+ ADM+V +NC ++ YQDTLY H+ RQFYR CTI+GT+DFIFG+A  VFQ 
Sbjct  360   IGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQN  419

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             CK+VVRKPL NQ C+VTAQGR + R  +  VIQ+C I A+P        NK +LGRPW+E
Sbjct  420   CKLVVRKPLENQQCIVTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRE  479

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
              SRT++M S ID+++ PEGW PW GNF L+T +Y+EY N+G GA    RVKW G K+ ++
Sbjct  480   LSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIKK-LT  538

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  539   PEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   393 bits (1009),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 201/397 (51%), Positives = 264/397 (66%), Gaps = 28/397 (7%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI------SRRLLeeptpttdeeiPQ  2526
             EKMK+LLKT+ EL+SN LAMV+ +   +  L++  +      SRRL              
Sbjct  185   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND----------  234

Query  2525  FVDSATRHLL--VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               D   R +L   A  +P+ VVAQDGSG+FKTI  A++S+P+ N++  VI IKAGVYKE+
Sbjct  235   --DWIKRRVLRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVYKEH  292

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIEN  2178
             V +P+K N IVF+G+GP KT ITG+++ A    GG  T++  TV V  E F  +++  EN
Sbjct  293   VEIPKKMNKIVFIGDGPLKTRITGSKSFA----GGVKTFQTATVAVNSEEFTAKNIGFEN  348

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAGA   QAVALR+S D AV +N  ++ YQDTLY H+YRQFY  C+ISGT+DFIFG++  
Sbjct  349   TAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDSLS  408

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             +FQ CK +VRKP+ NQACMVTAQGR D R   AIVIQ+  I AE A  A  P    +LGR
Sbjct  409   LFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYLGR  468

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWKE SRT+IM S ID  + P+GWSPW GNFALDTC+Y EY+NRG G+    RV WKG K
Sbjct  469   PWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIK  528

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  529   K-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  563



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   392 bits (1007),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 264/395 (67%), Gaps = 27/395 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS------RRLLeeptpttdeeiP  2529
             GEKMK LLKT  ELTSN L MVT L   L  L+I GI       RRLL            
Sbjct  162   GEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQI-GIGNVSAGRRRLLS-----------  209

Query  2528  QFVDSATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
              + +   R +L    R + VVA DGSG++K+I  A+N+ P KN R  VI +KAG+Y+EYV
Sbjct  210   DWAEPKMR-MLAGGIRANAVVALDGSGQYKSINAAINAAPSKNARPFVIHVKAGLYREYV  268

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIENT  2175
              VP+ K NIV +G+G T+T ITG +N+A    GG  T+   T  V  + F  +D+ IENT
Sbjct  269   EVPKHKTNIVILGDGATRTRITGRKNLA----GGVKTFATATFAVNADDFTAKDIGIENT  324

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AG    QAVALR++ D AV++N +++ +QDTLY H++RQFYR C ISGT+DF+FGNA  +
Sbjct  325   AGPEGHQAVALRVTGDRAVLYNLNIDGFQDTLYAHAHRQFYRNCRISGTIDFVFGNALSI  384

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C+ +VRKP+ANQACMVTAQGR  R    AIVIQ+ +I AE A   A P  + +LGRP
Sbjct  385   FQNCQFIVRKPMANQACMVTAQGRDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAYLGRP  444

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WK+FS T+IM S+I   + P+GW+PW G+FALDTC+YAEY+NRGPG++T +RVKWKG K 
Sbjct  445   WKQFSTTIIMSSYIGGSISPQGWAPWAGSFALDTCYYAEYRNRGPGSNTSQRVKWKGIK-  503

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +I P+ A ++ PG     D+QW+ RA +P+  G +
Sbjct  504   HIDPQTAARYAPGK-AYGDDQWIRRAGVPYVSGMM  537



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   393 bits (1009),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 201/399 (50%), Positives = 264/399 (66%), Gaps = 30/399 (8%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI------SRRLLeeptpttdeeiPQ  2526
             EKMK+LLKT+ EL+SN LAMV+ +   +  L++  +      SRRL              
Sbjct  185   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND----------  234

Query  2525  FVDSATRHLLV----APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
               D   R +L     A  +P+ VVAQDGSG+FKTI  A++S+P+ N++  VI IKAGVYK
Sbjct  235   --DWINRRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYIKAGVYK  292

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTI  2184
             E+V +P+K N IVF+G+GP KT ITG+++ A    GG  T++  TV V  E F  +++  
Sbjct  293   EHVEIPKKMNKIVFIGDGPLKTRITGSKSFA----GGVKTFQTATVAVNAEEFTAKNIGF  348

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA   QAVALR+S D AV +N  ++ YQDTLY H+YRQFY  C+ISGT+DFIFG++
Sbjct  349   ENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFGDS  408

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               +FQ CK +VRKP+ NQACMVTAQGR D R   AIVIQ+  I AE A  A  P    +L
Sbjct  409   LSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDAYL  468

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWKE SRT+IM S ID  + P+GWSPW GNFALDTC+Y EY+NRG G+    RV WKG
Sbjct  469   GRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKG  528

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  529   IKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  565



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   392 bits (1008),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 258/390 (66%), Gaps = 12/390 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--RRLLeeptpttdeeiPQFVDS  2514
             EKMK LL T+ E+ SN LA+VT       +L++   +  RRL+ E     D+    FV S
Sbjct  178   EKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLMGEGEENPDDG---FVQS  234

Query  2513  ATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             A R LL   +   + ++ VAQDGSG+FKTI  AL ++P+K++   VI +KAGVYKE V+V
Sbjct  235   ARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVKAGVYKETVIV  294

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
             P+K NN+V  G+GP KT +  N+N AD     T+   T+ V  +GF+ +D+  EN+AG  
Sbjct  295   PKKVNNVVIYGDGPEKTRVVNNKNYADGVQ--TFHTATLAVNSDGFMAKDIAFENSAGPT  352

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+S D AV +N  ++ YQDTLY H YRQFYR CTISGT+DF+FG+A  VFQKC
Sbjct  353   KHQAVAVRVSGDKAVFYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVFGDATAVFQKC  412

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             + +VRKP  NQ CMVTAQGRKD R     VIQ+ +IV E    A  P    FLGRPWKE+
Sbjct  413   RFIVRKPDINQNCMVTAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKIDAFLGRPWKEY  472

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRTLIM +FID  + P GWSPW GN+ L+T +Y EY+N+GPGA T KRV WKG ++ I+P
Sbjct  473   SRTLIMNTFIDGFIDPAGWSPWMGNYGLNTLYYGEYQNKGPGADTSKRVTWKGIQK-ITP  531

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             E+A  FT     + D  W+  + +P++PG 
Sbjct  532   EIALSFTAQKVYLND-GWVTNSSVPYTPGL  560



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   390 bits (1002),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 268/388 (69%), Gaps = 15/388 (4%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDSATR  2505
             MK  LKT+++LT N LAMV+++  +L  +E+P + SRRLL +  P        +VD   R
Sbjct  1     MKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP-------SWVDGRVR  53

Query  2504  HLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
              LL AP    +PD+VVAQDGSG++KTI  AL ++P+KN+   V+ IK+G YKEYV V R 
Sbjct  54    RLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQVNRT  113

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N+VF+G+GPTK++I+GN++  D     TYR  TV + G+ FI +++  ENTAGA+  Q
Sbjct  114   MPNLVFIGDGPTKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGALNYQ  171

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ C ++
Sbjct  172   AVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLL  231

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPLANQAC +TA GRKD R ++  V+Q C I  E    A    +K +LGRPWKE+S+T
Sbjct  232   VRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKT  291

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM +FI + +  EGWSPW+GNF LDT +Y+E +N GPGA+   RV W+G K+ +S E  
Sbjct  292   IIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEI  350

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++TP  ++  D+ W+    +P++PGF 
Sbjct  351   VEYTPAKYIQGDD-WIPGKGVPYTPGFF  377



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   392 bits (1006),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 193/389 (50%), Positives = 261/389 (67%), Gaps = 8/389 (2%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             + M   L +S  LTSNALA++  +   L + ++  + RRLL +      E    +V +  
Sbjct  193   DNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLGRRLLSDDEGERGEFP-SWVGNDK  251

Query  2507  RHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
             R LL    +   PD+ VAQDGSGK+KTIT AL+++P+K +   VI IK GVYKE VMV R
Sbjct  252   RKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKEGVYKENVMVDR  311

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                N++  G+GPTKT ITG+ N  D     T++  T+ V G+GFI ++L +ENTAGA K 
Sbjct  312   SMTNVMMFGDGPTKTKITGSLNYVD--GTSTFKTATLAVVGDGFIGKNLGVENTAGAAKH  369

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+ +D +V + C ++ YQDTLYTH+ RQFYR CTISGT+DF+FG+A VVFQ C M
Sbjct  370   QAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLM  429

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ANQ C+VTAQGRKDR  A+ IV+ +C I A+P L +A+     +LGRPWKE+SR
Sbjct  430   LVRKPMANQQCIVTAQGRKDRHEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSR  489

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM S ID ++  +GW PW G F L TC+Y E  NRGPGA+T KRV WKGYK+ +    
Sbjct  490   TIIMQSQIDGLINEDGWQPWLGEFGLKTCFYTEIGNRGPGAATTKRVTWKGYKK-VDLTH  548

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A ++T   F+   + WL +  +PF+PG +
Sbjct  549   AHKYTVQQFIQG-KTWLPKTGVPFTPGLM  576



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   393 bits (1010),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 263/391 (67%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMVT++  +L  ++IP + SRRLL +  P        ++D 
Sbjct  123   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFP-------SWMDG  175

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
              TR LL +P    + DIVVAQDGSG++KTI  ALN +P+K +   V+ IK G+YKEYV V
Sbjct  176   RTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQV  235

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTVI+G++N  D     TYR  TV + G+ FI +++  ENTAGA+
Sbjct  236   NRSMTHLVFIGDGPDKTVISGDKNYKDGI--TTYRTATVAIVGDHFIAKNMGFENTAGAI  293

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  294   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  353

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C I  EP        +K +LGRPWKE+
Sbjct  354   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEY  413

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M +FI + + PEGW PW GNFALDT +Y+E +N GPGA   KRV W G K+ +S 
Sbjct  414   SRTIFMNTFIPDFIPPEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIKK-LSE  472

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P+ PG  
Sbjct  473   EEILKFTPAEYIQGD-AWIPGKGVPYIPGLF  502



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   395 bits (1015),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 270/391 (69%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT+++LT N LAMV+++  +L  +E+P + SRRLL +  P        +VD 
Sbjct  183   GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP-------SWVDG  235

Query  2513  ATRHLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PD+VVAQDGSG++KTI  AL ++P+KN+   V+ IK+G YKEYV V
Sbjct  236   RVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQV  295

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   N+VF+G+GPTK++I+GN++  D     TYR  TV + G+ FI +++  ENTAGA+
Sbjct  296   NRTMPNLVFIGDGPTKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGAL  353

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ C
Sbjct  354   NYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNC  413

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPLANQAC +TA GRKD R ++  V+Q C I  E    A    +K +LGRPWKE+
Sbjct  414   TLLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEY  473

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + +  EGWSPW+GNF LDT +Y+E +N GPGA+   RV W+G K+ +S 
Sbjct  474   SKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSE  532

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  533   EEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   392 bits (1006),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/394 (49%), Positives = 265/394 (67%), Gaps = 11/394 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ----F  2523
             GEKM+ +LKTSMEL+SN LA+V ++   L  L++  ++RRLL +     D  I      +
Sbjct  186   GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLSDDPADPDNHIDDEFPYW  245

Query  2522  VDSATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               S  R LL   V+  +P++ VA+DGSG FKTI  A+  +P+ +++  ++ IK G+Y+E 
Sbjct  246   SHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQ  305

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V + +   N++ VG+GPTKT ITG+ N  D  P  T++  TV V G+GFI + +  EN+A
Sbjct  306   VQINKTFTNLMMVGDGPTKTKITGSLNFVDGTP--TFKTATVAVLGDGFIAKGIGFENSA  363

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             GA K QAVALR+ +D ++ +NC ++ YQDTLYTH+ RQFYR CTISGT+DFIFG+A V+F
Sbjct  364   GAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIF  423

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKPL NQ C+VTAQGRK+RR  SAI+IQ+    A+P         K +LGRPW
Sbjct  424   QNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPW  483

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT+IM S+I++++ P GW PW G+FAL TC+Y E++NRGPGA T  RVKW+G K  
Sbjct  484   KEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-T  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             I P  A  F PG FL  D +W+    +P++ G  
Sbjct  543   IKPSHAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   390 bits (1002),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/392 (49%), Positives = 260/392 (66%), Gaps = 14/392 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GEKMK LL  S +LTSN LAMV  +   LK L IPG+ SRRLLE            +V+ 
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEADDEFP-----SWVNG  241

Query  2513  ATRHLLV----APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
               R LL+    A  + D +VAQDGSG++KTI  A+  IP+K +   VI IK GVYKE V 
Sbjct  242   GKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKEQVS  301

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             + R   +++ +G+GPTKT ITGN N A+     T++  TV + G+ F+ +D+  EN+AGA
Sbjct  302   LARSHTHVLMIGDGPTKTKITGNLNYANGVQ--TFKTATVSISGDHFMAKDIGFENSAGA  359

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
             +  QAVALR+ ADM+V +NC ++ YQDTLY H+ RQFYR CTI+GT+DFIFG+A  VFQ 
Sbjct  360   IGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQN  419

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             CK+VVRKPL NQ C+VTAQGR + R  +  VIQ+C I A+P        NK +LGRPW+E
Sbjct  420   CKLVVRKPLDNQQCIVTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRE  479

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
              SRT++M S ID+++ PEGW PW G+F L+T +Y+EY N+G GA    RVKW G K+ ++
Sbjct  480   LSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIKK-LT  538

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  539   PEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   392 bits (1006),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/402 (49%), Positives = 261/402 (65%), Gaps = 18/402 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP------  2529
             GE+MK  LKTS ELT NALAMV ++   L  L+IP ++RR L     + +          
Sbjct  193   GERMKKALKTSGELTENALAMVDEISSILNQLQIPALNRRRLFSTKESAESSETPTTAED  252

Query  2528  ---QFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPE-KNDRRIVILIK  2373
                 ++ +  R LL   P    +PD+VVA+DG+G F TI  AL S+P+ K ++ I++ IK
Sbjct  253   DIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEALESLPKTKENKTIIMYIK  312

Query  2372  AGVYKEYVMVPRK-KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICR  2196
              GVY E V + R    + +  G+GPT+T ITG+ N  D  P  T++  TV V   GFIC+
Sbjct  313   EGVYSEIVEISRNLTGSFIMYGDGPTRTKITGSLNFIDGTP--TFKTATVSVNAHGFICK  370

Query  2195  DLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFI  2016
             D+ IEN AGA K QAVAL++ ADM V  NC ++ YQDTLY HS R F+R CTISGT+D+I
Sbjct  371   DIGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTLYAHSGRHFFRDCTISGTIDYI  430

Query  2015  FGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPN  1836
             FGN   +FQ CKMV+RKP+ NQA +VTAQGRK  R  SAIV+Q C I A+P+L       
Sbjct  431   FGNGESIFQNCKMVIRKPMVNQANIVTAQGRKTEREVSAIVLQGCTISADPSLVPEKNVF  490

Query  1835  KVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+IM + ID+ + P+GW PW G+F L TC+YAE+ NRGPGA    RV
Sbjct  491   KSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQTCYYAEFNNRGPGAVLTNRV  550

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW G K  ++PE A+++T  P++ AD+ W+    IP+ PG +
Sbjct  551   KWPGIKTPLTPEQAQEYTAAPYIQADD-WVKPLGIPYVPGLM  591



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   389 bits (998),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/396 (48%), Positives = 261/396 (66%), Gaps = 13/396 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKMK LLK++ ELTSN LAM+ ++   L  L+IPGISRRLL + +   +    +     
Sbjct  192   GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLSDESGKGEYRSDEGGLYP  251

Query  2525  -FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +     R L  A P   +P+++VAQDGSGK+KTI  AL  IP+  +   V+ +K GVYK
Sbjct  252   SWASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYK  311

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V   +   N++ +G+GPTKT I+G+ N  D    GT+R  TV   G  F+ +D+  EN
Sbjct  312   EQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGI--GTFRTATVAAVGSNFMAKDIGFEN  369

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
              AGA K QAVALR+ +DMA+ +NC ++ YQDTLY H++RQFYR CTI+GT+DFIFG++ V
Sbjct  370   NAGASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAV  429

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             VFQ C ++VRKPL NQ C+VTAQGR +RR  + IV+Q+C I A           K +LGR
Sbjct  430   VFQNCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGR  489

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK FSRT+IM S ID+++ PEGW PW G+F L+TC+YAEY NRGP ++T  RV W+G K
Sbjct  490   PWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIK  549

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + I+ +    FT G F+ +   WLG + +P++   +
Sbjct  550   Q-ITGQHVNDFTVGRFI-SGHLWLGASGVPYTSDMM  583



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   394 bits (1011),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/394 (49%), Positives = 265/394 (67%), Gaps = 11/394 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ----F  2523
             GEKM+ +LKTSMEL+SN LA+V ++   L  L++  ++RRLL +     D  I      +
Sbjct  186   GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLSDDPADPDNHIDDEFPYW  245

Query  2522  VDSATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               S  R LL   V+  +P++ VA+DGSG FKTI  A+  +P+ +++  ++ IK G+Y+E 
Sbjct  246   SHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQ  305

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V + +   N++ VG+GPTKT ITG+ N  D  P  T++  TV V G+GFI + +  EN+A
Sbjct  306   VQINKTFTNLMMVGDGPTKTKITGSLNFVDGTP--TFKTATVAVLGDGFIAKGIGFENSA  363

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             GA K QAVALR+ +D ++ +NC ++ YQDTLYTH+ RQFYR CTISGT+DFIFG+A V+F
Sbjct  364   GAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIF  423

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKPL NQ C+VTAQGRK+RR  SAI+IQ+    A+P         K +LGRPW
Sbjct  424   QNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPW  483

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT+IM S+I++++ P GW PW G+FAL TC+Y E++NRGPGA T  RVKW+G K  
Sbjct  484   KEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-T  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             I P  A  F PG FL  D +W+    +P++ G  
Sbjct  543   IKPSHAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   391 bits (1004),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/391 (49%), Positives = 267/391 (68%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT+++LT N LAMV+++  +L  +E+P + SRRLL +  P        +VD 
Sbjct  183   GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP-------SWVDG  235

Query  2513  ATRHLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PD+VVAQDGSG++KTI  AL ++P+KN+   VI IK+G YKEYV V
Sbjct  236   RVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIKSGTYKEYVQV  295

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   N+VF+G+GP K++I+GN++  D     TYR  TV + G+ FI +++  ENTAGA+
Sbjct  296   NRTMPNLVFIGDGPDKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGFENTAGAL  353

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTI+GT+DF+FG+A  VFQ C
Sbjct  354   NYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNC  413

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPLANQAC +TA GR D R ++  V+Q C I  E    A    +K +LGRPWKE+
Sbjct  414   TLLVRKPLANQACPITAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEY  473

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + +  EGWSPW+GNF LDT +Y+E +N GPGA+   RV W G K+ +S 
Sbjct  474   SKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWPGIKK-LSE  532

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  533   EEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   388 bits (997),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 261/393 (66%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ SRRLL +  P        +VD 
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSRRLLAQEIP-------SWVDQ  239

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  240   RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  300   QVNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAG  357

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  358   AIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  417

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  418   NCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  477

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + + P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   
Sbjct  478   EYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLS  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  538   NEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   387 bits (995),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/393 (49%), Positives = 262/393 (67%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  +EIPG+ SRRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMEIPGLNSRRLLAQEIP-------SWVDQ  237

Query  2513  ATRHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL      +  +PDIVVAQDGSG++ TI  AL ++P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVVHIKAGLYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+GN+N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  298   QVNKSMTHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
              +K QAVA+R+ +D ++  NC  + YQDTLYTHS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  356   PIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + V P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   
Sbjct  476   EYSRTIIMNTFIPDFVQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALASRVTWPGIKTLS  535

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  ++  +  W+    +P++PG L
Sbjct  536   NDEILK-FTPDQYIQGN-VWVPGKGVPYTPGLL  566



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   390 bits (1001),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 192/393 (49%), Positives = 262/393 (67%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ SRRLL E  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP-------SWVDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVVHIKAGIYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+GN++  D     TYR  TV + G+ FI +++  ENTAG
Sbjct  298   QVNKSMTHLVFIGDGPEKTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+ +D A+  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ
Sbjct  356   AIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + V P+GW PW+G+F L T +Y+E +N GPGA+   RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFVQPQGWQPWQGDFGLKTLFYSEVQNTGPGATVANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E   +FTP  ++  D  W+    +P++ G L
Sbjct  535   SDEDILKFTPAQYIQGD-TWVPGKGVPYTSGLL  566



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   389 bits (998),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 260/391 (66%), Gaps = 14/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT+++LT N LA+VT++ +F+  ++I G+ SRRLL             +VD+
Sbjct  188   GETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLNSRRLLSSNGYP------SWVDA  241

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL A     +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAGVYKEY+ V
Sbjct  242   RARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIKAGVYKEYIQV  301

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              +   ++VF+G+GP KT+I+G++   D     TYR  TV + G+ FI +D+  ENTAGA+
Sbjct  302   NKSMTDLVFIGDGPDKTIISGDKGFKDGIT--TYRTQTVAIVGDRFIAKDIGFENTAGAI  359

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +DM+V +NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ C
Sbjct  360   KHQAVAVRVQSDMSVFYNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNC  419

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GR+D R  +  V Q C I  EP   +    +K +LGRPWK +
Sbjct  420   TLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAY  479

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM +FI + V P+GW PW G+F L T +Y+E +N GPG+    RV W G K+  + 
Sbjct  480   SRTIIMNTFIPDFVQPQGWQPWNGDFGLSTLFYSEIQNTGPGSDVVNRVTWAGIKKLTNN  539

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++  QFTP  F+  D  W+    +P++PGF 
Sbjct  540   DLL-QFTPAQFIQGDS-WIPATGVPYTPGFF  568



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   390 bits (1002),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 265/391 (68%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMVT++  +L  ++IP + SRRLL +  P        ++D+
Sbjct  184   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFP-------SWMDA  236

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PDIVVAQDGSG++KTI  ALN +P+K +   V+ IK G+YKEYV V
Sbjct  237   RARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQV  296

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTVI+G+++  D     TY+  TV + G+ FI +++  ENTAGA+
Sbjct  297   NRSMTHLVFIGDGPDKTVISGSKSYKDGI--TTYKTATVAIVGDHFIAKNIAFENTAGAI  354

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ AD ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  355   KHQAVAIRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  414

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C IV EP   A    +K +LGRPWKE+
Sbjct  415   TLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEY  474

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM +FI + V PEGW PW G F L+T +Y+E +N GPGA+  KRV W G K+ +S 
Sbjct  475   SRTIIMNTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIKK-LSD  533

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P+  G  
Sbjct  534   EEILKFTPAQYIQGD-AWIPGKGVPYILGLF  563



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   388 bits (996),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/393 (49%), Positives = 263/393 (67%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ SRRLL E  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP-------SWVDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++KTI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +  +++VF+G+GP KT+I+GN+N  D     TYR  TV + G  FI +++  ENTAG
Sbjct  298   QVNKTMSHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGNYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D ++  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ
Sbjct  356   AIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + V P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  535   SEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   390 bits (1001),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 263/391 (67%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMV+++  +L  L+IP +S RRLL +  P        ++D+
Sbjct  182   GETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMSSRRLLSQDFP-------SWMDA  234

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PDIVVAQDGSG++KTI  AL ++P+K +   V+ IK G+YKEYV V
Sbjct  235   RARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIKGGIYKEYVQV  294

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+G  KTVITG++N  D     TY+  TV + G+ FI +++  ENTAG +
Sbjct  295   NRSMTHLVFIGDGSDKTVITGDKNYKDGI--TTYKTATVAIVGDHFIAKNIGFENTAGPI  352

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ AD ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  353   KHQAVAIRVLADQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  412

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C IV EP   A    +K +LGRPWKEF
Sbjct  413   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEF  472

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM +FI + + PEGW PW GNF L+T +Y+E +N GPG+   KRV W G K+ +S 
Sbjct  473   SRTIIMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVRNIGPGSGLTKRVTWPGIKK-LSE  531

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E    FTP  ++  D  W+    +P+ PG  
Sbjct  532   EEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  561



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   386 bits (991),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/393 (48%), Positives = 257/393 (65%), Gaps = 11/393 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVD--  2517
              E+MK +L TSM L+SNALAMV+++      L  P  S R L +          +F D  
Sbjct  195   AEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSSHRRLLQFDAFPVIGHSEFEDPK  254

Query  2516  ---SATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
                   R L  AP   +PDI+VA+DGSG +KTIT AL+ +P+  +   +I IK GVY E+
Sbjct  255   WYEGGVRKLSSAPKINKPDIIVAKDGSGSYKTITEALDHVPKYGNETFIIYIKEGVYNEH  314

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             ++V R   +++ +G+G  KT ITGN+N AD  P  TY   TV ++G+ F+ RD+  EN+A
Sbjct  315   ILVTRSMTSVMMIGDGANKTRITGNKNFADGTP--TYHTATVAIQGDHFMARDIGFENSA  372

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+SAD A+ + C ++ YQDTLYTH+ RQFY  CTISGT+DF+FG+A  VF
Sbjct  373   GPEKHQAVALRVSADEAIFYRCSMDGYQDTLYTHAQRQFYCDCTISGTIDFVFGDATAVF  432

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  ++RKPL NQ+C+VTAQGRK+RR  SAI+IQ+  I AEP        NK +LGRPW
Sbjct  433   QNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENKAYLGRPW  492

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KE+SRT+IM S+ID+++ PEGW PW+G + L TC+YAE  N GP A+  +RV W+G K+ 
Sbjct  493   KEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAESGNTGPAANKARRVTWRGIKQ-  551

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             I+      FTPG F   D +W+  + +P+ PG 
Sbjct  552   ITENHTADFTPGRFFRGD-KWIRLSGVPYIPGL  583



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   384 bits (985),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/389 (48%), Positives = 257/389 (66%), Gaps = 13/389 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             EKM  L+ T+ ELT N L MV    + +   +  G++R+LL              ++++ 
Sbjct  173   EKMAKLMNTTQELTLNVLYMVDSFGQMIT--QTTGLTRKLLSNSD--------SIIEASN  222

Query  2507  RHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
             R LL ++  +P+ VV+ DGSG++KTI  A+N++P+KN +  VILIK G+YKE + + + K
Sbjct  223   RKLLQISSAQPNAVVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEGIYKENIEIEKDK  282

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
              N+V +GEGPTKT+ITG+  V +     T+   T+ V G GF+ +D+ I+NTAG  KEQA
Sbjct  283   LNVVLIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIGIQNTAGPEKEQA  342

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR++AD A V+NC ++ YQDTLY HS RQFYR C I+GT+DF+FG A  VFQ CK++V
Sbjct  343   VALRVNADKAAVYNCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVFQNCKLIV  402

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP   Q CM+TAQG  D +     VIQ+CDI AEP   A NP  K +LGRPWK +SRT+
Sbjct  403   RKPGDTQNCMMTAQGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPWKMYSRTI  462

Query  1790  IMFSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEV  1617
             IM S ID  +  EGW+PW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+++IS + 
Sbjct  463   IMQSNIDAFINSEGWAPWNTTDFGIHTCFYAEYQNRGPGATLDKRVSHWRGYQKDISGDT  522

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +FT   F+  + QWL  A IP+    +
Sbjct  523   INKFTADKFINTNPQWLPVADIPYEADMM  551



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   384 bits (987),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 263/398 (66%), Gaps = 18/398 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKM+  LKTS ELTSN LAMV+++    K+L I    RRLL+     TDE+  Q     
Sbjct  181   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKSLNIK-TGRRLLQAAATATDEKRFQRAKII  239

Query  2525  --FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGV  2364
               ++D     L  A P   +PD+VV++ G GK+KTI  AL  IP+ N+ ++ VI +K GV
Sbjct  240   PAWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGV  299

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E+V   +   N++ +G+GPTKTVITG RN AD     TY   TV V G+ FI +D+  
Sbjct  300   YDEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQ--TYLTATVGVVGDYFIAKDVGF  357

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA+  QAVALR+ +D+++ +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A
Sbjct  358   ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  417

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               VFQ CKM+VRKPL NQACMVTAQGR DRR  SA+++Q+C I  E         NK +L
Sbjct  418   AAVFQNCKMIVRKPLENQACMVTAQGRLDRRSPSALILQNCTISGERGYD--KELNKAYL  475

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK ++R ++M S ID+++ PEGW  W G    +TCW+ E+ NRG GA   KRV W+G
Sbjct  476   GRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRG  535

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  536   MKK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   386 bits (992),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 264/391 (68%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMV+++  +L  ++IP + SRRLL +  P        ++D 
Sbjct  183   GETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEMNSRRLLSQEFP-------SWMDG  235

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    + DIVVAQDGSG++KTI  ALN +P+K +   V+ IKAG+YKEYV V
Sbjct  236   RARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIKAGIYKEYVQV  295

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTVI+G+++  D     TY+  TV + G+ FI +++  ENTAGA+
Sbjct  296   NRSMTHLVFIGDGPEKTVISGSKSYKDGI--TTYKTATVAIVGDHFIAKNIGFENTAGAI  353

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  354   KHQAVAIRVLSDESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  413

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C IV EP   A    +K +LGRPWKE+
Sbjct  414   TLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEY  473

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM +FI + + PEGW PW G+F L+T +Y+E +N GPGA   KRV W G K+ +S 
Sbjct  474   SRTIIMNTFIPDFIPPEGWQPWLGDFGLNTLFYSEVQNTGPGAPITKRVTWPGIKK-LSE  532

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E    FTP  ++  D  W+    +P+ PG  
Sbjct  533   EEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  562



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   387 bits (993),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 191/393 (49%), Positives = 260/393 (66%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ SRRLL E  P        ++D 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP-------SWLDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTFVVHIKAGLYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+GN+N  D     TYR  TV + G  FI +++  ENTAG
Sbjct  298   QVNKSMTHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGNYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+ +D ++  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ
Sbjct  356   AIKHQAVALRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R  +  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + V P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E   +FTP  ++  D  W+    +P++PG L
Sbjct  535   SDEDILKFTPAQYIQGD-TWVPGKGVPYTPGLL  566



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   384 bits (986),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/396 (48%), Positives = 255/396 (64%), Gaps = 13/396 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptptt-----deeiPQ  2526
              EKMK  LKTSM L+SN L MV+++      L++  + RRL  +   +        +  +
Sbjct  188   AEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMGRRLFSDEEESELPVLGHSDEAE  247

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
             +     R L+   P   +P+IVVA+DGSGK+ TI  AL  IP +++   VI IK GVYKE
Sbjct  248   WFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKEGVYKE  307

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
             YV + R   N++ +G+G  KT ITG++N  D +P  T    TV+V G+ F  RD+  ENT
Sbjct  308   YVTIERNMTNLLIIGDGANKTRITGDKNFIDGFP--TSLTATVVVLGDHFRARDIGFENT  365

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AGA K QAVALR++AD A+ + C ++ YQDTLYTH+ RQFYR C +SGT+DF+FG+A  V
Sbjct  366   AGAHKHQAVALRVNADEAIFYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAV  425

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C+ +VR+P+ NQ C+VTAQGRK+RR  SAI+IQ+   VA+P           +LGRP
Sbjct  426   FQNCRFIVRRPMDNQQCIVTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRP  485

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGA-STDKRVKWKGYK  1638
             WKEFSRT+IM SFID+++ P GW PW G+F L TC+Y E+ NRGPGA    +R KWKG K
Sbjct  486   WKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWKGVK  545

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              NI+ + A+ FTPG F   D  W+ R  IP+  G  
Sbjct  546   -NITAKHARDFTPGSFFKGD-WWIKRTGIPYVSGMF  579



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   382 bits (981),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 196/396 (49%), Positives = 264/396 (67%), Gaps = 23/396 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-------PGISRRLLeeptpttdeeiP  2529
             EKMK+LLKT+ EL+SN+LAMV+ +   L  L++           RRL+ E          
Sbjct  161   EKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGASSGRRLMSEEEEPYW----  216

Query  2528  QFVDSATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
                 +  R L   P +P+ VVAQDGSG+FKTI  A+N+IP+KN++  +I IKAG+YKE+V
Sbjct  217   ----TKGRLLAANPLKPNAVVAQDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGLYKEHV  272

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIENT  2175
              +P+K N +VF+G+GP KT ITG+++ A    GG  T++  TV V GE F  +++  ENT
Sbjct  273   EIPKKVNKVVFIGDGPFKTRITGSKSFA----GGVKTFQTATVAVNGEEFTAKNIAFENT  328

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AGA   QAVALR+SAD A+  N  ++ YQDTLY H+YRQ+YR CTISGT+DFIFG++  +
Sbjct  329   AGAEGHQAVALRVSADKAIFQNVAIDGYQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCL  388

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C  +VRKP+ NQACMVTAQGR D R   AIVIQ+  I AEPA  +  P    +LGRP
Sbjct  389   FQNCVFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRP  448

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WKE SRT+IM S ID  + P+GWSPW GNFALDT +Y EY+NRG G+    RV WKG  +
Sbjct  449   WKELSRTIIMQSEIDGFISPKGWSPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGI-Q  507

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +++ + A+++T G     DE W+  + +P+ P  +Q
Sbjct  508   HMTQQKAEEWTGGAAFRGDE-WITSSGVPYVPTLMQ  542



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   394 bits (1013),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/392 (50%), Positives = 263/392 (67%), Gaps = 20/392 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK  LK SMELTSNALAMV ++  FL+ + +   S              +P + D  
Sbjct  174   GQKMKDALKISMELTSNALAMVAEISTFLEAMGMQSFSE-------------LPDWADFN  220

Query  2510  TRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL A P+   PD+VVA+DGSGK++TI  AL  IP+K+++  V+ IK GVY+E V + 
Sbjct  221   KRKLLTASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEEKVQIN  280

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
                 +++ VG+GPTKT ITG+ N  D    GTY+  TV V+G+ FI +++  EN+AGA K
Sbjct  281   SSLTHLMMVGDGPTKTRITGHLNFIDGT--GTYQTATVAVQGDDFIAKEIGFENSAGAAK  338

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+SAD ++ +NCH++ YQDTLY H+YRQFY+ C ISGTVDFIFG++  VFQ C 
Sbjct  339   HQAVALRVSADKSIFYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCT  398

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             +VVRKP+ NQ C+VTAQGRKD R  + IVIQ+C  VA+P L         +LGRPWKE+S
Sbjct  399   LVVRKPMDNQQCIVTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYS  458

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM SF+D+ + P+GW  W   FAL+T +Y E+ NRGP A   KRVKW G K  + P 
Sbjct  459   RTIIMESFLDDFIQPDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVKE-LPPS  517

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               ++FTPG FL  + +W+   Q+P++ GF+ P
Sbjct  518   RVQRFTPGEFLDGN-RWIPPTQVPYAAGFIFP  548



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   382 bits (981),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 260/390 (67%), Gaps = 16/390 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             ++M  L+ T+ EL+ NAL+MV    E +   +  G++R+LL             FV+++ 
Sbjct  173   DEMVKLMNTTRELSINALSMVNSFGEMI--TQTTGLTRKLLSNSD--------SFVEASN  222

