BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i5 len=2721 path=[31329:0-343 25007:344-369 25033:370-1432
26095:1433-1533 26196:1534-1593 15876:1594-1669 4649:1670-1693
49376:1694-1707 49390:1708-1711 49394:1712-1712 49395:1713-1717
26373:1718-1741 26397:1742-1767 26423:1768-1780 49435:1781-1783
49438:1784-1872 26525:1873-1903 14258:1904-1913 26565:1914-1946
26598:1947-1985 26637:1986-1997 26649:1998-2009 2887:2010-2033
49607:2034-2045 44719:2046-2054 2932:2055-2068 49666:2069-2092
40300:2093-2118 16884:2119-2146 40352:2147-2176 15983:2177-2202
40407:2203-2264 40467:2265-2274 40477:2275-2298 40501:2299-2319
40522:2320-2343 40546:2344-2344 40547:2345-2397 40599:2398-2442
9182:2443-2448 40649:2449-2478 40678:2479-2515 50076:2516-2519
40718:2520-2653 40852:2654-2657 12548:2658-2720]

Length=2721
                                                                      Score     E

ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     469   7e-151   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          468   1e-150   
emb|CDO98832.1|  unnamed protein product                                468   1e-150   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     466   4e-150   
emb|CDO98833.1|  unnamed protein product                                458   4e-147   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     457   8e-147   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    454   4e-145   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     446   4e-142   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     446   4e-142   
emb|CDO98834.1|  unnamed protein product                                434   2e-137   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 431   5e-136   Ricinus communis
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    419   1e-131   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     416   8e-131   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     411   1e-128   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     410   2e-128   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     409   6e-128   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          409   8e-128   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     408   3e-127   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     407   3e-127   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     406   8e-127   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                405   2e-126   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    408   7e-126   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     402   2e-125   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    402   3e-125   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    402   3e-125   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         402   4e-125   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    400   3e-124   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    400   3e-124   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    399   4e-124   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                399   5e-124   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                399   6e-124   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    399   7e-124   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    399   1e-123   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    391   1e-123   Petunia integrifolia [violet-flowered petunia]
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    399   1e-123   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    397   2e-123   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     397   4e-123   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    399   1e-122   
emb|CBI39537.3|  unnamed protein product                                401   3e-122   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    394   5e-122   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    393   2e-121   
gb|EPS59322.1|  pectinesterase                                          391   2e-121   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    391   7e-121   
ref|XP_006382447.1|  pectin methylesterase family protein               391   7e-121   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             389   2e-120   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    389   5e-120   
gb|EPS72184.1|  pectinesterase family protein                           387   9e-120   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             392   1e-119   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             387   1e-119   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    387   2e-119   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     388   2e-119   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    389   2e-119   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    390   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314364.1|  putative pectinesterase family protein             386   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_002884519.1|  pectinesterase family protein                      389   5e-119   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     385   5e-119   
gb|EPS70728.1|  pectinesterase                                          385   7e-119   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                397   8e-119   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    388   9e-119   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    387   9e-119   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    385   1e-118   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    387   1e-118   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     384   2e-118   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             386   2e-118   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     383   3e-118   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    384   3e-118   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    386   4e-118   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     382   6e-118   
emb|CDY19737.1|  BnaA09g03900D                                          381   7e-118   
dbj|BAC42986.1|  putative pectinesterase                                386   8e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    383   9e-118   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    382   1e-117   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    386   1e-117   
ref|XP_002872255.1|  pectinesterase family protein                      384   1e-117   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     381   2e-117   
ref|XP_002865716.1|  pectinesterase family protein                      382   2e-117   
emb|CDY05188.1|  BnaC05g46150D                                          382   3e-117   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     384   4e-117   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     380   5e-117   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             380   6e-117   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             380   1e-116   
emb|CDY27751.1|  BnaA05g31600D                                          381   1e-116   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    380   2e-116   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    380   2e-116   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                379   2e-116   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                379   2e-116   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    383   5e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99968.1|  BnaC09g03330D                                          381   5e-116   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    378   6e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     377   6e-116   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    378   1e-115   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    377   1e-115   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     376   2e-115   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    377   2e-115   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    376   4e-115   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 376   4e-115   Ricinus communis
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             380   8e-115   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             375   8e-115   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          375   1e-114   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    374   2e-114   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          375   2e-114   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             375   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_007031044.1|  Pectinesterase, putative                           375   4e-114   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    376   4e-114   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    373   5e-114   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    376   6e-114   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             372   9e-114   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          372   9e-114   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     371   1e-113   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    375   1e-113   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          373   1e-113   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                375   1e-113   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    380   2e-113   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    375   2e-113   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    371   3e-113   
gb|AEL79481.1|  pectin methylesterase-like protein                      370   3e-113   
emb|CDP21547.1|  unnamed protein product                                374   3e-113   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    370   5e-113   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    369   1e-112   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         368   2e-112   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    373   3e-112   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             372   3e-112   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    367   4e-112   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    372   4e-112   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    367   4e-112   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                367   4e-112   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    373   5e-112   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         367   8e-112   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    366   8e-112   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             367   9e-112   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    374   9e-112   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          370   1e-111   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    365   1e-111   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    366   1e-111   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    367   2e-111   
gb|EPS69059.1|  hypothetical protein M569_05708                         382   2e-111   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             365   3e-111   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    365   3e-111   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     364   4e-111   
emb|CDX74137.1|  BnaA03g29100D                                          369   6e-111   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    365   1e-110   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    364   2e-110   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    363   2e-110   
emb|CBI22967.3|  unnamed protein product                                380   2e-110   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    362   3e-110   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    362   4e-110   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     358   4e-110   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    362   4e-110   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          362   5e-110   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    362   6e-110   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    365   7e-110   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    362   1e-109   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    360   2e-109   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             360   2e-109   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    364   2e-109   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    364   3e-109   
ref|XP_003591168.1|  Pectinesterase                                     360   3e-109   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     360   3e-109   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    360   3e-109   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     359   6e-109   
emb|CDX80613.1|  BnaC07g28310D                                          362   7e-109   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    363   7e-109   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     359   8e-109   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             358   8e-109   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     353   8e-109   
ref|XP_003591164.1|  Pectinesterase                                     359   1e-108   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    358   1e-108   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    358   2e-108   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    358   2e-108   
emb|CDY68790.1|  BnaAnng28400D                                          362   2e-108   
emb|CDY57858.1|  BnaC08g47740D                                          354   3e-108   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     354   3e-108   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    358   3e-108   
ref|XP_003591166.1|  Pectinesterase                                     358   3e-108   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    357   4e-108   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    357   5e-108   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    357   6e-108   
emb|CDY33925.1|  BnaA02g30620D                                          357   6e-108   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    356   9e-108   
ref|XP_003604119.1|  Pectinesterase                                     357   2e-107   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    348   3e-107   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    355   4e-107   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    354   6e-107   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             353   2e-106   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 353   2e-106   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             352   3e-106   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    351   7e-106   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    350   9e-106   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    350   1e-105   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    350   1e-105   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42959.2|  putative pectin methylesterase                         350   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             346   2e-105   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     350   2e-105   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 350   3e-105   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    360   3e-105   
emb|CDY24663.1|  BnaA05g30620D                                          349   3e-105   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             349   4e-105   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    349   5e-105   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     348   6e-105   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    348   8e-105   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    348   8e-105   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    341   8e-105   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    348   1e-104   
ref|XP_002882495.1|  pectinesterase family protein                      348   1e-104   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     348   1e-104   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    348   1e-104   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    348   2e-104   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   348   2e-104   
ref|XP_003626199.1|  Pectinesterase                                     348   2e-104   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     347   2e-104   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    347   3e-104   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    348   3e-104   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 347   3e-104   
gb|AAF63815.1|  pectin methylesterase, putative                         346   5e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71928.1|  BnaCnng75130D                                          339   7e-104   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             346   7e-104   
ref|NP_001049858.1|  Os03g0300500                                       345   9e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265171.1|  PREDICTED: pectinesterase                          347   9e-104   Vitis vinifera
ref|XP_003604120.1|  Pectinesterase                                     347   1e-103   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             346   1e-103   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    345   1e-103   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     344   3e-103   
gb|ABZ89800.1|  pectin methylesterase-like protein                      344   4e-103   Taiwania cryptomerioides
emb|CDY34927.1|  BnaA01g32580D                                          343   5e-103   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    344   5e-103   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          343   8e-103   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             346   1e-102   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    343   1e-102   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    342   1e-102   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     342   1e-102   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    342   2e-102   
emb|CDY05295.1|  BnaC05g45080D                                          341   3e-102   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          341   4e-102   Sorghum bicolor [broomcorn]
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    342   4e-102   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     340   6e-102   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    341   6e-102   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     340   6e-102   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     340   7e-102   
gb|AFI23411.1|  pectin methylesterase                                   341   7e-102   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          342   9e-102   Sorghum bicolor [broomcorn]
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     340   9e-102   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 340   1e-101   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          340   1e-101   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    335   1e-101   Medicago sativa [alfalfa]
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    340   1e-101   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    339   2e-101   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    340   2e-101   
ref|XP_003627458.1|  Pectinesterase                                     339   3e-101   
ref|XP_007012506.1|  Pectinesterase                                     339   4e-101   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    342   4e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AGT17860.1|  pollen-specific pectin methylesterase                   339   4e-101   
gb|AFB77929.1|  pectin methylesterase                                   339   4e-101   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    338   4e-101   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               338   4e-101   Ricinus communis
emb|CBI27741.3|  unnamed protein product                                331   4e-101   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    339   5e-101   
emb|CDY66111.1|  BnaAnng21510D                                          343   5e-101   
ref|XP_002324181.2|  pectinesterase family protein                      339   6e-101   Populus trichocarpa [western balsam poplar]
gb|EPS66234.1|  hypothetical protein M569_08543                         339   6e-101   
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...    343   8e-101   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    337   8e-101   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     338   9e-101   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    338   9e-101   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    338   1e-100   
gb|AFW03475.1|  pectin methylesterase 1                                 337   1e-100   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    338   1e-100   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             341   2e-100   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     337   2e-100   
dbj|BAK06954.1|  predicted protein                                      337   2e-100   
gb|KHG08631.1|  Pectinesterase 3                                        337   2e-100   
ref|XP_002868170.1|  predicted protein                                  341   2e-100   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             341   2e-100   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             340   2e-100   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    337   2e-100   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     337   3e-100   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     337   3e-100   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    337   3e-100   Citrus sinensis [apfelsine]
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             341   3e-100   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    337   3e-100   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                336   4e-100   
gb|EPS65387.1|  pectinesterase                                          335   5e-100   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              335   5e-100   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          335   5e-100   
gb|AFW03480.1|  pectin methylesterase 1                                 336   5e-100   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    337   6e-100   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    335   6e-100   
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    337   7e-100   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     335   7e-100   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    335   7e-100   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    336   7e-100   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     329   9e-100   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     335   1e-99    
ref|XP_010687597.1|  PREDICTED: pectinesterase                          335   1e-99    
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     334   1e-99    
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             335   1e-99    
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    335   2e-99    
gb|ACN40984.1|  unknown                                                 335   2e-99    
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    335   2e-99    
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             334   2e-99    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          334   3e-99    
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    334   3e-99    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     334   3e-99    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                334   4e-99    
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             333   5e-99    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     333   5e-99    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   327   6e-99    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    333   6e-99    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    332   7e-99    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     329   8e-99    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  333   8e-99    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             332   8e-99    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         333   8e-99    
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     333   9e-99    
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    329   1e-98    
ref|NP_001042866.1|  Os01g0312500                                       327   2e-98    
ref|NP_001275859.1|  pectinesterase 1 precursor                         332   2e-98    
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    330   2e-98    
emb|CDP19930.1|  unnamed protein product                                332   2e-98    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     331   2e-98    
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     332   2e-98    
dbj|BAK05856.1|  predicted protein                                      332   2e-98    
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          331   3e-98    
ref|XP_002304257.2|  pectinesterase family protein                      331   3e-98    
ref|XP_002275000.1|  PREDICTED: pectinesterase                          331   3e-98    
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 330   3e-98    
gb|ACF79975.1|  unknown                                                 330   3e-98    
emb|CAC01624.1|  putative pectin methylesterase                         331   3e-98    
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               330   3e-98    
emb|CBI26012.3|  unnamed protein product                                331   4e-98    
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             330   4e-98    
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     330   4e-98    
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     330   4e-98    
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              323   4e-98    
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 330   4e-98    
gb|AAL24278.1|  AT3g14310/MLN21_9                                       324   5e-98    
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              330   5e-98    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             330   5e-98    
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    331   6e-98    
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     330   6e-98    
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    330   7e-98    
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    331   7e-98    
gb|AFQ23194.1|  pectin methylesterase                                   330   7e-98    
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    330   8e-98    
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    329   9e-98    
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     330   1e-97    
dbj|BAA89480.1|  pectin methylesterase                                  330   1e-97    
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               330   1e-97    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     330   1e-97    
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             328   1e-97    
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          329   1e-97    
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             335   1e-97    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     330   1e-97    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     329   1e-97    
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    330   2e-97    
gb|EAY94391.1|  hypothetical protein OsI_16158                          328   2e-97    
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     328   2e-97    
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     328   2e-97    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            327   3e-97    
gb|EPS64331.1|  pectinesterase                                          327   3e-97    
gb|EAY94388.1|  hypothetical protein OsI_16156                          328   3e-97    
ref|NP_001052981.1|  Os04g0458900                                       328   3e-97    
gb|EPS69324.1|  hypothetical protein M569_05439                         328   4e-97    
emb|CDO99718.1|  unnamed protein product                                327   4e-97    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    327   5e-97    
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             328   5e-97    
emb|CAB65291.1|  pectin methyl-esterase PEF1                            327   5e-97    
emb|CAA96435.1|  pectin methylesterase                                  319   5e-97    
emb|CAH67075.1|  OSIGBa0097P08.5                                        327   5e-97    
gb|EPS62329.1|  pectinesterase                                          327   6e-97    
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             327   6e-97    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             327   7e-97    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    327   7e-97    
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    327   7e-97    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             327   7e-97    
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     327   7e-97    
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    327   7e-97    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          326   8e-97    
emb|CAA96434.1|  pectin methylesterase                                  318   8e-97    
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     327   9e-97    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                327   9e-97    
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 329   9e-97    
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    324   9e-97    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    326   1e-96    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   322   1e-96    
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          327   1e-96    
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             327   1e-96    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          326   1e-96    
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    327   2e-96    
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     327   2e-96    
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     326   2e-96    
gb|AHB84678.1|  pectin methylesterase                                   326   2e-96    
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    326   2e-96    
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             326   2e-96    
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                323   2e-96    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    327   2e-96    
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    326   2e-96    
ref|NP_001274969.1|  pectin methyl esterase                             326   2e-96    
gb|EAZ09211.1|  hypothetical protein OsI_31486                          320   2e-96    
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    325   3e-96    
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    326   3e-96    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     322   4e-96    
emb|CAB65290.2|  pectin methyl-esterase PER                             326   5e-96    
emb|CDY34642.1|  BnaC08g42010D                                          321   5e-96    
gb|EEC70505.1|  hypothetical protein OsI_01594                          325   5e-96    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 322   5e-96    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          325   5e-96    
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    326   5e-96    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   324   5e-96    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   5e-96    
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             325   6e-96    
emb|CAB95025.1|  pectin methylesterase                                  325   6e-96    
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    325   6e-96    
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  316   6e-96    
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    316   7e-96    
ref|NP_188048.1|  pectin methylesterase 3                               325   7e-96    
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   7e-96    
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    323   7e-96    
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     324   8e-96    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     323   8e-96    
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          324   8e-96    
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     323   9e-96    
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    324   1e-95    
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 325   1e-95    
gb|EPS74082.1|  hypothetical protein M569_00674                         322   1e-95    
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             324   1e-95    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     323   1e-95    
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     323   1e-95    
dbj|BAD95369.1|  pectin methylesterase like protein                     317   1e-95    
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    325   1e-95    
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    323   1e-95    
emb|CDX97564.1|  BnaA05g25150D                                          324   2e-95    
gb|ABJ99595.1|  pectinesterase inhibitor                                324   2e-95    
gb|ABQ42392.1|  pectin methylesterase-like protein                      324   2e-95    
ref|XP_011093901.1|  PREDICTED: probable pectinesterase/pectinest...    322   2e-95    
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    323   2e-95    
emb|CDY51798.1|  BnaC06g41940D                                          323   2e-95    
dbj|BAF42038.1|  pectin methylesterase 1                                325   2e-95    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          323   2e-95    
gb|ACQ85264.1|  pectin methylesterase                                   323   2e-95    
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             323   2e-95    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    323   2e-95    
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         322   2e-95    
gb|ABK94644.1|  unknown                                                 315   2e-95    
gb|AAO85706.1|  pectin methyl-esterase                                  323   2e-95    
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    323   2e-95    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     323   3e-95    
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     323   3e-95    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     322   3e-95    
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     322   3e-95    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     322   3e-95    
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    324   3e-95    
ref|XP_010656075.1|  PREDICTED: probable pectinesterase/pectinest...    322   3e-95    
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             322   3e-95    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    323   3e-95    
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     323   4e-95    
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    322   4e-95    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    323   4e-95    
emb|CAC18727.1|  putative pectin methylesterase                         321   4e-95    
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               323   4e-95    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     322   4e-95    
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         318   4e-95    
gb|AGG23325.1|  pectin methylesterase 1                                 322   4e-95    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    322   4e-95    
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    324   5e-95    
ref|XP_002516192.1|  Pectinesterase PPE8B precursor, putative           321   5e-95    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    322   5e-95    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     322   5e-95    
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    322   5e-95    
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                322   5e-95    
ref|XP_003591319.1|  Pectinesterase                                     322   5e-95    
ref|XP_010422610.1|  PREDICTED: probable pectinesterase/pectinest...    320   6e-95    
gb|AFC98398.1|  pectin methylesterase                                   322   6e-95    
gb|AAC72288.1|  putative pectin methylesterase                          323   6e-95    
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     321   6e-95    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     320   6e-95    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          321   6e-95    
tpg|DAA64233.1|  TPA: pectinesterase                                    322   7e-95    
emb|CDY02461.1|  BnaA08g00680D                                          314   7e-95    
ref|XP_002982529.1|  hypothetical protein SELMODRAFT_116557             316   8e-95    
ref|XP_002981054.1|  hypothetical protein SELMODRAFT_114014             316   8e-95    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   322   8e-95    
emb|CDY33229.1|  BnaC01g37020D                                          322   8e-95    
ref|XP_002885033.1|  ATPME3                                             322   9e-95    
ref|XP_002889876.1|  At1g11580/T23J18_33                                321   1e-94    
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             321   1e-94    
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     321   1e-94    
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       322   1e-94    
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    322   1e-94    
emb|CDY08206.1|  BnaA05g14130D                                          322   1e-94    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     320   1e-94    
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               320   1e-94    
ref|NP_172624.1|  methylesterase PCR A                                  320   2e-94    
ref|NP_192141.1|  probable pectinesterase/pectinesterase inhibito...    319   2e-94    
gb|AAQ21124.1|  pectinesterase                                          319   2e-94    
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        322   2e-94    
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            320   2e-94    
ref|XP_011000694.1|  PREDICTED: pectinesterase                          320   2e-94    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             320   2e-94    
emb|CAC18726.1|  putative pectin methylesterase                         320   2e-94    
gb|AAK59760.1|  At1g11580/T23J18_33                                     320   2e-94    



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   469 bits (1206),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/395 (58%), Positives = 284/395 (72%), Gaps = 20/395 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLKT+ ELTSN LA+V+   + + +L +PG+SRRLL               +TD
Sbjct  181   GEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGISRRLL---------------TTD  225

Query  2540  -EILSPFADPATRHLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              E  S F +  +R LL  +  K + VVAQDGSG+YK+I  AL ++P  NN+  VILIKAG
Sbjct  226   SEYTSAFVEAGSRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAG  285

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
              YKE V IP    N+ F+GEGPTKT ITGN+N  D    GTY   TV V G+GF+ RD+ 
Sbjct  286   EYKEMVDIPRSITNVVFIGEGPTKTKITGNKNFAD--GTGTYHTATVAVNGDGFVARDIG  343

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA KHQAVALR+SAD    YNC+++ YQDTLYTHSYRQFY+DCTI+GT+DFIFG+
Sbjct  344   FENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGD  403

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A VVFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  +A PP K +
Sbjct  404   ASVVFQNCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAY  463

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+I+ ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ DKRVKW 
Sbjct  464   LGRPWKEYSRTIIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWG  523

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             GYKRNISP+ A+++ P  F+  D  W+ +  I ++
Sbjct  524   GYKRNISPQEAEKYAPAHFIDQD-NWIKKTGISYA  557



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   468 bits (1204),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 281/394 (71%), Gaps = 20/394 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLKT+ ELTSN LA+VS   + + +L IPG+SRRLL               +TD
Sbjct  181   GEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGISRRLL---------------TTD  225

Query  2540  -EILSPFADPATRHLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              E  S F +  +R LL  +  K + VVAQDGSG+YK+I  AL ++P  NN+  VILIKAG
Sbjct  226   SEYTSAFVEAGSRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAG  285

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
              YKE V IP    N+ F+GEGPTKT ITGN+N  D    GTY   TV V G+GF+ RD+ 
Sbjct  286   EYKEMVDIPRSMINVVFIGEGPTKTKITGNKNFAD--GTGTYHTATVAVNGDGFVARDIG  343

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA KHQAVALR+SAD    YNC+++ YQDTLYTHSYRQFY+DCTI+GT+DFIFG+
Sbjct  344   FENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGD  403

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  +  PP K +
Sbjct  404   ASAVFQNCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAY  463

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ DKRVKW 
Sbjct  464   LGRPWKEYSRTIIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWG  523

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             GYKRNISP+ A+++ P  F+  D  W+ +  I +
Sbjct  524   GYKRNISPQEAEKYAPAHFIDQD-NWIKKTGISY  556



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   468 bits (1205),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 284/399 (71%), Gaps = 23/399 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE+MK LLKT+ ELTSN LA+V+ + + + +  I G  RRL+                + 
Sbjct  181   GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLM----------------SS  224

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
              +   F D   R L+AA     K + VVAQDGSG++KSI AA+N++P  NN+  VI IKA
Sbjct  225   SVEPDFVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKA  284

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKEYV +P   N I  VGEGPTKT ITGN+N  D    GT++  T+ V G+  I +DL
Sbjct  285   GIYKEYVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGV--GTFQTPTLSVNGDATILKDL  342

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAGAVKHQAVALR+S D   VYNC ++AYQDTLYTH+YRQ+YR+CTISGT+DFIFG
Sbjct  343   GIENSAGAVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFG  402

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQ+CKM+VRKPM NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K 
Sbjct  403   DASAVFQDCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKA  462

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+W
Sbjct  463   YLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQW  522

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             KG K+ I+P++A+ FTPG ++  D  W+  + +P++PG 
Sbjct  523   KGIKK-ITPQIAQSFTPGAYIQGDA-WITASGVPYAPGM  559



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   466 bits (1200),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 279/398 (70%), Gaps = 29/398 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLK + ELTSN LA+VS   + + +L IPG++RRLL+                 
Sbjct  177   GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLLD-----------------  219

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                      A   +L+   K ++VVA DGSG+YKSIN ALN++P +N +R VI IKAGVY
Sbjct  220   ---------AHERMLSDSLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVY  270

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              E+V IP K NNI F+GEGPTKT ITG+ N  D    GT++  T  V G+ F+ +D+  E
Sbjct  271   NEHVEIPRKMNNIVFIGEGPTKTKITGSLNYADG--TGTFKTATFAVNGDYFMAKDIGFE  328

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AG VKHQAVALR+S DMA  +NC ++ YQDTLY HSYRQF+RDCTI+GT+DFIFG+A 
Sbjct  329   NTAGPVKHQAVALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAA  388

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKPM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LG
Sbjct  389   AVFQNCKMIVRKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLG  448

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKEFSRT+IM + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY
Sbjct  449   RPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGY  508

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             ++ I+P+VA QFTPG F+M DE W+  + +P+ PG ++
Sbjct  509   QKTIAPQVAAQFTPGVFIMGDE-WVKLSGVPYEPGMIR  545



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   458 bits (1179),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 221/399 (55%), Positives = 280/399 (70%), Gaps = 23/399 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE+MK LLKT+ ELTSN LA+V+ + + + +  I G  RRL+                + 
Sbjct  165   GEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLM----------------SS  208

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
              +   F D   R L+AA     K + VVAQDGSG++KSI AA+N++P  NN+  VI IKA
Sbjct  209   SVEPDFVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKA  268

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKEYV +P   N I  VGEGPTKT ITGN+N  D    GT++  T+ V G+  I +DL
Sbjct  269   GIYKEYVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGV--GTFQTPTLSVNGDATILKDL  326

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAGAVKHQAVALR+S D   VYNC ++AYQDTLYTH+YRQ+YR+CTISGT+DFIFG
Sbjct  327   GIENSAGAVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFG  386

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   VFQ CKM+VRKPM NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K 
Sbjct  387   DGSAVFQGCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKA  446

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+W
Sbjct  447   YLGRPWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQW  506

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             KG K+ I+P++A+ FTPG ++  D  W+  + + ++ G 
Sbjct  507   KGIKK-ITPQIAQSFTPGAYIQGDA-WITASGVTYASGM  543



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   457 bits (1177),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 220/398 (55%), Positives = 277/398 (70%), Gaps = 29/398 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLK + ELTSN LA+VS   + + +L IPG++RRLL+                 
Sbjct  177   GEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLLD-----------------  219

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                      A   +L+   K +++VA DGSG+YKSIN ALN++P  N ++ VI IKAGVY
Sbjct  220   ---------AHERMLSDSLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVY  270

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              E+V IP K NNI F+GEGPTKT ITG+ N  D    GT++  T  V G+ F+ +D+  E
Sbjct  271   NEHVEIPRKMNNIIFIGEGPTKTKITGSLNYADG--TGTFKTATFAVNGDYFMAKDIGFE  328

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AG VKHQAVALR+S DMA  +NC ++ YQDTLY HSYRQF+RDCTI+GT+DFIFG+A 
Sbjct  329   NTAGPVKHQAVALRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAA  388

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC+MIVRKPM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LG
Sbjct  389   AVFQNCQMIVRKPMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLG  448

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKEFSRT+IM + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY
Sbjct  449   RPWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGY  508

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             ++ I+P+VA QFTP  F+M DE W+  + +P+ PG ++
Sbjct  509   QKTIAPQVAAQFTPAVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   454 bits (1167),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 275/392 (70%), Gaps = 19/392 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLKT+ ELTSN LA+++   D + S+ IPG+SRRLL                 +
Sbjct  180   GEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGISRRLL----------------AN  223

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
             +  S   D + R L  +  K + VVA DGSG++K+I  AL  +P  N +  VILIKAG Y
Sbjct  224   DYTSFVEDGSRRLLQVSSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEY  283

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             KE V +P    N+ F+GEGPTKT ITGN+N  D     T+   TV V G+GF+ RD+  E
Sbjct  284   KEIVDVPRGVTNVVFIGEGPTKTKITGNKNYADG--TATFHTATVAVNGDGFVARDIGFE  341

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA+KHQAVALR+SAD A  YNC+++ YQDTLYTHSYRQFY+DC+ISGT+DFIFG+A 
Sbjct  342   NTAGAMKHQAVALRVSADKAVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDAS  401

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVL++CEI AEPA  +  PP K +LG
Sbjct  402   AVFQNCKMIVRKPGNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLG  461

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKE+SRT+IM T ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TDKRVKW GY
Sbjct  462   RPWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGY  521

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             KRNISP+ A+++ P  F+  D  W+ +  I +
Sbjct  522   KRNISPQEAEKYAPNIFIDQD-SWIKKTGISY  552



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   446 bits (1147),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 214/400 (54%), Positives = 280/400 (70%), Gaps = 27/400 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIK--SLEIPGLSRRLLEEPAPLKDDHGNPVDS  2547
             GEKM+ LLK + ELTSN+LA+VS     +   +L+IPG++RRLL     +     N V+S
Sbjct  179   GEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVNRRLLNAHERML----NEVNS  234

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                                  K ++VVA DGSG+YKSIN AL ++P  N ++ VI IKAG
Sbjct  235   N------------------GLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAG  276

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKEY+ IP K N+I F+GEGPTKT ITGN+N  D    GT++  TV + G+ F+ +D+ 
Sbjct  277   IYKEYIDIPKKMNHIVFIGEGPTKTKITGNKNFADGI--GTFQTATVAINGDNFMAKDIG  334

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AGA+KHQAVALR+S D A  +NC  + YQDTLY H+YRQF+RDCTI+GT+DFIFG+
Sbjct  335   IENTAGAIKHQAVALRVSGDKAIFHNCQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGD  394

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQ+CKMIVRKPMANQ CMVTAQGRKDRRG  AIV+Q+CEI AE    +  P  K +
Sbjct  395   ASSVFQSCKMIVRKPMANQACMVTAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAY  454

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKEFSRT+IM + ID  + P+GWS+W G   L T +YAEY+NRG GA+++ RV W+
Sbjct  455   LGRPWKEFSRTIIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWR  514

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             GYK+NI  E+A  F PG F++ADE W+  + +P+  G ++
Sbjct  515   GYKKNIGKEIAAGFAPGVFILADE-WVRLSGVPYESGLMK  553



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   446 bits (1146),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 274/392 (70%), Gaps = 19/392 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLKT+ ELTSN LA+++   D + ++ IPG+SRRLL                 D
Sbjct  176   GEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGISRRLL----------------AD  219

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
             +  S   D + R L  +  K + VVA DGSG++K+I  AL  +P  N +  VILIKAG Y
Sbjct  220   DYTSFVEDGSRRLLQVSNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEY  279

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             KE V IP    N+ F+GEGPTKT ITGN+N  D     T+   TV V G+GF+ +D+  E
Sbjct  280   KEMVDIPRGVTNVVFIGEGPTKTKITGNKNYADGT--ATFHTSTVAVNGDGFVAKDIGFE  337

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA+KHQAVALR+SAD    YNC+++ YQDTLYTHSYRQFY+DC+ISGT+DFIFG+A 
Sbjct  338   NTAGAMKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDAS  397

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP ANQ CMVTAQGRKD RG  AI+L++CEI AEPA     PP K +LG
Sbjct  398   AVFQNCKMIVRKPGANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLG  457

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKE+SRT+IM + ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TD+RVKW GY
Sbjct  458   RPWKEYSRTIIMQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGY  517

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             K++ISP+ A+++ P  F+  D  W+ +  I +
Sbjct  518   KKSISPQEAEKYAPNIFIDQDS-WIKKTGISY  548



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   434 bits (1116),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 278/401 (69%), Gaps = 22/401 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK L++T+++L+SN LAIV+   + + +L IPGLSRRLL      K D  N V+   
Sbjct  184   GEKMKQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLSRRLLS-AEKRKLDEENFVE---  239

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                        R LL   P   K + ++AQDGSG +K+I  A+N++P  N    VILIKA
Sbjct  240   -----------RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKA  288

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE ++IP + NN+  +GEGP  T IT N+N  D    GT+   TV + G+G I RD+
Sbjct  289   GVYKEVILIPRRINNVVIMGEGPNVTKITANKNYVDGI--GTFHTATVAINGDGCILRDI  346

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAG  KHQAVALR+S D   VYNC ++ YQDTLY+H+YRQFYRD TISGT+DFIFG
Sbjct  347   GIENSAGPEKHQAVALRVSGDRTIVYNCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFG  406

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNCK+IVR P+ NQ CMVTAQGR + R   AIVLQ+C I+A+PAL +A+PP + 
Sbjct  407   DAAAVFQNCKLIVRMPLVNQACMVTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRA  466

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM + ID  + P+GWS W GT  L T +YAEYQNRGPGA+TD+RV W
Sbjct  467   YLGRPWKEYSRTIIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDW  526

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              G + +I+P+VA+ FTPG + + D  W+  +  P+ PG L+
Sbjct  527   PGIQ-HITPQVAESFTPGKYFIGDS-WITASGFPYVPGMLK  565



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   431 bits (1108),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 212/402 (53%), Positives = 274/402 (68%), Gaps = 12/402 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  LKT+ME++SN L IVS +   +  L+IPG+SRRLL++  P+   HG+      
Sbjct  190   GEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVSRRLLQDDIPVAG-HGD----IS  244

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +    + DP TR LL+APP   K D+VVA+DGSG YK+I  AL  IP  +N   V+ IK 
Sbjct  245   QAFPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKE  304

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y+EYV       N+  +G+GP KT ITG++N  D     TYR  TV V G+ F+ R++
Sbjct  305   GIYEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGI--NTYRTATVAVIGDNFVARNI  362

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA+KHQAVALR+S+D A  YNC ++ YQDTLYTH+ RQFYRDCT+SGT+DF+FG
Sbjct  363   GFENSAGAIKHQAVALRVSSDYAVFYNCSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFG  422

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +APVVFQNC  +VRKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P L+      K 
Sbjct  423   DAPVVFQNCTFLVRKPLENQQCIVTAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKS  482

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM TFIDD++ PEGWS W G+  L TCWY EY N GPG+    RVKW
Sbjct  483   YLGRPWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKW  542

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              G K  +S + A  FTPG FL  D  W+    +P++P   +P
Sbjct  543   NGIK-PVSRQHAIDFTPGRFLRGD-SWIKPTGVPYAPYLTRP  582



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   419 bits (1078),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 268/402 (67%), Gaps = 21/402 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              +KMK +L+ S ELTSN LA+V+++   + SL IP +SRRLL E     +  G P     
Sbjct  192   AKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVSRRLLTE-----EQDGIPE----  242

Query  2540  EILSPFADPATRHLLAAPPKA---DIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  + D   R LLAA PK    D+VVAQDGSGKYK+I  ALN +P  NN+  VI IK 
Sbjct  243   --FPSWVDEGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKTFVIYIKE  300

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVE--GEGFICR  2196
             GVYKE V++  K  N+  +G+GPTKTVITG+ N  D    G   C T      G  FI +
Sbjct  301   GVYKEKVLVDKKTTNVMIIGDGPTKTVITGSLNYVD----GVQTCNTATFTAIGSYFIAK  356

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  ENSAGA KHQAVALR+ +DM+ +YNCH++A+QDTLY H++RQFYRDCTISGT+DFI
Sbjct  357   DIKFENSAGAEKHQAVALRVQSDMSVIYNCHMDAFQDTLYAHAHRQFYRDCTISGTIDFI  416

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC+M V+KP+ NQ+C+VTA GR +RR A+AIVLQ+C I A+PA       N
Sbjct  417   FGDALAVFQNCQMFVKKPLENQQCIVTASGRSERRSASAIVLQNCTISADPAYYPLRNIN  476

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK++SRT+IM + IDD++ P+GW  W G   L+TC+YAEY NRG G++T  R 
Sbjct  477   KAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWMGNFALNTCFYAEYGNRGAGSATTGRA  536

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW+G K   +  +   FTP  F   D+ W+    +P+SP  +
Sbjct  537   KWRGIKSMTAQHIV-DFTPKAFFKGDDAWITATGVPYSPKLM  577



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   416 bits (1070),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 210/402 (52%), Positives = 269/402 (67%), Gaps = 23/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM  LL T+ EL+ N LA+V+   + I   +  GLSR+LL               +TD
Sbjct  172   GEKMAKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLL---------------TTD  214

Query  2540  EILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
             E  S F + + R LL  +  K + VVAQDGSG+YK+I  AL ++P  N    VILIKAG+
Sbjct  215   E--SSFVEASNRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGI  272

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +     N+ F+GEG TKT ITGN+ V++   G T+   TV V GEGF+ RD+  
Sbjct  273   YKEYVDVEKGMTNVVFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGF  332

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGAVK QAVALR++AD A +YNC ++ YQDTLY HS RQFYRDC I+GT+DF+FG+A
Sbjct  333   ENTAGAVKEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDA  392

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK+IVRKP   Q CMVTAQGR       A+V+Q+CEI AEP   A  PP K FL
Sbjct  393   AAVFQNCKLIVRKPGDGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFL  452

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-W  1650
             GRPWKE+SRT+IM ++ID  + P GW+ W  T + + TCWYAEYQNRGPGAS DKR+  W
Sbjct  453   GRPWKEYSRTIIMQSYIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             +GY++ IS +VA  FT G F+   D  +L +A IP+  G ++
Sbjct  513   RGYQKGISGDVANSFTAGLFINPTDSSFLPKADIPYEAGMMK  554



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   411 bits (1056),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/397 (51%), Positives = 267/397 (67%), Gaps = 13/397 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM  LLKTS ELTSN L +VS+++  + S  +P + RRLL E +  +++  + V    
Sbjct  185   GEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVGRRLLTEESNQQEEEPSWVGDRR  244

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
              +L             A  KAD+VVA+DGSGKYK++  ALN +P  +N+  VI +KAGVY
Sbjct  245   GLL---------QATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGVY  295

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +E VM+      +  +G+GPTKT IT  +N  D  P  T++  TV V G  FI +D+  E
Sbjct  296   QEQVMVDKSMTWVMMIGDGPTKTKITAGKNYVDGTP--TFKTATVSVIGSNFIAKDIGFE  353

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAGA KHQAVALR+ +DM+  YNC ++ YQDTLYTH++RQFYRDCTI+GT+DFIFGNA 
Sbjct  354   NSAGAAKHQAVALRVQSDMSIFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAA  413

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I ++P        NK +LG
Sbjct  414   AVFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLG  473

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK++SRT+IM   IDD++ PEGW  W G   L T +YAE  NRGPGA+TDKRVKWKG 
Sbjct  474   RPWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGI  533

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ I+P+ A  FT G F+  D  W+    +P+S G +
Sbjct  534   KK-ITPQHALDFTVGRFIRGDP-WIKPTGVPYSSGMM  568



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   410 bits (1055),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/412 (49%), Positives = 277/412 (67%), Gaps = 19/412 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPL-----KDDHGN  2559
             GEKMK+LL +S  + SN LA+V  +     SL + G  SRRLLEE   L     + D  +
Sbjct  163   GEKMKNLLHSSGMMLSNGLAMVGDISSIFSSLSLGGFTSRRLLEEEGSLAYGVDQTDGED  222

Query  2558  PVDSTDEILS------PFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPA  2406
             P  + D  ++       F D   R ++ A     KA+IVVAQDGSG++K+I  A+NS+P 
Sbjct  223   PKTAFDGKVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPK  282

Query  2405  INNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTV  2226
               +   VI +KAG YKE V+ P K NN+  +G+GP KT I+G++N  D     T+    +
Sbjct  283   KGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQ--TFHTAVL  340

Query  2225  IVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRD  2046
              V G+GFI +D+ IEN+AG +KHQAVA+R+S D +  YN H+N++QDTLY H+YRQ+YRD
Sbjct  341   GVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYAHAYRQYYRD  400

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             CTI+GT+DFIFG+A  VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C ILAE
Sbjct  401   CTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAE  460

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
             PA  +  PP K +LGRPWK+FSRT+IM T ID  + PEGW+ W+G   LDT +Y E++NR
Sbjct  461   PAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNR  520

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GPG+   +RV+WKG +  I+P +A+ FTPG     DE W+ ++ +P+  G +
Sbjct  521   GPGSDMSRRVRWKGIQ-TITPAIAESFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   409 bits (1051),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 209/402 (52%), Positives = 265/402 (66%), Gaps = 23/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM  LL T+ EL+ N LA+V+   + I   +  GLSR+LL               +TD
Sbjct  172   GEKMVKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLL---------------TTD  214

Query  2540  EILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
             E  S F + + R LL  +  K + VVAQDGSG+YK+I  AL ++P  N    VILIKAG+
Sbjct  215   E--SSFVEASNRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGI  272

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +     N+ F+GEG TKT ITGN++V+    G T+   TV V GEGF+ RD+  
Sbjct  273   YKEYVEVEKGMTNVVFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGF  332

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG  + QAVALR++AD A +YNC ++ YQDTLY HS RQFYRDC ISGT+DF+FG+A
Sbjct  333   ENTAGPAQEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDA  392

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK+IVR+P   Q CMVTAQGR       A V+Q+CEI AEP   AA P  K FL
Sbjct  393   AAVFQNCKLIVRRPGDGQNCMVTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFL  452

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-W  1650
             GRPWKE+SRT+IM +FID  + P GW+ W  T + + TCWYAEYQNRG GAS DKRV  W
Sbjct  453   GRPWKEYSRTIIMQSFIDGFIDPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             +GY+R IS +VA  FT G F+   D  +L +A IP+  G ++
Sbjct  513   RGYQRGISGDVANSFTAGVFINPTDNSFLPKADIPYEAGMMK  554



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   409 bits (1051),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 208/416 (50%), Positives = 275/416 (66%), Gaps = 27/416 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GEKMK+LL +S  + SN LA+V  +     SL + G  S RLLEE   L   +G  VD T
Sbjct  163   GEKMKNLLHSSGMILSNGLAMVGDISSIFSSLSLGGFTSGRLLEEEGSLA--YG--VDQT  218

Query  2543  D-EILS--------------PFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALN  2418
             D E L               PF D   R ++ A     KA+IVVAQDGSG++K+I  A+N
Sbjct  219   DGEDLKTAFDGKVTDAAGPPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAIN  278

Query  2417  SIPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYR  2238
             S+P   +   VI +KAG YKE V+ P K NN+  +G+GP KT I+G++N  D     T+ 
Sbjct  279   SLPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQ--TFH  336

Query  2237  CGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQ  2058
                + V G+GFI +D+ IEN+AG +KHQAVA+R+S D +  YN H+N +QDTLY H+YRQ
Sbjct  337   TAVLGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYAHAYRQ  396

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
             +YRDCTI+GT+DFIFG+A  VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C 
Sbjct  397   YYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCH  456

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             ILAEPA  +  PP K +LGRPWK+FSRT+IM T ID  + PEGW+ WQG   LDT +Y E
Sbjct  457   ILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGE  516

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++NRGPG+   +RV+WKG +  I+P +A  FTPG     DE W+ ++ +P+  G +
Sbjct  517   FKNRGPGSDMSRRVRWKGIQ-TITPAIADSFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   408 bits (1048),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 276/406 (68%), Gaps = 19/406 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-PGLSRRLLEEPAPLKDDHGNPVDST  2544
             GEKMK+LLKT+ E++SN LA+V+++  F+ SL++    SR+LL     L    G   D T
Sbjct  178   GEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLL-----LSGKIGYGGDPT  232

Query  2543  DEILSPFADPA------TRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIV  2385
             D   +P  +P        R LL+A   K + VVAQDGSG++ +I+AA+ S+P  NN+  V
Sbjct  233   D--YAPGEEPHFNLDSNRRRLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQTFV  290

Query  2384  ILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGF  2205
             I +KAGVYKEYV IP K N I  +G+GP KT I+G +N  +     TY   TV V  + F
Sbjct  291   IHVKAGVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TYHTATVAVNADDF  348

Query  2204  ICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTV  2025
             + +D+  EN+AGA  HQAVALR+S D A  YN H++ YQDTLY H+YRQ+YRDC+ISGT+
Sbjct  349   LAKDIGFENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTI  408

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG++  +FQNCK +VRKPMANQ CMVTAQGR +R    A ++Q+ + +AEPAL  A+
Sbjct  409   DFIFGDSQALFQNCKFVVRKPMANQACMVTAQGRVERHSLGATIIQNGDFVAEPALLQAS  468

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP+KV+LGRPWK  SRT+IM + I   + PEGW+ W GT  LDT +YAEYQNRGPG+   
Sbjct  469   PPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAEWSGTFALDTLYYAEYQNRGPGSDLK  528

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              RVKWKG  + +SP++A+ +T G F   DE W+  + +P+ P  +Q
Sbjct  529   NRVKWKGI-QTLSPQMAESWTGGKFYGGDE-WVKNSGVPYIPTMMQ  572



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   407 bits (1046),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 269/404 (67%), Gaps = 29/404 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK+LLK + EL++NAL IVS  ++ +++L+I G++ R L     L  + GN      
Sbjct  177   GEKMKNLLKNAHELSTNALDIVSSFEEQVENLQILGINNRRL-----LTVEAGN------  225

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                        R L  AP K ++VVAQDGSG++KSIN AL ++P  N +  VILIKAG+Y
Sbjct  226   ----------RRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIY  275

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              EYV + +   N+ F+GEGP KT ITGN+N  D  P   +   TV + G+GF+ +D+  E
Sbjct  276   NEYVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLP--VFSTATVAISGQGFVAKDIGFE  333

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG +KHQAVALR+SA+MA   NC ++ YQ TL TH  RQ YRDCTI+GT+DFIFG+A 
Sbjct  334   NSAGPLKHQAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAV  393

Query  2000  VVFQNCKMIVRKP--MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKV  1830
              VFQNCK+I RKP  M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK 
Sbjct  394   AVFQNCKLIARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKA  453

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK +SRT+IM + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV W
Sbjct  454   YLGRPWKLYSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNW  513

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             K Y +N +P+V  +FTPG  L   +    W+ +  +P+ PG ++
Sbjct  514   KNYIKNPTPDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   406 bits (1043),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 267/404 (66%), Gaps = 29/404 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK+LLK + EL++NAL IVS  +  ++ L+I G++ R L     L  + GN      
Sbjct  177   GEKMKNLLKNAHELSTNALDIVSSFEKQVEDLQILGINNRRL-----LTVEAGN------  225

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                        R L  AP K ++VVAQDGSG++KSIN AL ++P  N +  VI IKAG+Y
Sbjct  226   ----------RRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIY  275

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
              EYV + +   N+ F+GEGP KT ITGN+N  D  P   +   TV + G+GF+ +D+  E
Sbjct  276   NEYVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLP--VFSTATVAISGQGFVAKDIGFE  333

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG +KHQAVALR+SA+MA   NC ++ YQ TL TH  RQFYRDCTI+GT+DFIFG+A 
Sbjct  334   NSAGPLKHQAVALRVSAEMAVFQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAV  393

Query  2000  VVFQNCKMIVRKP--MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKV  1830
              VFQNCK+I RKP  M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK 
Sbjct  394   AVFQNCKLIARKPEEMQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKA  453

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK +SRT+IM + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV W
Sbjct  454   YLGRPWKLYSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNW  513

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             K Y +N +P+V  +FTPG  L   +    W+ +  +P+ PG ++
Sbjct  514   KNYIKNPTPDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   405 bits (1042),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/409 (49%), Positives = 263/409 (64%), Gaps = 17/409 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK+LL+TS EL SN LA+V+     + SL   G S R L         H +P D   
Sbjct  182   GEKMKNLLQTSGELLSNGLAMVTDFSSILSSL--GGFSSRRLLSDEGRSLYHLDPTDYAP  239

Query  2540  --------EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNR  2394
                     E    F D   R LLAA P   K + VVA+DGSG+Y +I AAL ++P   N+
Sbjct  240   GEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKKTNQ  299

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEG  2214
               VI +KAGVYKE V+IP   NNI  +G+GP KT I GN+N  D     T+    + V G
Sbjct  300   TFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQ--TFHTAVLAVNG  357

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             +GF+ +D+ IEN+AGA KHQAVA+R+S D A  YN H++ YQDTLY H+YRQFYRDC I+
Sbjct  358   DGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYAHAYRQFYRDCQIT  417

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQ C+++VR+PM +Q CMVTAQGRKD+R     VLQ C+I+A+PA  
Sbjct  418   GTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQRSVGVTVLQGCDIVADPAFL  477

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
             A  PP   +LGRPWKE+SRT++M + ID  + PEGWS W G   L T +Y EYQNRG G+
Sbjct  478   AVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAGS  537

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
                 RV WKG K+ I+P +A+ FTPG  +  ++ W+  + IP+  G LQ
Sbjct  538   GLSGRVTWKGIKK-ITPAIAQSFTPG-VVYKNDTWVSTSGIPYVSGMLQ  584



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   408 bits (1048),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 208/405 (51%), Positives = 272/405 (67%), Gaps = 25/405 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL------SRRLLEEPAPLKDDHGN  2559
             G+KM+ LLKTS ELTSN LA+VS++   + +L I  +       RRL  E       +G 
Sbjct  298   GKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRRLFAE-------NGF  350

Query  2558  PVDSTDEILSPFAD-PATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVI  2382
             P+  + E  S     PAT        K ++VVA+DGSGKY SIN AL  +P  N    VI
Sbjct  351   PMWVSSEQRSRIRQTPAT-------IKPNVVVAKDGSGKYTSINEALQEVPKDNPTTFVI  403

Query  2381  LIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFI  2202
              IKAGVYKE V++     N+ F+G+G TKT ITG+ N  D    GT+R  TV V G+GFI
Sbjct  404   YIKAGVYKEQVIVTKSMTNVMFIGDGRTKTKITGDLNYADG--TGTFRTATVGVVGDGFI  461

Query  2201  CRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVD  2022
              +D+  EN+AGA+KHQAVALR+ +D +  YNC ++ YQDTLY HS+RQFYRDCTISGT+D
Sbjct  462   AKDIGFENTAGAIKHQAVALRVQSDQSIFYNCQMDGYQDTLYAHSHRQFYRDCTISGTID  521

Query  2021  FIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANP  1842
             FIFG++  V QNCK+IVRKP+ NQ+C+VTAQGR +RR  +A+VLQ+C I  +P       
Sbjct  522   FIFGDSATVLQNCKIIVRKPLENQQCIVTAQGRIERREVSALVLQNCTISGDPEYLPVKD  581

Query  1841  PNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDK  1662
              NK +LGRPWKEFSRTLIM + IDDI+ PEGW  W G   L+T WYAE+ NRGPGA    
Sbjct  582   KNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPGAVQTH  641

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             RV W+G K+ I+  +A++FTPG FL  D+ W+ +A +P++PG ++
Sbjct  642   RVTWRGIKK-INAAIARRFTPGVFLRGDD-WIPKAGVPYTPGLIR  684



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   402 bits (1033),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/402 (52%), Positives = 265/402 (66%), Gaps = 23/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM  LL T+ EL+ N LA+V+   + I   +  GLSR+LL               +T+
Sbjct  172   GEKMVKLLNTTRELSINGLAMVNSFGEMI--TQTTGLSRKLLT--------------TTE  215

Query  2540  EILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
             E  S F + + R LL  +  K + VVAQDGSG+YK+I  AL ++P  N    VILIKAG+
Sbjct  216   E--SSFIEASNRKLLQISSAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGI  273

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +     N+ F+GEG TKT ITGN+  +    G T+   TV V GEGF+ RD+  
Sbjct  274   YKEYVEVEKGMTNVVFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGF  333

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG    QAVALR++AD A +YNC ++ YQDTLY HS RQFYRDC ISGT+DF+FG+A
Sbjct  334   ENTAGPTLEQAVALRVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDA  393

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK+IVRKP+ +Q CMVTAQGR       AIV+Q+CEI A+P   AA P    +L
Sbjct  394   AAVFQNCKLIVRKPLDSQNCMVTAQGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYL  452

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-W  1650
             GRPWKE+SRT+IM +FID  + P GWS W  T + L TCWYAEYQNRGPGAS DKRV  W
Sbjct  453   GRPWKEYSRTIIMQSFIDGFIDPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             +GY+R IS +VA  FT G F+  +   +L +A IP+  G ++
Sbjct  513   RGYQRGISGDVANSFTAGQFINPSGSSFLPKADIPYEAGMMK  554



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   402 bits (1034),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 264/400 (66%), Gaps = 19/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM  LL+TS ELT N L +VS++   + S  +P + RRL+ E            +S +
Sbjct  185   GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTE------------ESNE  232

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +   P      R LL A     KAD VVA+DGSGKYK++ AALN +P  +N+  VI +KA
Sbjct  233   QREEPSWVRDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKA  292

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+E VM+      +  +G+GPTKT IT  +N  D  P  T++  TV V G  FI +D+
Sbjct  293   GVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTP--TFKTATVSVIGSNFIAKDI  350

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA KHQAVALR+ +DM+  YNC ++ YQDTLYTH++RQFYRDCTI+GT+DFIFG
Sbjct  351   GFENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFG  410

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             N  VVFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P        NK 
Sbjct  411   NGAVVFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKA  470

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             FLGRPWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TDKRVKW
Sbjct  471   FLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKW  530

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KG K+ I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  531   KGIKK-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  568



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   402 bits (1033),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/405 (50%), Positives = 263/405 (65%), Gaps = 29/405 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLL--------EEPAPLKDDH  2565
             GEKM  LL+TS ELT N L +VS++   + S  +P + RRL+        EEP+ ++D  
Sbjct  188   GEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTEESNEQREEPSWVRDRR  247

Query  2564  GNPVDSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIV  2385
             G                       A  KAD VVA+DGSGKYK++ AALN +P  +N+  V
Sbjct  248   G-----------------LLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFV  290

Query  2384  ILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGF  2205
             I +KAGVY+E VM+      +  +G+GPTKT IT  +N  D  P  T++  TV V G  F
Sbjct  291   IYVKAGVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTP--TFKTATVSVIGSNF  348

Query  2204  ICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTV  2025
             I +D+  ENSAGA KHQAVALR+ +DM+  YNC ++ YQDTLYTH++RQFYRDCTI+GT+
Sbjct  349   IAKDIGFENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTI  408

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFGN  VVFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P      
Sbjct  409   DFIFGNGAVVFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIR  468

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
               NK FLGRPWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TD
Sbjct  469   HINKAFLGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATD  528

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KRVKWKG K+ I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  529   KRVKWKGIKK-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  571



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   402 bits (1033),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 203/408 (50%), Positives = 268/408 (66%), Gaps = 22/408 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  +K ++E+++N L I+  L   +  L+I G++RRLL+E         + V   D
Sbjct  187   GEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVNRRLLQE---------DEVLGHD  237

Query  2540  EILSPF---ADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAI---NNRRI  2388
             ++ S F    D  TR LLAAPP   K ++ VA+DGSG +K+I  AL+SIP     + +  
Sbjct  238   DVPSKFPSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTF  297

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEG  2208
             V+ IKAGVY+EYV      + +  +G+GP KT ITGN+N  D     TY   TV+V G+ 
Sbjct  298   VLYIKAGVYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGV--NTYHTATVVVLGDN  355

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             FI +++  ENSAGA+KHQAVALR+SAD A  YNC ++ YQDTLYTH+ RQFYR+C+ISGT
Sbjct  356   FIAKNIGFENSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLYTHAKRQFYRECSISGT  415

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG+APVVFQNCK +VRKP+ NQ+C+VTAQGRK RR  + I++Q+    A P L   
Sbjct  416   IDFVFGDAPVVFQNCKFLVRKPLENQQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPV  475

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                 K +LGRPWK+FSRT+IM ++IDDI+ PEGW  W GT  L TCWY E+ N GPG+  
Sbjct  476   KKQYKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLKTCWYTEFNNYGPGSDK  535

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               RVKW G K  I  + A  FTPG FL  D  W+    IP+SP   +P
Sbjct  536   KARVKWNGIK-TIDRQHALDFTPGRFLRGD-TWIKPTGIPYSPFLTRP  581



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   400 bits (1027),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 265/400 (66%), Gaps = 13/400 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE M+  LKT+ ELT N LA+V+++   + SL++P   RRLL      +     P    D
Sbjct  187   GESMRKALKTAGELTQNGLAMVTEVASILTSLQMPS-KRRLLSS----EQQSQCPFAMED  241

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             E    +   A R LLAA     K +I VA+DGSGKYK+I+ AL  +P  +N   VI IKA
Sbjct  242   E-FPTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKA  300

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY E V I     ++  +G+GPTKT ITGN+N  D  P  T++  TV V G+GF+ +D+
Sbjct  301   GVYHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTP--TFKTATVAVIGDGFMAKDI  358

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ +DM+  YNC ++ YQDTLY H++RQFYR+CTISGT+DFIFG
Sbjct  359   GFENSAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFG  418

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             N+ VV Q C+++VRKP+ NQ+ +VTA GRKDRR   AI+LQSC I+A+P L       + 
Sbjct  419   NSAVVLQKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRS  478

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM T IDD++ P+GW  W G   L TC+YAEY NRGPGA   +RVKW
Sbjct  479   YLGRPWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKW  538

Query  1649  KGYKRNI-SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +G K +I +PE A+QFT G F+  D  W+    +P+  G 
Sbjct  539   RGIKTSIMTPEKAQQFTAGRFIRGDS-WIKPTGVPYDSGL  577



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   400 bits (1027),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/400 (50%), Positives = 263/400 (66%), Gaps = 18/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLEEPAPLKDDHGNPVDST  2544
             G +MK +L++S ELTSN LA+V+++   + S  +P  +SRRLL              D  
Sbjct  191   GLRMKAMLRSSQELTSNGLAMVTEISSILASYNLPFNVSRRLLSSE-----------DGD  239

Query  2543  DEILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             D  LS  +D   R L A     KAD+VVA+DGSGKY+++N AL  IP   N+  VI IK 
Sbjct  240   DTELSWLSDGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQ  299

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE VM      ++  +G+GPTKT ITG+ N  D     T++  TV V G  FI +D+
Sbjct  300   GVYKEQVMFAKSMTHVMIIGDGPTKTRITGSLNFIDGVQ--TFKTATVSVIGSNFIAKDI  357

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ +DM+  YNCH++ YQDTLY H++RQFYRDC I+GT+DFIFG
Sbjct  358   GFENSAGPQKHQAVALRVQSDMSIFYNCHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFG  417

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  VFQNCKM++RKP+ NQ C+VTAQGR +RR A A+VLQ+C I  +PA       NK 
Sbjct  418   DSAAVFQNCKMVIRKPLDNQNCIVTAQGRTERREATALVLQNCTITGDPAYLPVKDQNKG  477

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM + IDD++ PEGW  W G   L+TC+Y E  NRGPG+  D RVKW
Sbjct  478   YLGRPWKEFSRTIIMNSRIDDVIAPEGWLPWAGDFALNTCFYTEILNRGPGSKLDGRVKW  537

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +G K+ +  + A ++TPG F+  D  W+  A +P+  G L
Sbjct  538   RGIKK-VPAQRAVEYTPGRFIRGD-WWIKAAGVPYVSGML  575



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   399 bits (1026),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 272/400 (68%), Gaps = 16/400 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KM+  LK+S ELTSN LA+V ++   +  + +   +R+LL +   +   HG+      
Sbjct  187   GHKMREALKSSEELTSNVLAMVDEISLALAKMNLTNFNRKLLSDDNVI--GHGDD-----  239

Query  2540  EILSPFADPATRHLLA---APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                S +A    R LL+   A  K ++VVA+DGSG++++IN AL  IP  + +  V+ IKA
Sbjct  240   --FSMWATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTFVLHIKA  297

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE V+   K  N+  VG+GPTKT I+ N+N  D     T++  TV V G+ FI RD+
Sbjct  298   GVYKEQVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTT--TFKTATVSVFGDNFIARDI  355

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA+KHQAVAL + +DMA  +NCH++ YQDTLY HS RQFYRDCTI+GT+DF+ G
Sbjct  356   GFENSAGAIKHQAVALMVRSDMAIFHNCHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLG  415

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNCKM++RKP+ NQ+C+VTAQGR  RR A+A++LQ+C I A+P+          
Sbjct  416   DAAAVFQNCKMLIRKPLDNQQCIVTAQGRSKRREASALILQNCTITADPSYTPFKGQILS  475

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK +SRT+IM ++IDDI+ P+GW  W G   L+TC+YAEY+NRGPGAST +RVKW
Sbjct  476   YLGRPWKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKW  535

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KG K+ I+P+ A +FT G F+  D +W+  A +P+  G L
Sbjct  536   KGIKK-ITPQHAVEFTAGRFMKGD-RWIRTAGVPYVAGML  573



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   399 bits (1026),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 270/413 (65%), Gaps = 27/413 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL----SRRLLEEPAPLKDDHGNPVD  2550
             EKMK+LLKT+ EL+SN LA+VS +   I  L++  L    SRRLL +   +    G+P D
Sbjct  184   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLY-GGDPTD  242

Query  2549  STDEILSPFADP------ATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINN  2397
                   +P  DP       +R LL   AAP K + VVA DGSG++K+I  A+N+IP  N 
Sbjct  243   -----YAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNT  297