Query  2507  RHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
             R LL ++  +P+ VV+  G G++KTI  A+N++P+ N    +ILIKAG YKE++ + + K
Sbjct  223   RKLLQISAAKPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFIILIKAGTYKEHIEIEKSK  282

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
              N+VF+GEG TKT+ITG+R V +     T+    + V GEGF+ RD+ +ENTAG  KEQA
Sbjct  283   PNVVFIGEGATKTIITGDRGVKNGGGYATWHTCALGVAGEGFVIRDIGLENTAGPEKEQA  342

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALRI+AD A+V+NC ++ +QDTLY HS+RQFYR C I+GT+DF+FG+A  VFQ C+++V
Sbjct  343   VALRINADKAIVYNCKIDGFQDTLYAHSFRQFYRDCIITGTIDFMFGDASAVFQNCQIIV  402

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP   QACMVTAQGR         VIQ+CDI  EP   +     K +LGRPWKEFS+T+
Sbjct  403   RKPGNTQACMVTAQGRTVPTSVGGFVIQNCDIKPEPGFPST---TKAYLGRPWKEFSKTI  459

Query  1790  IMFSFIDNIVVPEGWSPWK-GNFALDTCWYAEYKNRGPGASTDKRVK-WKGYKRNISPEV  1617
             IM S ID  + P GW+PW   +F + TC+YAEY+NRGPGA+ DKRV  W+GY+R IS + 
Sbjct  460   IMQSNIDAFIDPSGWAPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQRGISGDA  519

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
               QFT G F+  +  WL +  IP+  G ++
Sbjct  520   INQFTAGKFINTESPWLPKGDIPYDAGMMK  549



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   382 bits (980),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 261/391 (67%), Gaps = 12/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             G +M+  LK++ ++T+N L +V +L   L +L++PG+S RRLLE+           +V  
Sbjct  194   GVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMSGRRLLEDDDREMP----SWVSD  249

Query  2513  ATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R L+    A  +PD+VVAQDGSGK+KTI  AL  +P K+++  VI +KAG+YKE V++
Sbjct  250   GKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVKAGIYKEIVVI  309

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
             P+   ++   G+GPTKTV+TG+ N  D     T++  T    G  F  RD+  ENTAGA 
Sbjct  310   PKHMTHLTMYGDGPTKTVVTGSLNFIDGIQ--TFKTATFSAIGANFYARDMGFENTAGAA  367

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ +D ++  NC ++ YQDTLY H++RQFYR CTISGT+DF+FGNA   FQ C
Sbjct  368   KHQAVALRVQSDRSIFFNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNC  427

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             K+VVRKPL NQ C+VTA GR +R+  +A++ QSC  + +PA       NK +LGRPWKE+
Sbjct  428   KLVVRKPLDNQQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEY  487

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+I+ S ID+I+ PEGW PW G+F L+T +YAE +N+G GA   KRVKW+G K +I+P
Sbjct  488   SRTIIIGSTIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGAGADESKRVKWRGIK-HITP  546

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FTP  F+  D  W+    IP+S G +
Sbjct  547   QHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  576



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   384 bits (986),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/393 (48%), Positives = 260/393 (66%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  ++  +++PG+ SRRLL +  P        +VD 
Sbjct  186   GETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLNSRRLLADEVP-------SWVDQ  238

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       + DIVVAQDGSG++ TI  A+ ++P+K +   V+ IKAG+YKEYV
Sbjct  239   RGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVHIKAGIYKEYV  298

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V R   ++VF+G+GP KT+I+GN+N  D     TYR  TV + G+ FI +++  ENTAG
Sbjct  299   QVNRSMTHLVFIGDGPDKTIISGNKNFKDGIT--TYRTATVAIVGDHFIAKNIGFENTAG  356

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D A+  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG+A  VFQ
Sbjct  357   AIKHQAVAVRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQ  416

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR+D R  +  V Q C I  EP   A    +K +LGRPWK
Sbjct  417   NCTLLVRKPLPNQACPITAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWK  476

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM SFI + V P+GW PW G+F L T +Y+E +N GPGA+   RV W G K   
Sbjct  477   EYSRTIIMNSFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNIGPGAALASRVTWAGIKTLS  536

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K F P  F+ +D  W+    +P+ PG L
Sbjct  537   NEEILK-FAPAEFIQSDA-WVPGKGVPYIPGLL  567



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   382 bits (980),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/396 (47%), Positives = 261/396 (66%), Gaps = 13/396 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKMK LL ++ ELTSN LAMV+++   L +  +    RRLL        ++        
Sbjct  182   GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGAGGGTKKNTPKVIPV  241

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVYK  2358
             ++D  T  +  A P   +PD+ VA+DGSG+ K+I  A+  IP+ N D+  VI +K GVY 
Sbjct  242   WIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYN  301

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             EYVM+ +   N++ +G+GPTKT ITGN+N AD     T++  TV V G+ F+ +D+  EN
Sbjct  302   EYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTK--TFQTATVAVVGDYFVAKDIGFEN  359

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             +AGA   QAVALR+ +D+++ +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A V
Sbjct  360   SAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAV  419

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             VFQ CKM+VRKP+ NQACMVTAQGR DRR  +A+V+Q+C I  +P        +K +LGR
Sbjct  420   VFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGR  479

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK  +RT++M S ID+I+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K
Sbjct  480   PWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIK  539

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  540   K-LTPEHAVDFTAGR-LMEGDKWIKPSGVPYVAGMV  573



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   384 bits (987),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/393 (48%), Positives = 262/393 (67%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ SRRLL E  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP-------SWVDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++KTI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +  +++VF+G+GP KT+I+GN+N  D      YR  TV + G  FI +++  ENTAG
Sbjct  298   QVNKTMSHLVFIGDGPDKTIISGNKNYKDGITA--YRTATVAIVGNYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D ++  NC  + YQ+TLYTHS+RQF+R CTISGT+DF+FG+A  VFQ
Sbjct  356   AIKHQAVAVRVQSDESIFFNCRFDGYQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + V P+GW PW G+F L T +Y+E +N GPG++   RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  535   SEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   381 bits (979),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/391 (47%), Positives = 262/391 (67%), Gaps = 12/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             G +M+  LK++ E+T+N L +V +L   L +L+IPG++ RRLLE+           ++  
Sbjct  193   GTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMTGRRLLEDDDHEMP----SWISD  248

Query  2513  ATRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R L+    A  +PD++VAQDGSGK+KTI  AL  +P K+++  VI +KAG+YKE V++
Sbjct  249   GKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKEIVVI  308

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
             P+   ++   G+GPTKTV+TG+ N  D     T++  T    G  F  RD+  ENTAG+ 
Sbjct  309   PKHMTHLTMYGDGPTKTVVTGSLNFIDGIQ--TFKTATFSAIGANFYARDMGFENTAGSA  366

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ +D ++ +NC ++ YQDTLY H++RQFYR CTISGT+DF+FGNA   FQ C
Sbjct  367   KHQAVALRVQSDRSIFYNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNC  426

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             K+VVRKP+ NQ C+VTA GR +R+  +A++ Q C  + +PA       NK +LGRPWK++
Sbjct  427   KLVVRKPMDNQQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQY  486

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+I+ S ID+I+ PEGW PW G+F L+T +YAE +N+GPGA   KRVKW+G K +I+P
Sbjct  487   SRTIIIGSQIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGPGAVETKRVKWRGIK-HITP  545

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FTP  F+  D  W+    IP+S G +
Sbjct  546   QHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  575



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   382 bits (982),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 260/393 (66%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  ++IPG+ S RLL +  P        +V+ 
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSCRLLAQEIP-------SWVNQ  239

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  240   RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  300   QVNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAG  357

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  358   AIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  417

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  418   NCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  477

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + + P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   
Sbjct  478   EYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLS  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  538   NEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   382 bits (981),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 256/392 (65%), Gaps = 15/392 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GE MK  LKT++ELT N LA+++++  F+  ++IPG++ R L             +VD  
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGLNSRGLLAQEIP------SWVDQR  240

Query  2510  TRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
                LL A       +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV 
Sbjct  241   GPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYVQ  300

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             V +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAGA
Sbjct  301   VNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIAKNIGFVNTAGA  358

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
             +K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ 
Sbjct  359   IKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQN  418

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWKE
Sbjct  419   CTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKE  478

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM +FI + + P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K   +
Sbjct  479   YSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSN  538

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              E+ K FTP  ++  D  W+    +P++PG L
Sbjct  539   EEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   381 bits (978),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 190/398 (48%), Positives = 262/398 (66%), Gaps = 18/398 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKM+  LKTS ELTSN LAMV+++    K L I    RRLL+     TDE+  Q     
Sbjct  182   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQAAATATDEKRFQKAKII  240

Query  2525  --FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGV  2364
               ++D     L  A P   +PD+VV++ G GK+KTI  AL  IP+ N+ ++ VI +K GV
Sbjct  241   PAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGV  300

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E+V   +   N++ +G+GPTKTVITG +N A+     TY+  TV V G+ FI +D+  
Sbjct  301   YDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQ--TYQTATVAVVGDYFIAKDIGF  358

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA+  QAVALR+ +D+++ +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A
Sbjct  359   ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  418

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               VFQ CKM+VRKPL NQACMVTA GR DRR  +A+++Q+C I  E         NK +L
Sbjct  419   AAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTALILQNCTISGESGYD--KELNKAYL  476

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK ++R ++M S ID+++ PEGW  W G    +TCW+ E+ NRG GA   KRV W+G
Sbjct  477   GRPWKSYARAIVMQSQIDDVIAPEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRG  536

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  537   MKK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  572



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   381 bits (978),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 191/398 (48%), Positives = 260/398 (65%), Gaps = 18/398 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKM+  LKTS ELTSN LAMV+++    KTL I    RRLL+     TDE   Q     
Sbjct  182   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIK-TGRRLLQAAATATDENRFQRAKII  240

Query  2525  --FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGV  2364
               ++D     L  A P   +PD+VV+  G GK+KTI  AL  IP+ N+ ++ VI +K GV
Sbjct  241   PAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGV  300

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E+V   +   N++ +G+GPTKTVITG +N A+     TY+  TV V G+ FI +D+  
Sbjct  301   YDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQ--TYQTATVAVVGDYFIAKDIGF  358

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA+  QAVALR+ +D+++ +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A
Sbjct  359   ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  418

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               VFQ CKM+VRKPL NQACMVTA GR D R  SA+++Q+C I  E         NK +L
Sbjct  419   AAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYN--KELNKAYL  476

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK ++R ++M S ID+++ PEGW  W G    +TCW++E+ NRG GA   KRV W G
Sbjct  477   GRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSG  536

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  537   MKK-LTPEHAADFTAGKFMFGD-RWILPSGVPYVAGMM  572



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   389 bits (998),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 261/391 (67%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMVT++  +L  ++IP + SRRLL +  P        ++D 
Sbjct  184   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFP-------SWMDG  236

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
              TR LL AP    + DIVVAQDGSG++KTI  ALN +P+K +   V+ IK G+YKEYV V
Sbjct  237   RTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQV  296

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTVI+G++N  D     TY+  TV + G+ FI +++  ENTAGA+
Sbjct  297   NRSMTHLVFIGDGPDKTVISGDKNYKDGI--TTYKTATVAIVGDHFIAKNMGFENTAGAI  354

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  355   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSC  414

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C IV EP        +K +LGRPWKE+
Sbjct  415   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEY  474

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M +FI + + PEGW PW GNF L+T +Y+E  N GPGA   KRV W G K+ +S 
Sbjct  475   SRTIFMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVGNTGPGADVTKRVTWPGIKK-LSE  533

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   + TP  ++  D  W+    +P+ PG  
Sbjct  534   EEILKITPAEYIQGD-AWIPGKGVPYIPGLF  563



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   380 bits (977),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/398 (47%), Positives = 258/398 (65%), Gaps = 16/398 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVD--  2517
              E+MK++LKTSM L+SNALAMV+++      L  P  S R L +          +F D  
Sbjct  195   AEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPSHRRLLQFDAFPVIGHSEFEDPK  254

Query  2516  ---SATRHLLV-----APP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
                   R LL      AP   +PDI+VA+DGSG +KTIT AL  +P+  +   +I IK G
Sbjct  255   WYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVPKYGNETFIIYIKEG  314

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +Y E+++V R   N++ +G+G  KT ITGN+N  D     TY   TV ++G+ F+  D+ 
Sbjct  315   IYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDG--TTTYHTATVAIQGDHFMVMDIG  372

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
              EN+AG  K QAVALR+SAD A+ + C ++ YQDTLYTH+ RQFYR CTISGT+DF+FG+
Sbjct  373   FENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLYTHAQRQFYRDCTISGTIDFVFGD  432

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  +FQ C  ++RKPL NQ+C+VTAQGRK+RR  SAI+IQ+  I A+P        NK +
Sbjct  433   ATAIFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITADPDYFPVKDENKAY  492

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM S+ID+++ PEGW PW+G + L TC+YAE  N GP A+  +RV W+
Sbjct  493   LGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAELGNTGPAANKARRVTWR  552

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             G K+ I+   A  FTPG F   D +W+  + +P+ PG 
Sbjct  553   GIKK-ITENHAADFTPGRFFRGD-KWIRLSGVPYIPGL  588



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   384 bits (985),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 259/391 (66%), Gaps = 15/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMVT++  +L  ++IP + SRRLL +  P        ++D 
Sbjct  186   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPELNSRRLLSQEFP-------SWMDG  238

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PDIVVAQDGSG++ TI  A+N +P+K +   V+ IKAG+YKE+V V
Sbjct  239   RARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIKAGIYKEFVQV  298

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTVI+G+++  D     TYR  TV + G+ FI +++  ENTAGA+
Sbjct  299   NRSMTHLVFIGDGPDKTVISGSKSFKDGIT--TYRTTTVAIVGDHFIAKNMGFENTAGAI  356

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  357   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  416

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKPL NQAC +TA GRKD R  +  V+Q C I  E    A    +K +LGRPWKE+
Sbjct  417   TFLVRKPLPNQACPITAHGRKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEY  476

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM +FI + + PEGW PW  NF L+T +Y+E +N GPGA    RV W G K+    
Sbjct  477   SRTIIMNTFIPDFIPPEGWQPWLDNFGLETLFYSEVRNTGPGAPAMNRVTWPGIKKLGEE  536

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E+ K FTP  ++  D  W+    +P++PG  
Sbjct  537   EILK-FTPAQYIQGD-AWIPGKGVPYTPGLF  565



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   378 bits (970),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 260/397 (65%), Gaps = 14/397 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFV---  2520
             GEKMKH L T+ +LTSN LAMVT++   L +L +    RRLL      ++ +    V   
Sbjct  184   GEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGSNAKNAPKVIPT  243

Query  2519  -DSATRHLLVA-----PPRPDIVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVY  2361
               +  R L V+       +PD VVA+DGSG+++TI  A+  IP+ N D+  VI +K GVY
Sbjct  244   WINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVY  303

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              EYVM+ +   N++ +G+G TKT +TG++N A      T++  TV+V G+ FI +D+ IE
Sbjct  304   SEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAGVQ--TFQTATVVVVGDYFIAKDIGIE  361

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AGA   QAVALR+ +D+++ + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A 
Sbjct  362   NSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  421

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VVFQ CKM+VRKP+ NQACMVTAQGR DRR  S I++Q+C I  +P        NK +LG
Sbjct  422   VVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLG  481

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK  +RT++M S ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G 
Sbjct  482   RPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSDMSKRVKWSGI  541

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K N+  + A  FT G F+  D +W+  + +P+  G +
Sbjct  542   K-NLGADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   377 bits (969),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 183/396 (46%), Positives = 260/396 (66%), Gaps = 13/396 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKMK LL ++ ELTSN LAMV+++   L +  +    RRLL        ++        
Sbjct  182   GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGAGGDTKKNTPKIIPV  241

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVYK  2358
             ++D     +  A P   +PD+ VA+DGSG+ K+I  A+  IP+ N D+  VI +K GVY 
Sbjct  242   WIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYN  301

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E+VM+ +   N++ +G+GPTKT ITGN+N AD     T++  TV V G+ F+ +D+  EN
Sbjct  302   EHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTK--TFQTATVAVVGDYFVAKDIGFEN  359

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             +AGA   QAVALR+ +D+++ +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A V
Sbjct  360   SAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAV  419

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             VFQ CKM+VRKP+ NQACMVTAQGR DRR  +A+V+Q+C I  +P        +K +LGR
Sbjct  420   VFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGR  479

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK  +RT++M S ID+I+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K
Sbjct  480   PWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIK  539

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  540   K-LTPEHAVDFTAGR-LMEGDRWIKPSGVPYVAGMV  573



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   377 bits (969),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 257/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  + IP + SRRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPELNSRRLLSQDIP-------SWVDQ  237

Query  2513  ATRHLLVAP-----PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       + DIVVAQDGSG++ TI  A+  +P+K +   V+ IKAGVYKEYV
Sbjct  238   RGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVHIKAGVYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  298   QVNKSMTHLVFIGDGPDKTIISGSKNYKDGIT--TYRTATVAIIGDYFIAKNIGFVNTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  356   AIKHQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GRKD R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + + P+GW PW GNF LDT +Y+E +N GPGA+   RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNIGPGAALAGRVTWPGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E    FTP  ++  D  W+    +P++PG L
Sbjct  535   SDEEILSFTPDQYIQGD-VWVPGKGVPYTPGLL  566



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   379 bits (974),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 257/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA++++L  F+  ++IP + SRRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQGIP-------SWVDQ  237

Query  2513  ATRHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL      +  +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+G  KT+I+GN++  D     TYR  TV + G+ FI +++  ENTAG
Sbjct  298   QVNKSMTHLVFIGDGADKTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+ +D A+  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ
Sbjct  356   AIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM +FI + + P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +
Sbjct  476   EYSRTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E    FTP  ++  D  W+    +P++PG L
Sbjct  535   SDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   376 bits (966),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 256/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GE+MK ++KT+ +LTSN LA+VT+L +   + +IP  +RRLL            ++V  +
Sbjct  197   GEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIPNFNRRLLSTSNEGFP----EWVSQS  252

Query  2510  TRHLLV----APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
              R L      A   PD+VVAQDGSG   T+  AL  +P    +  VI +K G+YKE V +
Sbjct  253   KRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYKENVNI  312

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              +   N+  +G+GPTK+VIT   N  D     T+   TV V G GF+ +++  EN+AGA 
Sbjct  313   EKNMTNVFMIGDGPTKSVITAGLNFVDGVK--TFNTATVGVVGNGFVAKNMGFENSAGAE  370

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ +D ++ +NC ++ YQDTLY H++RQFYR CTISGT+DFIFGN+ VVFQ C
Sbjct  371   KHQAVALRVESDFSIFYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVFQNC  430

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             ++VVRKPL NQ   +TAQGR DRR  +A+++ +C IVA+P           +LGRPWKE+
Sbjct  431   QIVVRKPLDNQQNTITAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLPTYLGRPWKEY  490

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SR  I+ S ID++V P GW PW G+FAL+T +Y+EY NRGPGA+T +RVKW+G K +I+ 
Sbjct  491   SRAFILQSEIDDLVQPAGWLPWAGDFALNTLFYSEYDNRGPGAATAERVKWRGLK-SITA  549

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E A++FT   FL   E W+  A +PF PG +
Sbjct  550   EHAEKFTVARFLGGTE-WIKNASVPFIPGLI  579



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   375 bits (964),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 258/398 (65%), Gaps = 18/398 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             G KM+  LKTS ELTSN LAMV+++    K L I    RRLL++    TDE   Q     
Sbjct  181   GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQDAATATDENRFQRAKII  239

Query  2525  --FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGV  2364
               ++D+    L  A P   +PD+VV++ G GK+KTI  AL  IP+ N+ ++ VI +K GV
Sbjct  240   PAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGV  299

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E+V   +   N++ +G+GPTKTVITG +N AD     TY+  TV V G+ FI +D+  
Sbjct  300   YDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ--TYQTATVAVVGDYFIAKDVGF  357

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA+  QAVALR+ +D+++ +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A
Sbjct  358   ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  417

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               VFQ CKM+VRKPL NQACMVTA GR D R  SA+++Q+C I  E         NK +L
Sbjct  418   AAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYL  475

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPW   +R ++M S ID+++ PEGW  W G    +TCW+ E+ NRG GA   KRV W G
Sbjct  476   GRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSG  535

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  536   MKK-LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   375 bits (964),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/390 (49%), Positives = 253/390 (65%), Gaps = 11/390 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQF---V  2520
             G++MK  LK SMEL++N LA+V+ +   + +LE  G  RRLL++  P        F    
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQDDLPVLGHGDQIFPTWT  247

Query  2519  DSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
             D   R LL AP    + DIVVA+DGSG F TI  AL+ +P K+ +  V+ IKAG+Y+EY+
Sbjct  248   DFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKAGIYQEYI  307

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
                +   N++ +G+G   T I GN+N  D     TY   TV+V G+ F+ +++  EN AG
Sbjct  308   DFNKSMTNLMVIGDGRETTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNIGFENNAG  365

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+SAD A+ +NC ++ +QDT+YTH+ RQFYR C+ISGT+DF+FG+A  VFQ
Sbjct  366   AIKHQAVALRVSADYALFYNCSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQ  425

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              CK ++RKPL NQ C+VTAQGRK RR  SAI+IQ+  I A P L       K +LGRPWK
Sbjct  426   NCKFLIRKPLENQQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWK  485

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM SFID+++ PEGW PW G F L TCWY E+ N GPG+S   RVKW G K  I
Sbjct  486   EFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TI  544

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
               + A  FTPG F      W+    IP++P
Sbjct  545   DRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   375 bits (963),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/398 (47%), Positives = 258/398 (65%), Gaps = 18/398 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             G KM+  LKTS ELTSN LAMV+++    K L I    RRLL++    TDE   Q     
Sbjct  184   GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQDAATATDENRFQRAKII  242

Query  2525  --FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGV  2364
               ++D+    L  A P   +PD+VV++ G GK+KTI  AL  IP+ N+ ++ VI +K GV
Sbjct  243   PAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGV  302

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E+V   +   N++ +G+GPTKTVITG +N AD     TY+  TV V G+ FI +D+  
Sbjct  303   YDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ--TYQTATVAVVGDYFIAKDVGF  360

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             ENTAGA+  QAVALR+ +D+++ +NC+++ YQDTLYT ++RQFYR CTISGT+DFIFG+A
Sbjct  361   ENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDA  420

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
               VFQ CKM+VRKPL NQACMVTA GR D R  SA+++Q+C I  E         NK +L
Sbjct  421   AAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYL  478

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPW   +R ++M S ID+++ PEGW  W G    +TCW+ E+ NRG GA   KRV W G
Sbjct  479   GRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSG  538

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  539   MKK-LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  574



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   379 bits (974),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/391 (47%), Positives = 259/391 (66%), Gaps = 14/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT+++LT N LAMV+++   L  ++ P + SRRLL +           ++D 
Sbjct  184   GETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPELNSRRLLSQDQFP------SWLDV  237

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL  P    +PD+VVAQDGSG++KTI  AL ++P+K +   V+ IK G+YKEYV V
Sbjct  238   RARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIKEGIYKEYVQV  297

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   ++VF+G+GP KTV++G+++  D     TYR  TV + G+ FI +++  ENTAGA+
Sbjct  298   NRSMPDLVFIGDGPDKTVLSGDKSFKDGIT--TYRTATVGIIGDHFIAKNMGFENTAGAI  355

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA+R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  356   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  415

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GRKD R ++  V+Q C I  E    A    +K +LGRPWKE+
Sbjct  416   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEY  475

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + V  +GW PW+GNF LDT +Y+E +N GPGA    RV W G K+ +S 
Sbjct  476   SKTIIMNTFIPDFVPAQGWQPWQGNFGLDTLFYSEVRNTGPGAPVTNRVTWPGIKK-LSE  534

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P++PG  
Sbjct  535   EEVLEFTPSRYIQGD-AWIPGKGVPYTPGLF  564



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   375 bits (963),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 256/393 (65%), Gaps = 14/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK +L TS +LTSN LAMVT L   L+ L++ G++ R L             ++  A
Sbjct  195   GQKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLAQGNDNFP---SWLSPA  251

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   P   +P++VVAQDGSG++KTI  A+ +IP+  +   V+ IK GVYKE V   
Sbjct  252   KRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVVTFS  311

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGT--YRCGTVIVEGEGFICRDLTIENTAGA  2166
             R   +I+ +G+GPTKT ITG+ + A    GG   Y+  TV V G  F+ +D+  EN+AGA
Sbjct  312   RSLTHIMLIGDGPTKTKITGDLSFA----GGVQIYKTATVSVSGSHFMAKDIGFENSAGA  367

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
                QA+AL++ +DM+V +NC ++ YQ+TL++H+YRQFYR CTI+GT+DFI G+A  VFQ 
Sbjct  368   TGHQAIALKVQSDMSVFYNCQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQN  427

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             CKMVVRKPL NQ C +TAQGR + R  +  V+Q+C I AE         +  FLGRPWK 
Sbjct  428   CKMVVRKPLENQRCTITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKP  487

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT++M S ID+I+ P+GW+PW G F +DTC  +EY NRGPGA+   RV WKG  + +S
Sbjct  488   YSRTIVMQSSIDDIIDPKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LS  546

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             P+ A+ FT G FL  D  W+    +P++ G ++
Sbjct  547   PQDAEAFTAGKFLEGDS-WIAATGVPYTSGMMK  578



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   378 bits (971),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/393 (48%), Positives = 257/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA++++L  F+  ++IP + SRRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQGIP-------SWVDQ  237

Query  2513  ATRHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL      +  +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+YKEYV
Sbjct  238   RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+G  KT+I+GN++  D     TYR  TV + G+ FI +++  ENTAG
Sbjct  298   QVNKSMTHLVFIGDGADKTIISGNKSYKDGIT--TYRTATVAIVGDYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+ +D A+  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ
Sbjct  356   AIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+S+T+IM +FI + + P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +
Sbjct  476   EYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E    FTP  ++  D  W+    +P++PG L
Sbjct  535   SDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   374 bits (960),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/392 (49%), Positives = 256/392 (65%), Gaps = 22/392 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-------SRRLLeeptpttdeeiP  2529
             + M  + +TS ELTSNALAM+T +  FL    I G+       +R+LL            
Sbjct  185   QDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGNHARKLLSTEDGIP-----  238

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      +PD+VVAQDGSG++KTI  AL+ +P+ N +  VI IK GVY E
Sbjct  239   SWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSVVPKANQKPFVIYIKQGVYNE  298

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIE  2181
              V VP+K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++  E
Sbjct  299   KVDVPKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNFTAKNIGFE  355

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG    QAVALR+SAD AV HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  
Sbjct  356   NTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGK  415

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VV QKC +VVRKP+  Q+CM+TAQGR D R ++ +V+ +C I  EP        NK +LG
Sbjct  416   VVLQKCNIVVRKPMKGQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLG  475

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+FSRT+IM + ID++V P GW PW G+FAL+T +YAEY+N GPG+   +RVKW G 
Sbjct  476   RPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALNTLYYAEYENNGPGSDQSQRVKWPGI  535

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  536   KK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   374 bits (960),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 257/393 (65%), Gaps = 18/393 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + MK++ KTS ELTSN+LAM+T L   L  + I  ++       R+LL            
Sbjct  180   QDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDLGNYARKLLSTEEGIP-----  234

Query  2528  QFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +V + TR L+ A     + ++VVAQDGSG++K+I  AL ++P+ N    VI IK G+YK
Sbjct  235   SWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALKAVPQNNRWPFVIYIKQGIYK  294

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V V +K  ++ F+G+GPT+T ITGN N        TY+  TV + G+ F  +++  EN
Sbjct  295   ENVDVTKKMTHVTFIGDGPTRTKITGNLNFR-IGKVKTYQTATVAINGDNFTAKNIGFEN  353

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAG    QAVALR+SAD AV HNC ++ YQDTLY H++RQFYR CTISGTVDFIFG+A  
Sbjct  354   TAGPEGHQAVALRVSADYAVFHNCQMDGYQDTLYVHAHRQFYRDCTISGTVDFIFGDAKS  413

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             +FQ C +VVRKP+  Q+C+VTAQGR D R ++ IV+ +C I  EPA       NK +LGR
Sbjct  414   LFQNCNIVVRKPMGGQSCIVTAQGRTDVRESTGIVLHNCRITGEPAYIPVKAVNKAYLGR  473

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK FSRT++M + IDN++ P GW PW G+FAL+T +YAEY+N GPG++  +RV W G K
Sbjct  474   PWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALNTLYYAEYQNSGPGSNQAQRVNWAGIK  533

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              NISP  A +FTP  FL  +  W+ +  +P++P
Sbjct  534   -NISPRQALKFTPARFLRGN-LWIPQTHVPYTP  564



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   378 bits (971),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/404 (49%), Positives = 261/404 (65%), Gaps = 20/404 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG----ISRRLLeeptpttdeeiPQ--  2526
             EKMK LLKT ME+TSN LAMVT +   L+++   G     SRRLL               
Sbjct  177   EKMKELLKTGMEMTSNGLAMVTGISSVLQSIGGLGSYTTTSRRLLSNNDIIQIIGNSDDE  236

Query  2525  ---FVDSATRHLLVAPPR---PDIVVAQDGSGKFKTITGAL----NSIPEKNDRRIVILI  2376
                ++DS  R+LL +  +   P++VVA+DGSG + T+  AL    N I +KN++  V+ I
Sbjct  237   MPGWIDSNRRNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTFVLYI  296

Query  2375  KAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICR  2196
             K GVY+E V+V     N++F+G+GPTKT ITG  N  D     TY+  TV ++G+ FI R
Sbjct  297   KEGVYEEKVVVNSSLTNLMFLGDGPTKTKITGRLNFIDG--TNTYQTATVAIQGDHFIAR  354

Query  2195  DLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFI  2016
             D+  EN+AGA K QAVALR+SADM + +NC ++ YQDTLY H+YRQFYR C ISGT+DFI
Sbjct  355   DIGFENSAGAEKHQAVALRVSADMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISGTIDFI  414

Query  2015  FGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPN  1836
             FG++  VFQ C +VVRKPL NQ C+VTAQGRKD R  + +V+Q+C  V +PA       N
Sbjct  415   FGDSAAVFQGCSLVVRKPLDNQDCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYPVRNTN  474

Query  1835  KVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+IM S+I +     GW PW  +FALDT +YAE+ NRGP ++   RV
Sbjct  475   KAYLGRPWKEFSRTIIMESYISDSFQAAGWLPWFEDFALDTLFYAEFNNRGPSSNKTDRV  534

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW G K  +  +  K+FT   FL   E+W+ R ++P+  GF+ P
Sbjct  535   KWHGIKE-LPAKRVKRFTADEFLDG-ERWIPRTKVPYDGGFIFP  576



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   374 bits (960),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 251/390 (64%), Gaps = 17/390 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + KTS ELTSN LAM+T +  FL    + G++       R+LL            
Sbjct  185   QDMHKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDLGHYARKLLSTKDGIP-----  239

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      +P++VVAQDGSG++KTI  ALN +P+ N    VI IK GVY E
Sbjct  240   SWVGPNTRRLMATQGVVKPNVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQGVYNE  299

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
              V V +K  ++ F+G+GPTKT ITG+ N        TY   TV V G+ F  +++  ENT
Sbjct  300   KVNVTKKMTHVTFIGDGPTKTKITGSLNY-HIGKVKTYHTATVAVNGDNFTAKNIGFENT  358

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AG    QAVALR+SAD AV HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  VV
Sbjct  359   AGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVV  418

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
              Q C +VVRKP+ NQ+CM+TAQGR D R ++ +V+ +C I+ EP        NK +LGRP
Sbjct  419   LQNCNIVVRKPMKNQSCMITAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYLGRP  478

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WKEFSRT+IM + IDN++ P GW PW G+FAL T +YAE++N GPG+   +RVKW G K+
Sbjct  479   WKEFSRTIIMRTNIDNVIDPAGWLPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPGIKK  538

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  539   -LSPKQALRFTPARFLRGN-LWIPPNRVPY  566



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   374 bits (959),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/392 (49%), Positives = 254/392 (65%), Gaps = 21/392 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + KTS ELTSN LAM+T +   L    I G++       R+LL            
Sbjct  186   QDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDLGNYARKLLSTEDGIP-----  240

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      + ++VVAQDGSG++KTI  ALN +P+ N +  VI IK GVY E
Sbjct  241   SWVGPNTRQLMATKGGVKANVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQGVYNE  300

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIE  2181
              V V +K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++  E
Sbjct  301   KVDVTKKMTHVTFIGDGPTKTKITGSLNF---YIGKVKTYHTATVAINGDHFTAKNIGFE  357

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG    QAVALR+S D AV +NC ++ YQDTLY HS+RQF+R CTISGTVDFIFG+A 
Sbjct  358   NTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFGDAK  417

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VV Q C +VVRKP+  Q+CM+TAQGR D R +S +V+Q+C I  EPA       NK +LG
Sbjct  418   VVLQNCNIVVRKPMKGQSCMITAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKAYLG  477

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWKEFSRT+IM + IDNI+ P GW PW G+FAL+T +YAEY+N GPG+   +RVKW G 
Sbjct  478   RPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALNTLYYAEYENNGPGSDQAQRVKWPGI  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             K+ ISP+ A++FTP  FL  +  W+   ++P+
Sbjct  538   KK-ISPKQARRFTPARFLRGN-LWIPPNRVPY  567



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   377 bits (969),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 257/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA++++L  F+  ++IP + SRRLL E  P        +VD 
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLSEGIP-------SWVDQ  237

Query  2513  ATRHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL      +  +PDIVVAQDGSG++ TI  AL  +P+K +   V+ IKAG+Y EYV
Sbjct  238   RGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIYNEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   ++VF+G+GP KT+I+GN++  D     TYR  TV + G+ FI +++  ENTAG
Sbjct  298   QVNKSMTHLVFIGDGPDKTIISGNKSYKDGIT--TYRTCTVAIVGDYFIAKNIGFENTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+ +D A+  NC  + YQDTLYTHS+RQF+R CTISGT+DF+FG++  VFQ
Sbjct  356   AIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R ++  V Q C I  EP   A    +K +LGRPWK
Sbjct  416   NCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWK  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+S+T+IM +FI + + P+GW PW G+F L T +Y+E KN GPGA    RV W G K  +
Sbjct  476   EYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TL  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S E    FTP  ++  D  W+    +P++PG L
Sbjct  535   SDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   373 bits (958),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 258/391 (66%), Gaps = 13/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             G KMK +L  S +L+SN LAM+T L   LK L + G++ RRLL++ +         ++  
Sbjct  186   GAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLTGRRLLKDNSEFP-----SWLSH  240

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL   P   +PDIVVA+DGSG++KTI  A++ IP+  +   VI IK G+YKE V +
Sbjct  241   EKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKEQVTI  300

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   +I+ +G+G TKT ITG+ N A      T +  TV V G  FI +D+  ENTAGA+
Sbjct  301   SRSVTHIMMIGDGATKTRITGDLNYAAGVQ--TLQTSTVSVSGNHFIAKDIGFENTAGAI  358

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVALR+ +DM++ +NC ++ YQDTL+ H++RQFYR CTI+GT+DFIFG+A  VFQ C
Sbjct  359   GHQAVALRVQSDMSIFYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNC  418

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             K+VVRKPL NQ C+VTAQGR + R A+  V+Q+C+I A+P        NK +LGRPWKE+
Sbjct  419   KIVVRKPLENQNCVVTAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEY  478

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M   ID+++ P+GW PW G+FALDT  Y+EY+NRGPG+ T  RV WKG K+ +S 
Sbjct  479   SRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSA  537