Query  2396  RRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVI  2223
             +  VI IKAG+YKE+V IP K N +  +GEGP KT ITG+++    + GG  T+   TV 
Sbjct  298   QPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKS----YAGGVKTFHTATVA  353

Query  2222  VEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDC  2043
             V GE F+ +D+  EN+AGA  HQAVALR+S D A   N  ++ YQDTLY H+YRQ+YRD 
Sbjct  354   VNGEDFMAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDS  413

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             TISGT+DFIFG++   FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEP
Sbjct  414   TISGTIDFIFGDSLAYFQNCKFIVRKPMENQACMVTAQGRVDPRSVGAIVIQNGDITAEP  473

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
             A  A  PP   +LGRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG
Sbjct  474   AFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRG  533

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              G+   KRV WKG K+ I+PE+A  +T G     D+ W+  + +P++P F+QP
Sbjct  534   AGSGLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDD-WIKSSGVPYNPSFMQP  584



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   399 bits (1024),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 210/407 (52%), Positives = 265/407 (65%), Gaps = 34/407 (8%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL----SRRLL-EEPAPLKDDHGNPV  2553
             EKMK+LLKT+ EL+SN LA+VS +   I  L++  L    SRRLL E+P  +K  H    
Sbjct  184   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSEDPYWIKSPH----  239

Query  2552  DSTDEILSPFADPATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVI  2382
                           TR LL   AAP K + VVA DGSG++K+I  A+N+IP  N +  VI
Sbjct  240   --------------TRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVI  285

Query  2381  LIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEG  2208
              IKAG+YKE+V IP K N +  +GEGP KT ITG+++    + GG  T+   TV V GE 
Sbjct  286   FIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKS----YAGGVKTFHTATVAVNGED  341

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F+ +D+  EN+AGA  HQAVALR+S D A   N  ++ YQDTLY H+YRQ+YRD TISGT
Sbjct  342   FMAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGT  401

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++   FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEPA  A 
Sbjct  402   IDFIFGDSLAYFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLAT  461

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
              PP   +LGRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG G+  
Sbjct  462   TPPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGL  521

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              KRV WKG K+ I+PE+A  +T G     D+ W+  A +P++P F+Q
Sbjct  522   AKRVTWKGIKK-ITPEIALSWTAGLAFKGDD-WIKTAGVPYNPSFMQ  566



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   399 bits (1025),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 198/400 (50%), Positives = 268/400 (67%), Gaps = 19/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRR-LLEEPAPLKDDHGNPVDST  2544
              EKMK  LKTSM+L+SN LA+VS+    +  L+IPG+SRR LLE P    DD+ +     
Sbjct  188   AEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGISRRRLLEIPVLGHDDYPD-----  242

Query  2543  DEILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPA-INNRRIVILIK  2373
                   +A+P  R LLAA    K ++VVA+DGSG++++I AAL+ +P   NN   VI IK
Sbjct  243   ------WANPGMRRLLAAGSRVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVY+EY+ I     ++  +G+GP KT+ITGN+N  D  P  T++  TV V  E F+ RD
Sbjct  297   AGVYQEYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTP--TFKTATVAVTAEHFMARD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AG  KHQAVALR+ AD A  YNC ++ YQDTLY H+ RQFYRDCT+SGT+DFIF
Sbjct  355   IGFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  +FQ C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C I A+  L       +
Sbjct  415   GDAAAIFQGCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFR  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG++  KRVK
Sbjct  475   SFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVK  534

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             W+G K  I+P+ A  FT G F+M D +W+    +P+  G 
Sbjct  535   WRGIK-TITPQHALDFTAGRFVMGD-RWIKPTGVPYVSGM  572



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   399 bits (1024),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 267/399 (67%), Gaps = 19/399 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRR-LLEEPAPLKDDHGNPVDSTD  2541
             EKMK  LKTSM+L+SN LA+VS++   +  L+IPG+SRR LLE P    DD+ +      
Sbjct  189   EKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGISRRRLLEIPVLGHDDYPD------  242

Query  2540  EILSPFADPATRHLLAAPPKA--DIVVAQDGSGKYKSINAALNSIPA-INNRRIVILIKA  2370
                  +A+P  R LLAA  K   ++VVA+DGSG++K+I  A++ +P   NN   VI IKA
Sbjct  243   -----WANPGMRRLLAAGSKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKA  297

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV++     ++  +G+GP KT+ITGN+N  D  P  T++  TV V  E F+ RD+
Sbjct  298   GVYQEYVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTP--TFKTATVAVTAEHFMARDI  355

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG  KHQAVALR+ AD A  YNC ++ YQDTLY H+ RQFYRDCT+SGT+DFIFG
Sbjct  356   GFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFG  415

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  +FQ+C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C       L       + 
Sbjct  416   DAAAIFQSCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRS  475

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             FLGRPWKE+SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG+   KRVKW
Sbjct  476   FLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKW  535

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +G K NI+P+ A  FTPG FL  D +W+    +P+  G 
Sbjct  536   RGIK-NITPQHAVDFTPGRFLKGD-RWIKPTGVPYVSGL  572



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 261/396 (66%), Gaps = 24/396 (6%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEIL  2532
             M  LL ++ EL+ NAL++++   D +   +  GL+R+LL              DS+D   
Sbjct  1     MVKLLNSTRELSINALSMLNSFGDMVA--QATGLNRKLLT------------TDSSDAT-  45

Query  2531  SPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEY  2352
                   A R L  +  K +  VA DGSG+YK+I  AL+++P  N    +I IKAGVYKEY
Sbjct  46    ------ARRLLQISNAKPNATVALDGSGQYKTIKEALDAVPKKNTEPFIIFIKAGVYKEY  99

Query  2351  VMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSA  2172
             + IP    N+  +GEGPTKT ITGN++V+D     T+   TV V G  F+ +++  EN+A
Sbjct  100   IDIPKSMTNVVLIGEGPTKTKITGNKSVKDG--PSTFHTTTVGVNGANFVAKNIGFENTA  157

Query  2171  GAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  K QAVALR+SAD A +YNC ++ YQDTLY H+YRQFYRDCTI+GTVDFIFGN   V 
Sbjct  158   GPEKEQAVALRVSADKAIIYNCQIDGYQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVL  217

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNCK+IVRKP  NQ CMVTAQGR +     AIVLQ+CEI  +    + +PP+K +LGRPW
Sbjct  218   QNCKVIVRKPAQNQSCMVTAQGRTEPIQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPW  277

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             KE+SRT+IM ++ID  + PEGW+ W  T +  DT +YAEYQNRGPGA+ DKR+ WKG+++
Sbjct  278   KEYSRTIIMQSYIDKFIEPEGWAPWNITNFGRDTSYYAEYQNRGPGAALDKRITWKGFQK  337

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
               + E A++FT G ++  DE WL +A +P+  G ++
Sbjct  338   GFTGEAAQKFTAGVYINNDENWLQKANVPYEAGMMK  373



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   399 bits (1024),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 265/400 (66%), Gaps = 13/400 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+ +LKTSMEL+SN LAIV ++   + +L++  L+RRLL       DD  +P +  D
Sbjct  186   GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLS------DDPADPDNHID  239

Query  2540  EILSPFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +    ++    R LL A     K ++ VA+DGSG +K+IN A+  +P  +N+  ++ IK 
Sbjct  240   DEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKK  299

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y+E V I     N+  VG+GPTKT ITG+ N  D  P  T++  TV V G+GFI + +
Sbjct  300   GIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTP--TFKTATVAVLGDGFIAKGI  357

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA KHQAVALR+ +D +  YNC ++ YQDTLYTH+ RQFYRDCTISGT+DFIFG
Sbjct  358   GFENSAGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFG  417

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A V+FQNC  +VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K 
Sbjct  418   DAAVIFQNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKS  477

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW
Sbjct  478   YLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKW  537

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +G K  I P  A  F PG FL  D +W+    +P++ G  
Sbjct  538   RGIK-TIKPSHAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   397 bits (1021),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 265/403 (66%), Gaps = 18/403 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS--RRLLEEPAPLKDDHGNPVDS  2547
             GEKM+  L  + ELTSN LA+V+++   + +L +  LS  RRLL++       HG     
Sbjct  180   GEKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGNRRLLQDSEVQVLGHGE----  235

Query  2546  TDEILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                    + DP  R LL A      K D+VVA+DGSGKYK+I  AL  IP  +N+  V+ 
Sbjct  236   ----FPMWMDPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLY  291

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             +K GVY+E ++   K   +  +G+GPTKT I  N N  D     T++  TV V GE F+ 
Sbjct  292   VKEGVYREQIIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGV--NTFKTATVAVLGEQFLA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+  EN AGA+KHQAVALR+ +D +  YNCH++ YQDTLYTH++RQFYRDCTISGT+DF
Sbjct  350   KDIGFENDAGAIKHQAVALRVQSDFSVFYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  +FQNCKM+VRKP+ NQ+C+VTAQGRK+RR  +AI+LQ+C I A+ +       
Sbjct  410   IFGDASAIFQNCKMLVRKPLDNQQCIVTAQGRKERRQPSAIILQNCTITADASYVPVKAK  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              + FLGRPWKE+SRT+IM +FIDDI+ PEGW  W G   + TC+Y+E+ NRGPG+S   R
Sbjct  470   FRSFLGRPWKEYSRTIIMQSFIDDIIQPEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKWKG K  I+P  A  FT G FL  +  WL +  +PFS G +
Sbjct  530   VKWKGIK-TITPAHAVDFTVGTFLRGN-TWLPKFGVPFSAGMV  570



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   397 bits (1020),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 198/416 (48%), Positives = 278/416 (67%), Gaps = 22/416 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPL--KDDHGNPVD  2550
             GEKMK+LLKT+ E++SN LA+V+ +   + SL++  + SR+LL E      K + G  + 
Sbjct  179   GEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQLGNVASRKLLSEEGRFASKPNAGRKLQ  238

Query  2549  STDEI--------LSPFADPA------TRHLLAAPP-KADIVVAQDGSGKYKSINAALNS  2415
              +++I         +P  +P        RHLL+A   K + VV+QDGSG++ +I+AA+ +
Sbjct  239   LSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSATSLKPNAVVSQDGSGQFNTISAAIAT  298

Query  2414  IPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRC  2235
             +P  N++  VI +KAGVYKE V+IP   N I  +G+GP KT +TG  N  +     TY  
Sbjct  299   VPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKTRVTGRLNFAEGVK--TYHT  356

Query  2234  GTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQF  2055
              TV V  + F+ +D+  EN+AGA  HQAVALR S D A  YN H++ YQDTLY H+YRQ+
Sbjct  357   ATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFYNVHIDGYQDTLYAHTYRQY  416

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGT+DFIFG+A  +FQNC+ ++RKP+ NQ CM+TAQGR DRR   AIV+Q+ +I
Sbjct  417   YRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITAQGRVDRRSVGAIVIQNGDI  476

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
              AEPAL  A+PP+K++LGRPWK+FS T+IM + I   + PEGWS W GT  LDT +YAEY
Sbjct  477   AAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIGGFIAPEGWSPWAGTFALDTLYYAEY  536

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +NRGPG+    RV+WKG +  +SP++A+ +T G     DE W+  + +P+ P  +Q
Sbjct  537   KNRGPGSDVKNRVQWKGIQ-TLSPQMAESWTGGKIYGGDE-WIRISGVPYVPTMMQ  590



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   399 bits (1024),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 260/399 (65%), Gaps = 23/399 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT+++LT N LA+VS++ +F+  L+IPGL SRRLL    P            
Sbjct  188   GETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLNSRRLLSSDYP------------  235

Query  2543  DEILSPFADPATRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                   +  P +RHLLAA   K DIVVAQDGSG+YK+IN AL++IP   N   V+ IKAG
Sbjct  236   -----SWVGPRSRHLLAATEVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAG  290

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKEY+ +     N+ F+G+GP KT+I+G++  +D     T+R  TV + G+ FI +++ 
Sbjct  291   LYKEYIQVNRSMTNLVFIGDGPDKTIISGDKGFKDGIT--TFRTQTVAIIGDNFIAKNIG  348

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA+KHQAVA+R+ +DMA  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF+FG+
Sbjct  349   FENTAGAIKHQAVAVRVQSDMAVFHNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGD  408

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             +  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C I  EP   A    +K +
Sbjct  409   SATVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAY  468

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM TFI D V P+GW  W     L T +Y+E QN GPG+    RV W 
Sbjct  469   LGRPWKEYSRTIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWA  528

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K+  S ++  QFTP  F+  D  W+    +P++PG L
Sbjct  529   GIKKLTSKDI-DQFTPAKFIQGDS-WIPATGVPYTPGLL  565



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   401 bits (1030),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 265/400 (66%), Gaps = 13/400 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+ +LKTSMEL+SN LAIV ++   + +L++  L+RRLL       DD  +P +  D
Sbjct  186   GEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLLS------DDPADPDNHID  239

Query  2540  EILSPFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +    ++    R LL A     K ++ VA+DGSG +K+IN A+  +P  +N+  ++ IK 
Sbjct  240   DEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKK  299

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y+E V I     N+  VG+GPTKT ITG+ N  D  P  T++  TV V G+GFI + +
Sbjct  300   GIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTP--TFKTATVAVLGDGFIAKGI  357

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA KHQAVALR+ +D +  YNC ++ YQDTLYTH+ RQFYRDCTISGT+DFIFG
Sbjct  358   GFENSAGAAKHQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFG  417

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A V+FQNC  +VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K 
Sbjct  418   DAAVIFQNCTFVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKS  477

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW
Sbjct  478   YLGRPWKEFSRTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKW  537

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +G K  I P  A  F PG FL  D +W+    +P++ G  
Sbjct  538   RGIK-TIKPSHAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   394 bits (1012),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 195/401 (49%), Positives = 266/401 (66%), Gaps = 22/401 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             G +M+  LK++ E+T+N L IV++L   + SL+IPG++ RRLLE+     DDH  P   +
Sbjct  193   GTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMTGRRLLED-----DDHEMPSWIS  247

Query  2543  DEILSPFADPATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             D           R L+   AA  K D++VAQDGSGKYK+INAAL  +P  +N+  VI +K
Sbjct  248   D---------GKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVK  298

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+YKE V+IP    ++   G+GPTKTV+TG+ N  D     T++  T    G  F  RD
Sbjct  299   AGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQ--TFKTATFSAIGANFYARD  356

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AG+ KHQAVALR+ +D +  YNC ++ YQDTLY H++RQFYRDCTISGT+DF+F
Sbjct  357   MGFENTAGSAKHQAVALRVQSDRSIFYNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVF  416

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA   FQNCK++VRKPM NQ+C+VTA GR +R+   A++ Q C  + +PA       NK
Sbjct  417   GNAATNFQNCKLVVRKPMDNQQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSINK  476

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK++SRT+I+ + IDDI+ PEGW  W G   L+T +YAE QN+GPGA   KRVK
Sbjct  477   AYLGRPWKQYSRTIIIGSQIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGPGAVETKRVK  536

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K +I+P+ A  FTP  F+  D  W+    IP+S G +
Sbjct  537   WRGIK-HITPQHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  575



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   393 bits (1009),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 196/402 (49%), Positives = 263/402 (65%), Gaps = 15/402 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLK++ ELTSN LA++ ++   + +L+IPG+SRRLL       D+ G     +D
Sbjct  192   GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLS------DESGKGEYRSD  245

Query  2540  E--ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
             E  +   +A    R L  A P   K +++VAQDGSGKYK+IN AL  IP   N   V+ +
Sbjct  246   EGGLYPSWASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYV  305

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKE V       N+  +G+GPTKT I+G+ N  D    GT+R  TV   G  F+ +
Sbjct  306   KEGVYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGI--GTFRTATVAAVGSNFMAK  363

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  EN+AGA KHQAVALR+ +DMA  YNC ++ YQDTLY H++RQFYRDCTI+GT+DFI
Sbjct  364   DIGFENNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFI  423

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++ VVFQNC ++VRKP+ NQ+C+VTAQGR +RR    IVLQ+C I A           
Sbjct  424   FGDSAVVFQNCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKF  483

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK FSRT+IM + IDD++ PEGW  W G   L+TC+YAEY NRGP ++T  RV
Sbjct  484   KSYLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRV  543

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              W+G K+ I+ +    FT G F+ +   WLG + +P++   +
Sbjct  544   TWRGIKQ-ITGQHVNDFTVGRFI-SGHLWLGASGVPYTSDMM  583



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   391 bits (1004),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 266/399 (67%), Gaps = 25/399 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLKT  ELTSN L +V+ L   +  L+I G+               GN      
Sbjct  162   GEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQI-GI---------------GNVSAGRR  205

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
              +LS +A+P  R +LA   +A+ VVA DGSG+YKSINAA+N+ P+ N R  VI +KAG+Y
Sbjct  206   RLLSDWAEPKMR-MLAGGIRANAVVALDGSGQYKSINAAINAAPSKNARPFVIHVKAGLY  264

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFICRDLT  2187
             +EYV +P  K NI  +G+G T+T ITG +N+     GG  T+   T  V  + F  +D+ 
Sbjct  265   REYVEVPKHKTNIVILGDGATRTRITGRKNL----AGGVKTFATATFAVNADDFTAKDIG  320

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AG   HQAVALR++ D A +YN +++ +QDTLY H++RQFYR+C ISGT+DF+FGN
Sbjct  321   IENTAGPEGHQAVALRVTGDRAVLYNLNIDGFQDTLYAHAHRQFYRNCRISGTIDFVFGN  380

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNC+ IVRKPMANQ CMVTAQGR  R    AIV+Q+ EI AE A   A P  + +
Sbjct  381   ALSIFQNCQFIVRKPMANQACMVTAQGRDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAY  440

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+FS T+IM ++I   + P+GW+ W G+  LDTC+YAEY+NRGPG++T +RVKWK
Sbjct  441   LGRPWKQFSTTIIMSSYIGGSISPQGWAPWAGSFALDTCYYAEYRNRGPGSNTSQRVKWK  500

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K +I P+ A ++ PG     D+QW+ RA +P+  G +
Sbjct  501   GIK-HIDPQTAARYAPGK-AYGDDQWIRRAGVPYVSGMM  537



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   391 bits (1004),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 195/401 (49%), Positives = 260/401 (65%), Gaps = 13/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LL ++ ELTSN LA+VS++   + S  +    RRLL   A      G    +T 
Sbjct  182   GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGA-----GGGTKKNTP  236

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAIN-NRRIVILIK  2373
             +++  + D  T  +  A P   K D+ VA+DGSG+ KSI  A+  IP  N ++  VI +K
Sbjct  237   KVIPVWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY EYVMI     N+  +G+GPTKT ITGN+N  D     T++  TV V G+ F+ +D
Sbjct  297   EGVYNEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTK--TFQTATVAVVGDYFVAKD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAGA  HQAVALR+ +D++  YNC ++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  355   IGFENSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K
Sbjct  415   GDAAVVFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSK  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV 
Sbjct  475   AYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVT  534

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  535   WSGIKK-LTPEHAVDFTAGR-LMEGDKWIKPSGVPYVAGMV  573



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   391 bits (1004),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 198/397 (50%), Positives = 262/397 (66%), Gaps = 15/397 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G++MK  LK SMEL++N LAIVS +   I SLE  G  RRLL++  P+   HG      D
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQDDLPVLG-HG------D  240

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +I   + D   R LLAAP    KADIVVA+DGSG + +I  AL+ +P  +++  V+ IKA
Sbjct  241   QIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKA  300

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y+EY+       N+  +G+G   T I GN+N  D     TY   TV+V G+ F+ +++
Sbjct  301   GIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNI  358

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AGA+KHQAVALR+SAD A  YNC ++ +QDT+YTH+ RQFYRDC+ISGT+DF+FG
Sbjct  359   GFENNAGAIKHQAVALRVSADYALFYNCSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFG  418

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNCK ++RKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P L       K 
Sbjct  419   DASAVFQNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKS  478

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S   RVKW
Sbjct  479   YLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKW  538

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              G K  I  + A  FTPG F      W+    IP++P
Sbjct  539   NGIK-TIDRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   389 bits (1000),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/401 (49%), Positives = 260/401 (65%), Gaps = 14/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+  LKTS ELTSN LA+VS++    KSL I    RRLL+  A   D+         
Sbjct  181   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKSLNIK-TGRRLLQAAATATDEKRF---QRA  236

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +I+  + D     L  A P   K D+VV++ G GKYK+IN AL  IP  N  ++ VI +K
Sbjct  237   KIIPAWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+V       N+  +G+GPTKTVITG RN  D     TY   TV V G+ FI +D
Sbjct  297   EGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQ--TYLTATVGVVGDYFIAKD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ HQAVALR+ +D++  YNC+++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  355   VGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTAQGR DRR  +A++LQ+C I  E         NK
Sbjct  415   GDAAAVFQNCKMIVRKPLENQACMVTAQGRLDRRSPSALILQNCTISGERGYD--KELNK  472

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK ++R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV 
Sbjct  473   AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVT  532

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  533   WRGMKK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   389 bits (998),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 265/401 (66%), Gaps = 22/401 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             G +M+  LK++ ++T+N L IV++L   + SL++PG+S RRLLE+     DD   P   +
Sbjct  194   GVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMSGRRLLED-----DDREMPSWVS  248

Query  2543  DEILSPFADPATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             D           R L+   AA  K D+VVAQDGSGKYK+INAAL  +P  +N+  VI +K
Sbjct  249   D---------GKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVK  299

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+YKE V+IP    ++   G+GPTKTV+TG+ N  D     T++  T    G  F  RD
Sbjct  300   AGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQ--TFKTATFSAIGANFYARD  357

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA KHQAVALR+ +D +  +NC ++ YQDTLY H++RQFYRDCTISGT+DF+F
Sbjct  358   MGFENTAGAAKHQAVALRVQSDRSIFFNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVF  417

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA   FQNCK++VRKP+ NQ+C+VTA GR +R+   A++ QSC  + +PA       NK
Sbjct  418   GNAATNFQNCKLVVRKPLDNQQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINK  477

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+I+ + IDDI+ PEGW  W G   L+T +YAE QN+G GA   KRVK
Sbjct  478   AYLGRPWKEYSRTIIIGSTIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGAGADESKRVK  537

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K +I+P+ A  FTP  F+  D  W+    IP+S G +
Sbjct  538   WRGIK-HITPQHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  576



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   387 bits (995),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 250/400 (63%), Gaps = 22/400 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS--RRLLEEPAPLKDDHGNPVDST  2544
             EKMK LL T+ E+ SN LAIV+       SL++   +  RRL+ E     DD        
Sbjct  178   EKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLMGEGEENPDDG-------  230

Query  2543  DEILSPFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   F   A R LLA      KA++ VAQDGSG++K+I AAL ++P  +N   VI +K
Sbjct  231   ------FVQSARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVK  284

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVYKE V++P K NN+   G+GP KT +  N+N  D     T+   T+ V  +GF+ +D
Sbjct  285   AGVYKETVIVPKKVNNVVIYGDGPEKTRVVNNKNYADGVQ--TFHTATLAVNSDGFMAKD  342

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAG  KHQAVA+R+S D A  YN  ++ YQDTLY H YRQFYR+CTISGT+DF+F
Sbjct  343   IAFENSAGPTKHQAVAVRVSGDKAVFYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVF  402

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQ C+ IVRKP  NQ CMVTAQGRKD R     V+Q+ EI+ E    A  P   
Sbjct  403   GDATAVFQKCRFIVRKPDINQNCMVTAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKID  462

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRTLIM TFID  + P GWS W G   L+T +Y EYQN+GPGA T KRV 
Sbjct  463   AFLGRPWKEYSRTLIMNTFIDGFIDPAGWSPWMGNYGLNTLYYGEYQNKGPGADTSKRVT  522

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKG ++ I+PE+A  FT     + D  W+  + +P++PG 
Sbjct  523   WKGIQK-ITPEIALSFTAQKVYLND-GWVTNSSVPYTPGL  560



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   392 bits (1007),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 257/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SRRLL E  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+GN++ +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGNKSYKDGIT--TYRTATVAIVGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVALR+ +D A  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D V P+GW  WQG   L T +Y+E QN GPGA+   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWQGDFGLKTLFYSEVQNTGPGATVANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E   +FTP  ++  D  W+    +P++ G L
Sbjct  526   VTWAGIK-TLSDEDILKFTPAQYIQGD-TWVPGKGVPYTSGLL  566



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   387 bits (995),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 260/401 (65%), Gaps = 13/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LL ++ ELTSN LA+VS++   + S  +    RRLL   A      G+   +T 
Sbjct  182   GEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGA-----GGDTKKNTP  236

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAIN-NRRIVILIK  2373
             +I+  + D     +  A P   K D+ VA+DGSG+ KSI  A+  IP  N ++  VI +K
Sbjct  237   KIIPVWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+VMI     N+  +G+GPTKT ITGN+N  D     T++  TV V G+ F+ +D
Sbjct  297   EGVYNEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTK--TFQTATVAVVGDYFVAKD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAGA  HQAVALR+ +D++  YNC ++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  355   IGFENSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K
Sbjct  415   GDAAVVFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSK  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV 
Sbjct  475   AYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVT  534

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  535   WSGIKK-LTPEHAVDFTAGR-LMEGDRWIKPSGVPYVAGMV  573



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   387 bits (994),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 258/398 (65%), Gaps = 16/398 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GEKMK LL  S +LTSN LA+V  +   +K L IPGL SRRLLE      D+  + V+  
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEA----DDEFPSWVNGG  242

Query  2543  DEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
               +L     PAT        KAD +VAQDGSG+YK+I  A+  IP  NN   V+ IK GV
Sbjct  243   KRMLLLKETPAT-------IKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGV  295

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKE V +     ++  +G+GPTKT ITGN N  +     T++  TV + G+ F+ +D+  
Sbjct  296   YKEQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQ--TFKTATVSISGDHFMAKDIGF  353

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAGA+ HQAVALR+ ADM+  YNC ++ YQDTLY H+ RQFYRDCTI+GT+DFIFG+A
Sbjct  354   ENSAGAIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDA  413

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +L
Sbjct  414   IAVFQNCKLVVRKPLENQQCIVTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYL  473

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPW+E SRT++M + IDD++ PEGW  W G   L+T +Y+EY N+G GA    RVKW G
Sbjct  474   GRPWRELSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAG  533

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  534   IKK-LTPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   388 bits (997),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 204/447 (46%), Positives = 276/447 (62%), Gaps = 53/447 (12%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLL-----------------  2595
             GEKMK+LLKT+ E++SN LA+V+++   + SL++    SR+LL                 
Sbjct  178   GEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQLGNAASRKLLLSEKIGYGGDPTDYAPG  237

Query  2594  EEPAPLKDDH-----------------------------GNPVDSTDEILSPF-ADPATR  2505
             EEP    D +                             G+P D        F  D   R
Sbjct  238   EEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGYGGDPTDYAPGEEPHFNLDSNRR  297

Query  2504  HLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSKKN  2328
             HLL+A   K + VVAQDGSG++ +I+AA+ S+P  NN+  VI +KAGVYKEYV IP K N
Sbjct  298   HLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVYKEYVQIPKKMN  357

Query  2327  NIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAV  2148
              I  +G+GP KT I+G +N  +     TY   TV V  + F+ +D+  EN+AGA+ HQAV
Sbjct  358   KIVLIGDGPLKTRISGRKNFAEGVK--TYHTATVAVNADDFLAKDIGFENTAGALGHQAV  415

Query  2147  ALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALR+S D A  YN H++ YQDTLY H+YRQ+YRDC+ISGT+DFIFG+A  +FQNCK +VR
Sbjct  416   ALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALALFQNCKFVVR  475

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP  NQ CM+TAQGR +R      V+Q+ +I+AEPAL  A+PP+KV+LGRPWK  SRT+I
Sbjct  476   KPGPNQACMITAQGRVERHSLGVTVIQNGDIVAEPALLQASPPHKVYLGRPWKLLSRTII  535

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + I   + PEGW+ W GT  LDT +YAEYQNRGPG+    RV WKG ++ +SP++A+ 
Sbjct  536   MQSNIGGFIAPEGWAPWAGTFALDTLYYAEYQNRGPGSDLKARVTWKGIQK-LSPQMAES  594

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +T G     DE W+  + +P+ P  +Q
Sbjct  595   WTGGKLFGGDE-WIRGSGVPYVPTMMQ  620



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   389 bits (998),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/403 (49%), Positives = 262/403 (65%), Gaps = 10/403 (2%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE+MK  LKTS ELT NALA+V ++   +  L+IP L+RR L       +    P  + D
Sbjct  193   GERMKKALKTSGELTENALAMVDEISSILNQLQIPALNRRRLFSTKESAESSETPTTAED  252

Query  2540  EILSPFADPATRHLLAAPPKA---DIVVAQDGSGKYKSINAALNSIPAI-NNRRIVILIK  2373
             +I +   +   + L   P  A   D+VVA+DG+G + +I  AL S+P    N+ I++ IK
Sbjct  253   DIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEALESLPKTKENKTIIMYIK  312

Query  2372  AGVYKEYVMIPSKKNNIAFV--GEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
              GVY E V I S+    +F+  G+GPT+T ITG+ N  D  P  T++  TV V   GFIC
Sbjct  313   EGVYSEIVEI-SRNLTGSFIMYGDGPTRTKITGSLNFIDGTP--TFKTATVSVNAHGFIC  369

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+ IEN+AGA KHQAVAL++ ADM   +NC ++ YQDTLY HS R F+RDCTISGT+D+
Sbjct  370   KDIGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTLYAHSGRHFFRDCTISGTIDY  429

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFGN   +FQNCKM++RKPM NQ  +VTAQGRK  R  +AIVLQ C I A+P+L      
Sbjct  430   IFGNGESIFQNCKMVIRKPMVNQANIVTAQGRKTEREVSAIVLQGCTISADPSLVPEKNV  489

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWKEFSRT+IM T IDD + P+GW  W G   L TC+YAE+ NRGPGA    R
Sbjct  490   FKSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQTCYYAEFNNRGPGAVLTNR  549

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKW G K  ++PE A+++T  P++ AD+ W+    IP+ PG +
Sbjct  550   VKWPGIKTPLTPEQAQEYTAAPYIQADD-WVKPLGIPYVPGLM  591



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   390 bits (1001),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 258/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SRRLL E  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+YK+IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +    +++ F+G+GP KT+I+GN+N +D     TYR  TV + G  FI 
Sbjct  288   IKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGNYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVA+R+ +D +  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  526   VTWAGIK-TLSEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   386 bits (992),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 258/398 (65%), Gaps = 16/398 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GEKMK LL  S +LTSN LA+V  +   +K L IPGL SRRLLE      D+  + V+  
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLEA----DDEFPSWVNGG  242

Query  2543  DEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
               +L     PAT        KAD +VAQDGSG+YK+I  A+  IP   N   VI IK GV
Sbjct  243   KRMLLLKETPAT-------IKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGV  295

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKE V +     ++  +G+GPTKT ITGN N  +     T++  TV + G+ F+ +D+  
Sbjct  296   YKEQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQ--TFKTATVSISGDHFMAKDIGF  353

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAGA+ HQAVALR+ ADM+  YNC ++ YQDTLY H+ RQFYRDCTI+GT+DFIFG+A
Sbjct  354   ENSAGAIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDA  413

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +L
Sbjct  414   IAVFQNCKLVVRKPLDNQQCIVTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYL  473

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPW+E SRT++M + IDD++ PEGW  W G+  L+T +Y+EY N+G GA    RVKW G
Sbjct  474   GRPWRELSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAG  533

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ ++PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  534   IKK-LTPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   389 bits (999),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 255/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SRRLL E  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  233   -----SWLDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+GN+N +D     TYR  TV + G  FI 
Sbjct  288   IKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGNYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVALR+ +D +  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVALRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R     V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPREVTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E   +FTP  ++  D  W+    +P++PG L
Sbjct  526   VTWAGIK-TLSDEDILKFTPAQYIQGD-TWVPGKGVPYTPGLL  566



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   385 bits (989),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 194/400 (49%), Positives = 262/400 (66%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-PGLSRRLL-EEPAPLKDDHGNPVDS  2547
             GEKMK++L+T+ +++SN LA+VS +     SL++    SR+LL EE A L          
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL----------  218

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                    F     R L+   P A  VVAQDGSG++K+I+AA+ S+P  NN+  VI +KAG
Sbjct  219   -------FISMKQRSLMGLQPNA--VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAG  269

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKEYV IP K N I  +G+GP KT I+G +N  +     TY   TV V  + F  +D+ 
Sbjct  270   VYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TYHTATVSVNADEFFAKDIG  327

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YRDC+ISGT+DFIFG+
Sbjct  328   FENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGD  387

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP KV+
Sbjct  388   AQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVY  447

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV+W 
Sbjct  448   LGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWP  507

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             G  ++ SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  508   GI-QHFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   385 bits (989),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 254/399 (64%), Gaps = 21/399 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNP-VDS  2547
              EKMK +L  + E+ SN LAIV+       SL++    SRRL+ E     D+   P +DS
Sbjct  176   AEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRLMGE-----DEQQQPGIDS  230

Query  2546  TDEILSPFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                    F + A R LLA      K +  VAQDGSG +K+I AAL+++P  +N   VI +
Sbjct  231   -------FVEFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATFVIHV  283

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             KAGVYKE V+IP K NN+   G+GP KT +  N+N  D     T+   T+ V  +GF+ +
Sbjct  284   KAGVYKETVIIPKKVNNVVIYGDGPNKTRVVNNKNYADGVE--TFHTATLAVNSDGFMAK  341

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  ENSAGA KHQAVA+R+S D A  YN  ++ YQDTLY H YRQ YR+CTISGT+DFI
Sbjct  342   DIAFENSAGASKHQAVAVRVSGDKAIFYNVVMDGYQDTLYAHGYRQLYRNCTISGTIDFI  401

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQ C+MIVRKP  NQ CMVTAQGRKD+R     V+Q  EI+ EP   A  P  
Sbjct  402   FGDATAVFQKCRMIVRKPDINQNCMVTAQGRKDQRSIGITVIQDSEIVPEPGFTAVVPKI  461

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
               FLGRPWKE+SRT+IM T+ID  + P GWS W G   L+T +Y EYQNRGPG+ T KRV
Sbjct  462   DAFLGRPWKEYSRTIIMQTYIDGFIDPAGWSPWMGNYALNTLYYGEYQNRGPGSDTSKRV  521

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              WKG K+ I+PE+A+ FT     + D  W+  + +P++P
Sbjct  522   TWKGIKK-ITPELAQTFTAQKVFLND-GWVTNSSVPYTP  558



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   397 bits (1020),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 263/402 (65%), Gaps = 30/402 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK  LK SMELTSNALA+V+++  F++++ +   S                      
Sbjct  174   GQKMKDALKISMELTSNALAMVAEISTFLEAMGMQSFSE---------------------  212

Query  2540  EILSPFADPATRHLLAAPPK---ADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
               L  +AD   R LL A PK    D+VVA+DGSGKY++IN AL  IP  +N+  V+ IK 
Sbjct  213   --LPDWADFNKRKLLTASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKE  270

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+E V I S   ++  VG+GPTKT ITG+ N  D    GTY+  TV V+G+ FI +++
Sbjct  271   GVYEEKVQINSSLTHLMMVGDGPTKTRITGHLNFIDG--TGTYQTATVAVQGDDFIAKEI  328

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA KHQAVALR+SAD +  YNCH++ YQDTLY H+YRQFY+DC ISGTVDFIFG
Sbjct  329   GFENSAGAAKHQAVALRVSADKSIFYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFG  388

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  VFQ C ++VRKPM NQ+C+VTAQGRKD R    IV+Q+C  +A+P L         
Sbjct  389   DSAAVFQGCTLVVRKPMDNQQCIVTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILS  448

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM +F+DD + P+GW  W  T  L+T +Y E+ NRGP A   KRVKW
Sbjct  449   YLGRPWKEYSRTIIMESFLDDFIQPDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKW  508

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              G K  + P   ++FTPG FL  + +W+   Q+P++ GF+ P
Sbjct  509   PGVKE-LPPSRVQRFTPGEFLDGN-RWIPPTQVPYAAGFIFP  548



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   388 bits (997),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 257/401 (64%), Gaps = 24/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT+++LT N LAIV+++ DF+  ++I GL SRRLL         +G P    
Sbjct  188   GETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLNSRRLLSS-------NGYP----  236

Query  2543  DEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LLAA     K DIVVAQDGSG+Y +IN AL  +P   N   V+ IK
Sbjct  237   -----SWVDARARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIK  291

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AGVYKEY+ +     ++ F+G+GP KT+I+G++  +D     TYR  TV + G+ FI +D
Sbjct  292   AGVYKEYIQVNKSMTDLVFIGDGPDKTIISGDKGFKDGIT--TYRTQTVAIVGDRFIAKD  349

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +DM+  YNC  + YQDTLYTHS+RQF+RDCTISGT+DF+F
Sbjct  350   IGFENTAGAIKHQAVAVRVQSDMSVFYNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLF  409

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C+I  EP   +    +K
Sbjct  410   GDAAAVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSK  469

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK +SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG+    RV 
Sbjct  470   AYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWNGDFGLSTLFYSEIQNTGPGSDVVNRVT  529

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+  + ++  QFTP  F+  D  W+    +P++PGF 
Sbjct  530   WAGIKKLTNNDLL-QFTPAQFIQGDS-WIPATGVPYTPGFF  568



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   387 bits (993),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 256/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SRRLL +  P            
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSRRLLAQEIP------------  234

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  235   -----SWVDQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVH  289

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  290   IKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIA  347

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AGA+KHQAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  348   KNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  407

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  408   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKET  467

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   R
Sbjct  468   SKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANR  527

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  528   VTWPGIKTLSNEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   385 bits (989),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/399 (49%), Positives = 256/399 (64%), Gaps = 18/399 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M   L +S  LTSNALAI+  +   + S ++  L RRLL       DD G   +    
Sbjct  193   DNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLGRRLLS------DDEGERGE----  242

Query  2537  ILSPFADPATRHLLAAPPKA---DIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                 +     R LLA   K    D+ VAQDGSGKYK+I  AL+++P   N   VI IK G
Sbjct  243   -FPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFVIYIKEG  301

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKE VM+     N+   G+GPTKT ITG+ N  D     T++  T+ V G+GFI ++L 
Sbjct  302   VYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTS--TFKTATLAVVGDGFIGKNLG  359

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             +EN+AGA KHQAVALR+ +D +  Y C ++ YQDTLYTH+ RQFYR+CTISGT+DF+FG+
Sbjct  360   VENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGD  419

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A VVFQNC M+VRKPMANQ+C+VTAQGRKDR  A  IVL +C I A+P L +A+     +
Sbjct  420   AAVVFQNCLMLVRKPMANQQCIVTAQGRKDRHEATGIVLHNCTISADPTLSSASTTTVSY  479

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM + ID ++  +GW  W G   L TC+Y E  NRGPGA+T KRV WK
Sbjct  480   LGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEFGLKTCFYTEIGNRGPGAATTKRVTWK  539

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GYK+ +    A ++T   F+   + WL +  +PF+PG +
Sbjct  540   GYKK-VDLTHAHKYTVQQFIQG-KTWLPKTGVPFTPGLM  576



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   387 bits (993),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 258/401 (64%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+V+++ +++  ++IP + SRRLL +  P            
Sbjct  123   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFP------------  170

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D  TR LL +P    KADIVVAQDGSG+YK+IN ALN +P   N   V+ IK
Sbjct  171   -----SWMDGRTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIK  225

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKEYV +     ++ F+G+GP KTVI+G++N +D     TYR  TV + G+ FI ++
Sbjct  226   GGIYKEYVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGIT--TYRTATVAIVGDHFIAKN  283

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  284   MGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  343

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I  EP        +K
Sbjct  344   GDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSK  403

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+ M TFI D + PEGW  W G   LDT +Y+E +N GPGA   KRV 
Sbjct  404   SYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVT  463

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E   +FTP  ++  D  W+    +P+ PG  
Sbjct  464   WPGIKK-LSEEEILKFTPAEYIQGD-AWIPGKGVPYIPGLF  502



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   384 bits (986),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 260/398 (65%), Gaps = 20/398 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMKHL+KT+ E++SN LA+V+ +   + SL+I GLS R L     L ++ G       
Sbjct  168   GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKL-----LSEEEG-------  215

Query  2540  EILSPFADPATRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
                + F     R LLAA   K + VVA DGSG++ +I+AA+ S+P  NN+  VI +KAG+
Sbjct  216   ---ALFLSNNQRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGL  272

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV IP K N I  +G+GP KT I+G +N  +     T+   TV V  + F+ +D+  
Sbjct  273   YKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVAVSADEFMAKDIGF  330

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YRDC+ISGT+DFIFG+A
Sbjct  331   ENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDA  390

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL  A PP KV+L
Sbjct  391   LALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYL  450

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+    RVKW G
Sbjct  451   GRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPG  510

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + + + ++A+ +T G     DE W+  +  P+ P  +
Sbjct  511   IQ-HFTQQMAESWTGGRIYGGDE-WIRISGTPYVPTMM  546



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   386 bits (991),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 257/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  +EIPGL SRRLL +  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMEIPGLNSRRLLAQEIP------------  232

Query  2543  DEILSPFADPATRHLLA-----APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL      +  K DIVVAQDGSG+Y +IN AL ++P   N   V+ 
Sbjct  233   -----SWVDQRGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+GN+N +D     TYR  TV + G+ FI 
Sbjct  288   IKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGIT--TYRTATVAIVGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AG +KHQAVA+R+ +D +  +NC  + YQDTLYTHS+RQFYRDCTISGT+DF
Sbjct  346   KNIGFVNTAGPIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFYRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   LDT +Y+E QN GPGA+   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALASR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K   + E+ K FTP  ++  +  W+    +P++PG L
Sbjct  526   VTWPGIKTLSNDEILK-FTPDQYIQGN-VWVPGKGVPYTPGLL  566



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   383 bits (984),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/398 (49%), Positives = 259/398 (65%), Gaps = 20/398 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMKHL+KT+ E++SN LA+V+ +   + SL+I GLS R L     L ++ G       
Sbjct  168   GEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKL-----LSEEEG-------  215

Query  2540  EILSPFADPATRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
                + F     R LLAA   K + VVA DGSG++ +I+AA+ S+P  NN+  VI +KAG+
Sbjct  216   ---ALFLSNNQRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGL  272

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV IP K N I  +G+GP KT I+G +N  +     T+   TV V  + F+ +D+  
Sbjct  273   YKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVAVSADEFMAKDIGF  330

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YRDC+ISGT+DFIFG+A
Sbjct  331   ENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDA  390

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL  A PP KV+L
Sbjct  391   LALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPVKVYL  450

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+    RVKW G
Sbjct  451   GRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRVKWPG  510

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + + + ++A+ +T G     DE W+     P+ P  +
Sbjct  511   IQ-HFTQQMAESWTGGRIYGGDE-WIRITGTPYVPTMM  546



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   384 bits (986),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/401 (48%), Positives = 258/401 (64%), Gaps = 14/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+  LKTS ELTSN LA+VS++    K+L I    RRLL+  A   D+         
Sbjct  182   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQAAATATDEKRF---QKA  237

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +I+  + D     L  A P   K D+VV++ G GKYK+IN AL  IP  N  ++ VI +K
Sbjct  238   KIIPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVK  297

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+V       N+  +G+GPTKTVITG +N  +     TY+  TV V G+ FI +D
Sbjct  298   EGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQ--TYQTATVAVVGDYFIAKD  355

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ HQAVALR+ +D++  YNC+++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  356   IGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  415

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTA GR DRR   A++LQ+C I  E         NK
Sbjct  416   GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTALILQNCTISGESGYD--KELNK  473

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK ++R ++M + IDD++ PEGW  W G    +TCW+ E+ NRG GA   KRV 
Sbjct  474   AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVT  533

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  534   WRGMKK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  572



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   386 bits (991),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 259/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +++  +++PGL SRRLL +  P            
Sbjct  186   GETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLNSRRLLADEVP------------  233

Query  2543  DEILSPFADPATRHLL--AAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL  AAP    KADIVVAQDGSG+Y +IN A+ ++P   N   V+ 
Sbjct  234   -----SWVDQRGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVH  288

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+GN+N +D     TYR  TV + G+ FI 
Sbjct  289   IKAGIYKEYVQVNRSMTHLVFIGDGPDKTIISGNKNFKDGIT--TYRTATVAIVGDHFIA  346

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVA+R+ +D A  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  347   KNIGFENTAGAIKHQAVAVRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  406

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C I  EP   A    
Sbjct  407   VFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQT  466

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM +FI D V P+GW  W G   L T +Y+E QN GPGA+   R
Sbjct  467   SKAYLGRPWKEYSRTIIMNSFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNIGPGAALASR  526

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K   + E+ K F P  F+ +D  W+    +P+ PG L
Sbjct  527   VTWAGIKTLSNEEILK-FAPAEFIQSDA-WVPGKGVPYIPGLL  567



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   382 bits (981),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 262/400 (66%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLL-EEPAPLKDDHGNPVDS  2547
             GEKMK++L+T+ +++SN LA+VS +     SL++    SR+LL EE A L          
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSTASRKLLSEEEADL----------  218

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                    F     R L+   P A  VVAQDGSG++K+I+AA+ ++P  NN+  VI +KAG
Sbjct  219   -------FISIKQRRLMGLQPNA--VVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAG  269

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKEYV IP K N I  +G+GP KT I+G +N  +     T+   TV V  + F  +D+ 
Sbjct  270   VYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIG  327

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YRDC+ISGT+DFIFG+
Sbjct  328   FENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGD  387

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP KV+
Sbjct  388   AQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVY  447

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV+W 
Sbjct  448   LGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWP  507

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  508   GIQ-HFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   381 bits (978),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/398 (47%), Positives = 262/398 (66%), Gaps = 25/398 (6%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDSTDEI  2535
             MK  LKT+++LT N LA+VS++ +++  +E+P + SRRLL +  P               
Sbjct  1     MKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP---------------  45

Query  2534  LSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
                + D   R LL AP    K D+VVAQDGSG+YK+IN AL ++P  NN   V+ IK+G 
Sbjct  46    --SWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGT  103

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +     N+ F+G+GPTK++I+GN++ +D     TYR  TV + G+ FI +++  
Sbjct  104   YKEYVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKNMGF  161

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGA+ +QAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTI+GT+DF+FG+A
Sbjct  162   ENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDA  221

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNC ++VRKP+ANQ C +TA GRKD R +   VLQ C I  E    A    +K +L
Sbjct  222   AAVFQNCTLLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYL  281

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKE+S+T+IM TFI D +  EGWS WQG   LDT +Y+E +N GPGA+   RV W+G
Sbjct  282   GRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQG  341

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K+ +S E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  342   IKK-LSEEEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  377



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   386 bits (991),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 257/403 (64%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SRRLL E  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+YK+IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +    +++ F+G+GP KT+I+GN+N +D      YR  TV + G  FI 
Sbjct  288   IKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITA--YRTATVAIVGNYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVA+R+ +D +  +NC  + YQ+TLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQNTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  526   VTWAGIK-TLSEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   383 bits (983),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 192/401 (48%), Positives = 259/401 (65%), Gaps = 14/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+  LKTS ELTSN LA+VS++    K+L I    RRLL+  A   D++        
Sbjct  182   GEKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIK-TGRRLLQAAATATDENRF---QRA  237

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +I+  + D     L  A P   K D+VV+  G GKYK+IN AL  IP  N  ++ VI +K
Sbjct  238   KIIPAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVK  297

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+V       N+  +G+GPTKTVITG +N  +     TY+  TV V G+ FI +D
Sbjct  298   EGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQ--TYQTATVAVVGDYFIAKD  355

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ HQAVALR+ +D++  YNC+++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  356   IGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  415

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK
Sbjct  416   GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYN--KELNK  473

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK ++R ++M + IDD++ PEGW  W GT   +TCW++E+ NRG GA   KRV 
Sbjct  474   AYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVT  533

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  534   WSGMKK-LTPEHAADFTAGKFMFGD-RWILPSGVPYVAGMM  572



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   382 bits (982),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 196/397 (49%), Positives = 259/397 (65%), Gaps = 15/397 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G++MK  LK SMEL++N LAIVS +   I SLE  G  RRLL++  P+   HG      D
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQDDLPVLG-HG------D  240

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             +I   + D   R LLAAP    KADIVVA+DGSG + +I  AL+ +P  +++  V+ IKA
Sbjct  241   QIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKA  300

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y+EY+       N+  +G+G   T I GN+N  D     TY   TV+V G+ F+ +++
Sbjct  301   GIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGI--NTYHTATVVVLGDNFVAKNI  358

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               E +AGA+KHQAVALR+SAD A  YNC ++ +QDTLYT + RQF RDC++SGT+DF+FG
Sbjct  359   GFEKNAGAIKHQAVALRVSADYALFYNCSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFG  418

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNCK ++RKP+ NQ+C+VTAQGRK RR  +AIV+Q+  I A P L       K 
Sbjct  419   HASAVFQNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKS  478

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S   RVKW
Sbjct  479   YLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKW  538

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              G K  I  + A  FTPG F      W+    IP++P
Sbjct  539   NGIK-TIDRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   386 bits (992),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 264/401 (66%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT+++LT N LA+VS++ +++  +E+P + SRRLL +  P            
Sbjct  183   GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP------------  230

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K D+VVAQDGSG+YK+IN AL ++P  NN   V+ IK
Sbjct  231   -----SWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIK  285

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             +G YKEYV +     N+ F+G+GPTK++I+GN++ +D     TYR  TV + G+ FI ++
Sbjct  286   SGTYKEYVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKN  343

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ +QAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTI+GT+DF+F
Sbjct  344   MGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLF  403

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ANQ C +TA GRKD R +   VLQ C I  E    A    +K
Sbjct  404   GDAAAVFQNCTLLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSK  463

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+S+T+IM TFI D +  EGWS WQG   LDT +Y+E +N GPGA+   RV 
Sbjct  464   AYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVT  523

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K+ +S E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  524   WQGIKK-LSEEEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   384 bits (987),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 259/401 (65%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+VS++ +++  ++IP + SRRLL +  P            
Sbjct  183   GETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEMNSRRLLSQEFP------------  230

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K DIVVAQDGSG+YK+IN ALN +P   N   V+ IK
Sbjct  231   -----SWMDGRARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIK  285

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+YKEYV +     ++ F+G+GP KTVI+G+++ +D     TY+  TV + G+ FI ++
Sbjct  286   AGIYKEYVQVNRSMTHLVFIGDGPEKTVISGSKSYKDGIT--TYKTATVAIVGDHFIAKN  343

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  344   IGFENTAGAIKHQAVAIRVLSDESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  403

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K
Sbjct  404   GDAAAVFQNCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSK  463

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+IM TFI D + PEGW  W G   L+T +Y+E QN GPGA   KRV 
Sbjct  464   AYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLGDFGLNTLFYSEVQNTGPGAPITKRVT  523

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E    FTP  ++  D  W+    +P+ PG  
Sbjct  524   WPGIKK-LSEEEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  562



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   381 bits (978),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 261/400 (65%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-PGLSRRLL-EEPAPLKDDHGNPVDS  2547
             GEKMK++L+T+ +++SN LA+VS +     SL++    SR+LL EE A L          
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL----------  218

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                    F     R L+   P A  VVAQDGSG++K+I+AA+ S+P  NN+  VI +KAG
Sbjct  219   -------FISMKQRSLMGLQPNA--VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAG  269

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKEYV IP K N I  +G+GP KT I+G +N  +     T+   TV V  + F  +D+ 
Sbjct  270   VYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIG  327

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+
Sbjct  328   FENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGD  387

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP KV+
Sbjct  388   AQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVY  447

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV+W 
Sbjct  448   LGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWP  507

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             G  ++ SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  508   GI-QHFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   382 bits (980),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 191/395 (48%), Positives = 258/395 (65%), Gaps = 17/395 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS ELTSN LA+++ + + +    I GL+  L         ++   + ST++
Sbjct  186   QDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDL--------GNYARKLLSTED  237

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
              +  +  P TR L+A     KA++VVAQDGSG+YK+IN ALN +P  N +  VI IK GV
Sbjct  238   GIPSWVGPNTRQLMATKGGVKANVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQGV  297

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFICRDL  2190
             Y E V +  K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++
Sbjct  298   YNEKVDVTKKMTHVTFIGDGPTKTKITGSLNF---YIGKVKTYHTATVAINGDHFTAKNI  354

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG   HQAVALR+S D A  YNC ++ YQDTLY HS+RQF+RDCTISGTVDFIFG
Sbjct  355   GFENTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFG  414

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A VV QNC ++VRKPM  Q CM+TAQGR D R ++ +VLQ+C I  EPA       NK 
Sbjct  415   DAKVVLQNCNIVVRKPMKGQSCMITAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKA  474

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T ID+I+ P GW  W G   L+T +YAEY+N GPG+   +RVKW
Sbjct  475   YLGRPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALNTLYYAEYENNGPGSDQAQRVKW  534

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              G K+ ISP+ A++FTP  FL  +  W+   ++P+
Sbjct  535   PGIKK-ISPKQARRFTPARFLRGN-LWIPPNRVPY  567



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   382 bits (982),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 191/402 (48%), Positives = 255/402 (63%), Gaps = 25/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL SR LL +  P   D   P    
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGLNSRGLLAQEIPSWVDQRGP----  242

Query  2543  DEILSPFADPATRHLLAAP----PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                         R L AA      K DIVVAQDGSG+Y +IN AL  +P   N   V+ I
Sbjct  243   ------------RLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHI  290

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             KAG+YKEYV +     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI +
Sbjct  291   KAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIAK  348

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++   N+AGA+KHQAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF+
Sbjct  349   NIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFL  408

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +
Sbjct  409   FGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTISGEPDYLAVKETS  468

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   RV
Sbjct  469   KAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRV  528

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  529   TWPGIKTLSNEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   384 bits (987),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 261/416 (63%), Gaps = 15/416 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRR--LLEEPAPLKDDHGNPVDST  2544
             EKMK  L +SMELTSNAL +++++     SL     SRR  LL + AP+   HGN     
Sbjct  178   EKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRRLLFDEAPVLG-HGN-----  231

Query  2543  DEILSPFADPATRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              E+L  + D   R LLAA   K DIVVA+DGSGKYK+IN AL +IP   N+  V+ IK G
Sbjct  232   -ELLPDWVDMRRRRLLAAKEIKPDIVVAKDGSGKYKTINEALKNIPNNRNQTYVLYIKQG  290

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +Y E V   S   N+  +G+GPTKT ITGN+N +D  P  TY   T  V G+ FI +D+ 
Sbjct  291   IYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTP--TYLTATAAVMGDYFIAKDIG  348

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR++AD +  YNCH++ YQDTL  H+YRQFYRDC I GT+DF+FG+
Sbjct  349   FENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGD  408

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
                VFQNC + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +        K +
Sbjct  409   GAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYNEVKGEVKTY  468

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+S  +RVKW+
Sbjct  469   LGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKKERVKWQ  528

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
             G K  +     ++FT   FL  D  W+    IP++PG FL P  +   +   P  D
Sbjct  529   GVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLSPPQQDTSVEYSPVDD  582



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   380 bits (975),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 261/400 (65%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-PGLSRRLL-EEPAPLKDDHGNPVDS  2547
             GEKMK++L+T+ +++SN LA+VS +     SL++    SR+LL EE A L          
Sbjct  169   GEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEADL----------  218

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                    F     R L+   P A  VVAQDGSG++K+I+AA+ S+P  NN+  VI +KAG
Sbjct  219   -------FISMKQRSLMGLQPNA--VVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAG  269

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKEYV IP K N I  +G+GP KT I+G +N  +     T+   TV V  + F  +D+ 
Sbjct  270   VYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVK--TFHTATVSVNADEFFAKDIG  327

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+S D A  +N H++ YQDTLY H+YRQ+YR C+ISGT+DFIFG+
Sbjct  328   FENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFIFGD  387

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP KV+
Sbjct  388   AQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPVKVY  447

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV+W 
Sbjct  448   LGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWP  507

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             G  ++ SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  508   GI-QHFSPQMAESWTENVMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   380 bits (977),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 257/401 (64%), Gaps = 14/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KM+  LKTS ELTSN LA+VS++    K+L I    RRLL++ A   D++        
Sbjct  181   GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQDAATATDENRF---QRA  236

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +I+  + D     L  A P   K D+VV++ G GKYK+IN AL  IP  N  ++ VI +K
Sbjct  237   KIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+V       N+  +G+GPTKTVITG +N  D     TY+  TV V G+ FI +D
Sbjct  297   EGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ--TYQTATVAVVGDYFIAKD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ HQAVALR+ +D++  YNC+++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  355   VGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK
Sbjct  415   GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNK  472

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPW   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV 
Sbjct  473   AYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVT  532

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  533   WSGMKK-LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   380 bits (976),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 257/401 (64%), Gaps = 14/401 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KM+  LKTS ELTSN LA+VS++    K+L I    RRLL++ A   D++        
Sbjct  184   GAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TGRRLLQDAATATDENRF---QRA  239

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +I+  + D     L  A P   K D+VV++ G GKYK+IN AL  IP  N  ++ VI +K
Sbjct  240   KIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVK  299

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E+V       N+  +G+GPTKTVITG +N  D     TY+  TV V G+ FI +D
Sbjct  300   EGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ--TYQTATVAVVGDYFIAKD  357

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ HQAVALR+ +D++  YNC+++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  358   VGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  417

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK
Sbjct  418   GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNK  475

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPW   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV 
Sbjct  476   AYLGRPWTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVT  535

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  536   WSGMKK-LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  574



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   381 bits (978),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 255/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  ++IPGL S RLL +  P            
Sbjct  187   GETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNSCRLLAQEIP------------  234

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + +   R LL A       K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  235   -----SWVNQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVH  289

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  290   IKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGIT--TYRTATVAIVGDYFIA  347

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AGA+KHQAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  348   KNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  407

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  408   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKET  467

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   R
Sbjct  468   SKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANR  527

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  528   VTWPGIKTLSNEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   380 bits (977),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 253/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++  F+  + IP L SRRLL +  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPELNSRRLLSQDIP------------  232

Query  2543  DEILSPFADPATRHLLAAP-----PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       KADIVVAQDGSG+Y +IN A+  +P   N   V+ 
Sbjct  233   -----SWVDQRGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAGVYKEYV +     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  288   IKAGVYKEYVQVNKSMTHLVFIGDGPDKTIISGSKNYKDGIT--TYRTATVAIIGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AGA+KHQAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  346   KNIGFVNTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDARESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNIGPGAALAGR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  526   VTWPGIK-TLSDEEILSFTPDQYIQGD-VWVPGKGVPYTPGLL  566



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   380 bits (975),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 258/403 (64%), Gaps = 19/403 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLL--EEPAPLKDDHGNPV-DS  2547
             EKMK  LKTSM L+SN L +VS++      L++  + RRL   EE + L      PV   
Sbjct  189   EKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMGRRLFSDEEESEL------PVLGH  242

Query  2546  TDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
             +DE  + +     R L+A  P   K +IVVA+DGSGKY +IN AL  IP  +    VI I
Sbjct  243   SDE--AEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYI  300

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKEYV I     N+  +G+G  KT ITG++N  D +P  T    TV+V G+ F  R
Sbjct  301   KEGVYKEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFP--TSLTATVVVLGDHFRAR  358

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  EN+AGA KHQAVALR++AD A  Y C ++ YQDTLYTH+ RQFYRDC +SGT+DF+
Sbjct  359   DIGFENTAGAHKHQAVALRVNADEAIFYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFV  418

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC+ IVR+PM NQ+C+VTAQGRK+RR  +AI++Q+   +A+P         
Sbjct  419   FGDAAAVFQNCRFIVRRPMDNQQCIVTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFEL  478

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA-STDKR  1659
               +LGRPWKEFSRT+IM +FIDD++ P GW  W G   L TC+Y E+ NRGPGA    +R
Sbjct  479   PAYLGRPWKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRR  538

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              KWKG K NI+ + A+ FTPG F   D  W+ R  IP+  G  
Sbjct  539   AKWKGVK-NITAKHARDFTPGSFFKGD-WWIKRTGIPYVSGMF  579