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FT   F+  D  W+    + ++ G +
Sbjct  538   QDAAAFTVAKFIGGD-LWIPATGVSYASGMM  567



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   372 bits (956),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 259/391 (66%), Gaps = 13/391 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             G KMK +L  S +L+SN LA++T L   LK L + G + RRLL++ +         ++  
Sbjct  186   GAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFTGRRLLKDNSEFP-----SWLSH  240

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL   P   +PDIVVA+DGSG++KTI  A++ IP+K +   VI IK G+YK+ V +
Sbjct  241   EKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQQVTI  300

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R  ++I+ +G+G TKT ITG+ N A      T++  TV V G  FI +D+  ENTAGA+
Sbjct  301   SRSLSHIMMIGDGATKTKITGDLNYAAGVQ--TFKTSTVSVSGSHFIAKDIGFENTAGAI  358

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVALR+ +DM++ +NC ++ YQDTLY H++RQFYR CTI+GT+DFIFG+A  VFQ C
Sbjct  359   GHQAVALRVQSDMSIFYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNC  418

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             K+VVRKPL NQ C+VTAQGR + R A+  V+Q+C+I A+         NK +LGRPWKE+
Sbjct  419   KIVVRKPLENQNCIVTAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKEY  478

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M   ID+++ P+GW PW G+FALDT  Y+EY+NRGPG+ T  RV WKG K+ +S 
Sbjct  479   SRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSA  537

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FT   F+  D  W+    I ++ G +
Sbjct  538   QDADAFTVAKFIGGD-LWIPDTGISYASGMM  567



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   372 bits (956),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 255/390 (65%), Gaps = 8/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK  LKT+ ELTSN LAMVT++   L +L +    RRLL   +    + +P ++ + 
Sbjct  178   GDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNLNS-HRRLLSAHSKRNYQAVPSWMGAR  236

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
                LL A P   +P++VVAQDGSGK+KTI  AL  +P K++   VI IK GVYKE +++ 
Sbjct  237   QLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKEGVYKEEIIID  296

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R+  N+  +G+GPTKT I+G++N AD     T    T    G+ F+ +D+  ENTAG +K
Sbjct  297   RQMTNVFMIGDGPTKTKISGSKNKAD--GTATMHTATFAAVGDYFVAKDIRFENTAGHIK  354

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D ++ +NCH++AYQDTLYT +YRQ+YR CTI+GTVDFIFG+   +FQ CK
Sbjct  355   HQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCK  414

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             M+VRKP  +Q+CMVTAQGR D+   +AIV+Q+C I  EP   A    NK +LGRPWK+F+
Sbjct  415   MLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFA  474

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             R ++M S ID  + PEGW  W G+   +TC+  EY NRGP A   +RVKW   K+ ++ +
Sbjct  475   RVVVMNSQIDEAIQPEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWPSLKK-LTAD  533

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FTP      D +W+  + +P+  G +
Sbjct  534   QAATFTPAKLFEGD-RWIKPSGVPYVSGMV  562



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   372 bits (956),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/390 (46%), Positives = 255/390 (65%), Gaps = 7/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK  LKT+ ELTSN LAM T++   L +L +    R L  E +    + +P ++ + 
Sbjct  176   GDKMKGFLKTAQELTSNGLAMATQISSLLGSLNLNSHRRLLSAEKSKRNYQAVPSWMGAR  235

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
                LL A P   +P++VVAQDG+GK+KTIT AL  +P+K++   VI IK GVYKE +++ 
Sbjct  236   QLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFVIYIKEGVYKEQIIID  295

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R+  N+  +G+GPTKT I+GN+N AD     T    T    G+ F+ +D+  ENTAG +K
Sbjct  296   RQMTNVFMIGDGPTKTKISGNKNKAD--GTATMHTATFAAVGDYFVAKDIRFENTAGHIK  353

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D ++ +NCH++AYQDTLYT +YRQ+YR CTI+GTVDFIFG+   +FQ CK
Sbjct  354   HQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCK  413

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             M+VRKP  +Q+CMVTAQGR D+   +AIV+Q+C I  EP   A    NK +LGRPWK+F+
Sbjct  414   MLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFA  473

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             R ++M S ID  + PEGW  W G+   +TC+  EY N+GP A   +RVKW   K+ ++ +
Sbjct  474   RVVVMQSQIDEAIQPEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQRVKWPSLKK-LTAD  532

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FTP      D +W+  + +P+  G +
Sbjct  533   QAATFTPAKLFEGD-RWIKPSGVPYVSGMV  561



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   375 bits (964),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 189/394 (48%), Positives = 256/394 (65%), Gaps = 9/394 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiP-QFVD  2517
             GEKM+  L+TSMELTSN LAM+  +   L +LE+P  + RRLL +       +I   ++D
Sbjct  177   GEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFTNRRLLSDDILGHGMDILPSWID  236

Query  2516  SATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
                R LL A PR   PD++VA+DGSG F TI  AL +I +  ++  V+ IK GVY+E V 
Sbjct  237   EGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEKEFVLYIKEGVYEEKVT  296

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
               +   ++  +G+GPTKT ITG  N  D  P  TY   TV V G+ FI +D+  EN AG 
Sbjct  297   FHKNLLHLTVIGDGPTKTRITGKLNFIDGVP--TYHTATVAVLGDFFIAKDIGFENAAGP  354

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
              K QAVA+R+ AD  + +NCH + +QDTLY H+YRQFYR C ISGT+DF+FG++  V Q 
Sbjct  355   EKHQAVAVRVGADKTIFYNCHFDGFQDTLYAHTYRQFYRNCKISGTIDFVFGDSAAVLQN  414

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C + VRKPL NQ C+VTAQGRKD R  + +V+Q+C  VA+PA        K +LGRPWKE
Sbjct  415   CTLEVRKPLDNQQCIVTAQGRKDVRQPTGLVLQNCSFVADPAYFPYRFQLKSYLGRPWKE  474

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT+IM SFID+++ PEGW  W G+FALDT +YAE+ NRGP ++   R +W G K   S
Sbjct  475   FSRTIIMESFIDDLIQPEGWLAWNGSFALDTLFYAEFNNRGPSSNKMLRAQWNGVKELPS  534

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               V ++F P  F+  +  W+  A++P++ GF+ P
Sbjct  535   SRV-ERFLPSKFIDGN-HWIKSARVPYNSGFIYP  566



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   373 bits (957),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 257/396 (65%), Gaps = 17/396 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--RRLLeeptp----ttdeeiP  2529
             GE+MK LLKTSM L+SN LAMV ++   L  L  P  S  RRLL           D E+P
Sbjct  194   GEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRRLLSFDGLPILGHGDLELP  253

Query  2528  QFVDSATRHLLV---APP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKA  2370
             ++ ++  R LL    AP     +PD VV++DGSG +KTI  AL  +P+  +   VI IK 
Sbjct  254   EWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALEHVPKYGNETFVIYIKE  313

Query  2369  GVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY E V V R   N++ +G+G  KT ITGN N  D  P  TYR   V + G+ F+  D+
Sbjct  314   GVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTP--TYRTAAVAIHGDHFMAMDI  371

Query  2189  TIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFG  2010
               EN+AG  K QAVALR+SAD A+ + C ++ YQDTLYTH++RQFYR CTISGT+DF+FG
Sbjct  372   GFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFG  431

Query  2009  NAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             +A  +FQ C  VV KPL +Q+C+VTAQGRK+ R  SAIVIQ+  I A+P        NK 
Sbjct  432   DAAAIFQNCTFVVHKPLPDQSCIVTAQGRKEGRQPSAIVIQNSTITADPDYFLVKNVNKA  491

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM S+ID+++ PEGW PW G + L TC+Y E++N GP A+  +RV W
Sbjct  492   YLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLRTCFYTEFRNTGPAANKARRVTW  551

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             +G K+ I+   A QFTPG F   DE W+  + +P+S
Sbjct  552   QGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPYS  585



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   371 bits (953),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 256/397 (64%), Gaps = 19/397 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--------GISRRLLeeptpttdeei  2532
             +KM+ +LKTSME+TSNALAM+  L   +K L IP        G++R+LL           
Sbjct  154   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDTTGVNRKLLSAEDMP-----  208

Query  2531  PQFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVY  2361
              +++  A R LL A P   +P++VVA+DGSGK+ TI  AL  +P K+  R VI IKAG Y
Sbjct  209   -EWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAGTY  267

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             KE + V ++  N+VF+G+GPTKT+IT + +VA   P  TYR  TV V+G GF+ +D+  +
Sbjct  268   KEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIGFD  327

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AG    QAVA R +AD  ++ NCH   YQDTLY H  RQ Y  C I+GTVDFIFG+A 
Sbjct  328   NSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAA  387

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
              +FQ C ++VRKP   Q CMVTAQGR D    SAIV+Q+C I   P   +    NK +LG
Sbjct  388   SIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAYLG  447

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+F+R++IM S ID+I+ PEG++P  G   +DT + AE+ NRGPGA T++RV WKG 
Sbjct  448   RPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGI  507

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  508   KK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  542



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   377 bits (967),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 255/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  + IP  S RRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEIP-------SWVDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++KTI  AL  +P+K +   V+ IKAG+Y+EYV
Sbjct  238   RGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              + +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  298   QINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  356   PAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R A+  V Q C I  EP   A    +K +LGRPW+
Sbjct  416   NCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWR  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM SF+ + V P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  
Sbjct  476   EFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLS  535

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  F+     W+    +P++PG L
Sbjct  536   NEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   377 bits (969),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 255/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  + IP  S RRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEIP-------SWVDQ  237

Query  2513  ATRHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL A       +PDIVVAQDGSG++KTI  AL  +P+K +   V+ IKAG+Y+EYV
Sbjct  238   RGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              + +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  298   QINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  356   PAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R A+  V Q C I  EP   A    +K +LGRPW+
Sbjct  416   NCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWR  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM SF+ + V P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  
Sbjct  476   EFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLS  535

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  F+     W+    +P++PG L
Sbjct  536   NEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   372 bits (955),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 185/397 (47%), Positives = 258/397 (65%), Gaps = 14/397 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFV---  2520
             G+KMK  L T+ +LTSN LAMVT++   L +L +    RRLL       + +    V   
Sbjct  184   GDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGGNAKNAPKVIPT  243

Query  2519  -DSATRHLLVA-----PPRPDIVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVY  2361
               +  R L V+       +PD VVA+DGSG+++TI  A+  IP+ N D+  VI +K GVY
Sbjct  244   WINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVY  303

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              EYVM+ +   N++ +G+G  KT +TG++N A      T++  TV+V G+ FI +D+ IE
Sbjct  304   SEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAGVQ--TFQTATVVVVGDYFIAKDIGIE  361

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AGA   QAVALR+ +D+++ + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A 
Sbjct  362   NSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  421

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VVFQ CKM+VRKP+ NQACMVTAQGR DRR  S I++Q+C I  +P        NK +LG
Sbjct  422   VVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLG  481

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK  +RT++M S ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G 
Sbjct  482   RPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGI  541

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K N+S + A  FT G F+  D +W+  + +P+  G +
Sbjct  542   K-NLSADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   371 bits (953),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 255/397 (64%), Gaps = 19/397 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--------GISRRLLeeptpttdeei  2532
             +KM+ +LKTSME+TSNALAM+  L   +K L IP        G +R+LL           
Sbjct  170   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLLSTEDML-----  224

Query  2531  PQFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVY  2361
              +++  A R LL A P   +P++VVA+DGSGK+ TI  AL  +P K+  R VI IKAG Y
Sbjct  225   -EWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAGTY  283

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             KE + V ++  N+VF+G+GPTKT+IT + +VA   P  TYR  TV V+G GF+ +D+  +
Sbjct  284   KEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIGFD  343

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AG    QAVA R +AD  ++ NCH   YQDTLY H  RQ Y  C I+GTVDFIFG+A 
Sbjct  344   NSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAA  403

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
              +FQ C ++VRKP   Q CMVTAQGR D    SAIV+Q+C I   P   +    NK +LG
Sbjct  404   SIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAYLG  463

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+F+R++IM S ID+I+ PEG++P  G   +DT + AE+ NRGPGA T++RV WKG 
Sbjct  464   RPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGI  523

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  524   KK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   371 bits (953),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/394 (47%), Positives = 258/394 (65%), Gaps = 11/394 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ----F  2523
             GEKMK  LKT+ ELTSN LAMV+++   L +L      RRLL   +    + + +    +
Sbjct  178   GEKMKGFLKTAQELTSNGLAMVSEISSLLGSLNSNSHRRRLLGSSSGGQSKRVYKPLPSW  237

Query  2522  VDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
             + +    LL A P   +P++VVAQDG+GK+K+IT AL  +P+K+ +  VI IK GVYKEY
Sbjct  238   IGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKEGVYKEY  297

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V+V ++  N+V +G+GPTKT I+G++N AD     T    T    G+ F+ + +  ENTA
Sbjct  298   VIVDKEMTNVVMIGDGPTKTRISGSKNYAD--GTATMYTATFAAVGDYFVAKGIGFENTA  355

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             GA K QAVALR+ +D ++ +NC+++AYQDTLYT +YRQ+YR CTISGTVDFIFG+   +F
Sbjct  356   GAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMF  415

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C+MVVRKP  +Q+CMVTAQGR D+   +AIV+Q+C I  EP   A    NK +LGRPW
Sbjct  416   QNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPW  475

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K F+R +++ S ID+ + PEGW+ W G     +C+ AE  NRG GA   KRVKW+  K+ 
Sbjct  476   KGFARVVVIQSQIDDAIAPEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLKK-  534

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++PE A  FTP      D +W+  + +P+  G +
Sbjct  535   LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  567



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   371 bits (952),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 258/404 (64%), Gaps = 22/404 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--------------RRLLeept  2553
             G KM++    S EL+SNAL ++T+    L+ L+IPG+               RRLL +  
Sbjct  179   GTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIPGLDLSALNGGGDGGAAHRRLLGKAP  238

Query  2552  pttdeeiPQ--FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI  2388
                        +V    R ++  P    +PD  V+Q G G++KTI+ A+  +P  N    
Sbjct  239   KGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQSGGGQYKTISEAIAKVPMNNASPF  298

Query  2387  VILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEG  2208
             +I IKAG YKEY+ + +K+ N++ VG+GPTKT+ITG++N A      T++  TV V G+G
Sbjct  299   IIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITGSKNFAAGI--NTFKTATVGVLGDG  356

Query  2207  FICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGT  2028
             F+ RDLTIEN++G    QAVAL++ +D+AV++NC     QDTLY    RQFYR CT+SGT
Sbjct  357   FMARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTGNQDTLYALRGRQFYRDCTVSGT  416

Query  2027  VDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAA  1848
             +DFIFG+A  VFQ CK++VRKP  NQ CMVTAQGR + +G  A + + C + +EP  KA 
Sbjct  417   IDFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEEKGPGAFIFEGCTVSSEPGYKAV  476

Query  1847  NPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGAST  1668
                N  +LGRPWKE+S+T+ M+S ID+ + P+GW+ W+GNFALDT +YAE++N+G GA  
Sbjct  477   KAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQGNFALDTLYYAEFENKGAGADK  536

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              +RVKWKG K  +S + A  FTP    ++ ++W+  + +P++PG
Sbjct  537   SQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIPESGVPYAPG  579



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   374 bits (959),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 255/391 (65%), Gaps = 16/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT N LAMVT++  +L  ++   + SRRLL +           +VD 
Sbjct  170   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTELNSRRLLAQEP--------SWVDG  221

Query  2513  ATRHLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PD+VVAQDGSG++KTI+ A+ ++P+  +   V+ IK GVYKE+V V
Sbjct  222   RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  281

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R  +++VF+G+GP KTVITG ++  D     TYR  TV + G+ FI +++  ENTAGA 
Sbjct  282   DRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAKNMGFENTAGAA  339

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAV +R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  340   KHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  399

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GR+D +  +  V+Q C I  E    A    +K +LGRPWK +
Sbjct  400   ILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKESSKAYLGRPWKAY  459

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + +  EGW  WKGNF +DT +Y+E +N GPGA    RV W G K+ +S 
Sbjct  460   SKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSD  518

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E    +TP  ++  DE W+    +P++PG  
Sbjct  519   EDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  548



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   374 bits (960),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 256/391 (65%), Gaps = 16/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT NALAMVT++  +L  ++   +S RRLL +           +VD 
Sbjct  184   GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQEP--------SWVDG  235

Query  2513  ATRHLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PD+VVAQDGSG++KTI+ A+ ++P+  +   V+ IK GVYKE+V V
Sbjct  236   RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  295

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R  +++VF+G+GP KTVITG ++  D     TYR  TV + G+ FI +++  +NTAGA 
Sbjct  296   DRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAKNMGFQNTAGAA  353

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAV +R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  354   KHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  413

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GR+D +  +  V+Q C I  E    A    +K +LGRPWK +
Sbjct  414   ILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAY  473

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + +  EGW  WKGNF +DT +Y+E +N GPGA    RV W G K+ +S 
Sbjct  474   SKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSD  532

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E    +TP  ++  DE W+    +P++PG  
Sbjct  533   EDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   370 bits (950),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/396 (47%), Positives = 259/396 (65%), Gaps = 21/396 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M+ + KTS ELTSN LAM+T +   L    + G++       R+LL            
Sbjct  185   QDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLGKYARKLLSAEDGIP-----  239

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      + ++VVA DGSG++KTI  ALN++P+ N +  VI IK GVY E
Sbjct  240   SWVGPNTRRLMATKGGVKANVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGVYNE  299

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIE  2181
              V V +K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++  E
Sbjct  300   KVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYLTATVAINGDNFTAKNIGFE  356

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG    QAVALR+SAD+AV +NC ++ YQDTLY HS+RQF+R CT+SGTVDFIFG+  
Sbjct  357   NTAGPEGHQAVALRVSADLAVFYNCQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFGDGI  416

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VV Q C +VVRKP+ +Q+CM+TAQGR D+R ++ +V+Q+C I  EPA       NK +LG
Sbjct  417   VVLQNCNIVVRKPMKSQSCMITAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLG  476

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWKEFSRT+IM + ID+++ P GW PW G+FAL+T +YAEY+N GPG++  +RVKW G 
Sbjct  477   RPWKEFSRTIIMGTTIDDVIDPAGWLPWNGDFALNTLYYAEYENNGPGSNQAQRVKWPGI  536

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             K+ +SP+ A +FTP  FL  +  W+   ++P+   F
Sbjct  537   KK-LSPKQALRFTPARFLRGN-LWIPPNRVPYMGNF  570



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   377 bits (967),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 192/393 (49%), Positives = 259/393 (66%), Gaps = 10/393 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI-PGISRRLLeeptpttdeeiP--QFV  2520
             GEKM+  L  +M++TSNALAM+ +L  ++K+L I    SRRLL E       +     ++
Sbjct  174   GEKMRVSLTKAMQMTSNALAMMAELSTYIKSLGIESSTSRRLLSENEAVVGHDDELPNWM  233

Query  2519  DSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
             D   R LL A P   RP +VVA+DGSGKF+TI  AL  IP+K D   V+ IK GVY+E V
Sbjct  234   DLNKRRLLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYEERV  293

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V     +++F+G+GPTKT ITG  N  D     TYR  TV V+G+ F+  ++  EN+AG
Sbjct  294   QVNSSLTHLLFIGDGPTKTRITGKLNFIDG--TNTYRTATVAVQGDNFMAVNIGFENSAG  351

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVALR+SAD A+ +NCH++ YQDTLYTH+YRQFYR C ISGT+DFIFG++  VFQ
Sbjct  352   PQKHQAVALRVSADKAIFYNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQ  411

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQ C+VTAQGRKD R  + +VIQ+C I A+ A        K +LGRPWK
Sbjct  412   GCTLLVRKPLDNQQCIVTAQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWK  471

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             ++SRT+IM SF+D+++ P+GW PW   FAL T +Y E+ NRGP A   +RVKW G  R +
Sbjct  472   QYSRTIIMESFLDDLIQPQGWLPWNETFALQTLFYTEFNNRGPAAPKSERVKWAGI-REL  530

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                  ++FT   FL    +W+ + ++P + GF+
Sbjct  531   PSNRIRRFTLEEFLDG-HRWIPQTKVPHASGFI  562



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   370 bits (949),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 254/397 (64%), Gaps = 19/397 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--------GISRRLLeeptpttdeei  2532
             +KM+ +LKTSME+TSNALAM+  L   +K L IP        G +R+LL           
Sbjct  170   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLLSTEDML-----  224

Query  2531  PQFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVY  2361
              +++  A R LL A P   +P++VVA+DGSGK+ TI  AL  +P K+  R VI IKAG Y
Sbjct  225   -EWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAGTY  283

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             KE + V ++  N+VF+G+GPTKT+IT + +VA   P  TYR  TV V+G GF+ +D+  +
Sbjct  284   KEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIGFD  343

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             N+AG    QAVA R +AD  ++ NCH   YQDTLY H  RQ Y  C I+GTVDFIFG+A 
Sbjct  344   NSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAA  403

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
              +FQ C ++VRKP   Q CMVTAQGR D    SAIV+Q+C I   P        NK +LG
Sbjct  404   SIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYIPVKDTNKAYLG  463

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+F+R++IM S ID+I+ PEG++P  G   +DT + AE+ NRGPGA T++RV WKG 
Sbjct  464   RPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGI  523

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  524   KK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   370 bits (949),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 254/391 (65%), Gaps = 13/391 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRL--LeeptpttdeeiPQFVDS  2514
             + M  + KTS ELTSN LAMV+ +  FL    I  I+  L        +T++  P ++  
Sbjct  184   QDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDLGSYARKLLSTEDGFPTWMRP  243

Query  2513  ATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
              TR L+ A      +P+ VVA DGSG+FK+I  AL ++P+ N    VI IK G+YKE V 
Sbjct  244   ETRKLMAAVTGPKVKPNAVVALDGSGQFKSINDALKTVPKNNKFPFVIYIKQGIYKEKVD  303

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIENTA  2172
             V +    + F+G+GPTKT++TGN N      G   TY+  TV V GE F  +D+  ENTA
Sbjct  304   VTKTMTYVTFIGDGPTKTIVTGNLNFG---IGNVKTYQTATVAVNGENFTAKDIGFENTA  360

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G    QAVALR+SAD AV +NC ++ YQDTLY HS+RQFYR CTISGT+D+IFG+A   F
Sbjct  361   GPEGHQAVALRVSADYAVFYNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFF  420

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q CKMVVRKP+  Q+CMVTAQGR D+R ++ I++ +C I+ +PA       NK +LGRPW
Sbjct  421   QNCKMVVRKPMGGQSCMVTAQGRTDKRESTGIILHNCRIMGDPAYIPVKSTNKAYLGRPW  480

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT+IM + ID+I+ P+GW  W GNFALDT  Y EY+N G G+  + RVKW G K+ 
Sbjct  481   KEFSRTIIMRTTIDDIIDPKGWLEWNGNFALDTLEYGEYENNGSGSGQEMRVKWPGIKK-  539

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             +S   A QFT G FL  +  W+ R ++P++P
Sbjct  540   LSARQALQFTAGRFLRGN-TWIPRRRVPYTP  569



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   373 bits (958),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 256/391 (65%), Gaps = 16/391 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE +K  LKT+++LT NALAMVT++  +L  ++   +S RRLL +           +VD 
Sbjct  184   GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQEP--------SWVDG  235

Query  2513  ATRHLLVAP---PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
               R LL AP    +PD+VVAQDGSG++KTI+ A+ ++P+  +   V+ IK GVYKE+V V
Sbjct  236   RVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQV  295

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R  +++VF+G+GP KTVITG ++  D     TYR  TV + G+ FI +++  +NTAGA 
Sbjct  296   DRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAKNMGFQNTAGAA  353

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAV +R+ +D ++ +NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ C
Sbjct  354   KHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  413

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKPL NQAC +TA GR+D +  +  V+Q C I  E    A    +K +LGRPWK +
Sbjct  414   ILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAY  473

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             S+T+IM +FI + +  EGW  WKGNF +DT +Y+E +N GPGA    RV W G K+ +S 
Sbjct  474   SKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSD  532

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E    +TP  ++  DE W+    +P++PG  
Sbjct  533   EDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   385 bits (989),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/390 (49%), Positives = 256/390 (66%), Gaps = 23/390 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GEKMK LLK++ ELTSN LAM+ ++   L  L+IPGISRRLL                  
Sbjct  174   GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLV----------------G  217

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R L  A P   +P+++VAQDGSGK+KTI  AL  IP+  +   V+ +K GVYKE V   
Sbjct  218   QRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKEQVNFT  277

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   N++ +G+GPTKT I+G+ N  D    GT+R  TV   G  F+ +D+  EN AGA K
Sbjct  278   KSMTNVMLIGDGPTKTTISGSLNFIDGI--GTFRTATVAAVGSNFMAKDIGFENNAGASK  335

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DMA+ +NC ++ YQDTLY H++RQFYR CTI+GT+DFIFG++ VVFQ C 
Sbjct  336   HQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCL  395

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKPL NQ C+VTAQGR +RR  + IV+Q+C I A           K +LGRPWK FS
Sbjct  396   ILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFS  455

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S ID+++ PEGW PW G+F L+TC+YAEY NRGP ++T  RV W+G K+ I+ +
Sbjct  456   RTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQ  514

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                 FT G F+ +   WLG + +P++   +
Sbjct  515   HVNDFTVGRFI-SGHLWLGASGVPYTSDMM  543



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   368 bits (944),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 259/396 (65%), Gaps = 18/396 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP----GISRRLLeeptpt-tdeeiPQ  2526
              E M+ + KT+ +LTSN LA+ T LD  LK   IP      SR   +E +      ++ +
Sbjct  193   AEIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIPIPFLTTSRDSTDEDSIEPVGRQLTE  252

Query  2525  FVDSATRH--LLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGV  2364
             F D  T H   L+A      R + VVA+DGSG+++TIT AL ++P+ N+RR VI IK+GV
Sbjct  253   FPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNERRFVIYIKSGV  312

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDL  2190
             Y E V + +K  +++F+G+GPTKT++TGN +     P    TYR  TV V G+ F+ +D+
Sbjct  313   YAENVELTKKMTHVMFIGDGPTKTIVTGNLSFH---PNRISTYRTSTVAVNGDWFMAKDM  369

Query  2189  TIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFG  2010
               ENTAG    QAVALR+SAD AV +NC ++ YQDTLY H++RQFYR C ISGT+DF+FG
Sbjct  370   AFENTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFG  429

Query  2009  NAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             +A  VFQ C+ VVR+P+ NQ C+VTAQGRKDRR  + IVI    I+ +P        N+ 
Sbjct  430   DAKAVFQNCQFVVRRPMENQQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYLPVKTKNRA  489

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM S ID+I+ PEGW  W   FALDT +YAEY+N GPG+    RV+W
Sbjct  490   YLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALDTLYYAEYQNTGPGSDQAGRVRW  549

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G + ++S   A Q+TP  FL  +  W+ + ++P++
Sbjct  550   NGIQ-HLSDSAATQYTPDNFLRGN-TWIPKTRVPYA  583



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   367 bits (942),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 248/391 (63%), Gaps = 18/391 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-------SRRLLeeptpttdeeiP  2529
             ++M  + KTS ELTSN LAMV+ L   L    I G+       +R+LL            
Sbjct  184   QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGSYARKLLSTEDGFPT----  239

Query  2528  QFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              ++    R L+ A     +P+ VVA DGSG+FK+I  AL ++P KN    VI IK G+YK
Sbjct  240   -WMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYK  298

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V V +  + + F+G+GPTKT ITGN N        TY+  TV V GE F  +D+  EN
Sbjct  299   EKVDVTKTMSYVTFIGDGPTKTRITGNLNFG-MGKVKTYQTATVAVNGEHFTAKDIGFEN  357

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAG    QAVALR+SAD AV HNC ++ YQDTLY HS+RQFYR CTISGT+D+IFG+A  
Sbjct  358   TAGPKGHQAVALRVSADYAVFHNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKS  417

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
              FQ C MVVRKP+  Q+CMVTAQGR D+R  + IV+ +C I  +PA       NK +LGR
Sbjct  418   FFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGR  477

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK+FSRT+IM + I++I+ P+GW  W GNFALDT  YAE++N+GPG++   RVKW G K
Sbjct  478   PWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIK  537

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +  +P  A +FT G FL     W+ + Q+P+
Sbjct  538   K-FTPRQAGEFTAGKFLQGG-TWIPQTQVPY  566



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   366 bits (940),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 192/390 (49%), Positives = 254/390 (65%), Gaps = 15/390 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             GE M+ +L +S ELTSN LA+V   D+ L +L +P I+R+LL E  P        +V   
Sbjct  173   GESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLP-INRKLLAEGYP-------SYVTPG  224

Query  2510  TRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL    A  +P++VVAQDGSG  KTI  A++ +P K     +I IK G YKE V V 
Sbjct  225   KRRLLATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKEKVHVN  284

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   N++ +G+GPTKT ITG+ N  D     T+   TV V G+GF+ +DL IEN+AGA K
Sbjct  285   KSATNVMLIGDGPTKTKITGSLNYVDG--TRTFDTATVAVVGDGFVAKDLWIENSAGAEK  342

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+V +NC ++ YQDTLY H++RQFYR CTISGT+DFIFG++  +FQ C 
Sbjct  343   HQAVALRVQSDMSVFYNCRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCL  402

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++ RKPL NQ  +VTAQGRK R+ ASAI++ +C I A+PA          FLGRPWK +S
Sbjct  403   ILARKPLDNQQNIVTAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYS  462

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT I+ S ID+++ P+GW PW G+F L+TC+Y E  NRGPGA   KRV WKG K NI   
Sbjct  463   RTFILQSQIDDLIHPDGWLPWFGDFGLNTCFYTEVDNRGPGADKSKRVTWKGVK-NIDYA  521

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              AK+F+   FL    +WL R  +PF+   L
Sbjct  522   HAKKFSVQQFLHGG-KWLPRTGVPFTAELL  550



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   366 bits (940),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 184/396 (46%), Positives = 256/396 (65%), Gaps = 23/396 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GEKMK++LKT+ EL+S AL +V+  +E +  L+  GI+ RRLL               ++
Sbjct  178   GEKMKNILKTASELSSVALDIVSSFEEQMVGLQGLGITNRRLL-------------VAEA  224

Query  2513  ATRHLL-VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
               R LL +A  +P++VVAQDGSG+ K+I  AL ++P  N +  VI IKAG+Y E + V  
Sbjct  225   GNRRLLQIATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENIEVAN  284

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                N+VF+GEG  KT IT N+N  D  P   ++  TV + G+GF+ +D+  EN+AG +K+
Sbjct  285   TMTNVVFIGEGSNKTKITSNKNYLDGLP--IFQTATVSISGQGFVAKDIAFENSAGPLKK  342

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             +AVALR+SA+M    NC ++ YQ TL TH  RQFYR CTISGT+DFIFG+A  V Q CK+
Sbjct  343   EAVALRVSAEMTAFQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVLQNCKI  402

Query  1976  VVRKP--LANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP-NKVFLGRPWKE  1806
             + RKP  +  QA  + AQGR +  G   I+IQ+C I AEPAL A NPP NK FLGRP K 
Sbjct  403   IARKPEEMQTQAITIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRNKAFLGRPAKM  462

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT++M S ID  + PEGW+P+ G F L+T ++ EY+NRGPGA+TD+RV WK Y +N  
Sbjct  463   YSRTIVMQSQIDGFIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYMKNPP  522

Query  1625  PEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
              +V  +F PG  L   +    W+ +  +P+ P  ++
Sbjct  523   QDVIAKFAPGVVLKGGDNTDGWVTKTGVPYEPAMMK  558



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   367 bits (941),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/391 (48%), Positives = 257/391 (66%), Gaps = 12/391 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             E M+  L +S  LTSNALA++ ++   L T+ +P + RR L      + E      +   
Sbjct  197   ESMREALNSSQALTSNALAIIDEISSVLSTVRVPFLKRRFLSHEEEGSGEYPSWVANGKR  256

Query  2507  RHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             R L +A    +P+I+VAQDGSG +KTI  AL +IP+ ++   VI IK GVYKE V + + 
Sbjct  257   RLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSIFVIYIKEGVYKEQVWLDKS  316

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               N++ +G+GPTKT ITGN N  D           V+  G+GFI ++L  EN+AGA K Q
Sbjct  317   MMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVV--GDGFIAKNLGFENSAGAEKHQ  374

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+ +D ++ +NC ++ +QDTLY+H+ RQFYR CTI+GT+DFIFG+A  +FQ C + 
Sbjct  375   AVALRVQSDRSIFYNCQMDGFQDTLYSHTKRQFYRDCTITGTIDFIFGDAASIFQNCIIR  434

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPA---LKAANPPNKVFLGRPWKEF  1803
             VRKPLANQ C+VTA GRKDRR A+AI++ +C I A+P    L+A NP    +LGRPWK +
Sbjct  435   VRKPLANQQCIVTASGRKDRREATAIILHNCTIGADPDYLPLRARNPS---YLGRPWKPY  491

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRTL++ S ID+ + P+GW PW G+F L+TC+YAE  NRGPGA+  KRV WKGYK+ I  
Sbjct  492   SRTLVVQSQIDDFIHPQGWLPWLGDFGLNTCFYAEVDNRGPGATIAKRVAWKGYKK-IDY  550

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               A++FT   F+  +  WL    +P+ PG L
Sbjct  551   SHAQKFTVEQFIQGNS-WLKPTGVPYIPGLL  580



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   370 bits (950),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/393 (47%), Positives = 254/393 (65%), Gaps = 17/393 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDS  2514
             GE MK  LKT++ELT N LA+++++  F+  + IP  S RRLL +  P        +VD 
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEFP-------SWVDQ  237

Query  2513  ATRHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
               R LL      +  + DIVVAQDGSG++KTI  AL  +P+K +   V+ IKAG+Y+EYV
Sbjct  238   RGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYV  297

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              + +   ++VF+G+GP KT+I+G++N  D     TYR  TV + G+ FI +++   NTAG
Sbjct  298   QINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIAKNIGFVNTAG  355

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA+R+ +D ++  NC  + YQDTLY HS+RQFYR CTISGT+DF+FG+A  VFQ
Sbjct  356   PAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQ  415

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C ++VRKPL NQAC +TA GR D R A+  V Q C I  EP   A    +K +LGRPW+
Sbjct  416   NCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWR  475

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM SF+ + V P+GW PW GNF LDT +Y+E +N GPGA    RV W G K+  
Sbjct  476   EFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLS  535

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + E+ K FTP  F+     W+    +P++PG L
Sbjct  536   NEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   366 bits (940),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 250/390 (64%), Gaps = 11/390 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQF---V  2520
             G++MK  LK SMEL++N LA+V+ +   + +LE  G  RRLL++  P        F    
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQDDLPVLGHGDQIFPTWT  247

Query  2519  DSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
             D   R LL AP    + DIVVA+DGSG F TI  AL+ +P K+ +  V+ IKAG+Y+EY+
Sbjct  248   DFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKAGIYQEYI  307

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
                +   N++ +G+G   T I GN+N  D     TY   TV+V G+ F+ +++  E  AG
Sbjct  308   DFNKSMTNLMVIGDGRETTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNIGFEKNAG  365

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A+K QAVALR+SAD A+ +NC ++ +QDTLYT + RQF R C++SGT+DF+FG+A  VFQ
Sbjct  366   AIKHQAVALRVSADYALFYNCSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQ  425

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              CK ++RKPL NQ C+VTAQGRK RR  SAIVIQ+  I A P L       K +LGRPWK
Sbjct  426   NCKFLIRKPLENQQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWK  485

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM SFID+++ PEGW PW G F L TCWY E+ N GPG+S   RVKW G K  I
Sbjct  486   EFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TI  544

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
               + A  FTPG F      W+    IP++P
Sbjct  545   DRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   367 bits (941),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 257/401 (64%), Gaps = 19/401 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptptt--------dee  2535
             G++MK LLKTSM L+SN LAMV+++   L  L  P  SR                  D E
Sbjct  194   GQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRRRRLLSLDGLPILGHGDLE  253

Query  2534  iPQFVDSATRHLLV---APP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILI  2376
              P++ ++  R LL    AP     +PD VVA+DGSG +KTI+ AL  +P+  +   VI I
Sbjct  254   FPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEALEHVPKYGNETFVIYI  313

Query  2375  KAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICR  2196
             K GVY E V V R   N++ +G+G  KT ITGN+N  D  P  TYR  TV + G+ F+  
Sbjct  314   KEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTP--TYRTATVAIHGDHFMAM  371

Query  2195  DLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFI  2016
             D+  +N+AG  K QAVALR+SAD A+ + C ++ YQDTLYTH++RQFYR CTISGT+DF+
Sbjct  372   DIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTIDFV  431

Query  2015  FGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPN  1836
             FG+A  +FQ C  VVRKPL +Q+C+VTAQGRK+RR  SAIVIQ+  I A+P        N
Sbjct  432   FGDAAAIFQNCTFVVRKPLPDQSCIVTAQGRKERRQPSAIVIQNSTITADPDYFPVKNVN  491

Query  1835  KVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRV  1656
             + +LGRPWKE+SRT+IM S+ID+++ PEGW  W G + L TC+Y E+ N GP A+  +RV
Sbjct  492   RAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLRTCFYTEFCNTGPAANKARRV  551

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              W+G K+ I+   A QFTPG F   DE W+  + +P  PG 
Sbjct  552   TWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPCVPGL  590



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   365 bits (937),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 253/395 (64%), Gaps = 12/395 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP-----Q  2526
             GEKMK  LKT+ ELTSN LAMV+++   L ++      RRLL   +     +        
Sbjct  178   GEKMKGFLKTAQELTSNGLAMVSEISSLLGSVNSNTHRRRLLGSSSGDQKSKRVYKPLPS  237

Query  2525  FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
             ++ +    LL A P   +P++VVAQDG+GK+K+I  AL  +P+K+ +  VI IK GVYKE
Sbjct  238   WIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKEGVYKE  297

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
             YV+V +   N+V +G+GPTKT I+G++N AD     T    T    G+ F+ + +  ENT
Sbjct  298   YVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTT--TMYTATFAAVGDYFVAKGIGFENT  355

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AGA K QAVALR+ +D ++ +NC+++AYQDTLYT +YRQ+YR CTISGTVDFIFG+   +
Sbjct  356   AGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAM  415

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C+MVVRKP  +Q+CMVTAQGR D+   +AIV+Q+C I  EP   A    NK +LGRP
Sbjct  416   FQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRP  475

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WK F+R +++ S IDN + PEGW+ W G     +C+ AE  NRG GA   KRVKW+   +
Sbjct  476   WKGFARVVVIQSQIDNAIAPEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLMK  535

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FTP      D +W+  + +P+  G +
Sbjct  536   -LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  568



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   364 bits (934),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 252/390 (65%), Gaps = 15/390 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              E M+  L +S ELTSN LA+VT  D  L +L + G +R+LL E  P        ++   
Sbjct  173   AESMRKALNSSAELTSNILAIVTNFDSALDSLNL-GFNRKLLAEEYP-------SWISPG  224

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   P   +P+I VA+DGSG  KTI  A+  +P K++   VI IK GVY+E V V 
Sbjct  225   NRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIKEGVYEEQVQVN  284

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R   N++ +G+G +KT ITG  N  D     T++  TV + G+GFI +DL IEN+AGA K
Sbjct  285   RSLTNVMMIGDGTSKTKITGKLNYIDG--TATFKTATVAIVGDGFIGKDLWIENSAGAAK  342

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D +V +N  ++ YQDTLY H+ RQFYR CTISGT+DFIFG++P VFQ C 
Sbjct  343   HQAVALRVQSDKSVFYNVRMDGYQDTLYVHTKRQFYRECTISGTIDFIFGDSPTVFQNCL  402

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             +  RKPL NQ  +VTAQGRKDRR ASAI++ +C I A+PA   A      FLGRPWKEFS
Sbjct  403   IQARKPLDNQQNIVTAQGRKDRRQASAIILHNCTISADPAYFPARKKLPTFLGRPWKEFS  462

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT ++ S +D+++ P+GW PW G+F L++C+Y E  NRGPGA   +RV WKG K +I   
Sbjct  463   RTFVLQSQLDDLIDPKGWLPWSGDFGLNSCFYTELDNRGPGADMSQRVNWKGVK-SIDYA  521

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A++FT   F+  +  WL +  +PF PG L
Sbjct  522   HAQKFTVEHFIQGNA-WLPKTGVPFIPGLL  550



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   365 bits (938),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 244/378 (65%), Gaps = 12/378 (3%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQF---VDSATRHLLVAPP  2484
             EL++N L +V+ +   + +LE    + R L +          QF    D  TR LL AP 
Sbjct  201   ELSANLLDIVSGISSAIPSLE--SFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLAAPV  258

Query  2483  ---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFV  2313
                + DIVVA+DGSG F TI  AL  +P K+ +  V+ IKAGVY+EY+ + +   N+V +
Sbjct  259   SKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVI  318

Query  2312  GEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRIS  2133
             G+G   T I GN+N  D     T+   TV V G+ F+ +++  EN AGA+K QAVALR+S
Sbjct  319   GDGKENTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVS  376

Query  2132  ADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLAN  1953
             AD A+ +NC ++ +QDTLYTH+ RQFYR C+ISGT+DF+FG+A  VFQ CK +VRKPL N
Sbjct  377   ADYAIFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN  436

Query  1952  QACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFI  1773
             Q C+VTAQGRK RR  SA++IQS  I A P L       K +LGRPWKE+SRT+IM SFI
Sbjct  437   QQCIVTAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFI  496

Query  1772  DNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGP  1593
             D+++ PEGW PW G F L TCWY E+ N GPG+S + RVKW G K  I+ + A  FTPG 
Sbjct  497   DDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGR  555

Query  1592  FLMADEQWLGRAQIPFSP  1539
             FL  D  W+    IP++P
Sbjct  556   FLKGDS-WIKATGIPYTP  572



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   364 bits (934),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 191/390 (49%), Positives = 252/390 (65%), Gaps = 15/390 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              E M+  L +S E+TSN LA+V  LD  L +L + GISR+LL E  P        +V   
Sbjct  173   AESMRKALNSSAEMTSNILAIVINLDNTLDSLNL-GISRKLLAEEYP-------SWVSLG  224

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   P   +P++ VAQDG+G  KTI  AL  +P+K++   VI IK GVYKE V V 
Sbjct  225   KRRLLQLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKEKVQVN  284

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R   N++ VG+G  KT ITG+ N  D     T++  TV V G+GFI +DL IEN+AGA K
Sbjct  285   RSLTNVIMVGDGTNKTKITGSLNYIDG--TATFKTATVAVIGDGFIGKDLWIENSAGAAK  342

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D +V +N  ++ YQDTLY H+ RQFYR C ISGT+DFIFG+   V Q C 
Sbjct  343   HQAVALRVQSDKSVFYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQNCL  402

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++ RKP+ NQ  +VTAQGRKDRR A+AIV+ +C I A+PA          FLGRPWKEFS
Sbjct  403   ILARKPMDNQQNIVTAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWKEFS  462

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT ++ S +D+++ P+GW PW  NF L+TC+Y E  NRGPGA+T +RVKWKG K  I   
Sbjct  463   RTFVLQSQLDDLIDPKGWLPWFENFGLNTCFYTELDNRGPGANTSQRVKWKGVK-TIGYA  521

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A++FT   F+  +  WL ++ +P+ PG L
Sbjct  522   HAQKFTVEHFIQGN-TWLPKSGVPYIPGLL  550



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   364 bits (934),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 244/378 (65%), Gaps = 12/378 (3%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQF---VDSATRHLLVAPP  2484
             EL++N L +V+ +   + +LE    + R L +          QF    D  TR LL AP 
Sbjct  201   ELSANLLDIVSGISSAIPSLE--SFTHRRLLQDDLPVLGHGDQFPTWTDFGTRRLLAAPV  258

Query  2483  ---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFV  2313
                + DIVVA+DGSG F TI  AL  +P K+ +  V+ IKAGVY+EY+ + +   N+V +
Sbjct  259   SKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKGMINLVVI  318

Query  2312  GEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRIS  2133
             G+G   T I GN+N  D     T+   TV V G+ F+ +++  EN AGA+K QAVALR+S
Sbjct  319   GDGRENTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQAVALRVS  376

Query  2132  ADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLAN  1953
             AD AV +NC ++ +QDTLYTH+ RQFYR C+ISGT+DF+FG+A  VFQ CK +VRKPL N
Sbjct  377   ADYAVFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN  436

Query  1952  QACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFI  1773
             Q C+VTAQGRK RR  SA++IQ+  I A P L       K +LGRPWKE+SRT+IM SFI
Sbjct  437   QQCIVTAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFI  496

Query  1772  DNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGP  1593
             D+++ PEGW PW G F L TCWY E+ N GPG+S + RVKW G K  I+ + A  FTPG 
Sbjct  497   DDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGR  555

Query  1592  FLMADEQWLGRAQIPFSP  1539
             FL  D  W+    IP++P
Sbjct  556   FLKGDS-WIKATGIPYTP  572



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   366 bits (940),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/409 (46%), Positives = 252/409 (62%), Gaps = 11/409 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRR--LLeeptpttdeeiP---QF  2523
             EKMK  L +SMELTSNAL M+T++     +L     SRR  LL +  P           +
Sbjct  178   EKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRRLLFDEAPVLGHGNELLPDW  237

Query  2522  VDSATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
             VD   R LL A   +PDIVVA+DGSGK+KTI  AL +IP   ++  V+ IK G+Y E V 
Sbjct  238   VDMRRRRLLAAKEIKPDIVVAKDGSGKYKTINEALKNIPNNRNQTYVLYIKQGIYNEKVE  297

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
                   N++ +G+GPTKT ITGN+N  D  P  TY   T  V G+ FI +D+  EN+AG 
Sbjct  298   FTSSMTNLMVIGDGPTKTRITGNQNFKDGTP--TYLTATAAVMGDYFIAKDIGFENSAGP  355

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
              K QAVALR++AD ++ +NCH++ YQDTL  H+YRQFYR C I GT+DF+FG+   VFQ 
Sbjct  356   EKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQN  415

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C + VRKPL  Q C+VTAQGR D R  + +V Q+C IVA+ +        K +LGRPWKE
Sbjct  416   CTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYNEVKGEVKTYLGRPWKE  475

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM S ID+++ PEGW  W   FAL+T +Y E+ NRG G+S  +RVKW+G K  + 
Sbjct  476   YSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKKERVKWQGVKE-LQ  534

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
                 ++FT   FL  D  W+    IP++PG FL P  +   +   P  D
Sbjct  535   INRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLSPPQQDTSVEYSPVDD  582



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   362 bits (930),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 187/392 (48%), Positives = 253/392 (65%), Gaps = 22/392 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-------SRRLLeeptpttdeeiP  2529
             + M  + +TS ELTSNALAM+T +  FL    I G+        R+LL            
Sbjct  185   QDMHKIFETSKELTSNALAMITSISTFLGE-HITGLIGDHGNHGRKLLSTEDGIP-----  238

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      +PD+VVAQDGSG++KTI  AL+ +P+ N +  VI IK GVY E
Sbjct  239   SWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIKQGVYNE  298

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIE  2181
              V V +K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++  E
Sbjct  299   KVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNFTAKNIGFE  355

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG    QAVALR+SAD AV HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  
Sbjct  356   NTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGK  415

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VV QKC +VVRKP+  Q+CM+TAQGR + R ++ +V+ +C I  EP        NK +LG
Sbjct  416   VVLQKCNIVVRKPMKGQSCMITAQGRTNERESTGLVLDNCHITGEPEYIPVKSINKAYLG  475

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+FSRT+IM + I+++V P GW PW G+FAL+T +YAEY+N G G+   +RVKW G 
Sbjct  476   RPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGI  535

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  536   KK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   362 bits (929),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/392 (47%), Positives = 254/392 (65%), Gaps = 22/392 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-------SRRLLeeptpttdeeiP  2529
             + M  + +TS ELTSNALAM+T +  FL    I G+       +R+LL            
Sbjct  185   QDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGNHARKLLSTEDGIP-----  238

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V   TR L+      +P++VVAQDGSG++KTI  AL+ +P+ N +  VI IK GVY E
Sbjct  239   SWVGPNTRRLMAEQGVVKPNVVVAQDGSGEYKTINEALSVVPKANQKPFVIYIKQGVYNE  298

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGG--TYRCGTVIVEGEGFICRDLTIE  2181
              V V +K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+    +++  E
Sbjct  299   KVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNLTAKNIGFE  355

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG    QAVALR+SAD AV HNC ++ YQDTLY HS+RQFYR CTISGTVDFIFG+  
Sbjct  356   NTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGK  415

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
             VV QKC +VVRKP+ +Q+CM+TAQGR D R ++ +V+ +C I  EP        NK +LG
Sbjct  416   VVLQKCNIVVRKPMKSQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLG  475

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK+FSRT+IM + I+++V P GW PW G+FAL+T +YAEY+N G G+   +RVKW G 
Sbjct  476   RPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGI  535

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  536   KK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   362 bits (930),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 188/390 (48%), Positives = 249/390 (64%), Gaps = 8/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              E MK  L  S  LTSN+LA++ ++   L T +IP +SRRLL E      E    +V + 
Sbjct  197   AESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLSRRLLSEEEADDGEYP-SWVTNG  255

Query  2510  TRHLL---VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   +   +PDIVVAQDGSG ++TI  AL +IP+ ++   VI IK GVYKE V + 
Sbjct  256   KRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIYIKEGVYKEQVWLD  315

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   N++ +G+GPTKT ITGN N  D           V+  GEGFI +DL  EN+AG  K
Sbjct  316   KSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVV--GEGFIAKDLGFENSAGPEK  373

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D ++ +NC ++ YQDTLY H+ RQFYR CTI+GT+DFIFG++  +FQ C 
Sbjct  374   HQAVALRVQSDRSIFYNCQMDGYQDTLYCHTKRQFYRDCTITGTIDFIFGDSASIFQNCL  433

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRKPLANQ C+VTA GRKDRR A+AI++ +C I A+      +  N  +LGRPWK +S
Sbjct  434   IKVRKPLANQQCIVTASGRKDRREATAIILHNCTISADSEYLPFHIQNPSYLGRPWKPYS  493

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM S ID  + PEGW PW G+  L TC+YAE  N G GA+  KRV W+GYK+ I   
Sbjct  494   RTIIMQSQIDEFIHPEGWLPWLGDVGLHTCFYAEVDNHGLGANVTKRVTWRGYKK-IDSS  552

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A+QFT   F+  +  WL    +P+ PG L
Sbjct  553   HAQQFTVQRFIQGNS-WLRPTGVPYIPGLL  581



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   361 bits (927),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 253/390 (65%), Gaps = 8/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              E M+  ++ S ++TSNALAMV +LD  +++L I  + RR L       +     ++ +A
Sbjct  181   AETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSLLRRKLLSDAGANEFP--SWMPAA  238

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              R LL   P    P++ VAQDG+G F+TIT AL  +P+ N+   VI +KAGVYKE  +V 
Sbjct  239   QRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKAGVYKERFLVD  298

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +    +  +G+GPTKT ITGN +V       T++  TV V GE F+   L  ENTAG  K
Sbjct  299   KHMTKVTMIGDGPTKTKITGNVSVI-AGEISTFKTATVAVAGEWFVGIGLGFENTAGPEK  357

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR++AD +V +NC ++ YQDTLY HS RQFYR CTI+GT+DFIFG++  +FQ C 
Sbjct  358   HQAVALRVNADRSVFYNCRMDGYQDTLYAHSERQFYRDCTITGTIDFIFGDSATIFQNCM  417

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++ RKP+ NQ  +VTAQGRK+R+G  AIV+Q+C I ++PA          +LGRPWK +S
Sbjct  418   IIARKPMDNQQNIVTAQGRKERQGNGAIVLQNCTITSDPAYYPHRKVLPTYLGRPWKPYS  477

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTLI+ S +D+++ P+GW PW G+  LDTC+YAE  NRGPGA   KRV W G K N++  
Sbjct  478   RTLILQSQLDDLIHPDGWLPWTGDVGLDTCFYAELDNRGPGADLTKRVTWPGIK-NLTYV  536

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A+++T   +L   + W+ RA +PF PG L
Sbjct  537   EAQEYTIENYLYG-QTWISRAGVPFIPGLL  565



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   361 bits (926),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 185/393 (47%), Positives = 253/393 (64%), Gaps = 18/393 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG-------ISRRLLeeptpttdeeiP  2529
             ++M+H+ KT+ EL+SN+LAMVT +   L      G        +R+LL            
Sbjct  179   QEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTEDGIPT----  234

Query  2528  QFVDSATRHLLVAPPRP---DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +V    R L+ A P P   + VVAQDGSG+FKTI  ALN+IP+ N    VI IK G+YK
Sbjct  235   -WVGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQGIYK  293

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E VMV RK   + F+G+G TKTVITGN+N        T++   +IVEG+ F  +++ +EN
Sbjct  294   EKVMVTRKMPYVTFIGDGQTKTVITGNQNYG-IGKVKTFQTAPLIVEGDHFTMKNIGVEN  352

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAG    QAVALR+SAD AV H+C  + YQDTLY HS+R F+R CT+SGTVDFIFG+A  
Sbjct  353   TAGPEGGQAVALRVSADYAVFHSCQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKC  412

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             + Q CK+VVRKP   Q+CMVTAQGR D R ++ +V+ +C I  +PA       +K +LGR
Sbjct  413   ILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGR  472

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWK+FSRT++M + ID+++ P GW  W G+FAL T +YAEY N GPG++  +RVKW G  
Sbjct  473   PWKQFSRTIVMKTLIDDVIDPAGWLEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWPGI-  531

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             R I+P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  532   RKITPQDALSYTGDRFLGGN-TWIPQTQVPYTP  563



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   361 bits (927),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 256/397 (64%), Gaps = 17/397 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ-----  2526
             GEKM+  LKTS ELT+N LAMV ++      L +    RRLLE    T  ++  +     
Sbjct  182   GEKMREFLKTSQELTNNGLAMVDQVSTMFGALNVKS-GRRLLEATAGTGAKKFQKAKVIP  240

Query  2525  -FVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRI-VILIKAGVY  2361
              ++D+    L  A P   +PD+VVA+ G GK+ T+  AL  IP+ N  ++ VI +K GVY
Sbjct  241   AWIDNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVKEGVY  300

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +E+V+  +   N++ +G+GPTKT+ITG +N A+     T +  TV V G+ FI +D+  E
Sbjct  301   EEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTK--TMQTATVGVVGDYFIAKDIGFE  358

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAGAV  QAVALR+ +D+++ +NC ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A 
Sbjct  359   NTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  418

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
              VFQ CKM+VRKPL NQACMVTA GR DRR  + I++Q+C I  EP  +     NK +LG
Sbjct  419   AVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTGIILQNCTISGEPGYE--KDLNKAYLG  476

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK ++R ++M S ID+++ PEGW  W G+    +CW+ E+ NRG GA   KR  W+G 
Sbjct  477   RPWKNYARAIVMQSQIDDVIAPEGWMEWIGSNNHQSCWFGEFGNRGLGADQTKRATWRGI  536

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K  ++ + A  FT G F+  D +W+  + +P+  G +
Sbjct  537   KE-LTAQHAADFTAGRFVFGD-RWIQPSGVPYVAGMM  571



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   360 bits (925),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/394 (48%), Positives = 254/394 (64%), Gaps = 21/394 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + KTS EL+SN+LAMVT L   L    I G++       R+LL            
Sbjct  177   QDMLKIFKTSRELSSNSLAMVTDLSTILPNSNITGLTGTLANYARKLLSTKDGIPT----  232

Query  2528  QFVDSATRHLLVAPP------RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
              +V    R L+ AP       + + VVAQDGSG+FKTI  ALN++P+ N    VI IK G
Sbjct  233   -WVGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIADALNAVPKDNRLPFVIHIKQG  291

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V+V +K   + F+G+GPTKT ITG+ N        T+   TV ++GE F  +++ 
Sbjct  292   IYKEKVIVTKKMPYVTFIGDGPTKTKITGSLNFG-LGKVKTFLTATVTIDGEHFTAKNIW  350

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
             IENTAG    QAVALR+SAD AV ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG+
Sbjct  351   IENTAGPEGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGD  410

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  + Q CK+VVRKP   Q+CMVTAQGR D R ++ +V+ +C IV EPA       NK +
Sbjct  411   AKCILQNCKIVVRKPKGGQSCMVTAQGRTDVRESTGLVLHNCHIVGEPAYIPVKSVNKAY  470

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWK  1647
             LGRPWK+FSRT+IM + ID+++ P GW PW+G+FAL+T +YAE+ N GPG++  +RV W 
Sbjct  471   LGRPWKKFSRTIIMKTTIDDVIDPAGWLPWRGDFALETLYYAEHLNIGPGSNQAQRVNWP  530

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             G K+ +SPE A  +T G FL  D  W+ + Q+P+
Sbjct  531   GIKK-LSPEEALLYTGGRFLHGD-TWIPQTQVPY  562



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   361 bits (927),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/411 (45%), Positives = 256/411 (62%), Gaps = 12/411 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP---QFV  2520
             GEKMK  L  SM+LTSNAL+M+T++ +   +L      RRLL + TP     I     ++
Sbjct  177   GEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLGHGIELLPDWI  236

Query  2519  DSATRHLLVA----PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
             D   R LL        +PD+VVA+DGSGK+K I  AL  IPE  ++  V+ IK GVY E 
Sbjct  237   DVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVYDEK  296

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V +    +N+V +G+GPTKT ITGN++     P  TY+  TV + G+ F+ +D+  ENTA
Sbjct  297   VEILSTMSNLVIIGDGPTKTRITGNQSFKGGVP--TYQTSTVAIMGDYFVAKDIGFENTA  354

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QA+ALR++AD ++ +NCH++ YQDTL  H+YRQFYR CTI GT+DF+FG+A  VF
Sbjct  355   GPDKHQALALRVAADKSIFYNCHMDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVF  414

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C + VRKP+  Q C+VTAQGR D R  S IV+Q+C IVA+ +        K +LGRPW
Sbjct  415   QNCTLAVRKPMKEQHCIVTAQGRTDLRQPSGIVLQNCSIVADESYNEVKGEAKTYLGRPW  474

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K++SRT+IM S ID+++ PEGW  W   FA DT +Y E+ N+G G+S   RV W G K  
Sbjct  475   KQYSRTIIMESKIDDLIQPEGWLEWNKTFAFDTLFYTEFNNKGLGSSKADRVTWSGVKE-  533

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF-LQP*NKQAKLSSHPTKD  1482
             +  E  ++FT   FL AD  W+    +P++ GF L P    + +   P  D
Sbjct  534   LPIERVQRFTASNFLDAD-LWIPSTGVPYTSGFLLSPPQSDSSIVYSPVND  583



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   360 bits (925),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 256/395 (65%), Gaps = 16/395 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP---QFV  2520
             G KMK+ LKTS ELT NALAM T++    +T  +    RRLL +      +       ++
Sbjct  181   GAKMKNFLKTSQELTKNALAMATEIGNLFRTSSLKS-QRRLLADTPMDPKKAPKIIPSWI  239

Query  2519  DSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKND-RRIVILIKAGVYKEY  2352
             +     +  A P   +PD++VA+DGSGK+KT+  AL  IP+ N  +  VI IK GVY E 
Sbjct  240   EGRKLDIATANPISLKPDVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGVYSEQ  299

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V++ +   N++F+G+GPTKT ITGN+N AD     T++  TV V G+ FI +D+  ENTA
Sbjct  300   VVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQ--TFKTATVAVIGDYFIAKDIGFENTA  357

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             GA   QAVALR+ +D+++ +NC ++ YQDTLYT ++RQFYR C ISGT+DFIFG+A  VF
Sbjct  358   GARGHQAVALRVQSDLSIFYNCQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDAAAVF  417

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q CKM+VRKP  NQ+CMVTAQGR D+R  + IV+Q+C I  E    AA      +LGRPW
Sbjct  418   QNCKMIVRKPGPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFDAAT--TMAYLGRPW  475

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K +SRT++M S IDN++ P GW  W G    +T W+ E+ NRG GA+T++RVKW  YK  
Sbjct  476   KMYSRTIVMQSQIDNVINPLGWMEWTGTTNHETSWFGEFSNRGLGAATNQRVKW--YKL-  532

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              +PE A  F PG  L+ D +W+  + +P+  G ++
Sbjct  533   ATPEEAGAFAPGSILLGD-KWIMPSGVPYVAGMMR  566



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   358 bits (918),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/399 (47%), Positives = 244/399 (61%), Gaps = 13/399 (3%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATR  2505
             KM+  L TS ELT N LA+V +  E L +L +P   RRLL               D A R
Sbjct  173   KMRRALNTSQELTENILALVDEFSETLASLGLPSFHRRLLAGNGGAPSW----MTDDAKR  228

Query  2504  HLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              +L A P     +PD+ VA DGSG FKTI  AL  +P K+    V+ +KAG YKEYV VP
Sbjct  229   RVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVPTKSATAYVMYVKAGTYKEYVSVP  288

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R   N+V VG+G TKTV+TG+++ A      T    T+ V G GF  R + +ENTAGA  
Sbjct  289   RNVTNLVVVGDGATKTVVTGSKSFAMNIT--TKDTATMEVIGNGFQMRGVGVENTAGARN  346

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+  + C  + YQDTLYTH+ RQ+YR C ++GT+DFIFGNA VVFQ C 
Sbjct  347   HQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCVVTGTIDFIFGNAQVVFQNCL  406

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRK + NQ  +VTAQGRK+RR A   VI +C +   P  +++    K +LGRPWKE S
Sbjct  407   IQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTVEPHPEFESSAGRLKTYLGRPWKEHS  466

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTL + S I   V P+GW PW G+F L TC+YAE +N GPGA T KR KWKG K NI+ +
Sbjct  467   RTLYIQSEIGGFVDPQGWLPWLGDFGLSTCYYAEVENHGPGADTSKRAKWKGVK-NITYQ  525

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
              A+Q       +  + WL +  +PF PG L P N+  ++
Sbjct  526   QAQQKYTVERFIQGQTWLPKLGVPFIPGLL-PQNQTGRI  563



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   358 bits (919),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/404 (47%), Positives = 248/404 (61%), Gaps = 31/404 (8%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-------SRRLLeeptpttdeeiP  2529
             ++M  + KTS ELTSN LAMV+ L   L    I G+       +R+LL            
Sbjct  184   QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGSYARKLLSTEDGFPT----  239

Query  2528  QFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              ++    R L+ A     +P+ VVA DGSG+FK+I  AL ++P KN    VI IK G+YK
Sbjct  240   -WMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYK  298

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V V +  + + F+G+GPTKT ITGN N        TY+  TV V GE F  +D+  EN
Sbjct  299   EKVDVTKTMSYVTFIGDGPTKTRITGNLNFG-MGKVKTYQTATVAVNGEHFTAKDIGFEN  357

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAY-------------QDTLYTHSYRQFYRGCTI  2037
             TAG    QAVALR+SAD AV HNC ++ Y             QDTLY HS+RQFYR CTI
Sbjct  358   TAGPKGHQAVALRVSADYAVFHNCQIDGYVDSFYANCQIDGYQDTLYAHSHRQFYRDCTI  417

Query  2036  SGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPAL  1857
             SGT+D+IFG+A   FQ C MVVRKP+  Q+CMVTAQGR D+R  + IV+ +C I  +PA 
Sbjct  418   SGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAY  477

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPG  1677
                   NK +LGRPWK+FSRT+IM + I++I+ P+GW  W GNFALDT  YAE++N+GPG
Sbjct  478   IPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPG  537

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++   RVKW G K+  +P  A +FT G FL     W+ + Q+P+
Sbjct  538   SNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGG-TWIPQTQVPY  579



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   362 bits (928),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/411 (45%), Positives = 257/411 (63%), Gaps = 12/411 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP---QFV  2520
             GEKMK  L  SM+LTSNAL+M+T++ +   +L      RRLL + TP     I     ++
Sbjct  177   GEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLGHGIELLPDWI  236

Query  2519  DSATRHLLVA----PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
             D   R LL        +PD+VVA+DGSGK+K I  AL  IPE  ++  V+ IK GVY E 
Sbjct  237   DVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVYNEK  296

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V +    +N+V +G+GPTKT ITGN++  D  P  TY+  TV + G+ F+ +D+  ENTA
Sbjct  297   VEILSTMSNLVIIGDGPTKTRITGNQSFKDGIP--TYQTSTVAIMGDYFVAKDIGFENTA  354

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QA+ALR++AD ++ +NCH++ YQDTL  H+YRQFYR CTI GT+DF+FG+A  VF
Sbjct  355   GPDKHQALALRVAADKSIFYNCHVDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVF  414

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C + VRKP+  Q C+VTAQGR D R  + +V Q+C IVA+ +        K +LGRPW
Sbjct  415   QNCTLAVRKPMKEQHCIVTAQGRTDARQPTGLVFQNCSIVADESYNEVKGEVKTYLGRPW  474

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K++SRT+IM S ID+++ PEGW  W   FA +T +Y E+ N+G G+S   RV+W G K  
Sbjct  475   KQYSRTIIMESNIDDLIQPEGWLEWNKTFAFETLFYTEFNNKGSGSSKTDRVRWSGVKE-  533

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
             +  E  ++FT   F+ AD  W+    +P++ G FL P    + +   P  D
Sbjct  534   LPIERVQRFTTSSFIDAD-LWIPSTGVPYTSGFFLSPPQSDSSIVYSPVDD  583



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   374 bits (959),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 259/399 (65%), Gaps = 19/399 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG------ISRRLLeeptpttdeeiP  2529
             G +M+ +L+ SME+TSN L MV ++  FL ++   G       SRRLL            
Sbjct  172   GNRMRQVLRESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAVTSRRLLSTDEFLP-----  226

Query  2528  QFVDSATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEK-NDRRIVILIKAGVY  2361
             ++VD+  R LL A P+   PD++VA+DG+G + TI  AL +IP+   ++ IV+ I+ GVY
Sbjct  227   EWVDAGKRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPKSGKNKTIVLYIREGVY  286

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +E +       N+  +G+GPTKT ITG  N  D     TY+  TV V+G+ FI RD+  E
Sbjct  287   EEKLQFNSSMKNLFVIGDGPTKTRITGKSNFIDGT--NTYQTATVAVQGDDFIARDIGFE  344

Query  2180  NTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAP  2001
             NTAG  K QAVALR+SAD A+ +NCH++AYQDTLY H+YRQFYR C ISGT+DFIFG++ 
Sbjct  345   NTAGPEKHQAVALRVSADKAIFYNCHMDAYQDTLYAHAYRQFYRNCRISGTIDFIFGDSA  404

Query  2000  VVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLG  1821
              VFQ C ++VRKPL NQ C+VTAQGRK+ R  +  ++Q+C I  +  L A     K +LG
Sbjct  405   AVFQNCTLLVRKPLENQQCVVTAQGRKEIRQPTGFILQNCSIRPDRDLYAIRKNIKTYLG  464

Query  1820  RPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             RPWK++SRT+IM SF+D+++ P GW PW G FALDT +Y E+ NRGP A   +R +W G 
Sbjct  465   RPWKQYSRTVIMESFLDDLICPTGWLPWNGTFALDTLFYTEFNNRGPAAPKKQRARWPGV  524

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             K   S  + ++FT   FL  +  W+ R Q+P++PGF+ P
Sbjct  525   KELPSSRI-QRFTAVEFLDGN-GWIPRTQVPYTPGFVFP  561



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   357 bits (917),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 188/396 (47%), Positives = 250/396 (63%), Gaps = 24/396 (6%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiPQF  2523
             M ++ K+S EL+SN+LAM T L   L    I G++       R+LL             +
Sbjct  179   MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAKYARKLLYTEDGIPT-----W  233

Query  2522  VDSATRHLLVAPPRP---------DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKA  2370
             V    R L+ A P+P         ++ VAQDGSG FKTIT AL  +P+ N    +I IK 
Sbjct  234   VGPHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKE  293

Query  2369  GVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKE V V +K   + F+G+GP KT ITGN N        T+   T+ +EGE F  +++
Sbjct  294   GIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFG-IGKVKTFLTSTLTIEGEHFTAKNI  352

Query  2189  TIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFG  2010
              IENTAG    QAVALR+SAD AV ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG
Sbjct  353   GIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFG  412

Query  2009  NAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             +A  + Q C +VVRKP   Q+CMVTAQGR D R ++ +V+ +C I+ EPA       NK 
Sbjct  413   DAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGEPAYIRVKSVNKA  472

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM + ID+++ P GW PWKG+FAL T +YAE+ N GPG++   RVKW
Sbjct  473   YLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKW  532

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  533   PGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   356 bits (914),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 253/387 (65%), Gaps = 9/387 (2%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRH  2502
             M ++ K S +L+SN+LAMVT L+      E+ G       +   T ++ +P +V    R 
Sbjct  179   MINIFKRSRQLSSNSLAMVTDLNS--NATELTGAFENNARKLLSTEEDGVPTWVGPEARR  236

Query  2501  LLVAPPRPDI----VVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             L+ AP  P +    VVAQDGSG+FKTI  ALN++P++N    VI IK GVYKE V+V RK
Sbjct  237   LMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVVTRK  296

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
                + F+G+GPTKTVITG+ N        TY    + VEGE F  + + +ENTAG    Q
Sbjct  297   MPYVTFIGDGPTKTVITGSLNFG-IGKVKTYLTAPLTVEGEHFTAKGIGMENTAGPEGGQ  355

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+S D AV  +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG++  + Q CK+V
Sbjct  356   AVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIV  415

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+A Q+CMVTAQGR D R  + IV+ +C IV +PA       +K +LGRPWKEFSRT
Sbjct  416   VRKPMAGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRT  475

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             ++M + +D+++ P GW PW G+FAL T +YAE+ N GPGA+  +RVKW G K+ ++PE A
Sbjct  476   IVMKTIVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTPEQA  534

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGF  1533
               +T   FL  +  W+ R Q+P++ G 
Sbjct  535   LSYTGDRFLSGN-TWIPRTQVPYTAGM  560



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   356 bits (914),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 185/397 (47%), Positives = 251/397 (63%), Gaps = 23/397 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + +TS EL+SN+LAMVT +   L    I G++       R+LL            
Sbjct  179   QDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGALANYARKLLSTEDGIP-----  233

Query  2528  QFVDSATRHLLVAPP--------RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIK  2373
              +V    R L+ A          + + VVAQDGSG+FKTIT ALN +P+ N    VI IK
Sbjct  234   NWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALNGVPKGNTVPFVIHIK  293

Query  2372  AGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKE VMV RK   + F+G+GP KTVITG+ N        T+   T+ VEG+ F  ++
Sbjct  294   QGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFG-IGKVKTFLTATITVEGDHFTAKN  352