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   379 bits (972),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/409 (49%), Positives = 260/409 (64%), Gaps = 40/409 (10%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL------SRRLLEEPAPLKDDHGNP  2556
             EKMK+LLKT+ EL+SN LA+VS +   I  L++  L      SRRL              
Sbjct  185   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLF-------------  231

Query  2555  VDSTDEILSPFADPATRHLLAAPPKA----DIVVAQDGSGKYKSINAALNSIPAINNRRI  2388
               S D+ ++       R +L    KA    + VVAQDGSG++K+I  A++S+P  N +  
Sbjct  232   --SNDDWIN-------RRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTF  282

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEG  2214
             VI IKAGVYKE+V IP K N I F+G+GP KT ITG+++    + GG  T++  TV V  
Sbjct  283   VIYIKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKS----FAGGVKTFQTATVAVNA  338

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             E F  +++  EN+AGA  HQAVALR+S D A  YN  ++ YQDTLY H+YRQFY DC+IS
Sbjct  339   EEFTAKNIGFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSIS  398

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  
Sbjct  399   GTIDFIFGDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFL  458

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
             A  P    +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+
Sbjct  459   ATKPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGS  518

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
                 RV WKG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  519   GLANRVTWKGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  565



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   379 bits (972),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 198/407 (49%), Positives = 257/407 (63%), Gaps = 38/407 (9%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL------SRRLLEEPAPLKDDHGNP  2556
             EKMK+LLKT+ EL+SN LA+VS +   I  L++  L      SRRL      +K      
Sbjct  185   EKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSNDDWIK------  238

Query  2555  VDSTDEILSPFADPATRHLL--AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVI  2382
                             R +L   A  K + VVAQDGSG++K+I  A++S+P  N +  VI
Sbjct  239   ----------------RRVLRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVI  282

Query  2381  LIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEG  2208
              IKAGVYKE+V IP K N I F+G+GP KT ITG+++    + GG  T++  TV V  E 
Sbjct  283   YIKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKS----FAGGVKTFQTATVAVNSEE  338

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F  +++  EN+AGA  HQAVALR+S D A  YN  ++ YQDTLY H+YRQFY DC+ISGT
Sbjct  339   FTAKNIGFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGT  398

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  A 
Sbjct  399   IDFIFGDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLAT  458

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
              P    +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+  
Sbjct  459   KPAIDAYLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGL  518

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
               RV WKG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  519   ANRVTWKGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  563



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   383 bits (984),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 259/401 (65%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+V+++ +++  ++IP + SRRLL +  P            
Sbjct  184   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFP------------  231

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K DIVVAQDGSG+YK+IN ALN +P   N   V+ IK
Sbjct  232   -----SWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIK  286

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKEYV +     ++ F+G+GP KTVI+G+++ +D     TY+  TV + G+ FI ++
Sbjct  287   EGIYKEYVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGIT--TYKTATVAIVGDHFIAKN  344

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ AD +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  345   IAFENTAGAIKHQAVAIRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  404

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K
Sbjct  405   GDAAAVFQNCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSK  464

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+IM TFI D V PEGW  W G   L+T +Y+E QN GPGA+  KRV 
Sbjct  465   TYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVT  524

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E   +FTP  ++  D  W+    +P+  G  
Sbjct  525   WPGIKK-LSDEEILKFTPAQYIQGD-AWIPGKGVPYILGLF  563



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   381 bits (979),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 261/401 (65%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT+++LT N LA+VS++ +++  +E+P + SRRLL +  P            
Sbjct  183   GETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNSRRLLSQEFP------------  230

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K D+VVAQDGSG+YK+IN AL ++P  NN   VI IK
Sbjct  231   -----SWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIK  285

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             +G YKEYV +     N+ F+G+GP K++I+GN++ +D     TYR  TV + G+ FI ++
Sbjct  286   SGTYKEYVQVNRTMPNLVFIGDGPDKSIISGNKSFKDGIT--TYRTATVAIIGDNFIAKN  343

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+ +QAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTI+GT+DF+F
Sbjct  344   MGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLF  403

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ANQ C +TA GR D R +   VLQ C I  E    A    +K
Sbjct  404   GDAAAVFQNCTLLVRKPLANQACPITAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSK  463

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+S+T+IM TFI D +  EGWS WQG   LDT +Y+E +N GPGA+   RV 
Sbjct  464   AYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVT  523

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  524   WPGIKK-LSEEEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   378 bits (970),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 260/399 (65%), Gaps = 17/399 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M+ + KTS ELTSN LA+++ + + +    + G++  L          +   + S ++
Sbjct  185   QDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDL--------GKYARKLLSAED  236

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
              +  +  P TR L+A     KA++VVA DGSG+YK+IN ALN++P  N +  VI IK GV
Sbjct  237   GIPSWVGPNTRRLMATKGGVKANVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGV  296

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFICRDL  2190
             Y E V +  K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  +++
Sbjct  297   YNEKVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYLTATVAINGDNFTAKNI  353

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG   HQAVALR+SAD+A  YNC ++ YQDTLY HS+RQF+RDCT+SGTVDFIFG
Sbjct  354   GFENTAGPEGHQAVALRVSADLAVFYNCQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFG  413

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +  VV QNC ++VRKPM +Q CM+TAQGR D+R +  +VLQ+C I  EPA       NK 
Sbjct  414   DGIVVLQNCNIVVRKPMKSQSCMITAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKA  473

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T IDD++ P GW  W G   L+T +YAEY+N GPG++  +RVKW
Sbjct  474   YLGRPWKEFSRTIIMGTTIDDVIDPAGWLPWNGDFALNTLYYAEYENNGPGSNQAQRVKW  533

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              G K+ +SP+ A +FTP  FL  +  W+   ++P+   F
Sbjct  534   PGIKK-LSPKQALRFTPARFLRGN-LWIPPNRVPYMGNF  570



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   377 bits (968),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 191/402 (48%), Positives = 262/402 (65%), Gaps = 28/402 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M  L+ T+ EL+SNAL++V+   + I   +  GL+R+LL                   
Sbjct  173   DEMMKLMSTTRELSSNALSMVNSFGEMI--TQNTGLTRKLLSNS----------------  214

Query  2537  ILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                 F + + R LL  +  K + VV+  G G+YK+I  AL ++P  +    VILIKAG Y
Sbjct  215   --DSFVEASNRKLLQISASKPNAVVSASGGGQYKTIQEALQAVPKSSPTPFVILIKAGTY  272

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLT  2187
             KE++ I     N+  +GEGPTKT+ITG++ V    P    T+   T+ V G+GF+ +D+ 
Sbjct  273   KEHIQIEKNMLNVVLIGEGPTKTIITGDQAV---VPNRISTWHTATLGVCGDGFVMKDMG  329

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AG  K QAVALRI+AD A +YNC+++ YQDTLY HS RQFYRDCTI+GT+DF+FG+
Sbjct  330   IENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGD  389

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK+IVRKP  NQ CM+TAQGR  +      V+Q+C+I A+ AL +ANPP KV+
Sbjct  390   ASAVFQNCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADKALTSANPPVKVY  449

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-  1653
             LGRPWKEFS+T+IM + ID  V P GWS W  T + + TC+YAEYQNRGPGA+ DKRV  
Sbjct  450   LGRPWKEFSKTIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVST  509

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             W+GY+++IS +V   FT G F+   + WL    IP+  G ++
Sbjct  510   WRGYQKDISGDVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   378 bits (971),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 257/400 (64%), Gaps = 15/400 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
              E+MK +L TSM L+SNALA+VS++      L  P  S RRLL+  A        PV   
Sbjct  195   AEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSSHRRLLQFDA-------FPVIGH  247

Query  2543  DEILSP-FADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
              E   P + +   R L +AP   K DI+VA+DGSG YK+I  AL+ +P   N   +I IK
Sbjct  248   SEFEDPKWYEGGVRKLSSAPKINKPDIIVAKDGSGSYKTITEALDHVPKYGNETFIIYIK  307

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E++++     ++  +G+G  KT ITGN+N  D  P  TY   TV ++G+ F+ RD
Sbjct  308   EGVYNEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTP--TYHTATVAIQGDHFMARD  365

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAG  KHQAVALR+SAD A  Y C ++ YQDTLYTH+ RQFY DCTISGT+DF+F
Sbjct  366   IGFENSAGPEKHQAVALRVSADEAIFYRCSMDGYQDTLYTHAQRQFYCDCTISGTIDFVF  425

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I AEP        NK
Sbjct  426   GDATAVFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENK  485

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N GP A+  +RV 
Sbjct  486   AYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAESGNTGPAANKARRVT  545

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             W+G K+ I+      FTPG F   D +W+  + +P+ PG 
Sbjct  546   WRGIKQ-ITENHTADFTPGRFFRGD-KWIRLSGVPYIPGL  583



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   377 bits (968),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/397 (48%), Positives = 250/397 (63%), Gaps = 15/397 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS ELTSN LA+VS +  F+    I  ++  L          +   + ST++
Sbjct  184   QDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDL--------GSYARKLLSTED  235

Query  2537  ILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +  P TR L+AA      K + VVA DGSG++KSIN AL ++P  N    VI IK 
Sbjct  236   GFPTWMRPETRKLMAAVTGPKVKPNAVVALDGSGQFKSINDALKTVPKNNKFPFVIYIKQ  295

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+YKE V +      + F+G+GPTKT++TGN N        TY+  TV V GE F  +D+
Sbjct  296   GIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNF-GIGNVKTYQTATVAVNGENFTAKDI  354

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG   HQAVALR+SAD A  YNC ++ YQDTLY HS+RQFYRDCTISGT+D+IFG
Sbjct  355   GFENTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFG  414

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A   FQNCKM+VRKPM  Q CMVTAQGR D+R +  I+L +C I+ +PA       NK 
Sbjct  415   DAKSFFQNCKMVVRKPMGGQSCMVTAQGRTDKRESTGIILHNCRIMGDPAYIPVKSTNKA  474

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T IDDI+ P+GW  W G   LDT  Y EY+N G G+  + RVKW
Sbjct  475   YLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWNGNFALDTLEYGEYENNGSGSGQEMRVKW  534

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              G K+ +S   A QFT G FL  +  W+ R ++P++P
Sbjct  535   PGIKK-LSARQALQFTAGRFLRGN-TWIPRRRVPYTP  569



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   376 bits (965),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/402 (48%), Positives = 262/402 (65%), Gaps = 28/402 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M  L+ T+ EL+SNAL++V+   + I   +  GL+R+LL                   
Sbjct  173   DEMMKLMSTTRELSSNALSMVNNFGEMIT--QNTGLTRKLLSNS----------------  214

Query  2537  ILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
                 F + + R LL  +  K + VV+  G G+YK+I  AL ++P  +    VILIKAG Y
Sbjct  215   --DSFVEASNRKLLQISASKPNAVVSTSGGGQYKTIQEALQAVPRSSPTPFVILIKAGTY  272

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLT  2187
             KE++ I     N+  +GEGPTKT+ITG++ V    P    T+   T+ V G+GF+ +D+ 
Sbjct  273   KEHIEIEKNMLNVVLIGEGPTKTIITGDQAV---VPNRISTWHTATLGVCGDGFVMKDMG  329

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AG  K QAVALRI+AD A +YNC+++ YQDTLY HS RQFYRDCTI+GT+DF+FG+
Sbjct  330   IENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGD  389

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK+IVRKP  NQ CM+TAQGR  +      V+Q+C+I A+ AL +ANPP KV+
Sbjct  390   ASAVFQNCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADQALTSANPPVKVY  449

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-  1653
             LGRPWKEFS+T+IM + ID  V P GWS W  T + + TC+YAEYQNRGPGA+ DKRV  
Sbjct  450   LGRPWKEFSKTIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVST  509

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             W+GY+++IS +V   FT G F+   + WL    IP+  G ++
Sbjct  510   WRGYQKDISGDVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   377 bits (968),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 257/402 (64%), Gaps = 22/402 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP----GLSRRLLEEPAPLKDDHGNPVD  2550
             E M+ + KT+ +LTSN LAI + LD+ +K   IP      SR   +E         + ++
Sbjct  194   EIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIPIPFLTTSRDSTDE---------DSIE  244

Query  2549  STDEILSPFADPATRH---LLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI  2388
                  L+ F D  T H   LLA      +A+ VVA+DGSG+Y++I  AL ++P  N RR 
Sbjct  245   PVGRQLTEFPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNERRF  304

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEG  2208
             VI IK+GVY E V +  K  ++ F+G+GPTKT++TGN +        TYR  TV V G+ 
Sbjct  305   VIYIKSGVYAENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRIS-TYRTSTVAVNGDW  363

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F+ +D+  EN+AG   HQAVALR+SAD A  YNC ++ YQDTLY H++RQFYRDC ISGT
Sbjct  364   FMAKDMAFENTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLYVHTHRQFYRDCRISGT  423

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG+A  VFQNC+ +VR+PM NQ+C+VTAQGRKDRR    IV+    I+ +P     
Sbjct  424   IDFVFGDAKAVFQNCQFVVRRPMENQQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYLPV  483

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                N+ +LGRPWKE+SRT+IM + IDDI+ PEGW  W  T  LDT +YAEYQN GPG+  
Sbjct  484   KTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALDTLYYAEYQNTGPGSDQ  543

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
               RV+W G + ++S   A Q+TP  FL  +  W+ + ++P++
Sbjct  544   AGRVRWNGIQ-HLSDSAATQYTPDNFLRGN-TWIPKTRVPYA  583



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   376 bits (965),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 257/403 (64%), Gaps = 16/403 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMKH L T+ +LTSN LA+V+++   + SL +    RRLL       +    P     
Sbjct  184   GEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGSNAKNAP----K  239

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAIN-NRRIVILIK  2373
              I +   +  +  +    P   K D VVA+DGSG+Y++I  A+  IP  N ++  VI +K
Sbjct  240   VIPTWINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVK  299

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFIC  2199
              GVY EYVMI     N+  +G+G TKT +TG++N    +  G  T++  TV+V G+ FI 
Sbjct  300   EGVYSEYVMIDKYMTNVMLIGDGATKTKVTGSKN----FAAGVQTFQTATVVVVGDYFIA  355

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+ IENSAGA  HQAVALR+ +D++  Y C ++ YQDTLYT ++RQFYRDCTISGT+DF
Sbjct  356   KDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDF  415

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I  +P        
Sbjct  416   IFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDK  475

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KR
Sbjct  476   NKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSDMSKR  535

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKW G K N+  + A  FT G F+  D +W+  + +P+  G +
Sbjct  536   VKWSGIK-NLGADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   376 bits (965),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 260/404 (64%), Gaps = 26/404 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             G+KMK +L TS +LTSN LA+V+ L   ++ L++ GL+ R+LL +        GN     
Sbjct  195   GQKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLAQ--------GN-----  241

Query  2543  DEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
              +    +  PA R LLA  P   K ++VVAQDGSG+YK+IN A+ +IP   N   V+ IK
Sbjct  242   -DNFPSWLSPAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIK  300

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGT--YRCGTVIVEGEGFIC  2199
              GVYKE V       +I  +G+GPTKT ITG+ +    + GG   Y+  TV V G  F+ 
Sbjct  301   EGVYKEVVTFSRSLTHIMLIGDGPTKTKITGDLS----FAGGVQIYKTATVSVSGSHFMA  356

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+  ENSAGA  HQA+AL++ +DM+  YNC ++ YQ+TL++H+YRQFYR+CTI+GT+DF
Sbjct  357   KDIGFENSAGATGHQAIALKVQSDMSVFYNCQIDGYQNTLFSHTYRQFYRECTITGTIDF  416

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             I G+A  VFQNCKM+VRKP+ NQ C +TAQGR + R     VLQ+C I AE         
Sbjct  417   ISGDAAAVFQNCKMVVRKPLENQRCTITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLD  476

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +  FLGRPWK +SRT++M + IDDI+ P+GW+ W GT  +DTC  +EY NRGPGA+   R
Sbjct  477   SPSFLGRPWKPYSRTIVMQSSIDDIIDPKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSR  536

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             V WKG  + +SP+ A+ FT G FL  D  W+    +P++ G ++
Sbjct  537   VTWKGIVK-LSPQDAEAFTAGKFLEGDS-WIAATGVPYTSGMMK  578



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   380 bits (975),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 255/401 (64%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+VS++  ++  L+IP +S RRLL +  P            
Sbjct  182   GETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMSSRRLLSQDFP------------  229

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K DIVVAQDGSG+YK+IN AL ++P   N   V+ IK
Sbjct  230   -----SWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIK  284

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKEYV +     ++ F+G+G  KTVITG++N +D     TY+  TV + G+ FI ++
Sbjct  285   GGIYKEYVQVNRSMTHLVFIGDGSDKTVITGDKNYKDGI--TTYKTATVAIVGDHFIAKN  342

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AG +KHQAVA+R+ AD +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  343   IGFENTAGPIKHQAVAIRVLADQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  402

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K
Sbjct  403   GDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSK  462

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKEFSRT+IM TFI D + PEGW  W G   L+T +Y+E +N GPG+   KRV 
Sbjct  463   SYLGRPWKEFSRTIIMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVRNIGPGSGLTKRVT  522

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E    FTP  ++  D  W+    +P+ PG  
Sbjct  523   WPGIKK-LSEEEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  561



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   375 bits (962),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 188/396 (47%), Positives = 257/396 (65%), Gaps = 14/396 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + MK++ KTS ELTSN+LA+++ L   +  + I  ++  L         ++   + ST+E
Sbjct  180   QDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDL--------GNYARKLLSTEE  231

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              +  +    TR L+AA     KA++VVAQDGSG+YKSI+ AL ++P  N    VI IK G
Sbjct  232   GIPSWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALKAVPQNNRWPFVIYIKQG  291

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V +  K  ++ F+G+GPT+T ITGN N        TY+  TV + G+ F  +++ 
Sbjct  292   IYKENVDVTKKMTHVTFIGDGPTRTKITGNLNFR-IGKVKTYQTATVAINGDNFTAKNIG  350

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY H++RQFYRDCTISGTVDFIFG+
Sbjct  351   FENTAGPEGHQAVALRVSADYAVFHNCQMDGYQDTLYVHAHRQFYRDCTISGTVDFIFGD  410

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  +FQNC ++VRKPM  Q C+VTAQGR D R +  IVL +C I  EPA       NK +
Sbjct  411   AKSLFQNCNIVVRKPMGGQSCIVTAQGRTDVRESTGIVLHNCRITGEPAYIPVKAVNKAY  470

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK FSRT++M T ID+++ P GW  W G   L+T +YAEYQN GPG++  +RV W 
Sbjct  471   LGRPWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALNTLYYAEYQNSGPGSNQAQRVNWA  530

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             G K NISP  A +FTP  FL  +  W+ +  +P++P
Sbjct  531   GIK-NISPRQALKFTPARFLRGN-LWIPQTHVPYTP  564



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   375 bits (962),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 256/401 (64%), Gaps = 22/401 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE+MK ++KT+ +LTSN LAIV++L D   S +IP  +RRLL               +++
Sbjct  197   GEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIPNFNRRLLS--------------TSN  242

Query  2540  EILSPFADPATRHLLAAPPKA----DIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             E    +   + R L      A    D+VVAQDGSG   ++N AL  +PA   +  VI +K
Sbjct  243   EGFPEWVSQSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVK  302

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKE V I     N+  +G+GPTK+VIT   N  D     T+   TV V G GF+ ++
Sbjct  303   EGIYKENVNIEKNMTNVFMIGDGPTKSVITAGLNFVDGVK--TFNTATVGVVGNGFVAKN  360

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAGA KHQAVALR+ +D +  YNC ++ YQDTLY H++RQFYR+CTISGT+DFIF
Sbjct  361   MGFENSAGAEKHQAVALRVESDFSIFYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIF  420

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GN+ VVFQNC+++VRKP+ NQ+  +TAQGR DRR   A++L +C I+A+P          
Sbjct  421   GNSAVVFQNCQIVVRKPLDNQQNTITAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLP  480

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SR  I+ + IDD+V P GW  W G   L+T +Y+EY NRGPGA+T +RVK
Sbjct  481   TYLGRPWKEYSRAFILQSEIDDLVQPAGWLPWAGDFALNTLFYSEYDNRGPGAATAERVK  540

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K +I+ E A++FT   FL   E W+  A +PF PG +
Sbjct  541   WRGLK-SITAEHAEKFTVARFLGGTE-WIKNASVPFIPGLI  579



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   374 bits (960),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/398 (48%), Positives = 254/398 (64%), Gaps = 24/398 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGN---PVDS  2547
             + M  + +TS ELTSNALA+++ +  F            L E    L  DHGN    + S
Sbjct  185   QDMHKIFETSKELTSNALAMITSISSF------------LGEHITGLIGDHGNHARKLLS  232

Query  2546  TDEILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             T++ +  +  P TR L+A     K D+VVAQDGSG+YK+IN AL+ +P  N +  VI IK
Sbjct  233   TEDGIPSWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSVVPKANQKPFVIYIK  292

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFIC  2199
              GVY E V +P K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  
Sbjct  293   QGVYNEKVDVPKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNFTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY HS+RQFYRDCTISGTVDF
Sbjct  350   KNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+  VV Q C ++VRKPM  Q CM+TAQGR D R +  +VL +C I  EP        
Sbjct  410   IFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSI  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK+FSRT+IM T IDD+V P GW  W G+  L+T +YAEY+N GPG+   +R
Sbjct  470   NKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALNTLYYAEYENNGPGSDQSQR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             VKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  530   VKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   375 bits (962),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 195/418 (47%), Positives = 261/418 (62%), Gaps = 16/418 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  L  SM+LTSNAL++++++ D   SL      RRLL +  P+   HG       
Sbjct  177   GEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLG-HGI------  229

Query  2540  EILSPFADPATRHLLAA----PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             E+L  + D   R LLA       K D+VVA+DGSGKYK IN AL  IP   N+  V+ IK
Sbjct  230   ELLPDWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIK  289

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E V I S  +N+  +G+GPTKT ITGN++ +   P  TY+  TV + G+ F+ +D
Sbjct  290   EGVYDEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVP--TYQTSTVAIMGDYFVAKD  347

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AG  KHQA+ALR++AD +  YNCH++ YQDTL  H+YRQFYRDCTI GT+DF+F
Sbjct  348   IGFENTAGPDKHQALALRVAADKSIFYNCHMDGYQDTLCAHTYRQFYRDCTIRGTIDFVF  407

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC + VRKPM  Q C+VTAQGR D R  + IVLQ+C I+A+ +        K
Sbjct  408   GDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDLRQPSGIVLQNCSIVADESYNEVKGEAK  467

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK++SRT+IM + IDD++ PEGW  W  T   DT +Y E+ N+G G+S   RV 
Sbjct  468   TYLGRPWKQYSRTIIMESKIDDLIQPEGWLEWNKTFAFDTLFYTEFNNKGLGSSKADRVT  527

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF-LQP*NKQAKLSSHPTKD  1482
             W G K  +  E  ++FT   FL AD  W+    +P++ GF L P    + +   P  D
Sbjct  528   WSGVKE-LPIERVQRFTASNFLDAD-LWIPSTGVPYTSGFLLSPPQSDSSIVYSPVND  583



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   375 bits (962),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/385 (50%), Positives = 252/385 (65%), Gaps = 16/385 (4%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFADPATR  2505
             EL++N L IVS +   I SLE     RRLL++  P+   HG+           + D  TR
Sbjct  201   ELSANLLDIVSGISSAIPSLE-SFTHRRLLQDDLPVLG-HGDQ-------FPTWTDFGTR  251

Query  2504  HLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSK  2334
              LLAAP    KADIVVA+DGSG + +I  AL  +P  + +  V+ IKAGVY+EY+ I   
Sbjct  252   RLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKG  311

Query  2333  KNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQ  2154
               N+  +G+G   T I GN+N  D     T+   TV V G+ F+ +++  EN+AGA+KHQ
Sbjct  312   MINLVVIGDGKENTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQ  369

Query  2153  AVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALR+SAD A  YNC ++ +QDTLYTH+ RQFYRDC+ISGT+DF+FG+A  VFQNCK +
Sbjct  370   AVALRVSADYAIFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFL  429

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ+C+VTAQGRK RR  +A+++QS  I A P L       K +LGRPWKE+SRT
Sbjct  430   VRKPLENQQCIVTAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRT  489

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S + RVKW G K  I+ + A
Sbjct  490   IIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHA  548

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSP  1539
               FTPG FL  D  W+    IP++P
Sbjct  549   MDFTPGRFLKGDS-WIKATGIPYTP  572



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   375 bits (962),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 195/418 (47%), Positives = 260/418 (62%), Gaps = 26/418 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGN------  2559
             GEKMK  L  SMEL+ N LAI +++   +K LEI G+SRRLL+E  P+   HG+      
Sbjct  188   GEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQENLPVLG-HGDWSTYLD  246

Query  2558  -PVDSTDEILSPFA-----------DPATRHLLAAPP---KADIVVAQDGSGKYKSINAA  2424
              P+     +L                P  R L+AAPP   KADIVVA+DGSG + +INAA
Sbjct  247   IPMTRRRRLLQDNEPPVLGHGQFEIQPGVRRLMAAPPSRIKADIVVAKDGSGNFTTINAA  306

Query  2423  LNSIPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGT  2244
             ++SIP    +  VI IK GVY+E +    K  N+A +G+G  KT ITG+ N  D  P  T
Sbjct  307   MSSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITGHLNNADGVP--T  364

Query  2243  YRCGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSY  2064
             +R  TV V G+ F  +++  ENSAGA K QAVAL + +D +  YNC ++ YQDTLY HS 
Sbjct  365   FRTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDGYQDTLYVHSK  424

Query  2063  RQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQS  1884
             RQFYRDCTI+GT+DF+FG+A  VFQNC  +VR P+  Q+C+VTAQGR D R   AIV+Q+
Sbjct  425   RQFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPLNGQQCIVTAQGRTDARQPTAIVIQN  484

Query  1883  CEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWY  1704
                 A P L         +LGRPW  FSRT+IM +++DD++ PEGW+IW G   L+T +Y
Sbjct  485   STFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGWAIWDGPWGLNTSFY  544

Query  1703  AEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +E+ N GPG++   RV W+G KR IS   A  FTPG F+     W+   ++P++PGF 
Sbjct  545   SEFNNYGPGSNKTGRVTWRGIKR-ISQATAFGFTPGKFING-AAWIKPRRVPYTPGFF  600



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   376 bits (966),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 252/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S+L +F+  ++IP L SRRLL +  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQGIP------------  232

Query  2543  DEILSPFADPATRHLLA-----APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL      +  K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+G  KT+I+GN++ +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGIT--TYRTATVAIVGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVALR+ +D A  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    
Sbjct  406   LFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    R
Sbjct  466   SKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  526   VTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   373 bits (957),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 252/385 (65%), Gaps = 16/385 (4%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFADPATR  2505
             EL++N L IVS +   I SLE     RRLL++  P+   HG+           + D  TR
Sbjct  201   ELSANLLDIVSGISSAIPSLE-SFTHRRLLQDDLPVLG-HGDQ-------FPTWTDFGTR  251

Query  2504  HLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSK  2334
              LLAAP    KADIVVA+DGSG + +I  AL  +P  + +  V+ IKAGVY+EY+ I   
Sbjct  252   RLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQEYLEISKG  311

Query  2333  KNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQ  2154
               N+  +G+G   T I GN+N  D     T+   TV V G+ F+ +++  EN+AGA+KHQ
Sbjct  312   MINLVVIGDGRENTRIIGNKNFVDGI--NTFHTATVAVLGDNFVAKNIGFENNAGAIKHQ  369

Query  2153  AVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALR+SAD A  YNC ++ +QDTLYTH+ RQFYRDC+ISGT+DF+FG+A  VFQNCK +
Sbjct  370   AVALRVSADYAVFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFL  429

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ+C+VTAQGRK RR  +A+++Q+  I A P L       K +LGRPWKE+SRT
Sbjct  430   VRKPLENQQCIVTAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRT  489

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S + RVKW G K  I+ + A
Sbjct  490   IIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHA  548

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSP  1539
               FTPG FL  D  W+    IP++P
Sbjct  549   MDFTPGRFLKGDS-WIKATGIPYTP  572



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   376 bits (966),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 252/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S+L +F+  ++IP L SRRLL E  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLSEGIP------------  232

Query  2543  DEILSPFADPATRHLLA-----APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL      +  K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+Y EYV +     ++ F+G+GP KT+I+GN++ +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYNEYVQVNKSMTHLVFIGDGPDKTIISGNKSYKDGIT--TYRTCTVAIVGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVALR+ +D A  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    
Sbjct  406   LFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+S+T+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    R
Sbjct  466   SKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  526   VTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   372 bits (955),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 186/393 (47%), Positives = 249/393 (63%), Gaps = 13/393 (3%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS ELTSN LA+++ +  F+    + GL+  L          +   + ST +
Sbjct  185   QDMHKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDL--------GHYARKLLSTKD  236

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
              +  +  P TR L+A     K ++VVAQDGSG+YK+IN ALN +P  N    VI IK GV
Sbjct  237   GIPSWVGPNTRRLMATQGVVKPNVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQGV  296

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E V +  K  ++ F+G+GPTKT ITG+ N        TY   TV V G+ F  +++  
Sbjct  297   YNEKVNVTKKMTHVTFIGDGPTKTKITGSLNYH-IGKVKTYHTATVAVNGDNFTAKNIGF  355

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY HS+RQFYRDCTISGTVDFIFG+ 
Sbjct  356   ENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDG  415

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
              VV QNC ++VRKPM NQ CM+TAQGR D R +  +VL +C I+ EP        NK +L
Sbjct  416   KVVLQNCNIVVRKPMKNQSCMITAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYL  475

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKEFSRT+IM T ID+++ P GW  W G   L T +YAE++N GPG+   +RVKW G
Sbjct  476   GRPWKEFSRTIIMRTNIDNVIDPAGWLPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPG  535

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  536   IKK-LSPKQALRFTPARFLRGN-LWIPPNRVPY  566



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   372 bits (956),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 254/404 (63%), Gaps = 12/404 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KM++    S EL+SNAL I+++    ++ L+IPGL    L         H   +    
Sbjct  179   GTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIPGLDLSALNGGGDGGAAHRRLLGKAP  238