Query  2192  LTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIF  2013
             + IENTAG    QAVALR+SAD AV H+C ++ +QDTLY HS+RQFYR CT+SGTVDFIF
Sbjct  353   IGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIF  412

Query  2012  GNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNK  1833
             G+A  + Q CK+VVRKP   Q+CMVTAQGR + R ++ +V+  C I  +PA       NK
Sbjct  413   GDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPVKSVNK  472

Query  1832  VFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVK  1653
              +LGRPWKEFSRT+IM + ID+++ P GW PW G+FAL T +YAE+ N GPG++  +RVK
Sbjct  473   AYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVK  532

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             W G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  533   WPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  567



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   355 bits (912),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/392 (47%), Positives = 256/392 (65%), Gaps = 18/392 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             ++M ++ KTS ELTSN+LAMVT +   L    I G++       R+LL            
Sbjct  179   QEMINIFKTSRELTSNSLAMVTGMSTLLPNSNITGLTGVLASYARKLLSTEDGIPT----  234

Query  2528  QFVDSATRHLLVA---PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +V    R L+VA   P + + VVAQDGSG+FKTIT ALN++P+ +    +I IK G+YK
Sbjct  235   -WVGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEGIYK  293

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V+V +K  ++ F+G+GPTKTVITG+ N        T+   T+ ++G  F  + + IEN
Sbjct  294   EKVIVTKKMPHVTFIGDGPTKTVITGSLNFR-IGKVKTFLTATITIQGNHFTAKSIGIEN  352

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             T+G    QAVALR+SAD AV +NC ++ YQ+TLY HS+RQFYR CT+SGTVDFIFG+A  
Sbjct  353   TSGPKGGQAVALRVSADYAVFYNCQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGDAKC  412

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             + Q CK+VVRKP  +Q+CMVTAQGR D R  + IV+ +C IV +PA       NK +LGR
Sbjct  413   ILQNCKIVVRKPKRSQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYLGR  472

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PW++FSRT+IM + ID+++ P GW  W+G  AL T +YAE+ N GPG++  +RVKW G K
Sbjct  473   PWRQFSRTIIMKTTIDDVIDPAGWLLWQGESALKTLFYAEHLNIGPGSNQAQRVKWPGLK  532

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + +SPE A  FT   FL+ D  W+ +  +P++
Sbjct  533   K-LSPEEALMFTGNRFLLGD-TWIPQTHVPYT  562



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   356 bits (914),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/391 (47%), Positives = 251/391 (64%), Gaps = 11/391 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             + M  +LK S+ELT+NAL ++  L  F+K L +  ++  L       +++ +P +V  + 
Sbjct  185   QTMAKVLKASLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSEDGLPSWVSQSQ  244

Query  2507  RHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             R LL AP   +P+ VVAQDGSG+FKT+T AL  +P+KN    VI +KAG+YKEYV V + 
Sbjct  245   RKLLAAPENVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGIYKEYVSVDKD  304

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
             ++++  +G+GPTKT+ TG+++ AD     TY   T  V    F   ++  EN+AGA K Q
Sbjct  305   RDHVTIIGDGPTKTIFTGSKSYADGVQ--TYNTATFGVNSAHFTALNVGFENSAGAAKHQ  362

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR++AD A+ +NC ++ YQDTLYT S RQFYR CTISGT+DF+FG+A  VFQ CK+V
Sbjct  363   AVALRVTADKALFYNCQMDGYQDTLYTQSKRQFYRDCTISGTIDFVFGDAVGVFQNCKLV  422

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ANQ CMVTA GR      SA+V Q+C    EP +     P   +LGRPW+ FS+ 
Sbjct  423   VRKPMANQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYLGRPWRNFSKV  481

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +I+ S ID + VPEG+ PW GN   +TC Y EY N+G GA+T+ RVKW G K  IS   A
Sbjct  482   VIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-TISAGEA  540

Query  1613  KQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              ++ PG F       A + W+  + IP+S G
Sbjct  541   AKYYPGKFYEIANGTARDDWITESGIPYSIG  571



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   355 bits (912),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 250/396 (63%), Gaps = 24/396 (6%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiPQF  2523
             M ++ K+S EL+SN+LAM T L   L    I G++       R+LL             +
Sbjct  179   MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAKYARKLLYTEDGIPT-----W  233

Query  2522  VDSATRHLLVAPPRP---------DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKA  2370
             V    R L+ A P+P         ++ VAQDGSG FKTIT AL  +P+ N    +I IK 
Sbjct  234   VGPHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIHIKE  293

Query  2369  GVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKE V V +K   + F+G+GP KT ITGN N        T+   T+ +EGE F  +++
Sbjct  294   GIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFG-IGKVKTFLTSTLTIEGEHFTAKNI  352

Query  2189  TIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFG  2010
              IENTAG    QAVALR+SAD AV ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG
Sbjct  353   GIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFG  412

Query  2009  NAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             +A  + Q C +VVRKP   Q+CMVTAQGR D R ++ +V+ +C I+ +PA       NK 
Sbjct  413   DAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGDPAYIRVKSVNKA  472

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM + ID+++ P GW PWKG+FAL T +YAE+ N GPG++   RVKW
Sbjct  473   YLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKW  532

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  533   PGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   359 bits (922),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 230/329 (70%), Gaps = 11/329 (3%)
 Frame = -2

Query  2510  TRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             +R LL   P    R ++VVA+DGSGKFKTI  AL  +P KN R+ VI IK GVYKE V V
Sbjct  366   SRRLLARRPSNSIRANVVVAKDGSGKFKTIAQALAMVPMKNKRKFVIHIKQGVYKEKVEV  425

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDLTIENTAG  2169
              +K  N++FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+  ENTAG
Sbjct  426   TKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDIGFENTAG  482

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A + QAVALR+SAD A+  NCH+N YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ
Sbjct  483   AARHQAVALRVSADFALFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQ  542

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C  V+R+P+ NQ C+VTAQGRKDRR  + IVI +  I+ + +       N+ FLGRPWK
Sbjct  543   NCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWK  602

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM + ID+++ PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R I
Sbjct  603   EYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-I  661

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             SP  A++F PG FL  +  W+ + +IP++
Sbjct  662   SPRAAREFAPGNFLRGN-TWIPQTRIPYN  689



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   355 bits (912),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/394 (45%), Positives = 249/394 (63%), Gaps = 12/394 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDS-  2514
             GEKM+  LKT+ ELTSN LAMV+++   + + ++    RRL+        +   + V   
Sbjct  179   GEKMRGFLKTAQELTSNGLAMVSEISRLVDSPKLNS-HRRLMSSSKGGQTKRNYKPVPGW  237

Query  2513  -ATRHL--LVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
              + RHL  L A P   +P++VVA+DG+GK+KTI  AL  +P+K++   VI IK G+Y+E 
Sbjct  238   MSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEET  297

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V+V ++  N+V +G+GPT T I+G+++ AD     T    T    G  F+ + +  ENTA
Sbjct  298   VIVDKEMTNVVMIGDGPTMTRISGSKSHADGIT--TMNTATFAAVGNYFVAKGIGFENTA  355

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G VK QAVALR+ +D ++  NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +F
Sbjct  356   GHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALF  415

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q CKMVVRKP   QACMVTAQGR DR   + I +Q+C I  EP   A    NK +LGRPW
Sbjct  416   QNCKMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPW  475

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K+F+R ++M S ID  + PEGW+ W G      C++ EY NRGP     +RVKW   KR 
Sbjct  476   KKFARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-  534

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  535   LTPDQAAAFTPARVFEGD-KWVKPSGVPYVPGMM  567



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   356 bits (913),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 254/404 (63%), Gaps = 20/404 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS---RRLLeeptpttdeeiP--Q  2526
             GEKMK  L  S ELTSN L + T+L    K+L I   +   +R+L E       +     
Sbjct  189   GEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLEEQGEAKNKEEIPH  248

Query  2525  FVDSATRHLL-VAPP--RPDIVVAQDGSGKFKTITGALNSIP-------EK-NDRRIVIL  2379
             +VD+  + LL V  P  + D+VVA+DGSG FKTIT AL   P       EK  ++  VI 
Sbjct  249   WVDTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDATKVEKGTNKTFVIY  308

Query  2378  IKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY+E V V      ++ +G+GPTKT ITG +N AD +    ++  TV + G  FI 
Sbjct  309   IKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFV--LFKTATVSIFGHNFIA  366

Query  2198  RDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDF  2019
             +D+  EN+AGA K QA+AL + +D +V +NCH+N YQDTLY HSYRQFYR CT+SGT+DF
Sbjct  367   KDIGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYAHSYRQFYRHCTVSGTIDF  426

Query  2018  IFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP  1839
             IFGNA  VFQ CK+V+RKPL ++ C++TAQ R+  R  +  ++Q+C I+A+P        
Sbjct  427   IFGNAAAVFQNCKLVIRKPLEDEGCVITAQARQHVREPTGFILQNCTIMADPLYYPLRLK  486

Query  1838  NKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKR  1659
             +K FLG PWK+FSRT+IM SF+ + + PEGW PW G F   +C+++EY+NRGPGA+   R
Sbjct  487   SKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQSSCFFSEYENRGPGAALLGR  546

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             VKW G K+ I+P+ A  FTP  F   +  W+    +P+ PG + 
Sbjct  547   VKWHGIKK-ITPQQADGFTPSKFYQGN-HWIIPTGVPYEPGMMH  588



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   355 bits (911),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/394 (45%), Positives = 245/394 (62%), Gaps = 12/394 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ----F  2523
             GEKMK  LKT+ ELTSN LAMV+++   + + ++    RRL+            +    +
Sbjct  179   GEKMKGFLKTAQELTSNGLAMVSEISRLVGSPKLNS-HRRLMSSSKGGQRNRNYKPVPGW  237

Query  2522  VDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
             +      LL A P   +P++VVA+DG+GK+KTI  AL  +P+K+    VI IK GVY+E 
Sbjct  238   MSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYIKKGVYEET  297

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V+V ++  N+V +G+GPT T I+G+++ AD     T +  T    G  F+ + +  ENTA
Sbjct  298   VIVDKQMTNVVMIGDGPTMTRISGSKSHADGVT--TMKTATFAALGNYFVAKGIGFENTA  355

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G VK QAVALR+ +D ++  NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +F
Sbjct  356   GHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALF  415

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q CKMVVRKP   QACMVTAQGR D    + I +Q+C I  EP   A    NK +LGRPW
Sbjct  416   QNCKMVVRKPGETQACMVTAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPW  475

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             K F+R ++M S ID  + PEGW+ W G      C++ EY N GPG+   +RVKW   KR 
Sbjct  476   KNFARVVVMQSSIDEAIAPEGWTEWTGEEYHQNCFFGEYGNTGPGSDVTQRVKWSTVKR-  534

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  535   LTPDQAAAFTPARVFEGD-KWIKPSGVPYVPGMM  567



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   351 bits (900),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/392 (46%), Positives = 251/392 (64%), Gaps = 17/392 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++    +  +  + ++ 
Sbjct  65    GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQHRLLNE  124

Query  2513  ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
                    A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EYV V
Sbjct  125   N------ASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEV  178

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+AG  
Sbjct  179   TKKMTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINMGFENSAGPH  236

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C
Sbjct  237   KHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNC  296

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
               VVRKP+ NQ C+VTAQGRK+R+  S IVIQ   IV++P   +    NK +L RPWK +
Sbjct  297   TFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNY  356

Query  1802  SRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N
Sbjct  357   SRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WN  415

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             ++ + A+ F+P  F    + W+    IP  PG
Sbjct  416   LNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  446



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   355 bits (911),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 250/389 (64%), Gaps = 12/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL +SM ++SNALA++T   + +  + +  I  RRLL++    +  E  + +D+
Sbjct  187   GKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKIVGRRLLQDYKTPSWVEHRKLLDA  246

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRR-IVILIKAGVYKEYVMVPR  2337
              T         P++ VA DGSG FK+I  AL  +P +  +   VI IKAGVY+EYV V  
Sbjct  247   KTNAF---KHTPNVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKAGVYREYVEVLT  303

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                +IVFVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++  EN+AG  K 
Sbjct  304   NMTHIVFVGDGGKKSIITGNKNFMDGVT--TYHTATVAIQGDHFTAINMGFENSAGPQKH  361

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+  D A+ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK 
Sbjct  362   QAVALRVQGDKAIFYNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKF  421

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             VVRKP+++Q C+VTAQGRK+R   SAIVI+   IVA+P        +K +L RPWK FSR
Sbjct  422   VVRKPMSDQQCIVTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKSYLARPWKNFSR  481

Query  1796  TLIMFSFIDNIVVPEGWSPW---KGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             T+IM +FID+++ P+G+ PW   +G   +DTC+YAEY N GPG+   KRVKW G   NI+
Sbjct  482   TIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYAEYHNYGPGSDKSKRVKWAGI-YNIN  540

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              + A++F P  F    + W+    IP+ P
Sbjct  541   TKAAQKFAPSKFFHGGD-WIKDTGIPYYP  568



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   358 bits (918),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 230/329 (70%), Gaps = 11/329 (3%)
 Frame = -2

Query  2510  TRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             +R LL   P    R ++VVA+DGSGKFKTI  AL  +P +N R+ VI IK GVYKE V V
Sbjct  366   SRRLLARRPTNGIRANVVVAKDGSGKFKTIAQALAMVPMQNKRKFVIHIKQGVYKEKVEV  425

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDLTIENTAG  2169
              +K  N++FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+  ENTAG
Sbjct  426   TKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDVGFENTAG  482

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A + QAVALR+SAD AV  NCH+N YQDTLY H++RQFYR C ISGT+DFIFG+A  VFQ
Sbjct  483   AARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQ  542

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C  V+R+P+ NQ C+VTAQGRKDRR  + IVI +  I+ + +       N+ FLGRPWK
Sbjct  543   NCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWK  602

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM + ID+++ PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R I
Sbjct  603   EYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-I  661

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             SP  A++F PG FL  +  W+ + +IP++
Sbjct  662   SPRDAREFAPGNFLRGN-TWIPQTRIPYN  689



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   353 bits (907),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 251/393 (64%), Gaps = 17/393 (4%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEI----PGISRRLLeeptpttdeeiPQFVDS  2514
             M + L  + +LTSNALA+V+++ + LK L++       +RRLL      T      +  S
Sbjct  179   MNNGLLNATQLTSNALAIVSEVAKILKALDVHLDGTKTNRRLLNVNGYPT------WFSS  232

Query  2513  ATRHLLVAPPR----PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
             A R LL +       P+ VVA+DGSG+FKTI  AL + P+KN+ R VI +KAGVY+EY+ 
Sbjct  233   ADRKLLASQDNGRLTPNAVVAKDGSGQFKTIAAALAAYPKKNNGRYVIYVKAGVYEEYIT  292

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             V +++ N+   G+GPTKT+ITG +N     P  T++  +    G+GFI + +  +NTAG 
Sbjct  293   VTKEQVNVFMYGDGPTKTIITGRKNNRQGVP--TFQTASFTAIGKGFIAKSIGFQNTAGP  350

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
                QAVALR+ +DM+   NC ++ YQDTLY  ++RQFYR C I+GT+DFIFG++  V Q 
Sbjct  351   EGHQAVALRVQSDMSAFFNCRMDGYQDTLYVQTHRQFYRNCVITGTIDFIFGDSSTVIQN  410

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
               ++VRKP+ NQ   VTA GRKD+   + +VIQ+C IV E  L       + +LGRPWKE
Sbjct  411   SLIIVRKPMDNQQNTVTAHGRKDKGERTGLVIQNCRIVPEEKLFPQRFKIRSYLGRPWKE  470

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM S I +++ PEGW PW G+FALDT +YAEY NRGPGA+T KRV WKG+K   +
Sbjct  471   YSRTVIMESTIGDLIQPEGWMPWSGDFALDTLFYAEYGNRGPGAATGKRVNWKGFKVITN  530

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
                A QFT GPFL  D +WL     PF  G  Q
Sbjct  531   KREALQFTAGPFLEGD-KWLPGTTTPFDLGLTQ  562



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   347 bits (891),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 246/391 (63%), Gaps = 12/391 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDS--AT  2508
             M+  LKT+ ELTSN LAMV+++   + + ++    RRL+        +   + V    + 
Sbjct  1     MRGFLKTAQELTSNGLAMVSEISRLVDSPKLNS-HRRLMSSSKGGQTKRNYKPVPGWMSD  59

Query  2507  RHL--LVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             RHL  L A P   +P++VVA+DG+GK+KTI  AL  +P+K++   VI IK G+Y+E V+V
Sbjct  60    RHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVIV  119

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              ++  N+V +G+GPT T I+G+++ AD     T    T    G  F+ + +  ENTAG V
Sbjct  120   DKEMTNVVMIGDGPTMTRISGSKSHADGIT--TMNTATFAAVGNYFVAKGIGFENTAGHV  177

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+ +D ++  NCH++AYQDTLYT +YRQFYR CTI+GTVDFIFG+   +FQ C
Sbjct  178   KHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNC  237

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             KMVVRKP   QACMVTAQGR DR   + I +Q+C I  EP   A    NK +LGRPWK+F
Sbjct  238   KMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKF  297

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +R ++M S ID  + PEGW+ W G      C++ EY NRGP     +RVKW   KR ++P
Sbjct  298   ARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTP  356

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FTP      D +W+  + +P+ PG +
Sbjct  357   DQAAAFTPARVFEGD-KWVKPSGVPYVPGMM  386



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   357 bits (917),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 230/329 (70%), Gaps = 11/329 (3%)
 Frame = -2

Query  2510  TRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             +R LL   P    R ++VVA+DGSGK KTI  AL  +P KN R+ VI IK GVYKE V V
Sbjct  366   SRRLLARRPTNSIRANVVVAKDGSGKCKTIAQALAMVPMKNKRKFVIHIKQGVYKETVEV  425

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPG--GTYRCGTVIVEGEGFICRDLTIENTAG  2169
              +K  N++FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+  ENTAG
Sbjct  426   TKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDIGFENTAG  482

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A + QAVALR+SAD AV  NCH+N YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ
Sbjct  483   AARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQ  542

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C  V+R+P+ NQ C+VTAQGRKDRR  + IVI +  I+ + +       N+ FLGRPWK
Sbjct  543   NCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWK  602

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+IM + ID+++ PEGW  W   FAL+T +Y EY+NRG G+   +RVKW+G +R I
Sbjct  603   EYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-I  661

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             SP  A++F+PG FL  +  W+ + +IP++
Sbjct  662   SPRAAREFSPGNFLRGN-TWIPQTRIPYN  689



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   353 bits (907),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 179/395 (45%), Positives = 253/395 (64%), Gaps = 21/395 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + KTS EL+SN+LAMVT++   +    + G++       R+LL            
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTEDSIPT----  234

Query  2528  QFVDSATRHLLVA------PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
              +V    R L+ A      P + + VVAQDG+G+FKTIT ALN++P+ N    +I IK G
Sbjct  235   -WVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEG  293

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V V +K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  +++ 
Sbjct  294   IYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFG-IGKVKTFLTATITIEGDHFTAKNIG  352

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
             IENTAG    QAVALR+SAD AV H+C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+
Sbjct  353   IENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGD  412

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  + Q CK+VVRKP   Q CMVTAQGR + R ++ +V+  C I  +PA       NK +
Sbjct  413   AKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAY  472

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWK  1647
             LGRPWKEFSRT+IM + ID+++ P GW PW G+FAL T +YAE+ N GPG++  +RVKW 
Sbjct  473   LGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWP  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  533   GIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   354 bits (909),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 181/388 (47%), Positives = 251/388 (65%), Gaps = 12/388 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDSA  2511
             +KMKHLL +S+ ++SN LA+V+   + +  + +  +  RRLL++    +  E    +D+ 
Sbjct  193   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSEIPSWVEHRILLDAM  252

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIP-EKNDRRIVILIKAGVYKEYVMVPRK  2334
             T     + P+P++ VA DGSG FK+I  AL  +P E+++   VI IKAGVY+EYV V + 
Sbjct  253   TNK---SKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYREYVEVLKN  309

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               +IVFVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++  EN+AG  K Q
Sbjct  310   MTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQGDHFTAINMGFENSAGPQKHQ  367

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+  D  +  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK V
Sbjct  368   AVALRVQGDKTIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFV  427

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP++NQ C+VTAQGRK+  G SAIVIQ   IVA+P        +K +L RPWK FSRT
Sbjct  428   VRKPMSNQQCIVTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRT  487

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM +FID+++ P+G+ PW    G   +DTC+YAEY N GPG++  KRVKW G   NI+ 
Sbjct  488   IIMDTFIDDLIHPDGFFPWHTEVGPINMDTCFYAEYHNYGPGSNKSKRVKWAGI-YNINS  546

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             + A +F P  F    + W+    IP+ P
Sbjct  547   KAAHRFAPSKFFHGGD-WIKDTGIPYFP  573



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   353 bits (907),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/395 (45%), Positives = 253/395 (64%), Gaps = 21/395 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiP  2529
             + M  + KTS EL+SN+LAMVT++   +    + G++       R+LL            
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTEDSIPT----  234

Query  2528  QFVDSATRHLLVA------PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
              +V    R L+ A      P + + VVAQDG+G+FKTIT ALN++P+ N    +I IK G
Sbjct  235   -WVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEG  293

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V V +K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  +++ 
Sbjct  294   IYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFG-IGKVKTFLTATITIEGDHFTAKNIG  352

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
             IENTAG    QAVALR+SAD AV H+C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+
Sbjct  353   IENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGD  412

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  + Q CK+VVRKP   Q CMVTAQGR + R ++ +V+  C I  +PA       NK +
Sbjct  413   AKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAY  472

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWK  1647
             LGRPWKEFSRT+IM + ID+++ P GW PW G+FAL T +YAE+ N GPG++  +RVKW 
Sbjct  473   LGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWP  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  533   GIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   353 bits (907),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 250/389 (64%), Gaps = 11/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++    +  +  + ++ 
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQHRLLNE  245

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
                 L     +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EYV V +K
Sbjct  246   NASPL---KRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKK  302

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+AG  K Q
Sbjct  303   MTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINMGFENSAGPHKHQ  360

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C  V
Sbjct  361   AVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFV  420

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPL NQ C+VTAQGRK+R+  S IVIQ   IV++P   +    NK +L RPWK +SRT
Sbjct  421   VRKPLENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRT  480

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ 
Sbjct  481   IIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNS  539

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + A+ F+P  F    + W+    IP  PG
Sbjct  540   KAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   353 bits (906),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 252/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFL-------KTLEIPGISRRLLeeptpttdeeiP  2529
             + MK + K S ELTSN+LAM+T +            T ++   +R+LL            
Sbjct  183   QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNARKLLNAEDGFP-----  237

Query  2528  QFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +V   TR L+ AP    +P++VVA+DGSG++K+I  AL ++P  N    VI IK GVYK
Sbjct  238   SWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYK  297

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V+V ++  ++ F+G+GPTKT ITG+ N A      TY   ++ VEG+ F+ +++ IEN
Sbjct  298   EKVVVTKQMYHVTFIGDGPTKTKITGSVNFA-IGKVRTYLTSSLTVEGDNFVAKNMGIEN  356

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAG    QAVALR+SAD  V+ NC ++ YQDTLY HS+RQFYR  TISGTVDFIFG++  
Sbjct  357   TAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIA  416

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             +FQ C +VVRKP+  Q CMVTAQGR D R  +AIV+ +C I+ EPA       NK +LGR
Sbjct  417   IFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGR  476

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWKEF+RT++M + I +++ P GW+ W G+FAL T +YAEY+N GPG++  +RVKW G +
Sbjct  477   PWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQ  536

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  537   RITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   353 bits (905),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 252/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFL-------KTLEIPGISRRLLeeptpttdeeiP  2529
             + MK + K S ELTSN+LAM+T +            T ++   +R+LL            
Sbjct  183   QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNARKLLNAEDGFP-----  237

Query  2528  QFVDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYK  2358
              +V   TR L+ AP    +P++VVA+DGSG++K+I  AL ++P  N    VI IK GVYK
Sbjct  238   SWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYK  297

Query  2357  EYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E V+V ++  ++ F+G+GPTKT ITG+ N A      TY   ++ VEG+ F+ +++ IEN
Sbjct  298   EKVVVTKQMYHVTFIGDGPTKTKITGSVNFA-IGKVRTYLTSSLTVEGDNFVAKNMGIEN  356

Query  2177  TAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPV  1998
             TAG    QAVALR+SAD  V+ NC ++ YQDTLY HS+RQFYR  TISGTVDFIFG++  
Sbjct  357   TAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIA  416

Query  1997  VFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGR  1818
             +FQ C +VVRKP+  Q CMVTAQGR D R  +AIV+ +C I+ EPA       NK +LGR
Sbjct  417   IFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGR  476

Query  1817  PWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYK  1638
             PWKEF+RT++M + I +++ P GW+ W G+FAL T +YAEY+N GPG++  +RVKW G +
Sbjct  477   PWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQ  536

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  537   RITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/389 (46%), Positives = 251/389 (65%), Gaps = 15/389 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG-ISRRLLeeptpttdeeiPQFVDSA  2511
             + M  + KTS EL+SN+LAMVT++   +    +    +R+LL             +V   
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTAKYARKLLSTEDSIPT-----WVGPE  233

Query  2510  TRHLLVA------PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
              R L+ A      P + + VVAQDG+G+FKTIT ALN++P+ N    +I IK G+YKE V
Sbjct  234   ARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYKEKV  293

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  +++ IENTAG
Sbjct  294   TVTKKMPHVTFIGDGPNKTLITGSLNFG-IGKVKTFLTATITIEGDHFTAKNIGIENTAG  352

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
                 QAVALR+SAD AV H+C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + Q
Sbjct  353   PEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQ  412

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              CK+VVRKP   Q CMVTAQGR + R ++ +V+  C I  +PA       NK +LGRPWK
Sbjct  413   NCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWK  472

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM + ID+++ P GW PW G+FAL T +YAE+ N GPG++  +RVKW G K+ +
Sbjct  473   EFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-L  531

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             +P+ A  +T   FL  D  W+ + Q+P++
Sbjct  532   TPQDALLYTGDRFLRGD-TWIPQTQVPYT  559



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 239/391 (61%), Gaps = 14/391 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             EKMK+ LK+S ELT N LA+V +  + L  L++P  SRRLL +           ++  A 
Sbjct  175   EKMKNALKSSQELTENILALVDQFGDTLANLDLPSFSRRLLGDDGLPG------WISDAK  228

Query  2507  RHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             R LL A P     +PD+ VA DGSG FKTI  AL  +P K     V+ +KAG YKEYV V
Sbjct  229   RRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPIKATATYVMYVKAGTYKEYVSV  288

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   N+V +G+G TKT+ITGN++        T    T+   G GF  R + +ENTAGA 
Sbjct  289   ARNVTNLVMIGDGATKTIITGNKSFMLNIT--TKDTATMEAIGNGFFMRGIGVENTAGAK  346

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVALR+ +D +V + C  + YQDTLYTH+ RQ+YR CTI+GT+DFIFGNA VVFQ C
Sbjct  347   NHQAVALRVQSDQSVFYQCQFDGYQDTLYTHTSRQYYRECTITGTIDFIFGNAQVVFQNC  406

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              +  R+ + NQ  +VTAQGRK++  A   VI +C I      KA     + FLGRPWKE+
Sbjct  407   LIQARRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHADFKADAAKFRTFLGRPWKEY  466

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRTL + S I   + P+GW PW G+F L+TC+YAE +NRG GA   KR KW+G K     
Sbjct  467   SRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGAGADMSKRAKWRGVKTVTYQ  526

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +  +++T   F+   +QW+ +  +PF PG L
Sbjct  527   QAQQKYTVERFIQG-QQWIPKYGVPFIPGLL  556



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/390 (46%), Positives = 250/390 (64%), Gaps = 8/390 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
              E M   +K S ++TSNALAM+ + D  + +  I   + R L   T   +     ++ +A
Sbjct  179   AEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISSHAGRKLLSGTRANEFPW--WMSAA  236

Query  2510  TRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
                 L   P   +P++ VAQDG+G FKTI+ AL  +P++N+   VI +KAGVYKE V+V 
Sbjct  237   QERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFVIYVKAGVYKEGVLVD  296

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +   ++  +G+GPTKT ITG+ +V  +    T++  TV V GE F    L  ENTAG   
Sbjct  297   KHMTHVTMIGDGPTKTKITGDVHVI-QGKISTFKTATVAVAGEWFTGMGLGFENTAGPQN  355

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR++AD +V +NC ++ YQDTLY HS RQFYR CTI+GT+DFIFG++  + Q C 
Sbjct  356   HQAVALRVNADRSVFYNCRMDGYQDTLYAHSGRQFYRDCTITGTIDFIFGDSATMLQNCM  415

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ  +VTA GR DR+G  A+VIQ+C I ++PA   +      +LGRPWK +S
Sbjct  416   IIVRKPMDNQQNIVTAHGRIDRQGNGALVIQNCTITSDPAYYPSRKKLPTYLGRPWKPYS  475

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTLI+ S +D++V P+GW PW GN  LDTC+YAE  NRGPGA+  KRV W G K+ +S +
Sbjct  476   RTLILQSQLDDLVHPDGWMPWNGNIGLDTCFYAELDNRGPGANLTKRVTWPGIKK-LSYD  534

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A++FT   +L   + W+ R  +PF PG L
Sbjct  535   EAQRFTVEHYLFG-QTWIPRTGVPFIPGLL  563



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   355 bits (912),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/405 (45%), Positives = 242/405 (60%), Gaps = 32/405 (8%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLE----------------IPGISRRLLeep  2556
             EKMK  L +SMELTSNAL M+T++     +L                 I G    LL   
Sbjct  178   EKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILGHGNELLP--  235

Query  2555  tpttdeeiPQFVDSATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVIL  2379
                       +VD   R LL A   +PDIVVA+DGS K+KTI  AL +IP   ++  V+ 
Sbjct  236   ---------DWVDMRRRRLLAAKEIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYVLY  286

Query  2378  IKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY E V       N++ +G+GPTKT ITGN+N  D  P  TY   T  V G+ F+ 
Sbjct  287   IKQGVYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTP--TYLTATAAVMGDYFVA  344

Query  2198  RDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDF  2019
             +D+  EN+AG  K QAVALR++AD ++ +NCH++ YQDTL  H+YRQFYR C I GT+DF
Sbjct  345   KDIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDF  404

Query  2018  IFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP  1839
             +FG+   VFQ C + VRKPL  Q C+VTAQGR D R  + +V Q+C IVA+ +       
Sbjct  405   VFGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYDEVKGE  464

Query  1838  NKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKR  1659
              K +LGRPWKE+SRT+IM S ID+++ PEGW  W   FAL+T +Y E+ NRG G+S  +R
Sbjct  465   VKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKTER  524

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              KW+G K  +     ++FT   FL  D  W+    IP++PGF  P
Sbjct  525   AKWQGVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLP  567



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   352 bits (904),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 245/389 (63%), Gaps = 17/389 (4%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             G KMK LL +SM + SNALA+++   + L       +  RRLL +    +  +  Q +D+
Sbjct  188   GAKMKELLTSSMHMGSNALAIISDFADTLADWNATKVFGRRLLHDSETPSWVDHRQLIDT  247

Query  2513  AT---RHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
              T   RH      +P++ VA DG+G FKTI  AL  +PEK  +  +I IK GVY EYV V
Sbjct  248   KTNTFRH------KPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIKEGVYSEYVEV  301

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              ++  ++VFVG+G  K+VITGN+N  D     TYR  +V ++G+ F   ++  EN+AG  
Sbjct  302   TKRMTHVVFVGDGGKKSVITGNKNFIDGV--NTYRTASVAIQGDHFTAINMGFENSAGPH  359

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVALR+  D ++  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C
Sbjct  360   KHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNC  419

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             K VVRKP++NQ C+VTAQGRK+R   SAIVIQ   IV++P        NK +L RPWK F
Sbjct  420   KFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPWKNF  479

Query  1802  SRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM +FID+++ P+G+ PW+   G   +DTC+YAEY N GPG+   KRV W G   N
Sbjct  480   SRTIIMDAFIDDLIHPDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRVHWAGI-WN  538

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++ + A  F P  F    + W+    IPF
Sbjct  539   LNAKAAHWFAPSKFFHGGD-WIEATGIPF  566



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   352 bits (902),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 253/395 (64%), Gaps = 23/395 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++           +VD 
Sbjct  162   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELP------SWVD-  214

Query  2513  ATRHLLV---APP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               +H L+   A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EY
Sbjct  215   --QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  272

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V V +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+A
Sbjct  273   VEVTKKMTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINMGFENSA  330

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VF
Sbjct  331   GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVF  390

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKP+ NQ C+VTAQGRK+R+  S IVIQ   IV++P   +    NK +L RPW
Sbjct  391   QNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPW  450

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             K +SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G 
Sbjct  451   KNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI  510

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A+ F+P  F    + W+    IP  PG
Sbjct  511   -WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  543



>ref|XP_009414337.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=592

 Score =   352 bits (904),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 190/392 (48%), Positives = 250/392 (64%), Gaps = 12/392 (3%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttd---eeiPQFVDS  2514
             KM+  +K++ E+TSNALA+V K+  FL  +++ G SRRLLEE     +   +  P +V  
Sbjct  202   KMQAAMKSAKEITSNALAIVGKISSFLTLIQVAGFSRRLLEEEPAEPEWYVDGNPSWVSH  261

Query  2513  ATRHLLVAPPRPD----IVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVYKEYV  2349
               R LL  P  P+    + VA+DGSG F TI+GAL   P+K  + R VI +K GVY+E V
Sbjct  262   GDRRLLQTPATPELTPNVTVAKDGSGDFTTISGALAKAPKKLLNGRYVIYVKEGVYEETV  321

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +   NI   G+G  KT++TG++N  D     TY   T    G+GF+  D+   NTAG
Sbjct  322   AVDKNTWNITMYGDGEQKTIVTGSKNFIDGVK--TYHTATFAAIGDGFMAVDMAFLNTAG  379

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
             A K QAVALR+ AD A+   C + AYQDTLY HS+RQFYR C ISGT+DFIFG+A  VFQ
Sbjct  380   ANKHQAVALRVQADRAIFLRCRMEAYQDTLYAHSHRQFYRDCLISGTIDFIFGDASAVFQ  439

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C + VR+PL NQ  +V AQGR   + ++  VIQ+C IVA PAL  A P  + +LGRPW+
Sbjct  440   HCTLTVRRPLNNQQNIVLAQGRSVLQESTGFVIQNCRIVAIPALADAKPKLRSYLGRPWQ  499

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFS T+IM S I + + PEG++PW+G+FALDT  YAEY N+GPGA T KRV W G+K  I
Sbjct  500   EFSNTIIMESEIGDFIEPEGYTPWEGSFALDTLSYAEYNNKGPGADTSKRVHWAGFKV-I  558

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             S E A  +T  PF+  D+ W+ +   P S G 
Sbjct  559   SQEEASAYTASPFIQGDD-WISKMGAPVSLGL  589



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   352 bits (903),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 179/389 (46%), Positives = 250/389 (64%), Gaps = 11/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++    +  +  + ++ 
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQHRLLNE  245

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
                 L     +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EYV V +K
Sbjct  246   NASPL---KRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKK  302

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+AG  K Q
Sbjct  303   MTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINMGFENSAGPHKHQ  360

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C  V
Sbjct  361   AVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFV  420

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ C+VTAQGRK+ +  S IVIQ   IV++P   +    NK +L RPWK +SRT
Sbjct  421   VRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRT  480

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ 
Sbjct  481   IIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNS  539

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + A+ F+P  F    + W+    IP+ PG
Sbjct  540   KAARWFSPSKFFHGTD-WIEVTGIPYFPG  567



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   345 bits (885),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 178/389 (46%), Positives = 248/389 (64%), Gaps = 17/389 (4%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDSATR  2505
             MK LL   M ++SNALA+VT L + +    I     RRLL++    +  +  + ++    
Sbjct  1     MKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQHRLLNEN--  58

Query  2504  HLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
                 A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EYV V +K
Sbjct  59    ----ASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKK  114

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+AG  K Q
Sbjct  115   MTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINMGFENSAGPHKHQ  172

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C  V
Sbjct  173   AVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFV  232

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ C+VTAQGRK+ +  S IVIQ   IV++P   +    NK +L RPWK +SRT
Sbjct  233   VRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRT  292

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G   N++ 
Sbjct  293   IIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNS  351

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + A+ F+P  F    + W+    IP+ PG
Sbjct  352   KAARWFSPSKFFHGTD-WIEVTGIPYFPG  379



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   352 bits (902),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 253/395 (64%), Gaps = 23/395 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++           +VD 
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELP------SWVD-  238

Query  2513  ATRHLLV---APP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               +H L+   A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EY
Sbjct  239   --QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  296

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V V +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+A
Sbjct  297   VEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINMGFENSA  354

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VF
Sbjct  355   GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVF  414

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKP+ NQ C+VTAQGRK+R+  S IVIQ   IV++P   +    NK +L RPW
Sbjct  415   QNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPW  474

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             K +SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G 
Sbjct  475   KNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI  534

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A+ F+P  F    + W+    IP  PG
Sbjct  535   -WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   353 bits (906),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/388 (46%), Positives = 251/388 (65%), Gaps = 12/388 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDSA  2511
             +KMKHLL +S+ ++SN LA+V+   + +  + +  +  RRLL++    +  E    +D+ 
Sbjct  193   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSEIPSWVEHRILLDAM  252

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIP-EKNDRRIVILIKAGVYKEYVMVPRK  2334
             T     + P+P++ VA DGSG FK+I  AL  +P E+++   VI IKAGVY+EYV V + 
Sbjct  253   TNK---SKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAGVYREYVEVLKN  309

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               +IVFVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++  EN+AG  K Q
Sbjct  310   MTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQGDHFTAINMGFENSAGPQKHQ  367

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+  D A+  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK V
Sbjct  368   AVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFV  427

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP++NQ C+VTAQGRK+    SAIVIQ   IVA+P        +K +L RPWK FSRT
Sbjct  428   VRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRT  487

Query  1793  LIMFSFIDNIVVPEGWSPW---KGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM +FID+++ P+G+ PW   +G   +DTC+Y EY N GPG+   KRVKW G   NI+ 
Sbjct  488   IIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGI-YNINT  546

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             + A++F P  F    + W+    IP+ P
Sbjct  547   KAAQKFAPSKFFHGGD-WIKDTGIPYYP  573



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   348 bits (892),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 221/313 (71%), Gaps = 5/313 (2%)
 Frame = -2

Query  2477  DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPT  2298
             ++VVA+DGSGK KTI  AL  +P KN R+ VI IK GVYKE + V +K  N++FVG+GPT
Sbjct  158   NVVVAKDGSGKCKTIEQALAMVPMKNRRKFVIYIKQGVYKEKIEVTKKMKNVMFVGDGPT  217

Query  2297  KTVITGNRN-VADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMA  2121
             KT+ITGN   + D+   GTYR  T  V G+ F+ +D+  ENTAGA + QAVALR+SAD A
Sbjct  218   KTIITGNVAFLPDRI--GTYRTSTFAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFA  275

Query  2120  VVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACM  1941
             V  NCH+  YQDTLY H++RQFYR C ISGT+DF+FG+A  VFQ C+ V+R+P+ NQ C+
Sbjct  276   VFFNCHMAGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDNQQCI  335

Query  1940  VTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIV  1761
             VTAQGRKDRR  + IVI +  I  +   +     N+ FLGRPWKE+SRT+IM + ID+++
Sbjct  336   VTAQGRKDRRETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVI  395

Query  1760  VPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
              PEGW  W   FAL T +Y+EY+NRG G+   +RV+W+G +R IS   A+ F PG FL  
Sbjct  396   DPEGWLKWNETFALKTLFYSEYRNRGRGSGQARRVRWRGIQR-ISARQARGFAPGEFLRG  454

Query  1580  DEQWLGRAQIPFS  1542
             +  W+ + +IP++
Sbjct  455   NA-WITKRRIPYN  466



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   351 bits (900),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 253/395 (64%), Gaps = 23/395 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++           +VD 
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDYELP------SWVD-  238

Query  2513  ATRHLLV---APP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               +H L+   A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EY
Sbjct  239   --QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  296

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V V +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+A
Sbjct  297   VEVTKKMTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINMGFENSA  354

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VF
Sbjct  355   GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVF  414

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKP+ NQ C+VTAQGRK+R+  S IVIQ   IV++P   +    NK +L RPW
Sbjct  415   QNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPW  474

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             K +SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G 
Sbjct  475   KNYSRTIIMDTYIDDLIDADGYLPWQGPEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI  534

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A+ F+P  F    + W+    IP  PG
Sbjct  535   -WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   349 bits (895),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 251/391 (64%), Gaps = 18/391 (5%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI----SRRLLeeptpttdeeiPQFVDS  2514
             M ++ K S +L+SN+LAMVT L+      E+ G     +R+LL             +V  
Sbjct  179   MINIFKRSRQLSSNSLAMVTDLNS--NATELTGAFENNARKLLSTEDGVPT-----WVGP  231

Query  2513  ATRHLLVAPPRPDI----VVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
               R L+ AP  P +    VVAQDGSG+FKTI  ALN++P++N    VI IK GVYKE V+
Sbjct  232   EARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVV  291

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             V RK   + F+G+GPTKTVI+G+ N        TY    + VEGE F  + + +ENTAG 
Sbjct  292   VTRKMPYVTFIGDGPTKTVISGSLNFG-IGKVKTYLTAPLTVEGEHFTAKGIGMENTAGP  350

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
                QAVALR+S D AV  +C ++ YQDTLY HS RQFYR CT+SGTVDFIFG++  + Q 
Sbjct  351   EGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQN  410

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             CK+VVRKP+A Q+CMVTAQGR D R  + IV+ +C IV +PA       +K +LGRPWKE
Sbjct  411   CKIVVRKPMAGQSCMVTAQGRSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWKE  470

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT+++ + +D+++ P GW PW G+FAL T +YAE+ N GPGA+  +RVKW G K+ ++
Sbjct  471   FSRTIVIKTTVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LT  529

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              E A  +T   FL  +  W+ R Q+P++ G 
Sbjct  530   HEQALSYTCDRFLSGN-TWIPRTQVPYTAGM  559



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   342 bits (876),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/319 (50%), Positives = 222/319 (70%), Gaps = 5/319 (2%)
 Frame = -2

Query  2483  RPDIVVAQDGSGKFKTITGALNSIPEKN-DRRIVILIKAGVYKEYVMVPRKKNNIVFVGE  2307
             +PD VVA+DGSG+++TI  A+  IP+ N D+  VI +K GVY EYVM+ +   N++ +G+
Sbjct  47    KPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGD  106

Query  2306  GPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISAD  2127
             G  KT +TG++N A      T++  TV+V G+ FI +D+ IEN+AGA   QAVALR+ +D
Sbjct  107   GAXKTKVTGSKNFAAGVQ--TFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSD  164

Query  2126  MAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQA  1947
             +++ + C ++ YQDTLYT ++RQFYR CTISGT+DFIFG+A VVFQ CKM+VRKP+ NQA
Sbjct  165   LSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQA  224

Query  1946  CMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDN  1767
             CMVTAQGR DRR  S I++Q+C I  +P        NK +LGRPWK  +RT++M S ID 
Sbjct  225   CMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDG  284

Query  1766  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1587
             I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K N+S + A  FT G F+
Sbjct  285   IIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFV  343

Query  1586  MADEQWLGRAQIPFSPGFL  1530
               D +W+  + +P+  G +
Sbjct  344   EGD-KWIKPSGVPYVAGMV  361



>sp|Q42920.1|PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=P65; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Medicago sativa]
 gb|AAA91128.1| putative pectinesterase [Medicago sativa]
Length=447

 Score =   345 bits (884),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 245/393 (62%), Gaps = 18/393 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--GISRRLLeeptpttdeeiPQFVD  2517
             GE M  +LKTSMEL+SNA+ M+  +   LK  +     +SRRLL +           +V+
Sbjct  63    GETMTKVLKTSMELSSNAIDMMDAVSRILKGFDTSQYSVSRRLLSDDGIP------SWVN  116

Query  2516  SATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
                R LL     +P+ VVAQDGSG+FKT+T AL ++P KN    VI +KAGVYKE V V 
Sbjct  117   DGHRRLLAGGNVQPNAVVAQDGSGQFKTLTDALKTVPPKNAVPFVIHVKAGVYKETVNVA  176

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             ++ N +  +G+GPTKT  TG+ N AD     TY   T  V G  F+ +D+  ENTAG  K
Sbjct  177   KEMNYVTVIGDGPTKTKFTGSLNYADGI--NTYNTATFGVNGANFMAKDIGFENTAGTGK  234

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR++AD A+ +NC ++ +QDTLY  S RQFYR C+ISGT+DF+FG    VFQ CK
Sbjct  235   HQAVALRVTADQAIFYNCQMDGFQDTLYVQSQRQFYRDCSISGTIDFVFGERFGVFQNCK  294

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             +V R P   Q C+VTA GR+ +  ASA+V QS     EPAL +  P    +LGRPWK++S
Sbjct  295   LVCRLPAKGQQCLVTAGGREKQNSASALVFQSSHFTGEPALTSVTPKVS-YLGRPWKQYS  353

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             + +IM S ID I VPEG+ PW G+   +TC Y EY N+GPGA T+ RVKW G K  ++  
Sbjct  354   KVVIMDSTIDAIFVPEGYMPWMGSAFKETCTYYEYNNKGPGADTNLRVKWHGVKV-LTSN  412

Query  1619  VAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             VA ++ PG F       A + W+ ++ +P+S G
Sbjct  413   VAAEYYPGKFFEIVNATARDTWIVKSGVPYSLG  445



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   348 bits (894),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 248/397 (62%), Gaps = 16/397 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI--------PGISRRLLeeptpttdeei  2532
             ++MK  L  + +LTSNALA+ + + E L++  I        P  SRRLLE       +  
Sbjct  174   KQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPSSSRRLLEHNNDEQGQYP  233

Query  2531  PQFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGV  2364
               F  +A R LL +      RP+ VVA+DGSG++KTI  AL + P+    R +I +KAG+
Sbjct  234   SWF-RAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAALAAYPKGLKGRYIIYVKAGI  292

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y EYV V + + N+   G+GP KT++TG+++ AD     T    T    G GF+ + +  
Sbjct  293   YNEYVTVTKDQVNVFMYGDGPRKTMVTGSKSWADGIT--TQNTATFAAIGSGFLAKAMGF  350

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             +NTAGA K QAVALR+ ++M+   NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++
Sbjct  351   QNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHRQFYRNCVISGTVDFIFGDS  410

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
             P + Q C ++VRKP+  Q   VTAQGR+D+R  + IVIQ+C IV E AL       K +L
Sbjct  411   PTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNCRIVPEQALFPTRFKTKSYL  470

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK +SR +IM S + + + P GW  W GNFALDT ++AEY NRGPGA T+ RV+WKG
Sbjct  471   GRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFAEYGNRGPGAVTNGRVRWKG  530

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  531   FHVIRNRNEALQFTTGPFLLGD-QWLRNTGVPYFTGL  566



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   349 bits (895),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 175/392 (45%), Positives = 248/392 (63%), Gaps = 11/392 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+ M  +L  S+EL++NAL ++  L  F+K L +   +  L       +++ +P +V  +
Sbjct  184   GQTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASALNNNRKLLSEDGLPSWVSQS  243

Query  2510  TRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
              R LL AP   +P++VVAQDGSG+FKT+T AL ++P+KN    VI +KAG+YKEYV +  
Sbjct  244   QRKLLAAPQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAGIYKEYVALDN  303

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
              ++++  +G+GP KT+ TG+++  D     TY   T  V    F   ++  EN+AGA K 
Sbjct  304   HRDHVTIIGDGPKKTIFTGSKSYGDGVQ--TYNTATFSVNSAHFTAFNVGFENSAGAAKH  361

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR++AD A+ +NC +N YQDTLYT S RQFYR CTI+GT+DF+FG+A  VFQ CK+
Sbjct  362   QAVALRVTADKALFYNCEMNGYQDTLYTQSKRQFYRDCTITGTIDFVFGDAVGVFQNCKL  421

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+A Q CMVTA GR      SA+V Q+C    EP +    P    +LGRPW+ FS+
Sbjct  422   IVRKPMATQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQPK-IAYLGRPWRNFSK  480

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
              +I+ S ID + VPEG+ PW GN   +TC Y EY N+G GA+T+ RVKW G K  IS   
Sbjct  481   VVIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-TISAGE  539

Query  1616  AKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             A ++ PG F       A + W+  + IP++ G
Sbjct  540   AAKYYPGKFYEIANATARDDWITESGIPYAMG  571



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   348 bits (894),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 248/397 (62%), Gaps = 16/397 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEI--------PGISRRLLeeptpttdeei  2532
             ++MK  L  + +LTSNALA+ + + E L++  I        P  SRRLLE       +  
Sbjct  174   KQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPSSSRRLLEHNNDEQGQYP  233

Query  2531  PQFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGV  2364
               F  +A R LL +      RP+ VVA+DGSG++KTI  AL + P+    R +I +KAG+
Sbjct  234   SWF-RAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAALAAYPKGLKGRYIIYVKAGI  292

Query  2363  YKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y EY+ V + + N+   G+GP KT++TG+++ AD     T    T    G GF+ + +  
Sbjct  293   YNEYITVTKDQVNVFMYGDGPRKTMVTGSKSWADGIT--TQNTATFAAIGSGFLAKAMGF  350

Query  2183  ENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNA  2004
             +NTAGA K QAVALR+ ++M+   NC ++AYQDTLY  ++RQFYR C ISGTVDFIFG++
Sbjct  351   QNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHRQFYRNCVISGTVDFIFGDS  410

Query  2003  PVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFL  1824
             P + Q C ++VRKP+  Q   VTAQGR+D+R  + IVIQ+C IV E AL       K +L
Sbjct  411   PTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNCRIVPEQALFPTRFKTKSYL  470

Query  1823  GRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKG  1644
             GRPWK +SR +IM S + + + P GW  W GNFALDT ++AEY NRGPGA T+ RV+WKG
Sbjct  471   GRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFAEYGNRGPGAVTNGRVRWKG  530

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  531   FHVIRNRNEALQFTAGPFLLGD-QWLRNTGVPYFTGL  566



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   349 bits (896),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 252/395 (64%), Gaps = 23/395 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++           +VD 
Sbjct  191   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELP------SWVD-  243

Query  2513  ATRHLLV---APP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               +H L+   A P   +P++ VA DGSG FK+I  AL  +PEKN +  VI IK GVY+EY
Sbjct  244   --QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  301

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V V +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+A
Sbjct  302   VEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINMGFENSA  359

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VF
Sbjct  360   GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVF  419

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKPL NQ C+VTAQGRK+ +  S IVIQ   IV++P   +    NK +L RPW
Sbjct  420   QNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPW  479

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             K +SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G 
Sbjct  480   KNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI  539

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A+ F+P  F    + W+    IP  PG
Sbjct  540   -WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  572



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   348 bits (893),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 254/400 (64%), Gaps = 20/400 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSM----ELTSNALAMVTKLDEFLKTLEI-------PGISRRLLeeptpttd  2541
             E+++ L+K S+    +LTSNALA+ T + + L+   I       P  S R+LE+      
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIATSIAQILENFNITLNKDLRPTSSSRILEQENDGHG  229

Query  2540  eeiPQFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIK  2373
             +    F  +A R LL        +P+ VVA+DGSG+FKTI  AL + P+    R +I +K
Sbjct  230   QYPSWF-PAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVK  288

Query  2372  AGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVY EYV V + + N+   G+GP KT++TG+++ AD     T    T    G GF+ + 
Sbjct  289   AGVYNEYVTVTKNQVNVFMYGDGPRKTMVTGSKSFADGIT--TQNTATFAAIGNGFLAKG  346

Query  2192  LTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIF  2013
             +  +NTAGA K QAVALR+ ++M+   NC ++AYQDTLY  ++RQFYR C ISGTVDFIF
Sbjct  347   MGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIF  406

Query  2012  GNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNK  1833
             G++P + Q   ++VRKP+ NQ   VTAQGR+DRR  +AIVIQ+C IV E  L        
Sbjct  407   GDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIP  466

Query  1832  VFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVK  1653
              +LGRPWK ++RT+IM S + + + P GW PW GNFALDT +YAEY NRGPGA+T++RV+
Sbjct  467   SYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVR  526

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKGY   I+   A QFT GPFL+AD +WL    IP+  G 
Sbjct  527   WKGYHV-INRNDAVQFTAGPFLLAD-RWLKTTGIPYFAGL  564



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   348 bits (893),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 185/396 (47%), Positives = 246/396 (62%), Gaps = 24/396 (6%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-------RRLLeeptpttdeeiPQF  2523
             M ++ KTS EL+SN+LAM T L   L      G++       R+LL             +
Sbjct  179   MLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLTGALAKYARKLLYTEDGIPT-----W  233

Query  2522  VDSATRHLLVAPPRP---------DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKA  2370
             V    R L+   P+P         + VV QDGSG FKTIT AL  +P+ N    +I IK 
Sbjct  234   VGPHARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKTITDALKVVPKNNRMPFIIHIKE  293

Query  2369  GVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKE V V +K   + F+G+GP KT ITGN N        T+   T+ +EGE F  +++
Sbjct  294   GIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFG-IGKVKTFLTSTLTIEGEHFTAKNI  352

Query  2189  TIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFG  2010
              IENTAG    QAVALR+SAD AV ++C ++ YQDTLY HS RQFYR CT+SGTVDFIFG
Sbjct  353   GIENTAGPKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFG  412

Query  2009  NAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             +A  + Q CK+VVRK    Q+CMVTAQGR D R ++ +V+ +C I+ EPA       NK 
Sbjct  413   DAKCILQNCKIVVRKAKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGEPAYIPVKSVNKA  472

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM + ID+++ P GW PWKG+FAL T +YAE+ N G G++   RVKW
Sbjct  473   YLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGAGSNEALRVKW  532

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G K+ +SPE A  +T G FL+ D  W+ + Q+P++
Sbjct  533   PGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYT  566



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   348 bits (892),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 242/401 (60%), Gaps = 15/401 (4%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATR  2505
             KM+  L +S ELT N LA+V +  E L  L IP   RRLL +           ++  A R
Sbjct  175   KMRRALNSSQELTENILALVDEFSETLANLGIPSFHRRLLADHAGGVP----SWMPDAKR  230

Query  2504  HLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              L    P     +PD+ VA+DGSG F+TI  AL  +P K+    V+ +KAG Y+EYV VP
Sbjct  231   RLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPVKSAATYVMYVKAGTYREYVSVP  290

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R   N+V VG+G TKTVITG+++        T    T+   G GF+ R + +ENTAGA  
Sbjct  291   RNVTNLVMVGDGATKTVITGDKSFMMNIT--TKDTATMEALGNGFLMRGIGVENTAGAKN  348

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+  + C  + YQDTLYTH+ RQ+YR C I+GT+DFIFGNA VVFQ C 
Sbjct  349   HQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRECVITGTIDFIFGNAQVVFQNCL  408

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALK--AANPPNKVFLGRPWKE  1806
             + VRK + NQ  +VTAQGRK+RR A   VI +C I   P  +  A +   + FLGRPWKE
Sbjct  409   IQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTIEPHPEFEKSAGDGKLRTFLGRPWKE  468

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
              SRTL + S I   + P+GW PW G+F L TC+YAE +NRG GA T KRVKW+G K    
Sbjct  469   HSRTLYIQSEIGGFIDPKGWLPWLGDFGLSTCYYAEVENRGAGADTSKRVKWRGVKNITY  528

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
                 +++T   F+   + WL +  +PF PG L P N+  ++
Sbjct  529   QHALQKYTVESFIQG-QHWLPQLGVPFIPGLL-PQNQSGRI  567



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   348 bits (894),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 249/392 (64%), Gaps = 13/392 (3%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQ----FVD  2517
             +M+  LK + ELTSN+LA+++++  FL T +IPG +R LLE+               +++
Sbjct  202   EMQKTLKIAKELTSNSLAIISEVSSFLTTFQIPGATRHLLEKEASGLPAVGEDGLPSWMN  261

Query  2516  SATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
                R +L         P++VVA+DGSGKFKTI+ AL ++PEK   R VI IKAG+Y EY+
Sbjct  262   QEERRILKGKRGVKLTPNVVVAKDGSGKFKTISEALAALPEKYTGRYVIYIKAGIYDEYI  321

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +K  N+   G+G  KT++TGN+N  D     T++  +    G+GF+ + +   NTAG
Sbjct  322   TVTKKMVNVTMYGDGSQKTIVTGNKNFVDGVR--TFQTASFAALGDGFMAQAMGFRNTAG  379

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA+R+ +D A+  NC    YQDTLY  ++RQFYR C I+GTVDFIFG+A  + Q
Sbjct  380   PEKHQAVAIRVQSDRAIFLNCRFEGYQDTLYVQTHRQFYRSCVIAGTVDFIFGDATAILQ  439

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C +VVRKPL NQ  +VTAQGR D    + IV+Q+C I A+  L       + +LGRPWK
Sbjct  440   NCLIVVRKPLDNQQNIVTAQGRVDGHETTGIVLQNCRITADKKLIPVKSKFQTYLGRPWK  499

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM S I++ + P G+ PW+G+FAL T +YAE+ N+GPGA+ + RVKW GYK+ I
Sbjct  500   EFSRTIIMESSIEDFIDPAGFMPWEGDFALKTLYYAEFNNKGPGANINARVKWPGYKK-I  558

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             + + A +FT G FL  D  W+  A +P   G 
Sbjct  559   NKQEAAKFTVGTFLDGD--WIKGAGVPVHFGL  588



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   349 bits (896),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 249/417 (60%), Gaps = 34/417 (8%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptptt-----------  2544
             GEKMK  L  SMEL+ N LA+ T++   LK LEI G+SRRLL+E  P             
Sbjct  188   GEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQENLPVLGHGDWSTYLDI  247

Query  2543  ---------------deeiPQF-VDSATRHLLVAPP---RPDIVVAQDGSGKFKTITGAL  2421
                                 QF +    R L+ APP   + DIVVA+DGSG F TI  A+
Sbjct  248   PMTRRRRLLQDNEPPVLGHGQFEIQPGVRRLMAAPPSRIKADIVVAKDGSGNFTTINAAM  307

Query  2420  NSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTY  2241
             +SIP    +  VI IK GVY+E +    K  N+  +G+G  KT ITG+ N AD  P  T+
Sbjct  308   SSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITGHLNNADGVP--TF  365

Query  2240  RCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYR  2061
             R  TV V G+ F  +++  EN+AGA K QAVAL + +D +V +NC ++ YQDTLY HS R
Sbjct  366   RTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDGYQDTLYVHSKR  425

Query  2060  QFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSC  1881
             QFYR CTI+GT+DF+FG+A  VFQ C  +VR PL  Q C+VTAQGR D R  +AIVIQ+ 
Sbjct  426   QFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPLNGQQCIVTAQGRTDARQPTAIVIQNS  485

Query  1880  DIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYA  1701
                A P L         +LGRPW  FSRT+IM S++D+++ PEGW+ W G + L+T +Y+
Sbjct  486   TFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGWAIWDGPWGLNTSFYS  545

Query  1700  EYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E+ N GPG++   RV W+G KR IS   A  FTPG F+     W+   ++P++PGF 
Sbjct  546   EFNNYGPGSNKTGRVTWRGIKR-ISQATAFGFTPGKFING-AAWIKPRRVPYTPGFF  600



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   348 bits (893),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/388 (46%), Positives = 242/388 (62%), Gaps = 9/388 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G KMK LL +S+ ++SNALA+++   + +       I RR L   + T          +A
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRHLLHDSETPSSVDHHKQHNA  247

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
              +++     +P++ VA DGSG FK+I  AL  +PEK+ +  VI IK GVY EYV V +  
Sbjct  248   MKNVF--KHKPNVTVALDGSGDFKSINEALTRVPEKSKKPFVIYIKEGVYPEYVEVTKHM  305

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
              ++VFVG+G  KT+ITGN+N  D     TYR  +V ++G+ F+  ++  EN+AG  K QA
Sbjct  306   THVVFVGDGGKKTIITGNKNFIDGV--NTYRTASVAIQGDHFVAINMGFENSAGPHKHQA  363

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR+  D  +  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK VV
Sbjct  364   VALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCKFVV  423

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP++NQ C+VTAQGRK+R   SAIVIQ   IV++P        NK +L RPWK FSRT+
Sbjct  424   RKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPWKNFSRTI  483

Query  1790  IMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             IM +FID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRV W G   N++ +
Sbjct  484   IMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKSKRVNWAGI-WNLNAK  542

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              A  F P  F    + W+    IPF  G
Sbjct  543   AAHWFAPSKFFHGGD-WIEATGIPFFSG  569



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   347 bits (891),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 249/392 (64%), Gaps = 17/392 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG-------ISRRLLeeptpttdeeiP  2529
             ++M+H+ KT+ EL+SN+LAMVT +   L      G        +R+LL            
Sbjct  179   QEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTEDGIPT----  234

Query  2528  QFVDSATRHLLVAPP--RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
              +V    R L+ AP   + + VVAQDGSG+FKTI  ALN++P+ N    VI IK G+YKE
Sbjct  235   -WVGREARRLMAAPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIYKE  293

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
              +MV RK   + F+G+G TKTVITGN N        T+    + +EG+ F  +++ +ENT
Sbjct  294   KIMVTRKMPYVTFIGDGQTKTVITGNLNYG-IGKVKTFLTAPLTIEGDHFTMKNIGVENT  352

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AG    QAVALR+SAD AV H+C  + +QDTLY HS+R F+R CT+SGTVDFIFG+A  +
Sbjct  353   AGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCI  412

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
              Q CK+VVRKP   Q+CMVTAQGR D R ++ +V+ +C I  +PA       +K +LGRP
Sbjct  413   LQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRP  472

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WK+FSRT++M + ID+++ P GW  W G+FAL T +YAE+ N GPG++  +RVKW G  R
Sbjct  473   WKQFSRTIVMKTMIDDVIDPAGWLAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWPGI-R  531

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              ++P+ A  +T   FL  +  W+   Q+P++P
Sbjct  532   KLTPQDALLYTGDRFLGGN-TWIPPTQVPYTP  562



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   348 bits (892),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 245/388 (63%), Gaps = 9/388 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK  L TSM ++SNALA+VT+L + +  L +  +  R L + + +      Q + +A
Sbjct  187   GQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLLQDSESPSWVDHQGLPNA  246

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
                L     + ++ VAQDG+G FK+I  AL  +PEKN +  VI IK G Y+EYV V +  
Sbjct  247   NTSLF--NHKLNVTVAQDGNGDFKSINEALKQVPEKNKKPFVIYIKEGTYQEYVEVTKDM  304

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
              ++VF+G+G  KT I GN+N  D     TYR  TV ++G+ F+  ++  EN AG  K QA
Sbjct  305   THVVFIGDGGKKTRIIGNKNFIDGI--NTYRTATVAIQGDYFVAINMGFENFAGPHKHQA  362

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C  VV
Sbjct  363   VALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVV  422

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP+ NQ C+VTAQGRK+++  S IVIQ   IV++P   +    NK +L RPWK +SRT+
Sbjct  423   RKPMKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTI  482

Query  1790  IMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             IM + ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRV W G   N++ +
Sbjct  483   IMDTNIDDLIHADGYLPWQGPEGPTGMDTCFYAEYHNTGPGSDKSKRVNWSGI-WNLNSK  541

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              A  F+P  F      W+    IP+ PG
Sbjct  542   AAHSFSPSKFFHG-TNWIQVTGIPYFPG  568



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   347 bits (891),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 254/400 (64%), Gaps = 19/400 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSM----ELTSNALAMVTKLDEFLKTLEI-------PGISRRLLeeptpttd  2541
             E+++ L+K S+    +LTSNALA+ + + + L+   I       P  S R L E      
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQENDGH  229

Query  2540  eeiPQFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIK  2373
             ++ P +  +A R LL        +P+ VVA+DGSG+FKTI  AL + P+    R +I +K
Sbjct  230   DQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVK  289

Query  2372  AGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVY EYV V + + N+   G+GP  T++TG+++ AD     T    T    G GF+ + 
Sbjct  290   AGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGIT--TQNTATFAAIGNGFLAKG  347

Query  2192  LTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIF  2013
             +  +NTAGA K QAVALR+ ++M+   NC ++AYQDTLY  ++RQFYR C ISGTVDFIF
Sbjct  348   MGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIF  407

Query  2012  GNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNK  1833
             G++P + Q   ++VRKP+ NQ   VTAQGR+DRR  +AIVIQ+C IV E  L        
Sbjct  408   GDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIP  467

Query  1832  VFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVK  1653
              +LGRPWK ++RT+IM S + + + P GW PW GNFALDT +YAEY NRGPGA+T++RV+
Sbjct  468   SYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVR  527

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  528   WKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   347 bits (891),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/396 (45%), Positives = 250/396 (63%), Gaps = 21/396 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG-------ISRRLLeeptpttdeeiP  2529
             ++M+H+ KT+ EL+SN+LAMVT +   L      G        +R+LL            
Sbjct  179   QEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLSAEDGIPT----  234

Query  2528  QFVDSATRHLLVA------PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
              +V    R L+ A      P + + VVAQDGSG+FKTI  ALN++P+ N    VI IK G
Sbjct  235   -WVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVPKGNTVPYVIHIKQG  293

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE VMV RK   + F+G+G TKTVITGN N        T+    + +EG+ F  +++ 
Sbjct  294   IYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNYG-IGKVKTFLTAPLTIEGDHFTMKNIG  352

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
             +ENTAG    QAVALR+SAD AV H+C  + +QDTLY HS+R F+R CT+SGTVDFIFG+
Sbjct  353   VENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRECTVSGTVDFIFGD  412

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  + Q CK+VVRKP   Q+CMVTAQGR D R ++ +V+ +C I  +PA       +K +
Sbjct  413   AKCILQNCKIVVRKPKKGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSY  472

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWK  1647
             LGRPWK+FSRT+IM + ID+++ P GW  W G+FAL T +YAE+ N GPG++  +RVKW 
Sbjct  473   LGRPWKQFSRTIIMKTMIDDVIDPAGWLAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWP  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             G  R ++P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  533   GI-RKLTPQDALLYTGDRFLGGN-TWIPQTQVPYTP  566



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   347 bits (890),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 239/391 (61%), Gaps = 14/391 (4%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             EKM+  LK+S ELT N LA+V +  + L  L+I G SRRLL +           ++ +A 
Sbjct  175   EKMRKALKSSQELTENILAIVDQFADTLANLDITGFSRRLLGDDGVPV------WMSNAK  228

Query  2507  RHLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             R LL A P     +PD+ VA DGSG FKTI  AL  +P K+    V+ +KAG YKEYV V
Sbjct  229   RRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVPVKSTGTYVMYVKAGTYKEYVSV  288

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              R   N+V +G+G TKT+ITGN++        T    T+   G GF  R + +ENTAG+ 
Sbjct  289   ARNVTNLVMIGDGATKTIITGNKSFMLNIT--TKDTATMEAIGNGFFMRGIGVENTAGSK  346

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
               QAVALR+ +D +  + C  + +QDTLYTH+ RQ+YR CTI+GT+DFIFGNA VV Q C
Sbjct  347   NHQAVALRVQSDQSAFYECQFDGHQDTLYTHTSRQYYRDCTITGTIDFIFGNAQVVLQNC  406

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
             ++ VR+ + NQ  +VTAQGRK++  A   VI +C I      KA     K FLGRPWKE+
Sbjct  407   RIQVRRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHEDFKADAAKFKTFLGRPWKEY  466

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRTL + S I   + P+GW PW G+F L+TC+YAE +NRG GA   KR KW+G K     
Sbjct  467   SRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGDGADMSKRAKWRGVKTVTYQ  526

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +  +++T   F+   + WL +  +PF PG L
Sbjct  527   QAQQKYTVERFIQG-QTWLPKFGVPFIPGLL  556



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   348 bits (892),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/388 (45%), Positives = 245/388 (63%), Gaps = 13/388 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLK--TLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             ++ +L+ S E TSN+LAM++ L +F    T  + G  RRLL +           ++    
Sbjct  214   LEKMLQASKEFTSNSLAMLSLLSQFQLPVTAAVSGAKRRLLAQNKDGFPT----WMSHEE  269

Query  2507  RHLLV---APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
             R +L      P P++ VA+DGSG FKTI+ AL ++P K + R +I +K GVY E V+V +
Sbjct  270   RRVLKKNDEKPTPNVTVAKDGSGNFKTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTK  329

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
             K  N+   G+G  K++ITGN+N AD     T++  +    GEGF+ + +   NTAG  K 
Sbjct  330   KMPNVTIYGDGSQKSIITGNKNFADGVR--TFQTASFAALGEGFMAKSMGFRNTAGPEKH  387

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVA R+ AD A+  NC    YQDTLY  ++RQFY+ C ISGTVDFIFG+A  +FQ C +
Sbjct  388   QAVAARVQADRAIFLNCRFEGYQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLI  447

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
              VRKP+ NQ  +VTAQGR D+R  + IV+Q+C I+ +  L+      K +LGRPWKEFSR
Sbjct  448   YVRKPMENQQNIVTAQGRTDKRETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSR  507

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
             T++M S I++++ P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK  I  + 
Sbjct  508   TIVMGSTIEDLIHPDGWTPWQGDFALKTLYYAEYNNKGPGAKTDNRVKWSGYKV-IDKQE  566

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             A ++T GPFL  +  WL    +P   G 
Sbjct  567   AMKYTVGPFLKGNA-WLRVKGVPVRFGL  593



>ref|XP_002445591.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
 gb|EES15086.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
Length=626

 Score =   348 bits (894),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/408 (47%), Positives = 246/408 (60%), Gaps = 26/408 (6%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--RRLLeeptpttdeeiP-----  2529
             ++M   +++  ELTSNALA++ K    L  L IPG +  RRLL +     + E       
Sbjct  220   KQMTATMESGKELTSNALAIIEKASSVLVALHIPGFTAHRRLLGDNDEAENMENQPEVKH  279

Query  2528  ------QFVDSAT----RHLL-----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDR  2394
                   +  D A     R LL      A  RP++VVA+DGSGKFKTI  ALN++P++   
Sbjct  280   SGMSLGELEDEAMAADKRRLLKGNNFQAKLRPNVVVAKDGSGKFKTINDALNAMPKQYTG  339

Query  2393  RIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEG  2214
             R +I +K GVY+EYV + R   N+   G+G  KTVITG+RN AD     TY+  T  V+G
Sbjct  340   RYLIYVKQGVYQEYVTITRAMENVTMYGDGAMKTVITGSRNFADGLT--TYKTATFNVQG  397