Query  2540  E------ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI  2388
             +       + P+     R ++  P    K D  V+Q G G+YK+I+ A+  +P  N    
Sbjct  239   KGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQSGGGQYKTISEAIAKVPMNNASPF  298

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEG  2208
             +I IKAG YKEY+ I  K+ N+  VG+GPTKT+ITG++N        T++  TV V G+G
Sbjct  299   IIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITGSKNFAAGI--NTFKTATVGVLGDG  356

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F+ RDLTIENS+G   HQAVAL++ +D+A +YNC     QDTLY    RQFYRDCT+SGT
Sbjct  357   FMARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTGNQDTLYALRGRQFYRDCTVSGT  416

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG+A  VFQNCK++VRKP  NQ+CMVTAQGR + +G  A + + C + +EP  KA 
Sbjct  417   IDFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEEKGPGAFIFEGCTVSSEPGYKAV  476

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                N  +LGRPWKE+S+T+ M++ IDD + P+GW+ WQG   LDT +YAE++N+G GA  
Sbjct  477   KAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQGNFALDTLYYAEFENKGAGADK  536

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              +RVKWKG K  +S + A  FTP    ++ ++W+  + +P++PG
Sbjct  537   SQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIPESGVPYAPG  579



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   371 bits (953),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 257/399 (64%), Gaps = 24/399 (6%)
 Frame = -2

Query  2714  KMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEI  2535
             +M  L+ T+ EL+ NAL++V+   + I   +  GL+R+LL +                  
Sbjct  174   QMVKLMNTTRELSINALSMVNSFGEMI--TQTTGLTRKLLSDS-----------------  214

Query  2534  LSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYK  2358
                F + + R L+  +  K + VV+  G G+YK+I  A+N++P  N    VILIKAG YK
Sbjct  215   -DSFVEASNRKLVQISASKPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFVILIKAGTYK  273

Query  2357  EYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIEN  2178
             E++ I   K N+ F+GEGPTKT+ITG+R V+       + C  + V GEGF+ +D+ IEN
Sbjct  274   EHIEIDKNKPNVVFIGEGPTKTIITGDRGVKHDGYATWHTCA-LGVAGEGFVIKDIGIEN  332

Query  2177  SAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             +AG  K QAVALRI+AD A V+NC ++ YQDTLY HS+RQFYRDCTI+GTVDFIFG+A  
Sbjct  333   TAGPAKEQAVALRINADKAVVHNCKIDGYQDTLYAHSFRQFYRDCTITGTVDFIFGDASA  392

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCK+IVRKP   Q CM+TAQGR         V+Q+C+I A+PA  +  PP K +LGR
Sbjct  393   VFQNCKLIVRKPGNAQACMITAQGRTVPTSFGGFVIQNCDIKADPAFTSTTPPIKAYLGR  452

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKG  1644
             PWKE+S+T+IM + ID  + P GW+ W  T + L TC+YAEYQNRGPGA+  KRV  W+G
Sbjct  453   PWKEYSKTIIMQSNIDAFIDPTGWAPWNSTDFGLHTCFYAEYQNRGPGAALGKRVSTWRG  512

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             Y++ IS +   ++T G F+   + WL +  IP+  G ++
Sbjct  513   YQKGISGDAINKYTAGKFINTQQPWLPKFDIPYDAGMMK  551



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   375 bits (963),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 252/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S+L +F+  ++IP L SRRLL +  P            
Sbjct  185   GETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSRRLLAQGIP------------  232

Query  2543  DEILSPFADPATRHLLA-----APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL      +  K DIVVAQDGSG+Y +IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVH  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+YKEYV +     ++ F+G+G  KT+I+GN++ +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGIT--TYRTATVAIVGDYFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AGA+KHQAVALR+ +D A  +NC  + YQDTLYTHS+RQF+RDCTISGT+DF
Sbjct  346   KNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    
Sbjct  406   LFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKET  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKE+S+T+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    R
Sbjct  466   SKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  526   VTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   373 bits (957),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/409 (47%), Positives = 258/409 (63%), Gaps = 28/409 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
              E+MK++LKTSM L+SNALA+VS++      L  P  S RRLL+  A     H       
Sbjct  195   AEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPSHRRLLQFDAFPVIGH-------  247

Query  2543  DEILSPFADPA-----TRHLL-----AAPP--KADIVVAQDGSGKYKSINAALNSIPAIN  2400
                 S F DP       R LL     +AP   K DI+VA+DGSG YK+I  AL  +P   
Sbjct  248   ----SEFEDPKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVPKYG  303

Query  2399  NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIV  2220
             N   +I IK G+Y E++++     N+  +G+G  KT ITGN+N  D     TY   TV +
Sbjct  304   NETFIIYIKEGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDG--TTTYHTATVAI  361

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
             +G+ F+  D+  ENSAG  KHQAVALR+SAD A  Y C ++ YQDTLYTH+ RQFYRDCT
Sbjct  362   QGDHFMVMDIGFENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLYTHAQRQFYRDCT  421

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGT+DF+FG+A  +FQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I A+P 
Sbjct  422   ISGTIDFVFGDATAIFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITADPD  481

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
                    NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N GP
Sbjct  482   YFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAELGNTGP  541

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A+  +RV W+G K+ I+   A  FTPG F   D +W+  + +P+ PG 
Sbjct  542   AANKARRVTWRGIKK-ITENHAADFTPGRFFRGD-KWIRLSGVPYIPGL  588



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   375 bits (964),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 195/409 (48%), Positives = 263/409 (64%), Gaps = 20/409 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPG----LSRRLLEEPAPLKDDHGNPVD  2550
             EKMK LLKT ME+TSN LA+V+ +   ++S+   G     SRRLL       +D    + 
Sbjct  177   EKMKELLKTGMEMTSNGLAMVTGISSVLQSIGGLGSYTTTSRRLLS-----NNDIIQIIG  231

Query  2549  STDEILSPFADPATRHLLAAPPKA---DIVVAQDGSGKYKSINAALNSIPAI----NNRR  2391
             ++D+ +  + D   R+LL +  K    ++VVA+DGSG Y ++N AL +I  I    NN+ 
Sbjct  232   NSDDEMPGWIDSNRRNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKT  291

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              V+ IK GVY+E V++ S   N+ F+G+GPTKT ITG  N  D     TY+  TV ++G+
Sbjct  292   FVLYIKEGVYEEKVVVNSSLTNLMFLGDGPTKTKITGRLNFIDG--TNTYQTATVAIQGD  349

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
              FI RD+  ENSAGA KHQAVALR+SADM   YNC ++ YQDTLY H+YRQFYRDC ISG
Sbjct  350   HFIARDIGFENSAGAEKHQAVALRVSADMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISG  409

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG++  VFQ C ++VRKP+ NQ+C+VTAQGRKD R    +VLQ+C  + +PA   
Sbjct  410   TIDFIFGDSAAVFQGCSLVVRKPLDNQDCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYP  469

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWKEFSRT+IM ++I D     GW  W     LDT +YAE+ NRGP ++
Sbjct  470   VRNTNKAYLGRPWKEFSRTIIMESYISDSFQAAGWLPWFEDFALDTLFYAEFNNRGPSSN  529

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
                RVKW G K  +  +  K+FT   FL   E+W+ R ++P+  GF+ P
Sbjct  530   KTDRVKWHGIKE-LPAKRVKRFTADEFLDG-ERWIPRTKVPYDGGFIFP  576



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   380 bits (977),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 257/401 (64%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+V+++ +++  ++IP + SRRLL +  P            
Sbjct  184   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLLSQEFPS-----------  232

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D  TR LL AP    KADIVVAQDGSG+YK+IN ALN +P   N   V+ IK
Sbjct  233   ------WMDGRTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIK  286

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKEYV +     ++ F+G+GP KTVI+G++N +D     TY+  TV + G+ FI ++
Sbjct  287   GGIYKEYVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGI--TTYKTATVAIVGDHFIAKN  344

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  345   MGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  404

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQ+C ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP        +K
Sbjct  405   GDAAAVFQSCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSK  464

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+ M TFI D + PEGW  W G   L+T +Y+E  N GPGA   KRV 
Sbjct  465   SYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVGNTGPGADVTKRVT  524

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E   + TP  ++  D  W+    +P+ PG  
Sbjct  525   WPGIKK-LSEEEILKITPAEYIQGD-AWIPGKGVPYIPGLF  563



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   375 bits (962),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/418 (46%), Positives = 261/418 (62%), Gaps = 16/418 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  L  SM+LTSNAL++++++ D   SL      RRLL +  P+   HG       
Sbjct  177   GEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLLFDDTPVLG-HGI------  229

Query  2540  EILSPFADPATRHLLAA----PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             E+L  + D   R LLA       K D+VVA+DGSGKYK IN AL  IP   N+  V+ IK
Sbjct  230   ELLPDWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIK  289

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY E V I S  +N+  +G+GPTKT ITGN++ +D  P  TY+  TV + G+ F+ +D
Sbjct  290   EGVYNEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIP--TYQTSTVAIMGDYFVAKD  347

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AG  KHQA+ALR++AD +  YNCH++ YQDTL  H+YRQFYRDCTI GT+DF+F
Sbjct  348   IGFENTAGPDKHQALALRVAADKSIFYNCHVDGYQDTLCAHTYRQFYRDCTIRGTIDFVF  407

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC + VRKPM  Q C+VTAQGR D R    +V Q+C I+A+ +        K
Sbjct  408   GDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDARQPTGLVFQNCSIVADESYNEVKGEVK  467

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK++SRT+IM + IDD++ PEGW  W  T   +T +Y E+ N+G G+S   RV+
Sbjct  468   TYLGRPWKQYSRTIIMESNIDDLIQPEGWLEWNKTFAFETLFYTEFNNKGSGSSKTDRVR  527

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
             W G K  +  E  ++FT   F+ AD  W+    +P++ G FL P    + +   P  D
Sbjct  528   WSGVKE-LPIERVQRFTTSSFIDAD-LWIPSTGVPYTSGFFLSPPQSDSSIVYSPVDD  583



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   371 bits (952),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 247/394 (63%), Gaps = 14/394 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M  + KTS ELTSN LA+VS L   +    I G+   L          +   + ST++
Sbjct  184   QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDL--------GSYARKLLSTED  235

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                 +  P  R L+AA     K + VVA DGSG++KSINAAL ++P  N    VI IK G
Sbjct  236   GFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQG  295

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V +    + + F+G+GPTKT ITGN N        TY+  TV V GE F  +D+ 
Sbjct  296   IYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNF-GMGKVKTYQTATVAVNGEHFTAKDIG  354

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY HS+RQFYRDCTISGT+D+IFG+
Sbjct  355   FENTAGPKGHQAVALRVSADYAVFHNCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGD  414

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A   FQNC M+VRKPM  Q CMVTAQGR D+R    IVL +C I  +PA       NK +
Sbjct  415   AKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAY  474

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+FSRT+IM T I+DI+ P+GW  W G   LDT  YAE++N+GPG++   RVKW 
Sbjct  475   LGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWP  534

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             G K+  +P  A +FT G FL     W+ + Q+P+
Sbjct  535   GIKK-FTPRQAGEFTAGKFLQGG-TWIPQTQVPY  566



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   370 bits (950),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 256/401 (64%), Gaps = 27/401 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             EKM  L+ T+ ELT N L +V      I   +  GL+R+LL               ++D 
Sbjct  173   EKMAKLMNTTQELTLNVLYMVDSFGQMIT--QTTGLTRKLLS--------------NSDS  216

Query  2537  ILSPFADPATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
             I+    + + R LL   +A P A  VV+ DGSG+YK+I  A+N++P  N +  VILIK G
Sbjct  217   II----EASNRKLLQISSAQPNA--VVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEG  270

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE + I   K N+  +GEGPTKT+ITG+  V++     T+   T+ V G GF+ +D+ 
Sbjct  271   IYKENIEIEKDKLNVVLIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIG  330

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             I+N+AG  K QAVALR++AD AAVYNC ++ YQDTLY HS RQFYRDC I+GT+DF+FG 
Sbjct  331   IQNTAGPEKEQAVALRVNADKAAVYNCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGA  390

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK+IVRKP   Q CM+TAQG  D +     V+Q+C+I AEP   A NP  K +
Sbjct  391   AAAVFQNCKLIVRKPGDTQNCMMTAQGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAY  450

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-  1653
             LGRPWK +SRT+IM + ID  +  EGW+ W  T + + TC+YAEYQNRGPGA+ DKRV  
Sbjct  451   LGRPWKMYSRTIIMQSNIDAFINSEGWAPWNTTDFGIHTCFYAEYQNRGPGATLDKRVSH  510

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+GY+++IS +   +FT   F+  + QWL  A IP+    +
Sbjct  511   WRGYQKDISGDTINKFTADKFINTNPQWLPVADIPYEADMM  551



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   374 bits (959),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 190/405 (47%), Positives = 257/405 (63%), Gaps = 21/405 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDD---HGNPVD  2550
             GEKM+  L+TSMELTSN LA+++ +   + SLE+P  + R L     L DD   HG    
Sbjct  177   GEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFTNRRL-----LSDDILGHGM---  228

Query  2549  STDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                +IL  + D   R LL A P   K D++VA+DGSG + +IN AL +I     +  V+ 
Sbjct  229   ---DILPSWIDEGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEKEFVLY  285

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY+E V       ++  +G+GPTKT ITG  N  D  P  TY   TV V G+ FI 
Sbjct  286   IKEGVYEEKVTFHKNLLHLTVIGDGPTKTRITGKLNFIDGVP--TYHTATVAVLGDFFIA  343

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+  EN+AG  KHQAVA+R+ AD    YNCH + +QDTLY H+YRQFYR+C ISGT+DF
Sbjct  344   KDIGFENAAGPEKHQAVAVRVGADKTIFYNCHFDGFQDTLYAHTYRQFYRNCKISGTIDF  403

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG++  V QNC + VRKP+ NQ+C+VTAQGRKD R    +VLQ+C  +A+PA       
Sbjct  404   VFGDSAAVLQNCTLEVRKPLDNQQCIVTAQGRKDVRQPTGLVLQNCSFVADPAYFPYRFQ  463

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWKEFSRT+IM +FIDD++ PEGW  W G+  LDT +YAE+ NRGP ++   R
Sbjct  464   LKSYLGRPWKEFSRTIIMESFIDDLIQPEGWLAWNGSFALDTLFYAEFNNRGPSSNKMLR  523

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              +W G K   S  V ++F P  F+  +  W+  A++P++ GF+ P
Sbjct  524   AQWNGVKELPSSRV-ERFLPSKFIDGN-HWIKSARVPYNSGFIYP  566



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   370 bits (951),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 256/403 (64%), Gaps = 16/403 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK  L T+ +LTSN LA+V+++   + SL +    RRLL       +    P     
Sbjct  184   GDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKANRRRLLAGGGGGGNAKNAP----K  239

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAIN-NRRIVILIK  2373
              I +   +  +  +    P   K D VVA+DGSG+Y++I  A+  IP  N ++  VI +K
Sbjct  240   VIPTWINNKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVK  299

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFIC  2199
              GVY EYVMI     N+  +G+G  KT +TG++N    +  G  T++  TV+V G+ FI 
Sbjct  300   EGVYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKN----FAAGVQTFQTATVVVVGDYFIA  355

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +D+ IENSAGA  HQAVALR+ +D++  Y C ++ YQDTLYT ++RQFYRDCTISGT+DF
Sbjct  356   KDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDF  415

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I  +P        
Sbjct  416   IFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDK  475

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KR
Sbjct  476   NKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKR  535

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKW G K N+S + A  FT G F+  D +W+  + +P+  G +
Sbjct  536   VKWSGIK-NLSADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   369 bits (948),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/400 (47%), Positives = 250/400 (63%), Gaps = 13/400 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  LKT+ ELTSN LA+VS++   + SL      RRLL   +      G       
Sbjct  178   GEKMKGFLKTAQELTSNGLAMVSEISSLLGSLNSNSHRRRLLGSSS------GGQSKRVY  231

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             + L  +       LL A P   K ++VVAQDG+GKYKSI  AL  +P  + +  VI IK 
Sbjct  232   KPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKE  291

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKEYV++  +  N+  +G+GPTKT I+G++N  D     T    T    G+ F+ + +
Sbjct  292   GVYKEYVIVDKEMTNVVMIGDGPTKTRISGSKNYAD--GTATMYTATFAAVGDYFVAKGI  349

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AGA KHQAVALR+ +D +  YNC+++AYQDTLYT +YRQ+YRDCTISGTVDFIFG
Sbjct  350   GFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFG  409

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   +FQNC+M+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK 
Sbjct  410   DGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKA  469

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK F+R +++ + IDD + PEGW+ W G  +  +C+ AE  NRG GA   KRVKW
Sbjct  470   YLGRPWKGFARVVVIQSQIDDAIAPEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKW  529

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +  K+ ++PE A  FTP      D +W+  + +P+  G +
Sbjct  530   QTLKK-LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  567



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   368 bits (945),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 253/402 (63%), Gaps = 25/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KMK +L  S +L+SN LA+++ L   +K L + GL+ R L     LKD+   P     
Sbjct  186   GAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLTGRRL-----LKDNSEFP-----  235

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +     R LLA  P   K DIVVA+DGSG+YK+IN A++ IP   N   VI IK 
Sbjct  236   ----SWLSHEKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKK  291

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFICR  2196
             G+YKE V I     +I  +G+G TKT ITG+ N    +  G  T +  TV V G  FI +
Sbjct  292   GIYKEQVTISRSVTHIMMIGDGATKTRITGDLN----YAAGVQTLQTSTVSVSGNHFIAK  347

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  EN+AGA+ HQAVALR+ +DM+  YNC ++ YQDTL+ H++RQFYRDCTI+GT+DFI
Sbjct  348   DIGFENTAGAIGHQAVALRVQSDMSIFYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFI  407

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNCK++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+P        N
Sbjct  408   FGDAAAVFQNCKIVVRKPLENQNCVVTAQGRNESREATGFVLQNCNITADPEYYPVRFEN  467

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKE+SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV
Sbjct  468   KAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRV  527

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              WKG K+ +S + A  FT   F+  D  W+    + ++ G +
Sbjct  528   TWKGIKK-LSAQDAAAFTVAKFIGGD-LWIPATGVSYASGMM  567



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   373 bits (958),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/401 (46%), Positives = 253/401 (63%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE +K  LKT+++LT N LA+V+++ +++  ++IP L SRRLL +  P            
Sbjct  186   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPELNSRRLLSQEFP------------  233

Query  2543  DEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                   + D   R LL AP    K DIVVAQDGSG+Y +IN A+N +P   N   V+ IK
Sbjct  234   -----SWMDGRARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIK  288

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+YKE+V +     ++ F+G+GP KTVI+G+++ +D     TYR  TV + G+ FI ++
Sbjct  289   AGIYKEFVQVNRSMTHLVFIGDGPDKTVISGSKSFKDGIT--TYRTTTVAIVGDHFIAKN  346

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  347   MGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  406

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC  +VRKP+ NQ C +TA GRKD R     VLQ C I  E    A    +K
Sbjct  407   GDAAAVFQNCTFLVRKPLPNQACPITAHGRKDPRETTGFVLQGCTISGETDYLAVKETSK  466

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+SRT+IM TFI D + PEGW  W     L+T +Y+E +N GPGA    RV 
Sbjct  467   AYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLDNFGLETLFYSEVRNTGPGAPAMNRVT  526

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+    E+ K FTP  ++  D  W+    +P++PG  
Sbjct  527   WPGIKKLGEEEILK-FTPAQYIQGD-AWIPGKGVPYTPGLF  565



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   372 bits (955),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 256/401 (64%), Gaps = 24/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT+++LT N LA+VS++ + +  ++ P L SRRLL               S 
Sbjct  184   GETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPELNSRRLL---------------SQ  228

Query  2543  DEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             D+  S + D   R LL  P    K D+VVAQDGSG+YK+IN AL ++P   N   V+ IK
Sbjct  229   DQFPS-WLDVRARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIK  287

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              G+YKEYV +     ++ F+G+GP KTV++G+++ +D     TYR  TV + G+ FI ++
Sbjct  288   EGIYKEYVQVNRSMPDLVFIGDGPDKTVLSGDKSFKDGIT--TYRTATVGIIGDHFIAKN  345

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA+KHQAVA+R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+F
Sbjct  346   MGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLF  405

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I  E    A    +K
Sbjct  406   GDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSK  465

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE+S+T+IM TFI D V  +GW  WQG   LDT +Y+E +N GPGA    RV 
Sbjct  466   AYLGRPWKEYSKTIIMNTFIPDFVPAQGWQPWQGNFGLDTLFYSEVRNTGPGAPVTNRVT  525

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G K+ +S E   +FTP  ++  D  W+    +P++PG  
Sbjct  526   WPGIKK-LSEEEVLEFTPSRYIQGDA-WIPGKGVPYTPGLF  564



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   367 bits (943),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/400 (45%), Positives = 250/400 (63%), Gaps = 17/400 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK  LKT+ ELTSN LA+ +++   + SL +    RRLL      ++    P     
Sbjct  176   GDKMKGFLKTAQELTSNGLAMATQISSLLGSLNLNS-HRRLLSAEKSKRNYQAVP-----  229

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +       LL A P   K ++VVAQDG+GKYK+I  AL  +P  +N   VI IK 
Sbjct  230   ----SWMGARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFVIYIKE  285

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE ++I  +  N+  +G+GPTKT I+GN+N  D     T    T    G+ F+ +D+
Sbjct  286   GVYKEQIIIDRQMTNVFMIGDGPTKTKISGNKNKAD--GTATMHTATFAAVGDYFVAKDI  343

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG +KHQAVALR+ +D +  YNCH++AYQDTLYT +YRQ+YRDCTI+GTVDFIFG
Sbjct  344   RFENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFG  403

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK 
Sbjct  404   DGVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKA  463

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK+F+R ++M + ID+ + PEGW  W G+M+ +TC+  EY N+GP A   +RVKW
Sbjct  464   YLGRPWKDFARVVVMQSQIDEAIQPEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQRVKW  523

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  524   PSLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  561



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   372 bits (956),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 249/403 (62%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  + IP  S RRLL +  P            
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEIP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+YK+IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVY  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+Y+EYV I     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AG  K QAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  346   KNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKAT  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    R
Sbjct  466   SKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  526   VTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   367 bits (943),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 260/407 (64%), Gaps = 29/407 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP--------GLSRRLLEEPAPLKDDHG  2562
             +KM+ +LKTSME+TSNALA+++ L   +K L IP        G +R+LL           
Sbjct  170   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLL-----------  218

Query  2561  NPVDSTDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
                 ST+++L  +   A R LL A P   K ++VVA+DGSGKY +IN AL  +P  +  R
Sbjct  219   ----STEDMLE-WISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDR  273

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI IKAG YKE + +  +  N+ F+G+GPTKT+IT + +V    P  TYR  TV V+G 
Sbjct  274   FVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGA  333

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ +D+  +NSAG   HQAVA R +AD   ++NCH   YQDTLY H  RQ Y +C I+G
Sbjct  334   GFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITG  393

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I   P   +
Sbjct  394   TVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYIS  453

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ NRGPGA 
Sbjct  454   VKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGAD  513

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  514   TNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   367 bits (941),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 192/406 (47%), Positives = 258/406 (64%), Gaps = 33/406 (8%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-------PGLSRRLLEEPAPLKDDHGN  2559
             EKMK+LLKT+ EL+SN+LA+VS +   +  L++           RRL+ E          
Sbjct  161   EKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGASSGRRLMSEEE--------  212

Query  2558  PVDSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                       P+     R L A P K + VVAQDGSG++K+I  A+N+IP  NN+  +I 
Sbjct  213   ---------EPYWTKG-RLLAANPLKPNAVVAQDGSGQFKTIKEAINTIPKKNNQTFIIY  262

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGF  2205
             IKAG+YKE+V IP K N + F+G+GP KT ITG+++    + GG  T++  TV V GE F
Sbjct  263   IKAGLYKEHVEIPKKVNKVVFIGDGPFKTRITGSKS----FAGGVKTFQTATVAVNGEEF  318

Query  2204  ICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTV  2025
               +++  EN+AGA  HQAVALR+SAD A   N  ++ YQDTLY H+YRQ+YRDCTISGT+
Sbjct  319   TAKNIAFENTAGAEGHQAVALRVSADKAIFQNVAIDGYQDTLYAHNYRQYYRDCTISGTI  378

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG++  +FQNC  IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AEPA  +  
Sbjct  379   DFIFGDSLCLFQNCVFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNSHITAEPAFLSTK  438

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             P    +LGRPWKE SRT+IM + ID  + P+GWS W G   LDT +Y EYQNRG G+   
Sbjct  439   PAIDAYLGRPWKELSRTIIMQSEIDGFISPKGWSPWMGNFALDTLYYGEYQNRGAGSDLA  498

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              RV WKG  ++++ + A+++T G     DE W+  + +P+ P  +Q
Sbjct  499   NRVTWKGI-QHMTQQKAEEWTGGAAFRGDE-WITSSGVPYVPTLMQ  542



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   373 bits (957),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 249/403 (62%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  + IP  S RRLL +  P            
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEIP------------  232

Query  2543  DEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL A       K DIVVAQDGSG+YK+IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVY  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+Y+EYV I     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AG  K QAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  346   KNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKAT  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    R
Sbjct  466   SKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  526   VTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   367 bits (942),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 188/402 (47%), Positives = 253/402 (63%), Gaps = 25/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KMK +L  S +L+SN LA+++ L   +K L + G + R L     LKD+   P     
Sbjct  186   GAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFTGRRL-----LKDNSEFP-----  235

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +     R LLA  P   K DIVVA+DGSG+YK+IN A++ IP   N   VI IK 
Sbjct  236   ----SWLSHEKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKK  291

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFICR  2196
             G+YK+ V I    ++I  +G+G TKT ITG+ N    +  G  T++  TV V G  FI +
Sbjct  292   GIYKQQVTISRSLSHIMMIGDGATKTKITGDLN----YAAGVQTFKTSTVSVSGSHFIAK  347

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             D+  EN+AGA+ HQAVALR+ +DM+  YNC ++ YQDTLY H++RQFYRDCTI+GT+DFI
Sbjct  348   DIGFENTAGAIGHQAVALRVQSDMSIFYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFI  407

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNCK++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+         N
Sbjct  408   FGDAAAVFQNCKIVVRKPLENQNCIVTAQGRNESREATGFVLQNCNITADREYYPVRFEN  467

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKE+SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV
Sbjct  468   KAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRV  527

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              WKG K+ +S + A  FT   F+  D  W+    I ++ G +
Sbjct  528   TWKGIKK-LSAQDADAFTVAKFIGGD-LWIPDTGISYASGMM  567



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   366 bits (940),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 252/400 (63%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GE M+ +L +S ELTSN LAIV+  DD + SL +P ++R+LL E  P             
Sbjct  173   GESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLP-INRKLLAEGYP-------------  218

Query  2540  EILSPFADPATRHLLA---APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +  P  R LLA   A  K ++VVAQDGSG  K+I  A++ +P       +I IK 
Sbjct  219   ----SYVTPGKRRLLATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKE  274

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G YKE V +     N+  +G+GPTKT ITG+ N  D     T+   TV V G+GF+ +DL
Sbjct  275   GEYKEKVHVNKSATNVMLIGDGPTKTKITGSLNYVDG--TRTFDTATVAVVGDGFVAKDL  332

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAGA KHQAVALR+ +DM+  YNC ++ YQDTLY H++RQFYRDCTISGT+DFIFG
Sbjct  333   WIENSAGAEKHQAVALRVQSDMSVFYNCRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFG  392

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  +FQNC ++ RKP+ NQ+ +VTAQGRK R+ A+AI+L +C I A+PA          
Sbjct  393   DSASIFQNCLILARKPLDNQQNIVTAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPT  452

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             FLGRPWK +SRT I+ + IDD++ P+GW  W G   L+TC+Y E  NRGPGA   KRV W
Sbjct  453   FLGRPWKMYSRTFILQSQIDDLIHPDGWLPWFGDFGLNTCFYTEVDNRGPGADKSKRVTW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KG K NI    AK+F+   FL    +WL R  +PF+   L
Sbjct  513   KGVK-NIDYAHAKKFSVQQFLHGG-KWLPRTGVPFTAELL  550



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   367 bits (943),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 194/402 (48%), Positives = 252/402 (63%), Gaps = 19/402 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS--RRLLEEPAPLKDDHGNPVDS  2547
             GE+MK LLKTSM L+SN LA+V+++   +  L  P  S  RRLL         HG     
Sbjct  194   GEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRRLLSFDGLPILGHG-----  248

Query  2546  TDEILSPFADPATRHLL----AAPPKA---DIVVAQDGSGKYKSINAALNSIPAINNRRI  2388
              D  L  + +   R LL    A  PKA   D VV++DGSG YK+I  AL  +P   N   
Sbjct  249   -DLELPEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALEHVPKYGNETF  307

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEG  2208
             VI IK GVY E V +     N+  +G+G  KT ITGN N  D  P  TYR   V + G+ 
Sbjct  308   VIYIKEGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTP--TYRTAAVAIHGDH  365

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F+  D+  ENSAG  KHQAVALR+SAD A  Y C ++ YQDTLYTH++RQFYRDCTISGT
Sbjct  366   FMAMDIGFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGT  425

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG+A  +FQNC  +V KP+ +Q C+VTAQGRK+ R  +AIV+Q+  I A+P     
Sbjct  426   IDFVFGDAAAIFQNCTFVVHKPLPDQSCIVTAQGRKEGRQPSAIVIQNSTITADPDYFLV  485

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y E++N GP A+ 
Sbjct  486   KNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLRTCFYTEFRNTGPAANK  545

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +RV W+G K+ I+   A QFTPG F   DE W+  + +P+S
Sbjct  546   ARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPYS  585



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   374 bits (959),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 191/401 (48%), Positives = 260/401 (65%), Gaps = 16/401 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-PGLSRRLLEEPAPLKDDHGNPVDST  2544
             GEKM+  L  +M++TSNALA++++L  +IKSL I    SRRLL E           V   
Sbjct  174   GEKMRVSLTKAMQMTSNALAMMAELSTYIKSLGIESSTSRRLLSE--------NEAVVGH  225

Query  2543  DEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             D+ L  + D   R LL+A P   +  +VVA+DGSGK+++IN AL  IP   +   V+ IK
Sbjct  226   DDELPNWMDLNKRRLLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIK  285