Query  2213  EGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTIS  2034
             +GFI   L   NTAGA K QAVAL + +D ++  NC ++AYQDTLY HS  QFYR C IS
Sbjct  398   DGFIAIALGFRNTAGAAKHQAVALLVQSDRSIFLNCRMDAYQDTLYAHSKAQFYRNCVIS  457

Query  2033  GTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALK  1854
             GT+DF+FG+A  VFQ C +++R+PL +Q  + TAQGR D R ++  V Q C   AE  L+
Sbjct  458   GTIDFVFGDAAAVFQNCILLLRRPLDSQQNIATAQGRADGRESTGFVFQYCRFAAEAGLR  517

Query  1853  -AANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPG  1677
              A+ PP + +L RPW+EFSRTLIM S I   +   G+ PW G+F L T WYAEY NRGPG
Sbjct  518   DASRPPIRSYLARPWREFSRTLIMESEIPAFIDKAGYLPWNGDFGLKTLWYAEYGNRGPG  577

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             A T  RV W GYK+ IS E A +FT   FL A E WL     P   GF
Sbjct  578   ADTAGRVAWPGYKKVISKEEADKFTVQNFLHA-EPWLKPTGTPVKYGF  624



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   347 bits (889),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 254/400 (64%), Gaps = 19/400 (5%)
 Frame = -2

Query  2687  EKMKHLLKTSM----ELTSNALAMVTKLDEFLKTLEI-------PGISRRLLeeptpttd  2541
             E+++ L+K S+    +LTSNALA+ + + + L+   I       P  S R L E      
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQENDGH  229

Query  2540  eeiPQFVDSATRHLLVAPP----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIK  2373
             ++ P +  +A R LL        +P+ VVA+DGSG+FKTI  AL + P+    R +I +K
Sbjct  230   DQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVK  289

Query  2372  AGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVY EYV V + + N+   G+GP  T++TG+++ AD     T    T    G GF+ + 
Sbjct  290   AGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGIT--TQNTATFSAIGNGFLAKG  347

Query  2192  LTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIF  2013
             +  +NTAGA K QAVALR+ ++M+   NC ++AYQDTLY  ++RQFYR C ISGTVDFIF
Sbjct  348   MGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIF  407

Query  2012  GNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNK  1833
             G++P + Q   ++VRKP+ NQ   VTAQGR+DRR  +AIVIQ+C IV E  L        
Sbjct  408   GDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIP  467

Query  1832  VFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVK  1653
              +LGRPWK ++RT+IM S + + + P GW PW GNFALDT +YAEY NRGPGA+T++RV+
Sbjct  468   SYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVR  527

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  528   WKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   347 bits (891),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/394 (45%), Positives = 247/394 (63%), Gaps = 21/394 (5%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI------SRRLLeeptpttdeeiPQFV  2520
             ++ +L+TS E TSN+LAM++ L++    L++PG       +RRLL +           ++
Sbjct  212   LEKMLQTSKEFTSNSLAMLSLLNQ----LQLPGTGAAAGSNRRLLSQDKGEFPT----WM  263

Query  2519  DSATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
                 R +L    +   P++ VA+DGSG +KTI  AL  +P+K + R VI +K GVY E V
Sbjct  264   SHEDRRMLKKNDKKLTPNVTVAKDGSGNYKTINEALEKMPQKYEGRYVIYVKEGVYDETV  323

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +K  N+   G+G  K++ITGN+N AD     T++       GEGF+ + +   NTAG
Sbjct  324   TVTKKMPNVTMYGDGSQKSIITGNKNFADGVR--TFQTAPFAALGEGFMAKSMGFRNTAG  381

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA R+ AD A+  NC    YQ+TLY  ++RQFY+ C ISGTVDFIFG+A  +FQ
Sbjct  382   PEKRQAVAARVQADRAIFLNCRFEGYQETLYVQTHRQFYKSCVISGTVDFIFGDAATIFQ  441

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C + VRKPL NQ   VTAQGR D+R  + IV+Q+C I+ +  L+      K +LGRPWK
Sbjct  442   NCLIYVRKPLENQQNTVTAQGRTDKRETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRPWK  501

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT++M S I++++ P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK+ I
Sbjct  502   EFSRTIVMESTIEDLIHPDGWTPWEGDFALKTLYYAEYNNKGPGAKTDNRVKWDGYKK-I  560

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + E A Q+T GPFL     WL    +P   G  +
Sbjct  561   NKEEAMQYTVGPFLKG-HAWLKVEGVPVRFGLFE  593



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   347 bits (890),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/390 (47%), Positives = 239/390 (61%), Gaps = 11/390 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptpttdeeiPQFVDSA  2511
             +KM+ LL TS EL SNALA+VT+     K L     S RRLL             +VD  
Sbjct  215   DKMQKLLNTSKELGSNALAVVTQASAIFKALRGSKSSERRLLASDDGFVVP---DWVDPE  271

Query  2510  TRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
             +R +L +      P+  VA+DG+G F TI  AL++IPEK   R VI IK G+Y E V+V 
Sbjct  272   SRRVLKSKESKFTPNATVAKDGTGNFTTIAAALDAIPEKFKGRYVIYIKEGIYDESVVVS  331

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +K  NI   G+G  K++ITGN+N  D  P  TY+  T  V G+GF+ + L   NTAG  K
Sbjct  332   KKMQNITMYGDGSQKSIITGNKNYVDGVP--TYQTATFAVVGDGFLGQSLGFRNTAGPEK  389

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D ++  NC +  YQDTLY  ++RQFYR C I GTVDFIFG+A  VFQ C 
Sbjct  390   HQAVALRVQSDRSIFVNCRMEGYQDTLYAQTHRQFYRSCYIRGTVDFIFGDAAAVFQNCM  449

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + V KPL NQ  +VTAQGR D+R  + IV+Q+C I+A+  L+      + +LGRPWKE+S
Sbjct  450   IYVTKPLENQKNVVTAQGRIDKRQTTGIVLQNCKILADDQLEPVKARFQTYLGRPWKEYS  509

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT++M S I +++ P GW  W G+FAL T +Y EY N+GPG+ T  RVKW GYK  +   
Sbjct  510   RTIVMESEIGDLISPAGWLEWSGDFALKTLFYGEYNNKGPGSGTSDRVKWAGYK-TLQRN  568

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A +FT GPFL   E WL  A +P   G  
Sbjct  569   DALRFTAGPFLQG-ETWLDAAVVPVRFGMF  597



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   347 bits (889),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 173/392 (44%), Positives = 246/392 (63%), Gaps = 17/392 (4%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--GISRRLLeeptpttdeeiPQFVDSA  2511
             +M+ ++K   ELTSN+LAM++++  F  T E+P    SRR L             +++S 
Sbjct  214   EMEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMATKGVPT-----WMNSN  268

Query  2510  TRHLLVAP-----PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
              R +L        P+P++VVA+DGSG+FKTI  AL ++P K D R VI +K G+Y E V+
Sbjct  269   ERRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDETVV  328

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             + +K  N+   G+G  K++I+G++N  D     T++  T +  GEGF+ + +   N AG 
Sbjct  329   ITKKMVNVTMYGDGSQKSMISGSKNFVDGVR--TFQTATFVALGEGFLGQAIGFRNIAGP  386

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
              K QAVA R+ AD A+  NC    YQDTLY  ++RQFYR C I+GT+DFIFG+A  +FQ 
Sbjct  387   EKHQAVAARVQADRAIFVNCRFEGYQDTLYAQAHRQFYRSCLITGTIDFIFGDAAAIFQN  446

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C M++RKPL NQ  +VTAQGR D+   + IV+Q+C I+ +  L+A     K +LGRPWKE
Sbjct  447   CNMMIRKPLDNQQNIVTAQGRTDKHETTGIVLQNCKILPDKTLEAVKSQFKSYLGRPWKE  506

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT++M S I++++ P+GW  W+G+FAL T +YAE+ N+GPGA TD RVKW GYK  I 
Sbjct  507   FSRTIVMESKIEDVIHPDGWMAWQGDFALKTLYYAEFNNQGPGAKTDARVKWPGYKV-ID  565

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + A +FT G FL  D  W+     P   G  
Sbjct  566   KDEAAKFTIGTFLELD--WIESTSAPVHVGLF  595



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   346 bits (887),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 239/377 (63%), Gaps = 9/377 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDE--FLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-  2484
             ++ SNALAM+  + +      + +   +R+L       +    P+++ +  R LL +   
Sbjct  212   KMCSNALAMIKNMTDTDIANEMMLKSSNRKL---KEDESGIAWPEWLSAGDRRLLQSSSV  268

Query  2483  RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEG  2304
              P++VVA DGSG FKT++ A+   PEK+ +R +I IKAGVY+E V VP+KK+NI+F+G+G
Sbjct  269   TPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIGDG  328

Query  2303  PTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADM  2124
              TKT+ITG+RNV D     T+   TV   GE F+ RD+T +NTAG  K QAVALR+ +D+
Sbjct  329   RTKTIITGSRNVVD--GSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  2123  AVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQAC  1944
             +  +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ C +  RKP + Q  
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKN  446

Query  1943  MVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNI  1764
             MVTAQGR D    + IVIQ C I A   L+        +LGRPWKE+SRT++M S I ++
Sbjct  447   MVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDV  506

Query  1763  VVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ 
Sbjct  507   IQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-  565

Query  1583  ADEQWLGRAQIPFSPGF  1533
             A   WL     PF+ G 
Sbjct  566   AGGSWLSSTGFPFALGL  582



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   347 bits (889),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 240/375 (64%), Gaps = 7/375 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-RP  2478
              + SNALAM+  + +     E   ++R+L+EE   +      +++ +  R LL +    P
Sbjct  243   HMCSNALAMIKNMTDTDIAREREAMNRKLMEERDESGWP---KWLSAGDRRLLQSSSVTP  299

Query  2477  DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPT  2298
             D+VVA DGSG +KT++ A+ + PEK+ +R +I IKAGVYKE V V +KK NI+F+G+G +
Sbjct  300   DVVVAADGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGVYKENVEVGKKKTNIMFLGDGRS  359

Query  2297  KTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAV  2118
              T+ITG++NV D     T+   TV V GE FI RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  360   NTIITGSKNVVDG--STTFNSATVAVVGEKFIARDITFQNTAGPSKHQAVALRVGSDLSA  417

Query  2117  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMV  1938
              + C + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ C +  R+P + Q  M+
Sbjct  418   FYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNAAAVFQDCDIHARRPNSGQKNML  477

Query  1937  TAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1758
             TAQGR D    + IVIQ C I A   L+A     K +LGRPWKE+SRT++M + I N++ 
Sbjct  478   TAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSRTVVMQTSITNVID  537

Query  1757  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1578
             P GW  W G+FAL T +Y EY+N G GA T KRV WKG+K   S   A+ FTPG F+ A 
Sbjct  538   PAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASEAQGFTPGTFI-AG  596

Query  1577  EQWLGRAQIPFSPGF  1533
               WLG    P+S G 
Sbjct  597   SSWLGSTGFPYSLGL  611



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   346 bits (888),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 174/388 (45%), Positives = 245/388 (63%), Gaps = 13/388 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLK--TLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             ++ +L+ S E TSN+LAM++ L +F    T  + G  RRLL +           ++    
Sbjct  214   LEKMLQASKEFTSNSLAMLSLLSQFQLPVTAAVSGAKRRLLAQNKDRFPT----WMSHEE  269

Query  2507  RHLLV---APPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPR  2337
             R +L      P P++ VA+DGSG FKTI+ AL ++P K + R +I +K GVY E V+V +
Sbjct  270   RRVLKKNDEKPTPNVTVAKDGSGNFKTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTK  329

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
             K  N+   G+G  K++ITGN+N AD     T++  +    GEGF+ + +   NTAG  K 
Sbjct  330   KMPNVTIYGDGSQKSIITGNKNFADGVR--TFQTASFAALGEGFMAKSMGFRNTAGPEKH  387

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVA R+ AD A+  NC    YQDTLY  ++RQFY+ C ISGTVDFIFG+A  +FQ C +
Sbjct  388   QAVAARVQADRAIFLNCRFEGYQDTLYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLI  447

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
              VRKP+ NQ  +VTAQGR D++  + IV+Q+C I+ +  L+      K +LGRPWKEFSR
Sbjct  448   YVRKPMENQQNIVTAQGRTDKQETTGIVLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSR  507

Query  1796  TLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEV  1617
             T++M S I++++ P+GW+PW+G+FAL T +YAEY N+GPGA TD RVKW GYK  I  + 
Sbjct  508   TIVMDSTIEDLIHPDGWTPWQGDFALKTLYYAEYNNKGPGAKTDNRVKWSGYKV-IDKQE  566

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             A ++T GPFL  +  WL    +P   G 
Sbjct  567   AMKYTVGPFLKGNA-WLRVKGVPVRFGL  593



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   346 bits (888),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 244/391 (62%), Gaps = 17/391 (4%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIP--GISRRLLeeptpttdeeiPQFVDSAT  2508
             ++ ++K   ELTSN+LAM++++  F  T E+P    SRR L             ++D   
Sbjct  214   IEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMTTNGVPT-----WMDRNQ  268

Query  2507  RHLLVAP-----PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMV  2343
             R +L        P+P++VVA+DGSG+FKTI  AL ++P K D R VI +K G+Y E V++
Sbjct  269   RRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDETVVI  328

Query  2342  PRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAV  2163
              +K  N+   G+G  K++I+G++N  D     T++  T +  GEGF+ + +   N AG  
Sbjct  329   TKKMVNVTMYGDGSQKSMISGSKNFVDGVR--TFQTATFVALGEGFLGQAIGFRNIAGPE  386

Query  2162  KEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKC  1983
             K QAVA R+ AD A+  NC    YQDTLYT ++RQFYR C I+GT+DFIFG+A  +FQ C
Sbjct  387   KHQAVAARVQADRAIFVNCRFEGYQDTLYTQAHRQFYRSCLITGTIDFIFGDAAAIFQNC  446

Query  1982  KMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEF  1803
              M++RKPL NQ  MVTAQGR D+   + IV+Q+C I+ +  L+      K +LGRPWKEF
Sbjct  447   NMMIRKPLDNQQNMVTAQGRTDKHETTGIVLQNCKILPDKTLEPVKSQFKSYLGRPWKEF  506

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT++M S I++++ P+GW  W+G+FAL T +YAE+ N+GPGA TD RVKW GYK  I  
Sbjct  507   SRTIVMESTIEDVIHPDGWMAWEGDFALKTLYYAEFNNKGPGAKTDARVKWPGYKV-IDK  565

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A +FT G FL  D  W+     P   G  
Sbjct  566   DEAAKFTIGTFLELD--WIESTSAPVHVGLF  594



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   345 bits (886),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 251/395 (64%), Gaps = 23/395 (6%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIP-GISRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   M ++SNALA+VT L + +    I     RRLL++           +VD 
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLLQDSELP------SWVD-  238

Query  2513  ATRHLLV---APP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               +H L+   A P   +P++ VA D SG FK+I  AL  +PEKN +  VI IK GVY+EY
Sbjct  239   --QHRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEY  296

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V V +K  ++VF+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  EN+A
Sbjct  297   VEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINMGFENSA  354

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VF
Sbjct  355   GPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVF  414

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C  VVRKPL NQ C+VTAQGRK+ +  S IVIQ   IV++P   +    NK +L RPW
Sbjct  415   QNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPW  474

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGY  1641
             K +SRT+IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRVKW G 
Sbjct  475   KNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI  534

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A+ F+P  F    + W+    IP  PG
Sbjct  535   -WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_007012506.1| Pectinesterase [Theobroma cacao]
 gb|EOY30125.1| Pectinesterase [Theobroma cacao]
Length=592

 Score =   346 bits (887),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 249/389 (64%), Gaps = 11/389 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKT-LEIPGISRRLLeeptpttdeeiP-QFVDSAT  2508
             +K  L +S ELTSN+LAM  +L   + + +E+P  SR LLE  +P+ D++    +++   
Sbjct  207   IKSTLNSSQELTSNSLAMARQLSSHVSSVMEMPAASRHLLESTSPSVDKDGLPNWLNHDE  266

Query  2507  RHLL----VAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
             R LL    V  P P++ VA+DGSG F TI+ AL ++P+K D R VI +KAG+Y+E V+V 
Sbjct  267   RRLLKGADVEKPTPNVTVAKDGSGNFSTISEALAAMPQKYDGRYVIYVKAGIYEETVLVT  326

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             +K  N+   G+G  KT++TGN+N  D  P  TY   T +  G+GF+ + +   NTAG  K
Sbjct  327   KKMVNLTIYGDGSQKTIVTGNKNYVDGVP--TYLTATFVASGDGFLAKAMGFRNTAGPEK  384

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVA R+ AD A+  NC    YQDTLY  ++RQFYR C ++GT+DFIFG+A  VFQ C 
Sbjct  385   HQAVAARVDADRAIFLNCRFEGYQDTLYVQTHRQFYRSCVVAGTIDFIFGDAAAVFQNCL  444

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRKP+ NQ  +VTAQGRKD+   + IV+Q+C I+ + +  +     K +LGRPWKE+S
Sbjct  445   IYVRKPMDNQKNIVTAQGRKDKFETTGIVLQNCKILPDDSFTSFKSQFKSYLGRPWKEYS  504

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT++M S I++++ P GW  W+GNFAL+T +YAEY N GPGA TD RVKW G ++ I+ +
Sbjct  505   RTIVMESLIEDLIDPAGWLEWEGNFALNTLYYAEYNNNGPGAKTDARVKWPG-RKVINKD  563

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A +FT   FL     W+     P   G 
Sbjct  564   EAMKFTVETFLQG--TWIKATGAPVRMGL  590



>ref|XP_007149854.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
 gb|ESW21848.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
Length=460

 Score =   341 bits (875),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/389 (44%), Positives = 245/389 (63%), Gaps = 11/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             G+KMK LL   ME++SN LA+VT+L + +    +  +   R L+     +  +  + ++ 
Sbjct  65    GKKMKDLLMIGMEMSSNVLAIVTELADTITNSNVTNLLGHRHLQGSESPSWNDHHRLLNE  124

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
                   +   +P++ VA+DG+G FK I  AL  +PEKN R  VI IK G+Y+EYV V + 
Sbjct  125   NAS---LVNHKPNVTVAKDGNGDFKNINEALKQVPEKNKRPFVIYIKEGIYQEYVQVTKD  181

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++VF+G+G  KT ITGN+N  D     TY+  T+ ++G+ F+  ++  EN AG  K Q
Sbjct  182   MTHVVFIGDGGKKTRITGNKNFIDGI--NTYKTSTIAIQGDYFVAINMGFENFAGPQKHQ  239

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ C  V
Sbjct  240   AVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFV  299

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPL NQ C+VTAQGRK+++  S IVIQ   IV++P   +    NK +L RPWK +SRT
Sbjct  300   VRKPLKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSIRFENKAYLARPWKNYSRT  359

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM ++ID+++  +G+ PW+   G   +DTC+YAEY N GPG++  KRV W G   N++ 
Sbjct  360   IIMDTYIDDLIHADGYLPWQGLEGPSGMDTCFYAEYHNTGPGSNKSKRVHWSGI-WNLNS  418

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             +    F+P  F    + W+    IP  PG
Sbjct  419   KAIHWFSPSKFFHGTD-WIHVTGIPCFPG  446



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   345 bits (884),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/390 (45%), Positives = 249/390 (64%), Gaps = 11/390 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiP--QFVDS  2514
             + M+++ +TS EL+SN+LAMV+ +     +    G++  L          E     +V  
Sbjct  179   QDMQNIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTLTNYARKLLSAEDGIPTWVRP  238

Query  2513  ATRHLLVA------PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
               R LL A      P + + VVAQDGSG+FKTI  ALN++P+ N    VI IK G+YKE 
Sbjct  239   EARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIYKEK  298

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V+V RK   + F+G+GP KTVITG+ N        T+  G++ +EG+ F  +++ IENTA
Sbjct  299   VIVTRKMPYVTFIGDGPNKTVITGSLNFG-IGKVKTFLTGSITIEGDHFTAKNIGIENTA  357

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G    QAVALR+SAD A   +C ++ +QDTLY HS+RQFYR CT+SGTVDFIFG+A  + 
Sbjct  358   GPEGGQAVALRVSADYAAFQSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCIL  417

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q CK+VVRKP   Q+CMVTAQGR + R ++ +V+ +C I  + A       +K +LGRPW
Sbjct  418   QNCKIVVRKPKKGQSCMVTAQGRSNVRESTGLVLHNCHITGDSAYIPVKSESKAYLGRPW  477

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT++M + ID+++ P GW PW G+FAL T +YAE+ N GPG++   RVKW G K+ 
Sbjct  478   KEFSRTIVMKTAIDDVIDPAGWLPWSGDFALKTLYYAEHLNTGPGSNQAHRVKWPGIKK-  536

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             ++P+ A  +T   FL   E W+ + Q+P++
Sbjct  537   LTPQDALLYTGDKFL-GGETWIPQTQVPYT  565



>ref|XP_004303758.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   345 bits (885),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 236/375 (63%), Gaps = 4/375 (1%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-RP  2478
             +L SNALAM+  + +     E+  +S     +      E  P+++ +A RHLL +    P
Sbjct  207   KLCSNALAMIKNMTDNDIANEMKAMSSTTNRKLKEERSEGWPEWLSAADRHLLQSSTVTP  266

Query  2477  DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPT  2298
             +++VA DGSG +KT++ A+ + P K+  R VI IKAGVY+E V VP+ K NI+F+G+G T
Sbjct  267   NVIVAADGSGNYKTVSEAVAAAPSKSTSRYVIRIKAGVYRENVDVPKAKTNIMFLGDGRT  326

Query  2297  KTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAV  2118
              T+ITG+RNV D     T+   TV   G GF+ RD+T +NTAG  K QAVALR+ +D++ 
Sbjct  327   TTIITGSRNVVD--GDTTFNSATVAAVGAGFLARDITFQNTAGPSKHQAVALRVGSDLSA  384

Query  2117  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMV  1938
              + C + AYQD+LY HS RQF+ GC I+GTVDFIFGNA VV Q C +  RKP + Q  M+
Sbjct  385   FYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGNAAVVLQNCDIHARKPNSGQKNML  444

Query  1937  TAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1758
             TAQGR D    + IVIQ   I A   L+A     K +LGRPWKE+SRT+IM S I +I+ 
Sbjct  445   TAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITDIID  504

Query  1757  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1578
             P GW  W G FALDT +YAEY N G GAST  RV WKGYK   S   A+ FTPG F+ A 
Sbjct  505   PAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFI-AG  563

Query  1577  EQWLGRAQIPFSPGF  1533
               WL     PF+ G 
Sbjct  564   GSWLSATGFPFTLGL  578



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   337 bits (864),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 216/333 (65%), Gaps = 4/333 (1%)
 Frame = -2

Query  2528  QFVDSATRHLLVAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEY  2352
             +++ +  R LL A     D+ VA DGSG +KT+  A+ S PE++ +R +I IKAGVYKE 
Sbjct  37    EWLSAGDRRLLQASTVTADVTVAADGSGNYKTVGEAVASAPERSSKRYIIRIKAGVYKEN  96

Query  2351  VMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTA  2172
             V VP+KK NI+FVG+G T T+IT +RNV D     T+   TV V G+GF+ RD+T +NTA
Sbjct  97    VEVPKKKTNIMFVGDGRTNTIITASRNVVDG--STTFHSATVAVVGDGFLARDITFQNTA  154

Query  2171  GAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+ +D++  + C + AYQDTLY HS RQF+ GC ++GTVDFIFGNA  V 
Sbjct  155   GPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGNAAAVL  214

Query  1991  QKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPW  1812
             Q C +  R+P + Q  MVTAQGR D    + IVIQ C I A   LK        +LGRPW
Sbjct  215   QDCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPW  274

Query  1811  KEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRN  1632
             KE+SRT++M + I +++ P GW PW GNFALDT +YAEY+N G GA T KRV WKG+K  
Sbjct  275   KEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVI  334

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              S   A+ FT G F+     WL     PFS G 
Sbjct  335   TSASEAQAFTAGSFI-GGSSWLPSTGFPFSLGL  366



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   344 bits (883),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 239/377 (63%), Gaps = 9/377 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDE--FLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-  2484
             ++ SNALAM+  + +      + +   +R+L       +    P+++ +  R LL +   
Sbjct  212   KMCSNALAMIKNMTDTDIANEMMLKSSNRKL---KEDESGIAWPEWLSAGDRRLLQSSSV  268

Query  2483  RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEG  2304
              P++VVA DGSG FKT++ A+   PEK+ +R +I IKAGVY+E V VP+KK+NI+F+G+G
Sbjct  269   TPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYRENVEVPKKKSNIMFIGDG  328

Query  2303  PTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADM  2124
              TKT+ITG+RNV D     T+   TV V GE F+ RD+T +NTAG  K QAVALR+ +D+
Sbjct  329   RTKTIITGSRNVVD--GSTTFHSATVAVVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  2123  AVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQAC  1944
             +  +NC + AYQDTLY HS RQFY  C ++GTVDFIF NA  VFQ C +  RKP + Q  
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFENAAAVFQNCDIHARKPNSGQKN  446

Query  1943  MVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNI  1764
             MVTAQGR D    + IVIQ C I A   L+        +LGRPWKE+SRT++M S I ++
Sbjct  447   MVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDV  506

Query  1763  VVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ 
Sbjct  507   IQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-  565

Query  1583  ADEQWLGRAQIPFSPGF  1533
             A   WL     PF+ G 
Sbjct  566   AGGSWLSSTGFPFALGL  582



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   344 bits (883),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 238/377 (63%), Gaps = 9/377 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDE--FLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-  2484
             ++ SNALAM+  + +      + +   +R+L       +    P+++ +  R LL +   
Sbjct  212   KMCSNALAMIKNMTDTDIANEMMLKSSNRKL---KEDESGIAWPEWLSAGDRRLLQSSSV  268

Query  2483  RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEG  2304
              P++VVA DGSG FKT++ A+   PEK+ +R +I IKAGVY E V VP+KK+NI+F+G+G
Sbjct  269   TPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYIIRIKAGVYIENVEVPKKKSNIMFIGDG  328

Query  2303  PTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADM  2124
              TKT+ITG+RNV D     T+   TV   GE F+ RD+T +NTAG  K QAVALR+ +D+
Sbjct  329   RTKTIITGSRNVVD--GSTTFHSATVAAVGEKFLARDITFQNTAGPSKHQAVALRVGSDL  386

Query  2123  AVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQAC  1944
             +  +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ C +  RKP + Q  
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKN  446

Query  1943  MVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNI  1764
             MVTAQGR D    + IVIQ C I A   L+        +LGRPWKE+SRT++M S I ++
Sbjct  447   MVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDV  506

Query  1763  VVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ 
Sbjct  507   IQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-  565

Query  1583  ADEQWLGRAQIPFSPGF  1533
             A   WL     PF+ G 
Sbjct  566   AGGSWLSSTGFPFALGL  582



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   344 bits (883),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 244/389 (63%), Gaps = 10/389 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
             G KMK LL +S+ ++SNALA+++   + +       I  RRLL +    +  +      +
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRRLLHDSETPSSVDHHHKQHN  247

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             A +++     +P++ VA DGSG FK+I  AL  +P+K+ +  VI IK GVY EYV V + 
Sbjct  248   AKKNVF--KHKPNVTVALDGSGDFKSINEALTQVPKKSKKPFVIYIKEGVYPEYVEVTKH  305

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++VFVG+G  KT+ITGN+N  D     TYR  +V ++G+ F+  ++  EN+AG  K Q
Sbjct  306   MTHVVFVGDGGKKTIITGNKNFIDGV--NTYRTASVAIQGDHFVAINMGFENSAGPHKHQ  363

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVALR+  D  +  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK V
Sbjct  364   AVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCKFV  423

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP++NQ C+VTAQGRK+R   SAIVIQ   IV++P        NK +L RPWK FSRT
Sbjct  424   VRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPWKNFSRT  483

Query  1793  LIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             +IM +FID+++  +G+ PW+   G   +DTC+YAEY N GPG+   KRV W G   N++ 
Sbjct  484   IIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRVNWAGI-WNLNA  542

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + A  F P  F    + W+    IPF  G
Sbjct  543   KAAHWFAPSKFFHGGD-WIEATGIPFFSG  570



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   343 bits (881),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 234/378 (62%), Gaps = 7/378 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQF---VDSATRHLLVAPP  2484
             +L SNALAM+  + +     E     R+L E   P +      F   + +  R LL +  
Sbjct  190   KLISNALAMIKNMTDTDMAAERSAAGRKLEENNLPESFAGEDGFPAWMSAGDRRLLQSSS  249

Query  2483  -RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGE  2307
               P++VVA DGSG FKT+  A+ + PEK+ +R VI IKAGVY+E V VP+KK NI+F+G+
Sbjct  250   VTPNVVVAADGSGDFKTVAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKKKTNIMFLGD  309

Query  2306  GPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISAD  2127
             G  KT+ITG++NV D     T+R  TV   GE F+ RD+T +NTAG  K QAVALR+ +D
Sbjct  310   GRMKTIITGSKNVKDG--STTFRSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSD  367

Query  2126  MAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQA  1947
              +  + C + AYQDTLY HS RQFYR C I GTVDFIFGNA  V Q C ++ R+P + Q 
Sbjct  368   FSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNAAAVLQNCDILARRPNSGQK  427

Query  1946  CMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDN  1767
              MVTAQGR+D    + I I  C I A+  L         +LGRPWKE+SRT+IM S I +
Sbjct  428   NMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRTVIMQSTISD  487

Query  1766  IVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1587
             ++ P GW  W GNFAL+T +Y EY+N G GA T  RVKWKGYK   S   AKQFT G F+
Sbjct  488   VINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEAKQFTVGDFI  547

Query  1586  MADEQWLGRAQIPFSPGF  1533
                  WLG    PF+ GF
Sbjct  548   NGG-SWLGSTGFPFTAGF  564



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   344 bits (882),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 235/374 (63%), Gaps = 9/374 (2%)
 Frame = -2

Query  2651  LTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPPR-PD  2475
             + SNALAM+  + +     E     RR+       + EE P ++    R LL A    PD
Sbjct  211   MCSNALAMIKNMTDTDMAQEQYKAKRRV-----EESSEEFPAWLSWGDRKLLQASMLVPD  265

Query  2474  IVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTK  2295
             + VA DGSG + T++ A+ + PEK+ +R +I IKAGVY+E V VP+KK NI+ VG+G   
Sbjct  266   VTVAADGSGHYTTVSEAVAAAPEKSHKRYIIRIKAGVYRENVNVPKKKTNIMMVGDGRIN  325

Query  2294  TVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVV  2115
             T+ITG R+V D     T+R  +V   GEGF+ RD+T +NTAG  K+QAVALR+ +D +  
Sbjct  326   TIITGRRSVVD--GSTTFRSASVAAVGEGFLARDITFQNTAGPSKDQAVALRVGSDKSAF  383

Query  2114  HNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVT  1935
             + C++ AYQDTLY HS RQFY    I GTVDFIFGNA  +FQ C +  R+P   Q  MVT
Sbjct  384   YRCNIIAYQDTLYVHSLRQFYVDSLIVGTVDFIFGNAAAIFQNCDIHARRPNRGQKNMVT  443

Query  1934  AQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVP  1755
             AQGR D    + I+IQ C I A   LK        +LGRPWKE+SRT+IM SFI +++ P
Sbjct  444   AQGRDDPNQNTGIIIQKCRIGATSDLKPVKRSFPTYLGRPWKEYSRTVIMQSFITDVIHP  503

Query  1754  EGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADE  1575
             EGW  W GNFAL+T +Y EY+N G GA+T KRVKWKGYK   S  VA+QFT   F++ D 
Sbjct  504   EGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWKGYKVITSATVAQQFTVKNFILGD-  562

Query  1574  QWLGRAQIPFSPGF  1533
              WLG    PFS G 
Sbjct  563   HWLGSTGFPFSAGL  576



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   344 bits (882),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 232/375 (62%), Gaps = 8/375 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-RP  2478
             +L SNALAM+  + +     E     R+L            P ++ +  R LL +     
Sbjct  220   KLCSNALAMIKNMTDTDMERESEAGGRKL----EEEETNGWPNWLSAGDRRLLQSSTVTA  275

Query  2477  DIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPT  2298
             D+VVA DGSG FKT++ A+ + PEK+ RR VI IKAGVY+E V VP+KK NI+F+G+G T
Sbjct  276   DVVVAADGSGDFKTVSAAVEAAPEKSSRRYVIRIKAGVYRENVEVPKKKTNIMFLGDGRT  335

Query  2297  KTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAV  2118
             KT+IT +RNV D     T+   TV   GE F+ RDLT +NTAG+ K QAVALR+ +D++ 
Sbjct  336   KTIITASRNVVD--GSTTFHSATVAAVGERFLARDLTFQNTAGSSKHQAVALRVGSDLSA  393

Query  2117  VHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMV  1938
              + C + A+QDTLY HS RQFY  C I+GTVDFIFGN   VFQ C +  R P + Q  MV
Sbjct  394   FYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGNGAAVFQDCDIHARLPGSGQKNMV  453

Query  1937  TAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVV  1758
             TAQGR D    + IVIQ C I A   L+        FLGRPWKE+SRT++M S + +++ 
Sbjct  454   TAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSRTVVMQSTVTDVID  513

Query  1757  PEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD  1578
             P GW  W GNFAL T +YAEY+N G GA T  RVKWKGYK   S   A+ FTPG F+  +
Sbjct  514   PAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAEAQAFTPGRFIDGN  573

Query  1577  EQWLGRAQIPFSPGF  1533
               WLG    PF+ G 
Sbjct  574   S-WLGATGFPFALGL  587



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   343 bits (880),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/390 (45%), Positives = 236/390 (61%), Gaps = 12/390 (3%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATR  2505
             KM+  L +S ELT N LA+V +  E L  L +P   RRLL E           ++  A R
Sbjct  175   KMRKALNSSQELTENILALVDEFSETLANLGLPSFHRRLLAEHARGAP----SWMPDAKR  230

Query  2504  HLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              LL+  P     RPD+ VA+DGSG F+TI  AL  +P K+    V+ +KAG Y+EYV V 
Sbjct  231   RLLLVSPGEKGFRPDVTVAKDGSGDFRTINAALAKVPLKSATTYVMYVKAGKYREYVSVA  290

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R   N+V VG+G TKTVITG+++        T    T+   G GF+ R + ++NTAGA  
Sbjct  291   RNVTNLVMVGDGATKTVITGHKSFMMNIT--TKDTATMEAIGNGFLMRGIGVKNTAGAKN  348

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +DM+  + C  + YQDTLYTH+ RQ+YR C I+GT+DFIFGNA VVFQ C 
Sbjct  349   HQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCVITGTIDFIFGNAQVVFQNCL  408

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRK + NQ  +VTAQGRK+RR     VI +C +   P  + +    + FLGRPWKE S
Sbjct  409   IQVRKCMDNQQNIVTAQGRKERRSVGGTVIHNCTVAPHPEFEKSVGRFRTFLGRPWKEHS  468

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTL + S I   + P+GW PW G+F L TC+YAE +N GPGA+  +RVKW+G K      
Sbjct  469   RTLYIQSEIGGFIDPQGWLPWLGDFGLSTCYYAEVENHGPGANMTRRVKWRGIKNITYQH  528

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +++T   F+   + WL +  +PF PG L
Sbjct  529   ALQKYTVESFIQG-QHWLPQLGVPFIPGLL  557



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   343 bits (879),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 179/397 (45%), Positives = 248/397 (62%), Gaps = 29/397 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS--------RRLLeeptpttdee  2535
             G++M+ LL  SM+++SNALAM+T +   L +      S        RRLL E        
Sbjct  176   GDRMRDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSRRRRLLSEKD------  229

Query  2534  iPQFVDSATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKE  2355
                  D    +++    +PD++VA+DGSG FKTI  AL  +PE +++  V+ IK G+Y+E
Sbjct  230   -----DLPKLNIM----KPDLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIKEGIYEE  280

Query  2354  YVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENT  2175
              V +     N++ VG+GP KT ITG  N  +     TY+  TV V G+ F   D+  EN 
Sbjct  281   QVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTT--TYQSATVAVHGDRFTAMDVGFENA  338

Query  2174  AGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVV  1995
             AG    QAVALR+SAD+AV +NCH++ YQDTLY H+YRQFYR CTISGT+D+IFG+A  +
Sbjct  339   AGPEGHQAVALRVSADLAVFYNCHMDGYQDTLYAHTYRQFYRDCTISGTIDYIFGDAAAL  398

Query  1994  FQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRP  1815
             FQ C MVVRKPLANQ C+VTAQGRKD    + +V+Q+C +V +PA       NK +L RP
Sbjct  399   FQGCTMVVRKPLANQYCIVTAQGRKDVHQPTGLVLQNCSVVGDPAYYPVMDVNKAYLARP  458

Query  1814  WKEFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKR  1635
             WK +SR +IM S+ID I+ P+G+  W G FALDT +Y E+ NRGPGA   +R+KW G K 
Sbjct  459   WKLYSRAVIMESYIDRIIQPDGYLEWNGTFALDTLFYTEFNNRGPGADKSRRLKWTGIKE  518

Query  1634  NISPEVAKQFTPGPFLMADEQWL--GRAQIPFSPGFL  1530
              ++ +  K+FT   F+    +W    + +IP+  GF+
Sbjct  519   -LTGKRMKRFTGDDFIDG-SRWTKHNKMKIPYKGGFV  553



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   344 bits (882),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 241/378 (64%), Gaps = 10/378 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRH  2502
             M+   K++ ELTSNALA+V+K+   L + ++ G +R LL + +              TR 
Sbjct  209   MEKTFKSAKELTSNALAIVSKVTSILSSFDLTGANRHLLAQESSGPSLANNGLPIWMTRE  268

Query  2501  -LLVAPPR-----PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
                V  P+     P+ VVA+DGSG F TI+ AL ++P K   R VI +K GVY E V V 
Sbjct  269   DRRVLKPKESNLTPNAVVAKDGSGNFTTISAALAAMPPKYPGRYVIYVKEGVYDETVTVE  328

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             RK  N+   GEG  KT++TGN+N  D     T++  + +  G+GF+   +   NTAG  K
Sbjct  329   RKMQNVTMYGEGSRKTIVTGNKNFVDGVR--TFQTASFVALGDGFVAVSMGFRNTAGPEK  386

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVA+R+ +D ++  NC ++ YQDT+Y  ++RQF+RGC I+GT+DFIFG+A  +FQ C 
Sbjct  387   HQAVAIRVQSDRSIFLNCRMDGYQDTVYAQTHRQFFRGCVITGTIDFIFGDASAIFQNCL  446

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRKPL NQ  +VTAQGR D+R  + IV+Q+C I+ +  L       K +LGRPWKEFS
Sbjct  447   ITVRKPLDNQQNIVTAQGRTDKRETTGIVLQNCRILPDQDLIPTKTQVKSYLGRPWKEFS  506

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RT++M S I++++ P+GW PW+GNFAL T +YAEY N+GPGA+   RVKW GYK  I  E
Sbjct  507   RTIVMESTIEDLIQPQGWLPWEGNFALSTLYYAEYNNKGPGAALSARVKWPGYKV-IEKE  565

Query  1619  VAKQFTPGPFLMADEQWL  1566
              A ++T GPF+  D+ WL
Sbjct  566   EAVKYTVGPFIQGDD-WL  582



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   343 bits (881),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 249/405 (61%), Gaps = 27/405 (7%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             +KMK++L TSM ++SNALA+++ L + +  L      RRL+++       E     D   
Sbjct  184   KKMKNILTTSMHMSSNALAVISDLADNVLDLNATTDGRRLIDDYKGEYVGEQVVAKDDVN  243

Query  2507  R-----------------HLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVIL  2379
                               H+     + ++VVA+DGSGKFK I  AL  +P+KN +  VI 
Sbjct  244   DVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKINDALKQVPKKNQKPFVIH  303

Query  2378  IKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY EYV V +K  ++VF+G+G  KT ITGN+N  D     TY+  TV +EG+ F+ 
Sbjct  304   IKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGI--NTYQTPTVAIEGDNFVA  361

Query  2198  RDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDF  2019
              ++  EN+AG  K QAVA+R+ AD A+ + C ++ YQDTLY H+ RQFYR CTISGT+DF
Sbjct  362   INIGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYVHTMRQFYRDCTISGTIDF  421

Query  2018  IFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPP  1839
             IFG+A  VFQ C  +V+KPL NQ C+VTAQGRK+R   S IVIQ+C IVA+         
Sbjct  422   IFGDAISVFQNCTFLVKKPLENQQCIVTAQGRKERHQPSGIVIQNCHIVADT--HNVKFD  479

Query  1838  NKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKG----NFALDTCWYAEYKNRGPGAS  1671
             NK +L RPWK FSRT+ M ++I +++ P+G+ PW+G       +DTC+YAEY N+GPG+ 
Sbjct  480   NKAYLARPWKNFSRTVFMKTYIGDLIQPDGFMPWQGPNGTVSGIDTCFYAEYNNKGPGSD  539

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               KRVKW G K  ++ + A  F P  F   D+ W+   +IP+S G
Sbjct  540   KSKRVKWPGIK-TLTSQSASHFLPSMFFHGDD-WIKVTKIPYSSG  582



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   343 bits (881),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 176/392 (45%), Positives = 237/392 (60%), Gaps = 13/392 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPG-ISRRLLeeptpttdeeiPQF---VDS  2514
             M+   K S ELTSN+LAMV+ L  F+K+   P  ++RRLL +   +           + +
Sbjct  207   MEKTFKASKELTSNSLAMVSSLTSFMKSFPFPAALNRRLLAKEDNSPALNKDDLPGWMSN  266

Query  2513  ATRHLLVAP----PRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVM  2346
               R +L       P+P++ VA+DGSG FKTI+ AL ++P K + R VI +K G+Y E V 
Sbjct  267   EDRRILKGASKDKPKPNVTVAKDGSGDFKTISEALAAMPAKYEGRYVIFVKQGIYDETVT  326

Query  2345  VPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGA  2166
             V +K +NI   G+G  KT++TGN+N AD     T+R  T  V G+GF+C+ +   NTAG 
Sbjct  327   VTKKMSNITIYGDGSQKTIVTGNKNFADGVQ--TFRTATFAVLGDGFLCKAMGFRNTAGP  384

Query  2165  VKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQK  1986
              K QAVA+R+ AD A+  NC    YQDTLY  ++RQFYR C I+GTVDFIFG+A  +FQ 
Sbjct  385   EKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFYRSCVITGTVDFIFGDATAIFQN  444

Query  1985  CKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKE  1806
             C + VRKPL NQ  ++TAQGR D    + IV+Q+C I  +  L       + +LGRPWKE
Sbjct  445   CLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCRIEPDKDLVPVKTKIRSYLGRPWKE  504

Query  1805  FSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT+IM S I + + P+GW PW+G F L T +YAEY N+G GA T  R+KW GY   I+
Sbjct  505   FSRTIIMESTIGDFIHPDGWLPWQGEFGLKTLYYAEYNNKGAGAKTTARIKWPGY-HIIN  563

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              E A +FT  PF   D  W+     P   G  
Sbjct  564   NEEAMKFTAEPFYQGD--WISATGSPIHLGLF  593



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   343 bits (880),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 178/377 (47%), Positives = 239/377 (63%), Gaps = 9/377 (2%)
 Frame = -2

Query  2654  ELTSNALAMVTKLDE--FLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRHLLVAPP-  2484
             ++ SNALAM+  + +      + +   +R+L       +    P+++ +  R LL +   
Sbjct  212   KMCSNALAMIKNMTDTDIANEMMLKSSNRKL---KEDESGIAWPEWLSAGDRRLLQSSSV  268

Query  2483  RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEG  2304
              P++VVA DGSG FKT++ A+   PEK+ +R  I IKAGVY+E V VP+KK++I+F+G+G
Sbjct  269   TPNVVVAADGSGNFKTVSEAVAKAPEKSSKRYTIRIKAGVYRENVEVPKKKSSIMFIGDG  328

Query  2303  PTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADM  2124
              TKT+ITG+RNV D     T+   TV V GE F+ R++T +NTAG  K QAVALR+ +D+
Sbjct  329   RTKTIITGSRNVVD--GSTTFHSATVAVVGEKFLAREITFQNTAGPSKHQAVALRVGSDL  386

Query  2123  AVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQAC  1944
             +  +NC + AYQDTLY HS RQFY  C ++GTVDFIFGNA  VFQ C +  RKP + Q  
Sbjct  387   SAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGNAAAVFQNCDIHARKPNSGQKN  446

Query  1943  MVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNI  1764
             MVTAQGR D    + IVIQ C I A   L+        +LGRPWKE+SRT++M S I ++
Sbjct  447   MVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISDV  506

Query  1763  VVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + P GW  W G+FAL T +YAEY+N G GAST  RVKW GYK   S   A+ FTPG F+ 
Sbjct  507   IQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI-  565

Query  1583  ADEQWLGRAQIPFSPGF  1533
             A   WL     PF+ G 
Sbjct  566   AGGSWLSSTGFPFALGL  582



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   343 bits (880),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 251/404 (62%), Gaps = 19/404 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeep-------tpttdeei  2532
             G+KM+  L+T+M +TSN LA++++L + L  + +    RRLL            T D ++
Sbjct  184   GKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSGRRLLTAADDLPVLGHETDDFDL  243

Query  2531  PQFVDS--ATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAG  2367
             P +V+S    R LL    R     +VVA+DGSG F TI  AL  +P KN R  +I IK G
Sbjct  244   PDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFIIYIKEG  303

Query  2366  VYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY EYV V R   ++V +G+G  K+ ITG++N  D    GTY+  +  + G+ F+   + 
Sbjct  304   VYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGV--GTYKTASAAIIGDFFVAIGMG  361

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
              ENTAGA K QAVALR+ +D ++ + C ++ YQDTLY H+ RQFYR C ISGT+DF+FG+
Sbjct  362   FENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHAMRQFYRDCIISGTIDFVFGD  421

Query  2006  APVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVF  1827
             A  V Q C   VRKP+ANQ C+VTAQGRK+R   S I+I    IV++P+       NK +
Sbjct  422   AVAVLQNCTFEVRKPMANQQCIVTAQGRKERNQPSGIIIHGGSIVSDPSYYPVRFDNKAY  481

Query  1826  LGRPWKEFSRTLIMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRV  1656
             L RPWK FSRT+IM S+ID+++ P+G+ PW+   G   +DTC+Y+E  N GPGA   KRV
Sbjct  482   LARPWKNFSRTIIMDSYIDDLITPDGYMPWQTVEGLSGMDTCFYSEINNHGPGADKSKRV  541

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW+G K ++S ++A  F P PF   D+ W+   ++P+  G   P
Sbjct  542   KWEGIK-SLSNDMATTFLPSPFFHGDD-WIRVTRVPYDSGLPSP  583



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   342 bits (878),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 176/390 (45%), Positives = 232/390 (59%), Gaps = 14/390 (4%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATR  2505
             KM+  L  S ELT N L++V +  + +  L++   SRRLL            +++  A R
Sbjct  174   KMRKALNVSQELTENILSIVDEFGDTIANLDLSIFSRRLLGHDGAP------RWMSDAKR  227

Query  2504  HLLVAPP-----RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVP  2340
              LL   P     +PD+ VA DGSG F TI  AL  +P K +   V+ +K G YKEYV VP
Sbjct  228   RLLEVSPSEPDFKPDVTVAADGSGDFTTINEALAKVPLKREDTYVMYVKEGTYKEYVSVP  287

Query  2339  RKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVK  2160
             R  +N+V +G+G  KTVITG ++        T    T+   G GF  R +T+ENTAGA  
Sbjct  288   RNVSNLVMIGDGADKTVITGEKSFMMNIT--TKDTATMEAIGNGFFMRGITVENTAGAKN  345

Query  2159  EQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCK  1980
              QAVALR+ +D +V + C  + YQDTLYTH+ RQ+YR CT+SGT+DFIFGNA VVFQ C 
Sbjct  346   HQAVALRVQSDQSVFYECQFHGYQDTLYTHTSRQYYRDCTVSGTIDFIFGNAQVVFQNCL  405

Query  1979  MVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRK + NQ  ++TAQGRK+R  A  IVI +C I   P  K      + FLGRPWKE S
Sbjct  406   IQVRKCMENQQNIITAQGRKERHSAGGIVIHNCTIEPHPEFKDHMGRLRTFLGRPWKEHS  465

Query  1799  RTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             RTL + S I + V PEGW PW G F L+TC+YAE +NRGPGA    R  WKG K     +
Sbjct  466   RTLYIQSEIGDFVDPEGWLPWLGEFGLNTCYYAEVENRGPGADMSNRATWKGVKHITYQQ  525

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +++T   F+   + W+ +  +PF PG L
Sbjct  526   AEEKYTVERFIQG-QLWISKYGVPFIPGLL  554



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   353 bits (907),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 186/430 (43%), Positives = 254/430 (59%), Gaps = 49/430 (11%)
 Frame = -2

Query  2684  KMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS-RRLLeeptp--------------  2550
             K++ +L+TSME++SN LA+V  L     TL+I   + RRLL                   
Sbjct  171   KVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATYKVHRRLFGDDDGNNVL  230

Query  2549  -----------------------ttdeeiPQFVDSATRHLLVAP-------PRPDIVVAQ  2460
                                    + D  +P++VD   R LL +P        + ++VVAQ
Sbjct  231   LSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASPMLTDDLKAKANVVVAQ  290

Query  2459  DGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITG  2280
             DGSGKFKTI  A+  IP       +I IK GVY EY+++ +   N+VFVG+GPTKT IT 
Sbjct  291   DGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMTNVVFVGDGPTKTRITN  350

Query  2279  NRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHL  2100
             N+N AD     T++  T+ V G+ F+ +D+ +EN+AGA+K QAVA R  +D ++  NCH 
Sbjct  351   NKNYADG--TKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAFRAQSDKSIFFNCHF  408

Query  2099  NAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRK  1920
             + YQDTLYTH+YRQFYR C I+GT+DFIFG+A V FQ C  VVRKPL NQ C+VTAQGR 
Sbjct  409   DGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLENQNCIVTAQGRM  468

Query  1919  DRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSP  1740
             +R   + I+I +    A+P        NK +LGRPWKE+S+T+IM S I +++ PEGW P
Sbjct  469   ERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQPEGWLP  528

Query  1739  WKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGR  1560
             W+GNF LDT +Y EY N G GA    RVKW+G K  I    A++F P P L  ++ W+  
Sbjct  529   WEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFMP-PILYENDDWIRD  586

Query  1559  AQIPFSPGFL  1530
             + IP+ P  +
Sbjct  587   SGIPYDPALI  596



>ref|XP_003534837.2| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=490

 Score =   340 bits (871),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 234/391 (60%), Gaps = 11/391 (3%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             +KM   + +S+EL+SNAL M   +   L        +RRLL E     D  +    +   
Sbjct  64    QKMAMAMSSSLELSSNALDMTDTISRMLNGFRPKIFNRRLLSEEATVVDGFLSWVNEGQR  123

Query  2507  RHLLVA--PPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRK  2334
             R L VA    +P+ VVAQDGSG+FKT+T AL ++P  ND+  VI +KAGVYKE V V   
Sbjct  124   RFLQVALGSVKPNAVVAQDGSGQFKTLTEALKTVPANNDKPFVIQVKAGVYKEIVKVTNT  183

Query  2333  KNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQ  2154
               ++  +GEG TKT  TG+ N  D     T    T  V G  F+ +D+  ENTAG+ K+Q
Sbjct  184   MTHVTIIGEGATKTKFTGSLNFVDG--STTLESATFAVNGANFMAKDIGFENTAGSSKQQ  241

Query  2153  AVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMV  1974
             AVAL ++AD AV +NC ++ +QDTL+  S RQFYR CTISGT+DFIFG+A  VFQ C+++
Sbjct  242   AVALLVTADQAVFYNCQMDGFQDTLFAQSQRQFYRDCTISGTIDFIFGDAFAVFQNCQLI  301

Query  1973  VRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR PL    CMVTA GR     ASA+V QSC    EP L +A  P   FLGRPW  +S+ 
Sbjct  302   VRNPLKGARCMVTAGGRVKANSASALVFQSCHFTGEPELASAE-PKLAFLGRPWMPYSKV  360

Query  1793  LIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM S I+NI +PEG+  W  N   DTC Y EY N+GPGA T KRVKW+G K   S E A
Sbjct  361   VIMDSQIENIFLPEGYEAWTANANKDTCTYYEYNNKGPGADTSKRVKWQGVKVITSTE-A  419

Query  1613  KQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
               + PG F       + + W+  A IP+S G
Sbjct  420   NNYYPGKFYELANSTSRDAWITDAGIPYSLG  450



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   342 bits (878),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 245/384 (64%), Gaps = 9/384 (2%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSA  2511
             G+KMK LL   M ++SNALA+VT L + +    +  +SRR L + +          + + 
Sbjct  181   GKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRRRLLQDSKLPVWVDQHRLLNE  240

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKK  2331
                LL    +P++ VA DGSG FK+I  AL  +P++N +  VI IK GVY+EYV V +K 
Sbjct  241   NESLL--RHKPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVYQEYVEVTKKM  298

Query  2330  NNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQA  2151
              ++VF+GEG  KT ITGN+N  D     TYR  TV ++G+ F+  ++  EN+AG  K QA
Sbjct  299   THVVFIGEGGKKTRITGNKNFID--GTNTYRTATVAIQGDYFVAINMGFENSAGPQKHQA  356

Query  2150  VALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVV  1971
             VALR+ AD ++ +NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  +FQ C  VV
Sbjct  357   VALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAIFQNCTFVV  416

Query  1970  RKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKPL NQ C+VTAQGRK+ +  S IVIQ   IV++P   +    NK +L RPWK +SRT+
Sbjct  417   RKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTI  476

Query  1790  IMFSFIDNIVVPEGWSPWK---GNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPE  1620
             IM ++ID+++  +G+ PW+   G   ++TC+YAEY + GPG+   KRVKW G   N++ +
Sbjct  477   IMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKWAGI-WNLNSK  535

Query  1619  VAKQFTPGPFLMADEQWLGRAQIP  1548
              A+ F+   F    + W+    IP
Sbjct  536   AARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   343 bits (879),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/394 (44%), Positives = 246/394 (62%), Gaps = 21/394 (5%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIP------GISRRLLeeptpttdeeiPQFV  2520
             ++ +L+TS E TSN+LAM++ L++    L++P      G +RRLL +           ++
Sbjct  217   LEKMLQTSKEFTSNSLAMLSLLNQ----LQLPSTGAAAGSNRRLLSQDKSGFP----NWM  268

Query  2519  DSATRHLLVAPPR---PDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYV  2349
                 R +L    +   P++ VA+DGSG +KTI+ AL  +P+K + R VI +K GVY E V
Sbjct  269   SHEDRRMLKKNDKKLTPNVTVAKDGSGNYKTISEALEKMPQKYEGRYVIYVKEGVYXETV  328

Query  2348  MVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAG  2169
              V +K  N+   G+G  K++ITGN+N AD     T++       GEGF+ + +   NTAG
Sbjct  329   TVTKKMPNVTMYGDGSQKSIITGNKNXADGVR--TFQTAPFAALGEGFMAKSMGFRNTAG  386

Query  2168  AVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQ  1989
               K QAVA R+ AD A+  NC    YQ+TLY  ++RQFY+ C ISGTVDFIFG+A  +FQ
Sbjct  387   PEKRQAVAARVQADRAIFLNCRFEGYQETLYAQTHRQFYKSCXISGTVDFIFGDAAAIFQ  446

Query  1988  KCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWK  1809
              C + VRKPL NQ   VTAQGR D+R  + IV+Q+C I+ +  L+      K +LGRPWK
Sbjct  447   NCLIYVRKPLENQQNTVTAQGRTDKRETTGIVLQNCQIMPDKDLEPVKSQFKTYLGRPWK  506

Query  1808  EFSRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT++M S I++++  +GW+PW+G+FAL T +YAEY N+GPG  TD RVKW GYK+ I
Sbjct  507   EFSRTIVMESTIEDLIHXDGWTPWEGDFALKTLYYAEYNNKGPGXKTDNRVKWDGYKK-I  565

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + E A Q+T GPFL     WL    +P   G  +
Sbjct  566   NKEEAMQYTVGPFLKG-HAWLKVEGVPVRFGLFE  598



>ref|XP_011078157.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=590

 Score =   342 bits (878),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 235/383 (61%), Gaps = 7/383 (2%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSATRH  2502
             M+ LL TS E  SNALA+V +L   LKT++     R+LL          +          
Sbjct  213   MQKLLNTSKEHGSNALAIVAELSTTLKTVQS---QRKLLGMDEAGFPAWMGHHEYRRALK  269

Query  2501  LLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNI  2322
                    P++ VA+DGSG F TI  AL ++PEK   R VI IK GVY E V++ +K  N+
Sbjct  270   ADATKFTPNVTVAKDGSGNFTTIAAALKAMPEKYTGRYVIYIKEGVYDENVIITKKMVNV  329

Query  2321  VFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVAL  2142
                G G  K++ITG++N  D  P  TY+  +    G+GF+ + L   NTAG  K QAVAL
Sbjct  330   TMYGVGSQKSIITGSKNYVDGVP--TYQTASFAAIGDGFMAQSLGFRNTAGPEKHQAVAL  387

Query  2141  RISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKP  1962
             R+ +D ++  NC +  YQD+LY  ++RQFYRGC I+GT+DFIFGNA  VFQ C + VRKP
Sbjct  388   RVQSDRSIFLNCRMEGYQDSLYAQTHRQFYRGCYITGTIDFIFGNAAAVFQNCLIYVRKP  447

Query  1961  LANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
             +ANQ  +VTAQGR D+R  + IV+Q+C I+A   LK      K +LGRPWKE+SRT+IM 
Sbjct  448   MANQQNIVTAQGRTDKRQTTGIVLQNCRILAADTLKPEKAKFKSYLGRPWKEYSRTIIME  507

Query  1781  SFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFT  1602
             + I + +  EGW  W+G+FAL T +YAE+ N+GPG+ST  RVKW GYK  I  E A +FT
Sbjct  508   TEIGDFIQAEGWMEWEGDFALKTLYYAEFNNKGPGSSTSGRVKWPGYK-TIKKEEALEFT  566

Query  1601  PGPFLMADEQWLGRAQIPFSPGF  1533
              GPFL   E W+  A +P   G 
Sbjct  567   VGPFLQG-ESWIKNADVPVRFGM  588



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   342 bits (876),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/390 (45%), Positives = 247/390 (63%), Gaps = 12/390 (3%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGI-SRRLLeeptpttdeeiPQFVDS  2514
              +KMKHLL +S+ ++SN LA+V+   + +  + +  +  R LL++    +  E    +D+
Sbjct  174   SKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRCLLQDSEIPSWVEHRILLDA  233

Query  2513  ATRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIP-EKNDRRIVILIKAGVYKEYVMVPR  2337
              T     + P+P++ VA DGSG FK+I  AL  +P E+++   VI IK GVY+EYV V +
Sbjct  234   MTNK---SKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYREYVEVLK  290

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
                +IVFVG+G  K++ITGN+N  D     TY   TV ++ + F   ++  EN+AG  K 
Sbjct  291   NMTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQEDHFTAINMGFENSAGPQKH  348

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+  D A+  NC ++ YQDTLY H+ RQFYR CTISGT+DF+FGNA  VFQ CK 
Sbjct  349   QAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKF  408

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSR  1797
             VVRKP++NQ C+VTAQGRK+    SAIVIQ   IVA+P        +K +L  PWK FSR
Sbjct  409   VVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPWKNFSR  468

Query  1796  TLIMFSFIDNIVVPEGWSPW---KGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNIS  1626
             T+IM +FID+++ P+G+ PW   +G   +DTC+Y EY N GPG+   KRVKW G   NI+
Sbjct  469   TIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGI-YNIN  527

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              + A++F P  F    + W+    IP+ P 
Sbjct  528   TKAAQKFAPSKFFHGGD-WIKDTGIPYYPN  556



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   342 bits (877),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 250/410 (61%), Gaps = 32/410 (8%)
 Frame = -2

Query  2687  EKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVDSAT  2508
             +KM+++L TSM ++SNALA+++ L + +  L +    RRL++      +       +   
Sbjct  186   KKMQNILTTSMHMSSNALAIISDLAKSVLDLNLTNNERRLIDNNNNNNNNNNNDVGEQVF  245

Query  2507  RHLLVAPP----------------------RPDIVVAQDGSGKFKTITGALNSIPEKNDR  2394
              H  V  P                      + +++VA+DGSGKFK I  AL  +P+KN +
Sbjct  246   GHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGKFKKINDALKHVPKKNKK  305

Query  2393  RIVILIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEG  2214
               VI IK GVY EYV V +K  ++VFVG+G  KT ITGN+N  D     TY+  TV + G
Sbjct  306   IFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFIDGV--NTYKTPTVAIAG  363

Query  2213  EGFICRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTIS  2034
             + F+  ++  EN+AG  K QAVA+R+ AD ++ + C ++ YQDTLY H+ RQFYR CTIS
Sbjct  364   DYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTLYAHTMRQFYRDCTIS  423

Query  2033  GTVDFIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALK  1854
             GT+DF+FG+A  +FQ C  VVRKPL NQ C+VTAQGRKD+   S IVIQ C IV++    
Sbjct  424   GTIDFVFGDAVAIFQNCTFVVRKPLENQQCIVTAQGRKDKHQPSGIVIQGCSIVSDT--H  481

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWK---GNF-ALDTCWYAEYKNR  1686
                  NK +L RPWK +SRT+ M ++I +++ P+G+ PW+   G    +DTC+Y EYKN+
Sbjct  482   NVKFDNKAYLARPWKNYSRTIFMKTYIGDLIEPDGYMPWQLPNGTLTGMDTCFYVEYKNK  541

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             GPG++  KRVKW+G K N++   A  F P  F   D+ W+   ++P+S G
Sbjct  542   GPGSNKSKRVKWRGIK-NLTSHTASVFLPYKFFHGDD-WIKVTRVPYSSG  589



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   341 bits (875),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 245/403 (61%), Gaps = 21/403 (5%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeeiPQFVD--  2517
              EKM   +K   ELT N LA+     + L   +  G  RRLL +           ++   
Sbjct  171   AEKMMEFMKLGKELTINGLALANGFSDLLLPND-HGAGRRLLADSNKMGLINKADYIGEH  229

Query  2516  -----SATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVY  2361
                  + TR LL A P   +P + VA+DGSG F TI  AL S+P   +   +I IKAGVY
Sbjct  230   WLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVPLSCNDTYIIYIKAGVY  289

Query  2360  KEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGT--YRCGTVIVEGEGFICRDLT  2187
             +E ++V     +++F+G+GP  T ITGN++      GGT  +   TV V+G+ FI +D+ 
Sbjct  290   QENIIVGTSMWSVMFIGDGPNATKITGNKSKV----GGTETFWTATVGVDGDNFIAKDIG  345

Query  2186  IENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGN  2007
              EN+AGA   QAVALR S D ++  NC ++ YQDT++ H++RQF+R CTISGT+DFIFGN
Sbjct  346   FENSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFAHNHRQFFRDCTISGTIDFIFGN  405

Query  2006  APVVFQKCKMVVRKPLANQ-ACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV  1830
             A  VFQ C ++VRKPL NQ AC+VTA+GR      SAIV+Q+C I+  P     +P  K 
Sbjct  406   ARAVFQNCTLLVRKPLENQKACLVTAEGRTTINETSAIVLQNCRILPAPEYPVNDPTYKT  465

Query  1829  FLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFA-LDTCWYAEYKNRGPGASTDKRVK  1653
             +LGRPWK +SRT+IM S +D++V PEGW+PW    A LDTCWYAE  N+GPGA   +RV 
Sbjct  466   YLGRPWKPYSRTVIMDSHLDSLVDPEGWAPWNVTSAHLDTCWYAELNNKGPGADLSRRVA  525

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             W G K+ I+   A  FTPG F++ D  W+    IP+  G + P
Sbjct  526   WPGIKK-ITVNEADDFTPGQFMVGD-SWIAGKGIPYDSGLILP  566



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   342 bits (877),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 241/391 (62%), Gaps = 10/391 (3%)
 Frame = -2

Query  2681  MKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGISRRLLeeptpttdeei---PQFVDSA  2511
             M   +K + +LTSN+LA++T+    L  L++PG SRRLL +    ++ +      F    
Sbjct  204   MAEAMKMATQLTSNSLAIITEASSVLSILKVPGFSRRLLSKENHFSEGKGGFPSWFPAGE  263

Query  2510  TRHLLVAPPRPDIVVAQDGSGKFKTITGALNSIPEKNDR--RIVILIKAGVYKEYVMVPR  2337
              R L +    P++ VA+DGSG F+TIT AL+ +P   +R  R VI IKAGVY E V V +
Sbjct  264   RRLLAMQEMTPNVAVAKDGSGDFRTITEALSKLPPAKERNGRYVIYIKAGVYDEQVTVTK  323

Query  2336  KKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKE  2157
             +  N+   G+G  KT+ITG++N  D  P  T++  T    G+ F+ + +   NTAGA K 
Sbjct  324   EMVNVTMYGDGSRKTIITGSKNFIDGTP--TFKTATFAAIGDDFMAKAIGFRNTAGAAKH  381

Query  2156  QAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKM  1977
             QAVALR+ +D AV  NC ++  QDTLY H++RQ+YR C I+GT+DFIFGNA  VFQ C++
Sbjct  382   QAVALRVQSDRAVFLNCRMDGNQDTLYAHAHRQYYRSCVITGTIDFIFGNAAAVFQNCQI  441

Query  1976  VVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKV--FLGRPWKEF  1803
             VVR+PL NQ  ++TAQGR D+R  + +VI  C I+ +  L A +   K   +LGRPWK++
Sbjct  442   VVRQPLPNQQNIITAQGRTDKRETTGVVIHKCKILPDKKLVAGSSTAKTRSYLGRPWKQY  501

Query  1802  SRTLIMFSFIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M S I   + PEGW PW G+FALDT +Y EY N+GPGA+  KRV WKGY+   S 
Sbjct  502   SRTVYMESTIGGFIEPEGWMPWDGDFALDTLFYGEYMNQGPGATLTKRVNWKGYRVLKSK  561

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E A  FT   F+   E W+         GF 
Sbjct  562   EEAMAFTVDKFIQGGE-WIKATGTAVRLGFF  591



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   342 bits (876),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 238/382 (62%), Gaps = 14/382 (4%)
 Frame = -2

Query  2654  ELTSNALAMVTKLD-----EFLKTLEIPGIS--RRLLeeptpttdeeiPQFVDSATRHLL  2496
              + SNALAM   +      EF +T  + G +  R+LLEE          +++ +  R LL
Sbjct  214   HMCSNALAMTKNMTDKDIAEFEQTNMVLGSNKNRKLLEEENGVGWP---EWISAGDRRLL  270

Query  2495  VAPP-RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVILIKAGVYKEYVMVPRKKNNIV  2319
                  + D+VVA DGSG FKT++ A+ + P K+ +R VI IKAGVYKE V VP+KK NI+
Sbjct  271   QGSTVKADVVVAADGSGNFKTVSEAVAAAPLKSSKRYVIKIKAGVYKENVEVPKKKTNIM  330

Query  2318  FVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFICRDLTIENTAGAVKEQAVALR  2139
             F+G+G T T+ITG+RNV D     T+   TV + G  F+ RD+T +NTAG  K QAVALR
Sbjct  331   FLGDGRTNTIITGSRNVVD--GSTTFHSATVAIVGGNFLARDITFQNTAGPAKHQAVALR  388

Query  2138  ISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVDFIFGNAPVVFQKCKMVVRKPL  1959
             + AD++  +NC + AYQDTLY H+ RQF+  C ISGTVDFIFGN+ VVFQ C +  R+P 
Sbjct  389   VGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNSAVVFQNCDIHARRPN  448

Query  1958  ANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANPPNKVFLGRPWKEFSRTLIMFS  1779
             + Q  MVTAQGR D    + IVIQ C I A   L+        +LGRPWKE+SRT+ M S
Sbjct  449   SGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTYLGRPWKEYSRTVFMQS  508

Query  1778  FIDNIVVPEGWSPWKGNFALDTCWYAEYKNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              I +++ P GW  W GNFAL+T  Y EY+N GPGA T KRV WKG+K   S   A+ FTP
Sbjct  509   SISDVIDPVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWKGFKVITSAAEAQSFTP  568

Query  1598  GPFLMADEQWLGRAQIPFSPGF  1533
             G F+     WLG    PFS G 
Sbjct  569   GNFI-GGSSWLGSTGFPFSLGL  589



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   341 bits (874),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 178/409 (44%), Positives = 250/409 (61%), Gaps = 27/409 (7%)
 Frame = -2

Query  2690  GEKMKHLLKTSMELTSNALAMVTKLDEFLKTLEIPGIS---RRLLeeptpttdeeiPQFV  2520
             G KMK+LLK++M ++SNALA++++L + +  + +       R+L+E+          + +
Sbjct  163   GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVI  222

Query  2519  DS-----------ATRHLLVAPP---RPDIVVAQDGSGKFKTITGALNSIPEKNDRRIVI  2382
              S             R LL       +P++VVA+DGSGK+K+I  AL  +PEKN +  VI
Sbjct  223   PSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVI  282

Query  2381  LIKAGVYKEYVMVPRKKNNIVFVGEGPTKTVITGNRNVADKWPGGTYRCGTVIVEGEGFI  2202
              IK GVY EYV V +K  ++VFVG+G  KT ITGN+N  D     TYR  +V VEG+ F+
Sbjct  283   YIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGL--NTYRTASVAVEGDYFV  340

Query  2201  CRDLTIENTAGAVKEQAVALRISADMAVVHNCHLNAYQDTLYTHSYRQFYRGCTISGTVD  2022
               ++  EN+AG  K QAVA+R+ AD ++ + C ++ YQDTLY H+ RQFYR CTISGTVD
Sbjct  341   AVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTVD  400

Query  2021  FIFGNAPVVFQKCKMVVRKPLANQACMVTAQGRKDRRGASAIVIQSCDIVAEPALKAANP  1842
             F+FG+A  VFQ C  VVRK L NQ C+VTAQGRK+R   S  VIQ   IV+       N 
Sbjct  401   FVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HTENL  457

Query  1841  PNKVFLGRPWKEFSRTLIMFSFIDNIVVPEGWSPWKGNFAL---DTCWYAEYKNRGPGAS  1671
              NK +L RPWK  SRT+ M ++I+ ++ PEG+ PW+G   L   D C+YAEY N GPG++
Sbjct  458   DNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNNTGPGSN  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               KRVKW+G    ++ E   +++P  F   D+ W+   +IP+      P
Sbjct  518   KSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVTAP  564



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8517767614092