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY+E V + S   ++ F+G+GPTKT ITG  N  D     TYR  TV V+G+ F+  +
Sbjct  286   EGVYEERVQVNSSLTHLLFIGDGPTKTRITGKLNFIDG--TNTYRTATVAVQGDNFMAVN  343

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAG  KHQAVALR+SAD A  YNCH++ YQDTLYTH+YRQFYRDC ISGT+DFIF
Sbjct  344   IGFENSAGPQKHQAVALRVSADKAIFYNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIF  403

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G++  VFQ C ++VRKP+ NQ+C+VTAQGRKD R    +V+Q+C I A+ A        K
Sbjct  404   GDSAAVFQGCTLLVRKPLDNQQCIVTAQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIK  463

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK++SRT+IM +F+DD++ P+GW  W  T  L T +Y E+ NRGP A   +RVK
Sbjct  464   SYLGRPWKQYSRTIIMESFLDDLIQPQGWLPWNETFALQTLFYTEFNNRGPAAPKSERVK  523

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W G  R +     ++FT   FL    +W+ + ++P + GF+
Sbjct  524   WAGI-RELPSNRIRRFTLEEFLDG-HRWIPQTKVPHASGFI  562



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   370 bits (950),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 252/401 (63%), Gaps = 14/401 (3%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLE--IPGLSRRLLEEPAPLKDDHGNPVDST  2544
             EKMK  L +SMELTSNAL +++++     SL        R LL + AP+   HGN     
Sbjct  178   EKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILG-HGN-----  231

Query  2543  DEILSPFADPATRHLLAAPP-KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              E+L  + D   R LLAA   K DIVVA+DGS KYK+IN AL +IP   N+  V+ IK G
Sbjct  232   -ELLPDWVDMRRRRLLAAKEIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYVLYIKQG  290

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY E V   S   N+  +G+GPTKT ITGN+N +D  P  TY   T  V G+ F+ +D+ 
Sbjct  291   VYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTP--TYLTATAAVMGDYFVAKDIG  348

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR++AD +  YNCH++ YQDTL  H+YRQFYRDC I GT+DF+FG+
Sbjct  349   FENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGD  408

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
                VFQNC + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +        K +
Sbjct  409   GAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYDEVKGEVKTY  468

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+S  +R KW+
Sbjct  469   LGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKTERAKWQ  528

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             G K  +     ++FT   FL  D  W+    IP++PGF  P
Sbjct  529   GVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLP  567



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   365 bits (938),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/407 (46%), Positives = 258/407 (63%), Gaps = 29/407 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP--------GLSRRLLEEPAPLKDDHG  2562
             +KM+ +LKTSME+TSNALA+++ L   +K L IP        G++R+LL           
Sbjct  154   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDTTGVNRKLL-----------  202

Query  2561  NPVDSTDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
                  + E +  +   A R LL A P   K ++VVA+DGSGKY +IN AL  +P  +  R
Sbjct  203   -----SAEDMPEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDR  257

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI IKAG YKE + +  +  N+ F+G+GPTKT+IT + +V    P  TYR  TV V+G 
Sbjct  258   FVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGA  317

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ +D+  +NSAG   HQAVA R +AD   ++NCH   YQDTLY H  RQ Y +C I+G
Sbjct  318   GFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITG  377

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I   P   +
Sbjct  378   TVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYIS  437

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ NRGPGA 
Sbjct  438   VKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGAD  497

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  498   TNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  542



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   366 bits (939),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 259/407 (64%), Gaps = 29/407 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP--------GLSRRLLEEPAPLKDDHG  2562
             +KM+ +LKTSME+TSNALA+++ L   +K L IP        G +R+LL           
Sbjct  170   QKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLL-----------  218

Query  2561  NPVDSTDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
                 ST+++L  +   A R LL A P   K ++VVA+DGSGKY +IN AL  +P  +  R
Sbjct  219   ----STEDMLE-WISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDR  273

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI IKAG YKE + +  +  N+ F+G+GPTKT+IT + +V    P  TYR  TV V+G 
Sbjct  274   FVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGA  333

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ +D+  +NSAG   HQAVA R +AD   ++NCH   YQDTLY H  RQ Y +C I+G
Sbjct  334   GFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITG  393

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I   P    
Sbjct  394   TVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYIP  453

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ NRGPGA 
Sbjct  454   VKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGAD  513

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  514   TNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   367 bits (943),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/413 (47%), Positives = 261/413 (63%), Gaps = 17/413 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G++MK LLKTSM L+SN LA+VS++   +  L  P  SR        L    G P+    
Sbjct  194   GQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRRRRLLSLD---GLPILGHG  250

Query  2540  EILSP-FADPATRHLL----AAPPKA---DIVVAQDGSGKYKSINAALNSIPAINNRRIV  2385
             ++  P + +   R LL    A  PKA   D VVA+DGSG YK+I+ AL  +P   N   V
Sbjct  251   DLEFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEALEHVPKYGNETFV  310

Query  2384  ILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGF  2205
             I IK GVY E V +     N+  +G+G  KT ITGN+N  D  P  TYR  TV + G+ F
Sbjct  311   IYIKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTP--TYRTATVAIHGDHF  368

Query  2204  ICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTV  2025
             +  D+  +NSAG  KHQAVALR+SAD A  Y C ++ YQDTLYTH++RQFYRDCTISGT+
Sbjct  369   MAMDIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTI  428

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DF+FG+A  +FQNC  +VRKP+ +Q C+VTAQGRK+RR  +AIV+Q+  I A+P      
Sbjct  429   DFVFGDAAAIFQNCTFVVRKPLPDQSCIVTAQGRKERRQPSAIVIQNSTITADPDYFPVK  488

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
               N+ +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y E+ N GP A+  
Sbjct  489   NVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLRTCFYTEFCNTGPAANKA  548

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAK  1506
             +RV W+G K+ I+   A QFTPG F   DE W+  + +P  PG     N+++K
Sbjct  549   RRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPCVPGLTT--NRRSK  597



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   382 bits (982),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/409 (47%), Positives = 264/409 (65%), Gaps = 29/409 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPG------LSRRLLEEPAPLKDDHGN  2559
             G +M+ +L+ SME+TSN L +V+++  F+ S+   G       SRRLL            
Sbjct  172   GNRMRQVLRESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAVTSRRLL------------  219

Query  2558  PVDSTDEILSPFADPATRHLLAAPPK---ADIVVAQDGSGKYKSINAALNSIP-AINNRR  2391
                STDE L  + D   R LLAA P+    D++VA+DG+G Y +IN AL +IP +  N+ 
Sbjct  220   ---STDEFLPEWVDAGKRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPKSGKNKT  276

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
             IV+ I+ GVY+E +   S   N+  +G+GPTKT ITG  N  D     TY+  TV V+G+
Sbjct  277   IVLYIREGVYEEKLQFNSSMKNLFVIGDGPTKTRITGKSNFIDGT--NTYQTATVAVQGD  334

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
              FI RD+  EN+AG  KHQAVALR+SAD A  YNCH++AYQDTLY H+YRQFYR+C ISG
Sbjct  335   DFIARDIGFENTAGPEKHQAVALRVSADKAIFYNCHMDAYQDTLYAHAYRQFYRNCRISG  394

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG++  VFQNC ++VRKP+ NQ+C+VTAQGRK+ R     +LQ+C I  +  L A
Sbjct  395   TIDFIFGDSAAVFQNCTLLVRKPLENQQCVVTAQGRKEIRQPTGFILQNCSIRPDRDLYA  454

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                  K +LGRPWK++SRT+IM +F+DD++ P GW  W GT  LDT +Y E+ NRGP A 
Sbjct  455   IRKNIKTYLGRPWKQYSRTVIMESFLDDLICPTGWLPWNGTFALDTLFYTEFNNRGPAAP  514

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               +R +W G K   S  + ++FT   FL  +  W+ R Q+P++PGF+ P
Sbjct  515   KKQRARWPGVKELPSSRI-QRFTAVEFLDGN-GWIPRTQVPYTPGFVFP  561



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   365 bits (937),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/400 (46%), Positives = 253/400 (63%), Gaps = 18/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK  LKT+ ELTSN LA+V+++   + SL +    RRLL   A  K ++        
Sbjct  178   GDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNLNS-HRRLLS--AHSKRNY--------  226

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             + +  +       LL A P   K ++VVAQDGSGKYK+I  AL  +P  +N   VI IK 
Sbjct  227   QAVPSWMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKE  286

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE ++I  +  N+  +G+GPTKT I+G++N  D     T    T    G+ F+ +D+
Sbjct  287   GVYKEEIIIDRQMTNVFMIGDGPTKTKISGSKNKAD--GTATMHTATFAAVGDYFVAKDI  344

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG +KHQAVALR+ +D +  YNCH++AYQDTLYT +YRQ+YRDCTI+GTVDFIFG
Sbjct  345   RFENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFG  404

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK 
Sbjct  405   DGVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKA  464

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK+F+R ++M + ID+ + PEGW  W G+ + +TC+  EY NRGP A   +RVKW
Sbjct  465   YLGRPWKDFARVVVMNSQIDEAIQPEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKW  524

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  525   PSLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  562



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   365 bits (937),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 252/401 (63%), Gaps = 15/401 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKM+  LKTS ELT+N LA+V ++     +L +    RRLLE  A      G       
Sbjct  182   GEKMREFLKTSQELTNNGLAMVDQVSTMFGALNVKS-GRRLLEATAGT----GAKKFQKA  236

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRI-VILIK  2373
             +++  + D     L  A P   K D+VVA+ G GKY ++N AL  IP  N  ++ VI +K
Sbjct  237   KVIPAWIDNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVK  296

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
              GVY+E+V+      N+  +G+GPTKT+ITG +N  +     T +  TV V G+ FI +D
Sbjct  297   EGVYEEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTK--TMQTATVGVVGDYFIAKD  354

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGAV HQAVALR+ +D++  YNC ++ YQDTLYT ++RQFYRDCTISGT+DFIF
Sbjct  355   IGFENTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTLYTQTHRQFYRDCTISGTIDFIF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCKMIVRKP+ NQ CMVTA GR DRR    I+LQ+C I  EP  +     NK
Sbjct  415   GDAAAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTGIILQNCTISGEPGYE--KDLNK  472

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK ++R ++M + IDD++ PEGW  W G+    +CW+ E+ NRG GA   KR  
Sbjct  473   AYLGRPWKNYARAIVMQSQIDDVIAPEGWMEWIGSNNHQSCWFGEFGNRGLGADQTKRAT  532

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K  ++ + A  FT G F+  D +W+  + +P+  G +
Sbjct  533   WRGIKE-LTAQHAADFTAGRFVFGD-RWIQPSGVPYVAGMM  571



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   364 bits (935),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 254/402 (63%), Gaps = 30/402 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M  L+ T+ EL+ NAL++V+   + I   +  GL+R+LL                   
Sbjct  173   DEMVKLMNTTRELSINALSMVNSFGEMI--TQTTGLTRKLLSNS----------------  214

Query  2537  ILSPFADPATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                 F + + R LL   AA P A  VV+  G G+YK+I  A+N++P  N    +ILIKAG
Sbjct  215   --DSFVEASNRKLLQISAAKPNA--VVSASGGGQYKTIQEAVNAVPKNNPTPFIILIKAG  270

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
              YKE++ I   K N+ F+GEG TKT+ITG+R V++     T+    + V GEGF+ RD+ 
Sbjct  271   TYKEHIEIEKSKPNVVFIGEGATKTIITGDRGVKNGGGYATWHTCALGVAGEGFVIRDIG  330

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             +EN+AG  K QAVALRI+AD A VYNC ++ +QDTLY HS+RQFYRDC I+GT+DF+FG+
Sbjct  331   LENTAGPEKEQAVALRINADKAIVYNCKIDGFQDTLYAHSFRQFYRDCIITGTIDFMFGD  390

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC++IVRKP   Q CMVTAQGR         V+Q+C+I  EP   +     K +
Sbjct  391   ASAVFQNCQIIVRKPGNTQACMVTAQGRTVPTSVGGFVIQNCDIKPEPGFPST---TKAY  447

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-  1653
             LGRPWKEFS+T+IM + ID  + P GW+ W  T + + TC+YAEYQNRGPGA+ DKRV  
Sbjct  448   LGRPWKEFSKTIIMQSNIDAFIDPSGWAPWNTTDFGIHTCFYAEYQNRGPGAALDKRVST  507

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             W+GY+R IS +   QFT G F+  +  WL +  IP+  G ++
Sbjct  508   WRGYQRGISGDAINQFTAGKFINTESPWLPKGDIPYDAGMMK  549



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   369 bits (947),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 250/403 (62%), Gaps = 27/403 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             GE MK  LKT++ELT N LAI+S++ +F+  + IP  S RRLL +  P            
Sbjct  185   GETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFSSRRLLSQEFP------------  232

Query  2543  DEILSPFADPATRHLL-----AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   + D   R LL      +  KADIVVAQDGSG+YK+IN AL  +P   N   V+ 
Sbjct  233   -----SWVDQRGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKKNTTFVVY  287

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IKAG+Y+EYV I     ++ F+G+GP KT+I+G++N +D     TYR  TV + G+ FI 
Sbjct  288   IKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGIT--TYRTQTVAIIGDSFIA  345

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++   N+AG  K QAVA+R+ +D +  +NC  + YQDTLY HS+RQFYRDCTISGT+DF
Sbjct  346   KNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDF  405

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    
Sbjct  406   LFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKAT  465

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    R
Sbjct  466   SKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANR  525

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  526   VTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   365 bits (936),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/412 (45%), Positives = 252/412 (61%), Gaps = 26/412 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS----RRLLEEPAPLKDDHGNP-  2556
             GEKMK  L  S ELTSN L + ++L    KSL I   +    R LLEE    K+    P 
Sbjct  189   GEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLEEQGEAKNKEEIPH  248

Query  2555  -VDSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAIN-------  2400
              VD+  + L         H+     KAD+VVA+DGSG +K+I  AL   P I+       
Sbjct  249   WVDTKQQKL--------LHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDATKVEKG  300

Query  2399  -NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVI  2223
              N+  VI IK GVY+E V + +    +  +G+GPTKT ITG +N  D +    ++  TV 
Sbjct  301   TNKTFVIYIKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFV--LFKTATVS  358

Query  2222  VEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDC  2043
             + G  FI +D+  ENSAGA KHQA+AL + +D +  YNCH+N YQDTLY HSYRQFYR C
Sbjct  359   IFGHNFIAKDIGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYAHSYRQFYRHC  418

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             T+SGT+DFIFGNA  VFQNCK+++RKP+ ++ C++TAQ R+  R     +LQ+C I+A+P
Sbjct  419   TVSGTIDFIFGNAAAVFQNCKLVIRKPLEDEGCVITAQARQHVREPTGFILQNCTIMADP  478

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
                     +K FLG PWK+FSRT+IM +F+ D + PEGW  W GT    +C+++EY+NRG
Sbjct  479   LYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQSSCFFSEYENRG  538

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             PGA+   RVKW G K+ I+P+ A  FTP  F   +  W+    +P+ PG + 
Sbjct  539   PGAALLGRVKWHGIKK-ITPQQADGFTPSKFYQGN-HWIIPTGVPYEPGMMH  588



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   364 bits (934),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 248/400 (62%), Gaps = 18/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              E MK  L  S  LTSN+LAI+ ++   + + +IP LSRRLL E     DD   P   T+
Sbjct  197   AESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLSRRLLSEEEA--DDGEYPSWVTN  254

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                        R LLA      K DIVVAQDGSG Y++I  AL +IP  +N   VI IK 
Sbjct  255   ---------GKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIYIKE  305

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE V +     N+  +G+GPTKT ITGN N  D           V+  GEGFI +DL
Sbjct  306   GVYKEQVWLDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVV--GEGFIAKDL  363

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ +D +  YNC ++ YQDTLY H+ RQFYRDCTI+GT+DFIFG
Sbjct  364   GFENSAGPEKHQAVALRVQSDRSIFYNCQMDGYQDTLYCHTKRQFYRDCTITGTIDFIFG  423

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  +FQNC + VRKP+ANQ+C+VTA GRKDRR A AI+L +C I A+      +  N  
Sbjct  424   DSASIFQNCLIKVRKPLANQQCIVTASGRKDRREATAIILHNCTISADSEYLPFHIQNPS  483

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK +SRT+IM + ID+ + PEGW  W G + L TC+YAE  N G GA+  KRV W
Sbjct  484   YLGRPWKPYSRTIIMQSQIDEFIHPEGWLPWLGDVGLHTCFYAEVDNHGLGANVTKRVTW  543

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +GYK+ I    A+QFT   F+  +  WL    +P+ PG L
Sbjct  544   RGYKK-IDSSHAQQFTVQRFIQGNS-WLRPTGVPYIPGLL  581



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   363 bits (933),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/398 (47%), Positives = 252/398 (63%), Gaps = 24/398 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGN---PVDS  2547
             + M  + +TS ELTSNALA+++ +  F            L E    L  DHGN    + S
Sbjct  185   QDMHKIFETSKELTSNALAMITSISTF------------LGEHITGLIGDHGNHGRKLLS  232

Query  2546  TDEILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             T++ +  +  P TR L+A     K D+VVAQDGSG+YK+IN AL+ +P  N +  VI IK
Sbjct  233   TEDGIPSWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIK  292

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFIC  2199
              GVY E V +  K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+ F  
Sbjct  293   QGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNFTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY HS+RQFYRDCTISGTVDF
Sbjct  350   KNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+  VV Q C ++VRKPM  Q CM+TAQGR + R +  +VL +C I  EP        
Sbjct  410   IFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTNERESTGLVLDNCHITGEPEYIPVKSI  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK+FSRT+IM T I+D+V P GW  W G+  L+T +YAEY+N G G+   +R
Sbjct  470   NKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             VKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  530   VKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   380 bits (976),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/400 (48%), Positives = 254/400 (64%), Gaps = 33/400 (8%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK LLK++ ELTSN LA++ ++   + +L+IPG+SRRLL                  
Sbjct  174   GEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLL------------------  215

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                        R L  A P   K +++VAQDGSGKYK+IN AL  IP   N   V+ +K 
Sbjct  216   --------VGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKE  267

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE V       N+  +G+GPTKT I+G+ N  D    GT+R  TV   G  F+ +D+
Sbjct  268   GVYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGI--GTFRTATVAAVGSNFMAKDI  325

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AGA KHQAVALR+ +DMA  YNC ++ YQDTLY H++RQFYRDCTI+GT+DFIFG
Sbjct  326   GFENNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFG  385

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++ VVFQNC ++VRKP+ NQ+C+VTAQGR +RR    IVLQ+C I A           K 
Sbjct  386   DSAVVFQNCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKS  445

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK FSRT+IM + IDD++ PEGW  W G   L+TC+YAEY NRGP ++T  RV W
Sbjct  446   YLGRPWKAFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTW  505

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +G K+ I+ +    FT G F+ +   WLG + +P++   +
Sbjct  506   RGIKQ-ITGQHVNDFTVGRFI-SGHLWLGASGVPYTSDMM  543



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   362 bits (930),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 186/398 (47%), Positives = 252/398 (63%), Gaps = 24/398 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGN---PVDS  2547
             + M  + +TS ELTSNALA+++ +  F            L E    L  DHGN    + S
Sbjct  185   QDMHKIFETSKELTSNALAMITSISSF------------LGEHITGLIGDHGNHARKLLS  232

Query  2546  TDEILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
             T++ +  +  P TR L+A     K ++VVAQDGSG+YK+IN AL+ +P  N +  VI IK
Sbjct  233   TEDGIPSWVGPNTRRLMAEQGVVKPNVVVAQDGSGEYKTINEALSVVPKANQKPFVIYIK  292

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIVEGEGFIC  2199
              GVY E V +  K  ++ F+G+GPTKT ITG+ N    + G   TY   TV + G+    
Sbjct  293   QGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNY---YIGKVKTYHTATVAINGDNLTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++  EN+AG   HQAVALR+SAD A  +NC ++ YQDTLY HS+RQFYRDCTISGTVDF
Sbjct  350   KNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+  VV Q C ++VRKPM +Q CM+TAQGR D R +  +VL +C I  EP        
Sbjct  410   IFGDGKVVLQKCNIVVRKPMKSQSCMITAQGRTDERESTGLVLDNCHITGEPEYIPVKSI  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK+FSRT+IM T I+D+V P GW  W G+  L+T +YAEY+N G G+   +R
Sbjct  470   NKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             VKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  530   VKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   362 bits (930),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 189/399 (47%), Positives = 255/399 (64%), Gaps = 14/399 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KMK+ LKTS ELT NALA+ +++ +  ++  +    R L + P    D    P     
Sbjct  181   GAKMKNFLKTSQELTKNALAMATEIGNLFRTSSLKSQRRLLADTPM---DPKKAPKIIPS  237

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINN-RRIVILIKAGV  2364
              I     D AT + ++  P  D++VA+DGSGKYK++N AL  IP  N  +  VI IK GV
Sbjct  238   WIEGRKLDIATANPISLKP--DVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGV  295

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E V++     N+ F+G+GPTKT ITGN+N  D     T++  TV V G+ FI +D+  
Sbjct  296   YSEQVVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQ--TFKTATVAVIGDYFIAKDIGF  353

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGA  HQAVALR+ +D++  YNC ++ YQDTLYT ++RQFYRDC ISGT+DFIFG+A
Sbjct  354   ENTAGARGHQAVALRVQSDLSIFYNCQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDA  413

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCKMIVRKP  NQ CMVTAQGR D+R    IVLQ+C I  E    AA      +L
Sbjct  414   AAVFQNCKMIVRKPGPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFDAAT--TMAYL  471

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWK +SRT++M + ID+++ P GW  W GT   +T W+ E+ NRG GA+T++RVKW  
Sbjct  472   GRPWKMYSRTIVMQSQIDNVINPLGWMEWTGTTNHETSWFGEFSNRGLGAATNQRVKW--  529

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             YK   +PE A  F PG  L+ D +W+  + +P+  G ++
Sbjct  530   YKL-ATPEEAGAFAPGSILLGD-KWIMPSGVPYVAGMMR  566



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   358 bits (920),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  65    GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  119

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  120   ---RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  169

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  170   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINM  227

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  228   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  287

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK 
Sbjct  288   NALAVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKA  347

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  348   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  407

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  408   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  446



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   362 bits (929),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/395 (46%), Positives = 257/395 (65%), Gaps = 14/395 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M ++ KTS ELTSN+LA+V+ +   + +  I GL+  L          +   + ST++
Sbjct  179   QEMINIFKTSRELTSNSLAMVTGMSTLLPNSNITGLTGVLAS--------YARKLLSTED  230

Query  2537  ILSPFADPATRHLLAA---PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              +  +  P  R L+ A   P KA+ VVAQDGSG++K+I  ALN++P  +    +I IK G
Sbjct  231   GIPTWVGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEG  290

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V++  K  ++ F+G+GPTKTVITG+ N        T+   T+ ++G  F  + + 
Sbjct  291   IYKEKVIVTKKMPHVTFIGDGPTKTVITGSLNFRIG-KVKTFLTATITIQGNHFTAKSIG  349

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN++G    QAVALR+SAD A  YNC ++ YQ+TLY HS+RQFYRDCT+SGTVDFIFG+
Sbjct  350   IENTSGPKGGQAVALRVSADYAVFYNCQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGD  409

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  + QNCK++VRKP  +Q CMVTAQGR D R    IVL +C I+ +PA       NK +
Sbjct  410   AKCILQNCKIVVRKPKRSQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAY  469

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPW++FSRT+IM T IDD++ P GW +WQG   L T +YAE+ N GPG++  +RVKW 
Sbjct  470   LGRPWRQFSRTIIMKTTIDDVIDPAGWLLWQGESALKTLFYAEHLNIGPGSNQAQRVKWP  529

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G K+ +SPE A  FT   FL+ D  W+ +  +P++
Sbjct  530   GLKK-LSPEEALMFTGNRFLLGD-TWIPQTHVPYT  562



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   362 bits (929),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 256/406 (63%), Gaps = 33/406 (8%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLEEPAPLKDDHGNPVDST  2544
             GEKMK++LKT+ EL+S AL IVS  ++ +  L+  G++ RRLL                 
Sbjct  178   GEKMKNILKTASELSSVALDIVSSFEEQMVGLQGLGITNRRLL-----------------  220

Query  2543  DEILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                    A+   R LL  A  K ++VVAQDGSG++KSIN AL ++P  N +  VI IKAG
Sbjct  221   ------VAEAGNRRLLQIATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAG  274

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +Y E + + +   N+ F+GEG  KT IT N+N  D  P   ++  TV + G+GF+ +D+ 
Sbjct  275   IYNENIEVANTMTNVVFIGEGSNKTKITSNKNYLDGLP--IFQTATVSISGQGFVAKDIA  332

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG +K +AVALR+SA+M A  NC ++ YQ TL TH  RQFYRDCTISGT+DFIFG+
Sbjct  333   FENSAGPLKKEAVALRVSAEMTAFQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGD  392

Query  2006  APVVFQNCKMIVRKP--MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-N  1836
             A  V QNCK+I RKP  M  Q   + AQGR +  G   I++Q+C I AEPAL A NPP N
Sbjct  393   AVAVLQNCKIIARKPEEMQTQAITIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRN  452

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K FLGRP K +SRT++M + ID  + PEGW+ + GT  L+T ++ EYQNRGPGA+TD+RV
Sbjct  453   KAFLGRPAKMYSRTIVMQSQIDGFIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERV  512

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
              WK Y +N   +V  +F PG  L   +    W+ +  +P+ P  ++
Sbjct  513   TWKSYMKNPPQDVIAKFAPGVVLKGGDNTDGWVTKTGVPYEPAMMK  558



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   362 bits (930),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 192/401 (48%), Positives = 254/401 (63%), Gaps = 22/401 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             E M+  L +S  LTSNALAI+ ++   + ++ +P L RR L              + + E
Sbjct  197   ESMREALNSSQALTSNALAIIDEISSVLSTVRVPFLKRRFLSHEE----------EGSGE  246

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
               S  A+   R L  A    K +I+VAQDGSG YK+I  AL +IP  +N   VI IK GV
Sbjct  247   YPSWVANGKRRLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSIFVIYIKEGV  306

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKE V +     N+  +G+GPTKT ITGN N  D           V+  G+GFI ++L  
Sbjct  307   YKEQVWLDKSMMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVV--GDGFIAKNLGF  364

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAGA KHQAVALR+ +D +  YNC ++ +QDTLY+H+ RQFYRDCTI+GT+DFIFG+A
Sbjct  365   ENSAGAEKHQAVALRVQSDRSIFYNCQMDGFQDTLYSHTKRQFYRDCTITGTIDFIFGDA  424

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA---LKAANPPNK  1833
               +FQNC + VRKP+ANQ+C+VTA GRKDRR A AI+L +C I A+P    L+A NP   
Sbjct  425   ASIFQNCIIRVRKPLANQQCIVTASGRKDRREATAIILHNCTIGADPDYLPLRARNPS--  482

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK +SRTL++ + IDD + P+GW  W G   L+TC+YAE  NRGPGA+  KRV 
Sbjct  483   -YLGRPWKPYSRTLVVQSQIDDFIHPQGWLPWLGDFGLNTCFYAEVDNRGPGATIAKRVA  541

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             WKGYK+ I    A++FT   F+  +  WL    +P+ PG L
Sbjct  542   WKGYKK-IDYSHAQKFTVEQFIQGNS-WLKPTGVPYIPGLL  580



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   365 bits (938),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 233/335 (70%), Gaps = 11/335 (3%)
 Frame = -2

Query  2528  PFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
             P+    +R LLA  P    +A++VVA+DGSGK+K+I  AL  +P  N R+ VI IK GVY
Sbjct  360   PWVTLHSRRLLARRPSNSIRANVVVAKDGSGKFKTIAQALAMVPMKNKRKFVIHIKQGVY  419

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLT  2187
             KE V +  K  N+ FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+ 
Sbjct  420   KEKVEVTKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDIG  476

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA +HQAVALR+SAD A  +NCH+N YQDTLY H++RQFYRDC ISGT+DF+FG+
Sbjct  477   FENTAGAARHQAVALRVSADFALFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGD  536

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC  ++R+PM NQ+C+VTAQGRKDRR    IV+ +  I+ + +       N+ F
Sbjct  537   AKAVFQNCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAF  596

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM T IDD++ PEGW  W  T  L+T +Y EY+NRG G+   +RVKW+
Sbjct  597   LGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWR  656

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G +R ISP  A++F PG FL  +  W+ + +IP++
Sbjct  657   GIRR-ISPRAAREFAPGNFLRGN-TWIPQTRIPYN  689



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   362 bits (928),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 247/407 (61%), Gaps = 27/407 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M  + KTS ELTSN LA+VS L   +    I G+   L          +   + ST++
Sbjct  184   QEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDL--------GSYARKLLSTED  235

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                 +  P  R L+AA     K + VVA DGSG++KSINAAL ++P  N    VI IK G
Sbjct  236   GFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALKTVPMKNKFPFVIYIKQG  295

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE V +    + + F+G+GPTKT ITGN N        TY+  TV V GE F  +D+ 
Sbjct  296   IYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNF-GMGKVKTYQTATVAVNGEHFTAKDIG  354

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAY-------------QDTLYTHSYRQFYRD  2046
              EN+AG   HQAVALR+SAD A  +NC ++ Y             QDTLY HS+RQFYRD
Sbjct  355   FENTAGPKGHQAVALRVSADYAVFHNCQIDGYVDSFYANCQIDGYQDTLYAHSHRQFYRD  414

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             CTISGT+D+IFG+A   FQNC M+VRKPM  Q CMVTAQGR D+R    IVL +C I  +
Sbjct  415   CTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRITGD  474

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
             PA       NK +LGRPWK+FSRT+IM T I+DI+ P+GW  W G   LDT  YAE++N+
Sbjct  475   PAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEFENK  534

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             GPG++   RVKW G K+  +P  A +FT G FL     W+ + Q+P+
Sbjct  535   GPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGG-TWIPQTQVPY  579



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   360 bits (924),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/400 (47%), Positives = 248/400 (62%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              E M+  L +S ELTSN LAIV+  D  + SL + G +R+LL E  P             
Sbjct  173   AESMRKALNSSAELTSNILAIVTNFDSALDSLNL-GFNRKLLAEEYP-------------  218

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +  P  R LL   P   K +I VA+DGSG  K+I  A+  +P  +N   VI IK 
Sbjct  219   ----SWISPGNRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIKE  274

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+E V +     N+  +G+G +KT ITG  N  D     T++  TV + G+GFI +DL
Sbjct  275   GVYEEQVQVNRSLTNVMMIGDGTSKTKITGKLNYIDG--TATFKTATVAIVGDGFIGKDL  332

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAGA KHQAVALR+ +D +  YN  ++ YQDTLY H+ RQFYR+CTISGT+DFIFG
Sbjct  333   WIENSAGAAKHQAVALRVQSDKSVFYNVRMDGYQDTLYVHTKRQFYRECTISGTIDFIFG  392

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++P VFQNC +  RKP+ NQ+ +VTAQGRKDRR A+AI+L +C I A+PA   A      
Sbjct  393   DSPTVFQNCLIQARKPLDNQQNIVTAQGRKDRRQASAIILHNCTISADPAYFPARKKLPT  452

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             FLGRPWKEFSRT ++ + +DD++ P+GW  W G   L++C+Y E  NRGPGA   +RV W
Sbjct  453   FLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWSGDFGLNSCFYTELDNRGPGADMSQRVNW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KG K +I    A++FT   F+  +  WL +  +PF PG L
Sbjct  513   KGVK-SIDYAHAQKFTVEHFIQGNA-WLPKTGVPFIPGLL  550



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   360 bits (925),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 249/400 (62%), Gaps = 12/400 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK  LKT+ ELTSN LA+VS++   + S+      RRLL   +   D     V    
Sbjct  178   GEKMKGFLKTAQELTSNGLAMVSEISSLLGSVNSNTHRRRLLGSSSG--DQKSKRVY---  232

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
             + L  +       LL A P   K ++VVAQDG+GKYKSI  AL  +P  + +  VI IK 
Sbjct  233   KPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKE  292

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKEYV++     N+  +G+GPTKT I+G++N  D     T    T    G+ F+ + +
Sbjct  293   GVYKEYVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTT--TMYTATFAAVGDYFVAKGI  350

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AGA KHQAVALR+ +D +  YNC+++AYQDTLYT +YRQ+YRDCTISGTVDFIFG
Sbjct  351   GFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFG  410

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   +FQNC+M+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK 
Sbjct  411   DGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKA  470

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK F+R +++ + ID+ + PEGW+ W G  +  +C+ AE  NRG GA   KRVKW
Sbjct  471   YLGRPWKGFARVVVIQSQIDNAIAPEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKW  530

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   + ++PE A  FTP      D +W+  + +P+  G +
Sbjct  531   QTLMK-LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  568



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   364 bits (935),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 233/335 (70%), Gaps = 11/335 (3%)
 Frame = -2

Query  2528  PFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
             P+    +R LLA  P    +A++VVA+DGSGK+K+I  AL  +P  N R+ VI IK GVY
Sbjct  360   PWVTLHSRRLLARRPTNGIRANVVVAKDGSGKFKTIAQALAMVPMQNKRKFVIHIKQGVY  419

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLT  2187
             KE V +  K  N+ FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+ 
Sbjct  420   KEKVEVTKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDVG  476

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA +HQAVALR+SAD A  +NCH+N YQDTLY H++RQFYRDC ISGT+DFIFG+
Sbjct  477   FENTAGAARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFIFGD  536

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC  ++R+PM NQ+C+VTAQGRKDRR    IV+ +  I+ + +       N+ F
Sbjct  537   AKAVFQNCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAF  596

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM T IDD++ PEGW  W  T  L+T +Y EY+NRG G+   +RVKW+
Sbjct  597   LGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWR  656

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G +R ISP  A++F PG FL  +  W+ + +IP++
Sbjct  657   GIRR-ISPRDAREFAPGNFLRGN-TWIPQTRIPYN  689



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   364 bits (934),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 233/335 (70%), Gaps = 11/335 (3%)
 Frame = -2

Query  2528  PFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
             P+    +R LLA  P    +A++VVA+DGSGK K+I  AL  +P  N R+ VI IK GVY
Sbjct  360   PWVTLHSRRLLARRPTNSIRANVVVAKDGSGKCKTIAQALAMVPMKNKRKFVIHIKQGVY  419

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLT  2187
             KE V +  K  N+ FVG+GPTKT+ITG+       P   GT+R  TV V G+ F+ +D+ 
Sbjct  420   KETVEVTKKMLNVMFVGDGPTKTIITGDIAF---LPNRVGTFRTATVAVNGDYFMAKDIG  476

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA +HQAVALR+SAD A  +NCH+N YQDTLY H++RQFYRDC ISGT+DF+FG+
Sbjct  477   FENTAGAARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGD  536

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC  ++R+PM NQ+C+VTAQGRKDRR    IV+ +  I+ + +       N+ F
Sbjct  537   AKAVFQNCVFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAF  596

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKE+SRT+IM T IDD++ PEGW  W  T  L+T +Y EY+NRG G+   +RVKW+
Sbjct  597   LGRPWKEYSRTIIMNTEIDDVIDPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWR  656

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             G +R ISP  A++F+PG FL  +  W+ + +IP++
Sbjct  657   GIRR-ISPRAAREFSPGNFLRGN-TWIPQTRIPYN  689



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   360 bits (925),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 254/409 (62%), Gaps = 25/409 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLE--------EPAPLKDDHG  2562
             +KMK++L TSM ++SNALA++S L D +  L      RRL++        E    KDD  
Sbjct  184   KKMKNILTTSMHMSSNALAVISDLADNVLDLNATTDGRRLIDDYKGEYVGEQVVAKDD--  241

Query  2561  NPVDSTDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
               V+     +        R LL       KA++VVA+DGSGK+K IN AL  +P  N + 
Sbjct  242   --VNDVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKINDALKQVPKKNQKP  299

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI IK GVY EYV +  K  ++ F+G+G  KT ITGN+N  D     TY+  TV +EG+
Sbjct  300   FVIHIKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGI--NTYQTPTVAIEGD  357

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
              F+  ++  ENSAG  KHQAVA+R+ AD A  Y C ++ YQDTLY H+ RQFYRDCTISG
Sbjct  358   NFVAINIGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYVHTMRQFYRDCTISG  417

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG+A  VFQNC  +V+KP+ NQ+C+VTAQGRK+R   + IV+Q+C I+A+     
Sbjct  418   TIDFIFGDAISVFQNCTFLVKKPLENQQCIVTAQGRKERHQPSGIVIQNCHIVADT--HN  475

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQG----TMYLDTCWYAEYQNRG  1683
                 NK +L RPWK FSRT+ M T+I D++ P+G+  WQG       +DTC+YAEY N+G
Sbjct  476   VKFDNKAYLARPWKNFSRTVFMKTYIGDLIQPDGFMPWQGPNGTVSGIDTCFYAEYNNKG  535

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             PG+   KRVKW G K  ++ + A  F P  F   D+ W+   +IP+S G
Sbjct  536   PGSDKSKRVKWPGIK-TLTSQSASHFLPSMFFHGDD-WIKVTKIPYSSG  582



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   360 bits (924),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/400 (47%), Positives = 253/400 (63%), Gaps = 18/400 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              E M+  ++ S ++TSNALA+V++LD  ++SL I  L RR L     L D   N   S  
Sbjct  181   AETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSLLRRKL-----LSDAGANEFPS--  233

Query  2540  EILSPFADPATRHLLAAPPKA---DIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +   A R LL   P     ++ VAQDG+G +++I  AL  +P  NN   VI +KA
Sbjct  234   -----WMPAAQRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKA  288

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE  ++      +  +G+GPTKT ITGN +V       T++  TV V GE F+   L
Sbjct  289   GVYKERFLVDKHMTKVTMIGDGPTKTKITGNVSVI-AGEISTFKTATVAVAGEWFVGIGL  347

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               EN+AG  KHQAVALR++AD +  YNC ++ YQDTLY HS RQFYRDCTI+GT+DFIFG
Sbjct  348   GFENTAGPEKHQAVALRVNADRSVFYNCRMDGYQDTLYAHSERQFYRDCTITGTIDFIFG  407

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  +FQNC +I RKPM NQ+ +VTAQGRK+R+G  AIVLQ+C I ++PA          
Sbjct  408   DSATIFQNCMIIARKPMDNQQNIVTAQGRKERQGNGAIVLQNCTITSDPAYYPHRKVLPT  467

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWK +SRTLI+ + +DD++ P+GW  W G + LDTC+YAE  NRGPGA   KRV W
Sbjct  468   YLGRPWKPYSRTLILQSQLDDLIHPDGWLPWTGDVGLDTCFYAELDNRGPGADLTKRVTW  527

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              G K N++   A+++T   +L   + W+ RA +PF PG L
Sbjct  528   PGIK-NLTYVEAQEYTIENYLYG-QTWISRAGVPFIPGLL  565



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   360 bits (923),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/400 (48%), Positives = 247/400 (62%), Gaps = 25/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              E M+  L +S E+TSN LAIV  LD+ + SL + G+SR+LL E  P             
Sbjct  173   AESMRKALNSSAEMTSNILAIVINLDNTLDSLNL-GISRKLLAEEYP-------------  218

Query  2540  EILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                  +     R LL   P   K ++ VAQDG+G  K+IN AL  +P  +N   VI IK 
Sbjct  219   ----SWVSLGKRRLLQLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKE  274

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVYKE V +     N+  VG+G  KT ITG+ N  D     T++  TV V G+GFI +DL
Sbjct  275   GVYKEKVQVNRSLTNVIMVGDGTNKTKITGSLNYIDG--TATFKTATVAVIGDGFIGKDL  332

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              IENSAGA KHQAVALR+ +D +  YN  ++ YQDTLY H+ RQFYRDC ISGT+DFIFG
Sbjct  333   WIENSAGAAKHQAVALRVQSDKSVFYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFG  392

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +   V QNC ++ RKPM NQ+ +VTAQGRKDRR A AIVL +C I A+PA          
Sbjct  393   DGAAVLQNCLILARKPMDNQQNIVTAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPT  452

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             FLGRPWKEFSRT ++ + +DD++ P+GW  W     L+TC+Y E  NRGPGA+T +RVKW
Sbjct  453   FLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWFENFGLNTCFYTELDNRGPGANTSQRVKW  512

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KG K  I    A++FT   F+  +  WL ++ +P+ PG L
Sbjct  513   KGVK-TIGYAHAQKFTVEHFIQGN-TWLPKSGVPYIPGLL  550



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   359 bits (921),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  162   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  216

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  217   ---RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  266

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  267   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  324

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  325   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  384

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK 
Sbjct  385   NALAVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKA  444

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  445   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  504

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  505   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  543



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   362 bits (930),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 253/402 (63%), Gaps = 28/402 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLL-EEPAPLKDDHGNPVDS  2547
             GE +K  LKT+++LT N LA+V+++ +++  ++   L SRRLL +EP+            
Sbjct  170   GETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTELNSRRLLAQEPS------------  217

Query  2546  TDEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                    + D   R LL AP    K D+VVAQDGSG+YK+I+ A+ ++P   N   V+ I
Sbjct  218   -------WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYI  270

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKE+V +    +++ F+G+GP KTVITG ++ +D     TYR  TV + G+ FI +
Sbjct  271   KTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAK  328

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++  EN+AGA KHQAV +R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+
Sbjct  329   NMGFENTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFL  388

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A    +
Sbjct  389   FGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKESS  448

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA    RV
Sbjct  449   KAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRV  508

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  509   TWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  548



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   363 bits (931),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 254/402 (63%), Gaps = 28/402 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLL-EEPAPLKDDHGNPVDS  2547
             GE +K  LKT+++LT NALA+V+++ +++  ++   LS RRLL +EP+            
Sbjct  184   GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQEPS------------  231

Query  2546  TDEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                    + D   R LL AP    K D+VVAQDGSG+YK+I+ A+ ++P   N   V+ I
Sbjct  232   -------WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYI  284

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKE+V +    +++ F+G+GP KTVITG ++ +D     TYR  TV + G+ FI +
Sbjct  285   KTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAK  342

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++  +N+AGA KHQAV +R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+
Sbjct  343   NMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFL  402

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A    +
Sbjct  403   FGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETS  462

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA    RV
Sbjct  463   KAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRV  522

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  523   TWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   359 bits (922),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  240

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  241   ---RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  290

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  291   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  348

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  349   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  408

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK 
Sbjct  409   NALAVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKA  468

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  469   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  528

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  529   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   358 bits (920),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 186/397 (47%), Positives = 254/397 (64%), Gaps = 17/397 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS EL+SN+LA+V+ L   + +  I GL+  L         ++   + ST +
Sbjct  177   QDMLKIFKTSRELSSNSLAMVTDLSTILPNSNITGLTGTLA--------NYARKLLSTKD  228

Query  2537  ILSPFADPATRHLLAAPP------KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
              +  +  P  R L+AAP       KA+ VVAQDGSG++K+I  ALN++P  N    VI I
Sbjct  229   GIPTWVGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIADALNAVPKDNRLPFVIHI  288

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+YKE V++  K   + F+G+GPTKT ITG+ N        T+   TV ++GE F  +
Sbjct  289   KQGIYKEKVIVTKKMPYVTFIGDGPTKTKITGSLNF-GLGKVKTFLTATVTIDGEHFTAK  347

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++ IEN+AG    QAVALR+SAD A  Y+C ++ YQDTLY HS RQFYRDCT+SGTVDFI
Sbjct  348   NIWIENTAGPEGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFI  407

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I+ EPA       N
Sbjct  408   FGDAKCILQNCKIVVRKPKGGQSCMVTAQGRTDVRESTGLVLHNCHIVGEPAYIPVKSVN  467

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK+FSRT+IM T IDD++ P GW  W+G   L+T +YAE+ N GPG++  +RV
Sbjct  468   KAYLGRPWKKFSRTIIMKTTIDDVIDPAGWLPWRGDFALETLYYAEHLNIGPGSNQAQRV  527

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              W G K+ +SPE A  +T G FL  D  W+ + Q+P+
Sbjct  528   NWPGIKK-LSPEEALLYTGGRFLHGD-TWIPQTQVPY  562



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   353 bits (905),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 185/398 (46%), Positives = 247/398 (62%), Gaps = 25/398 (6%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVDSTD  2541
             MK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H        
Sbjct  1     MKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH--------  52

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
              +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK GVY
Sbjct  53    RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVY  105

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++  E
Sbjct  106   QEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDG--TNTYRTATVAIQGDHFVAINMGFE  163

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  164   NSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNAL  223

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC  +VRKPM NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L 
Sbjct  224   AVFQNCTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLA  283

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKW  1650
             RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW
Sbjct  284   RPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKW  343

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              G   N++ + A+ F+P  F    + W+    IP+ PG
Sbjct  344   AGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPYFPG  379



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   359 bits (921),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/400 (46%), Positives = 254/400 (64%), Gaps = 24/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEE-PAPLKDDHGNPVDS  2547
             G+KMK LL +SM ++SNALAI++   D I  + +  +  RRLL++   P   +H   +D+
Sbjct  187   GKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKIVGRRLLQDYKTPSWVEHRKLLDA  246

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR-IVILIKA  2370
                        A +H        ++ VA DGSG +KSIN AL  +P   ++   VI IKA
Sbjct  247   KTN--------AFKHT------PNVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKA  292

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV + +   +I FVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++
Sbjct  293   GVYREYVEVLTNMTHIVFVGDGGKKSIITGNKNFMDGVT--TYHTATVAIQGDHFTAINM  350

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+  D A  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  351   GFENSAGPQKHQAVALRVQGDKAIFYNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFG  410

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNCK +VRKPM++Q+C+VTAQGRK+R   +AIV++   I+A+P        +K 
Sbjct  411   NAESVFQNCKFVVRKPMSDQQCIVTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKS  470

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEG---WSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK FSRT+IM TFIDD++ P+G   W   +G + +DTC+YAEY N GPG+   KR
Sbjct  471   YLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYAEYHNYGPGSDKSKR  530

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             VKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  531   VKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  568



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   358 bits (920),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDYELPSWVDQH-----  240

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  241   ---RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  290

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  291   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  348

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  349   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  408

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK 
Sbjct  409   NALAVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKA  468

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KR
Sbjct  469   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGPEGPSGMDTCFYAEYHNIGPGSDKSKR  528

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  529   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   358 bits (920),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  240

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  241   ---RLLNENASPLKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  290

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  291   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  348

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  349   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  408

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKP+ NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK 
Sbjct  409   NALAVFQNCTFVVRKPLENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKA  468

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  469   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  528

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  529   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   358 bits (920),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 250/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  240

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  241   ---RLLNENASPLKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  290

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  291   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  348

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  349   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  408

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKPM NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK 
Sbjct  409   NALAVFQNCTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKA  468

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  469   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  528

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP+ PG
Sbjct  529   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPYFPG  567



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   362 bits (929),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 254/402 (63%), Gaps = 28/402 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLL-EEPAPLKDDHGNPVDS  2547
             GE +K  LKT+++LT NALA+V+++ +++  ++   LS RRLL +EP+            
Sbjct  184   GETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSSRRLLAQEPS------------  231

Query  2546  TDEILSPFADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                    + D   R LL AP    K D+VVAQDGSG+YK+I+ A+ ++P   N   V+ I
Sbjct  232   -------WVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYI  284

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKE+V +    +++ F+G+GP KTVITG ++ +D     TYR  TV + G+ FI +
Sbjct  285   KTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGIT--TYRTATVAIIGDRFIAK  342

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++  +N+AGA KHQAV +R+ +D +  YNC  + YQDTLY HS+RQFYRDCTISGT+DF+
Sbjct  343   NMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFL  402

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A    +
Sbjct  403   FGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETS  462

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA    RV
Sbjct  463   KAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRV  522

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  523   TWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   354 bits (909),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 221/314 (70%), Gaps = 5/314 (2%)
 Frame = -2

Query  2480  ADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGP  2301
             A++VVA+DGSGK K+I  AL  +P  N R+ VI IK GVYKE + +  K  N+ FVG+GP
Sbjct  157   ANVVVAKDGSGKCKTIEQALAMVPMKNRRKFVIYIKQGVYKEKIEVTKKMKNVMFVGDGP  216

Query  2300  TKTVITGNRN-VEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADM  2124
             TKT+ITGN   + D+   GTYR  T  V G+ F+ +D+  EN+AGA +HQAVALR+SAD 
Sbjct  217   TKTIITGNVAFLPDRI--GTYRTSTFAVNGDYFMAKDIGFENTAGAARHQAVALRVSADF  274

Query  2123  AAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQEC  1944
             A  +NCH+  YQDTLY H++RQFYRDC ISGT+DF+FG+A  VFQNC+ ++R+PM NQ+C
Sbjct  275   AVFFNCHMAGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDNQQC  334

Query  1943  MVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDI  1764
             +VTAQGRKDRR    IV+ +  I  +   +     N+ FLGRPWKE+SRT+IM T IDD+
Sbjct  335   IVTAQGRKDRRETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDV  394

Query  1763  VVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + PEGW  W  T  L T +Y+EY+NRG G+   +RV+W+G +R IS   A+ F PG FL 
Sbjct  395   IDPEGWLKWNETFALKTLFYSEYRNRGRGSGQARRVRWRGIQR-ISARQARGFAPGEFLR  453

Query  1583  ADEQWLGRAQIPFS  1542
              +  W+ + +IP++
Sbjct  454   GNA-WITKRRIPYN  466



>gb|KHN20255.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=475

 Score =   354 bits (909),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 253/408 (62%), Gaps = 20/408 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KMK+LL +SM ++SNALAI+S++ D +  + +     R L E +      G  V   +
Sbjct  76    GNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDGHRELVEDSR----GGEHVFGHE  131

Query  2540  EILSPFADP---ATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
             E++  + +      R LL   P   K ++VVA+DGSGKYKSIN AL  +PA N +  VI 
Sbjct  132   EVIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIY  191

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY EYV +  K  ++ FVG+G +KT ITGN+N  D     TYR  +V + G+ FI 
Sbjct  192   IKEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGI--NTYRTASVAILGDYFIA  249

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
              ++  ENSAG  KHQAVA+R+ AD +  Y C ++ YQDTLY H+ RQFYRDCTISGT+DF
Sbjct  250   INIGFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDF  309

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++    K     
Sbjct  310   VFGDAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKF---D  366

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGPGAST  1668
             NKV+L RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YAEY N GPG++ 
Sbjct  367   NKVYLARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYAEYNNTGPGSNK  426

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              KRVKW+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  427   SKRVKWRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  472



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   358 bits (919),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 183/410 (45%), Positives = 259/410 (63%), Gaps = 22/410 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKD----DHGNPVD  2550
             +KM+++L TSM ++SNALAI+S L   +  L +    RRL++      +    D G  V 
Sbjct  186   KKMQNILTTSMHMSSNALAIISDLAKSVLDLNLTNNERRLIDNNNNNNNNNNNDVGEQVF  245

Query  2549  STDEILSPF-----ADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNR  2394
               D++  P      +    R LL A     KA+++VA+DGSGK+K IN AL  +P  N +
Sbjct  246   GHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGKFKKINDALKHVPKKNKK  305

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEG  2214
               VI IK GVY EYV +  K  ++ FVG+G  KT ITGN+N  D     TY+  TV + G
Sbjct  306   IFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFIDGV--NTYKTPTVAIAG  363

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             + F+  ++  ENSAG  KHQAVA+R+ AD +  Y C ++ YQDTLY H+ RQFYRDCTIS
Sbjct  364   DYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTLYAHTMRQFYRDCTIS  423

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  +FQNC  +VRKP+ NQ+C+VTAQGRKD+   + IV+Q C I+++    
Sbjct  424   GTIDFVFGDAVAIFQNCTFVVRKPLENQQCIVTAQGRKDKHQPSGIVIQGCSIVSDT--H  481

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMY-LDTCWYAEYQNR  1686
                  NK +L RPWK +SRT+ M T+I D++ P+G+  WQ   GT+  +DTC+Y EY+N+
Sbjct  482   NVKFDNKAYLARPWKNYSRTIFMKTYIGDLIEPDGYMPWQLPNGTLTGMDTCFYVEYKNK  541

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             GPG++  KRVKW+G K N++   A  F P  F   D+ W+   ++P+S G
Sbjct  542   GPGSNKSKRVKWRGIK-NLTSHTASVFLPYKFFHGDD-WIKVTRVPYSSG  589



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   358 bits (918),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 250/399 (63%), Gaps = 24/399 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPA-PLKDDHGNPVDST  2544
             +KMKHLL +S+ ++SN LAIVS   D +  + +  L  RRLL++   P   +H   +D+ 
Sbjct  193   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSEIPSWVEHRILLDAM  252

Query  2543  DEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR-IVILIKAG  2367
                              + PK ++ VA DGSG +KSIN AL  +P   +    VI IKAG
Sbjct  253   TN--------------KSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAG  298

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY+EYV +     +I FVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++ 
Sbjct  299   VYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQGDHFTAINMG  356

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR+  D    +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  357   FENSAGPQKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGN  416

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+  G +AIV+Q   I+A+P        +K +
Sbjct  417   AESVFQNCKFVVRKPMSNQQCIVTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHKSY  476

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM TFIDD++ P+G+  W    G + +DTC+YAEY N GPG++  KRV
Sbjct  477   LARPWKNFSRTIIMDTFIDDLIHPDGFFPWHTEVGPINMDTCFYAEYHNYGPGSNKSKRV  536

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             KW G   NI+ + A +F P  F    + W+    IP+ P
Sbjct  537   KWAGI-YNINSKAAHRFAPSKFFHGGD-WIKDTGIPYFP  573



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   357 bits (916),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 179/410 (44%), Positives = 249/410 (61%), Gaps = 34/410 (8%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLE-----------EPAP--  2580
             GEKM+  LKT+ ELTSN LA+VS++   + S ++    RRL+            +P P  
Sbjct  179   GEKMRGFLKTAQELTSNGLAMVSEISRLVDSPKLNS-HRRLMSSSKGGQTKRNYKPVPGW  237

Query  2579  LKDDHGNPVDSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAIN  2400
             + D H + + +T E L P                ++VVA+DG+GKYK+IN AL  +P  +
Sbjct  238   MSDRHLDLLTATPESLKP----------------NVVVAKDGTGKYKTINEALKEVPQKS  281

Query  2399  NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIV  2220
             N   VI IK G+Y+E V++  +  N+  +G+GPT T I+G+++  D     T    T   
Sbjct  282   NEAFVIYIKKGMYEETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGIT--TMNTATFAA  339

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
              G  F+ + +  EN+AG VKHQAVALR+ +D +  +NCH++AYQDTLYT +YRQFYRDCT
Sbjct  340   VGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCT  399

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             I+GTVDFIFG+   +FQNCKM+VRKP   Q CMVTAQGR DR     I LQ+C I  EP 
Sbjct  400   ITGTVDFIFGDGVALFQNCKMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPD  459

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
               A    NK +LGRPWK+F+R ++M + ID+ + PEGW+ W G  Y   C++ EY NRGP
Sbjct  460   YMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGP  519

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                  +RVKW   KR ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  520   RKDMTQRVKWSTVKR-LTPDQAAAFTPARVFEGD-KWVKPSGVPYVPGMM  567



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   357 bits (915),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 246/402 (61%), Gaps = 18/402 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDS--  2547
             GEKMK  LKT+ ELTSN LA+VS++   + S ++    R +       ++ +  PV    
Sbjct  179   GEKMKGFLKTAQELTSNGLAMVSEISRLVGSPKLNSHRRLMSSSKGGQRNRNYKPVPGWM  238

Query  2546  TDEILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
             +D  L          LL A P   K ++VVA+DG+GKYK+IN AL  +P  +    VI I
Sbjct  239   SDRDLD---------LLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYI  289

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVY+E V++  +  N+  +G+GPT T I+G+++  D     T +  T    G  F+ +
Sbjct  290   KKGVYEETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVT--TMKTATFAALGNYFVAK  347

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              +  EN+AG VKHQAVALR+ +D +  +NCH++AYQDTLYT +YRQFYRDCTI+GTVDFI
Sbjct  348   GIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFI  407

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+   +FQNCKM+VRKP   Q CMVTAQGR D      I LQ+C I  EP   A    N
Sbjct  408   FGDGVALFQNCKMVVRKPGETQACMVTAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKN  467

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK F+R ++M + ID+ + PEGW+ W G  Y   C++ EY N GPG+   +RV
Sbjct  468   KAYLGRPWKNFARVVVMQSSIDEAIAPEGWTEWTGEEYHQNCFFGEYGNTGPGSDVTQRV  527

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW   KR ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  528   KWSTVKR-LTPDQAAAFTPARVFEGD-KWIKPSGVPYVPGMM  567



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   357 bits (915),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 184/398 (46%), Positives = 251/398 (63%), Gaps = 14/398 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + MK + K S ELTSN+LA+++ +        I        E    L ++    +++ D 
Sbjct  183   QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNI-------TEATGDLGNNARKLLNAEDG  235

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
               S +  P TR L+AAP    K ++VVA+DGSG+YKSIN AL ++P  N    VI IK G
Sbjct  236   FPS-WVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQG  294

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKE V++  +  ++ F+G+GPTKT ITG+ N        TY   ++ VEG+ F+ +++ 
Sbjct  295   VYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIG-KVRTYLTSSLTVEGDNFVAKNMG  353

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AG    QAVALR+SAD   ++NC ++ YQDTLY HS+RQFYRD TISGTVDFIFG+
Sbjct  354   IENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGD  413

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             +  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ EPA       NK +
Sbjct  414   SIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAY  473

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N GPG++  +RVKW 
Sbjct  474   LGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWP  533

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  534   GIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   357 bits (915),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 184/398 (46%), Positives = 251/398 (63%), Gaps = 14/398 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + MK + K S ELTSN+LA+++ +        I        E    L ++    +++ D 
Sbjct  183   QDMKDIFKPSKELTSNSLAMITSMSSMFGKSNI-------TEATGDLGNNARKLLNAEDG  235

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
               S +  P TR L+AAP    K ++VVA+DGSG+YKSIN AL ++P  N    VI IK G
Sbjct  236   FPS-WVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQG  294

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKE V++  +  ++ F+G+GPTKT ITG+ N        TY   ++ VEG+ F+ +++ 
Sbjct  295   VYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIG-KVRTYLTSSLTVEGDNFVAKNMG  353

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             IEN+AG    QAVALR+SAD   ++NC ++ YQDTLY HS+RQFYRD TISGTVDFIFG+
Sbjct  354   IENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGD  413

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             +  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ EPA       NK +
Sbjct  414   SIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAY  473

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N GPG++  +RVKW 
Sbjct  474   LGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWP  533

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  534   GIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   356 bits (913),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 178/396 (45%), Positives = 255/396 (64%), Gaps = 14/396 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M+H+ KT+ EL+SN+LA+V+ +   + +    G +            ++   + +T++
Sbjct  179   QEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFA--------NYARKLLTTED  230

Query  2537  ILSPFADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              +  +  P  R L+AA P   KA+ VVAQDGSG++K+IN ALN+IP  N    VI IK G
Sbjct  231   GIPTWVGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQG  290

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKE VM+  K   + F+G+G TKTVITGN+N        T++   +IVEG+ F  +++ 
Sbjct  291   IYKEKVMVTRKMPYVTFIGDGQTKTVITGNQNY-GIGKVKTFQTAPLIVEGDHFTMKNIG  349

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             +EN+AG    QAVALR+SAD A  ++C  + YQDTLY HS+R F+RDCT+SGTVDFIFG+
Sbjct  350   VENTAGPEGGQAVALRVSADYAVFHSCQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGD  409

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I  +PA       +K +
Sbjct  410   AKCILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSY  469

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+FSRT++M T IDD++ P GW  W G   L T +YAEY N GPG++  +RVKW 
Sbjct  470   LGRPWKQFSRTIVMKTLIDDVIDPAGWLEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWP  529

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             G  R I+P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  530   GI-RKITPQDALSYTGDRFLGGNT-WIPQTQVPYTP  563



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   357 bits (917),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/399 (46%), Positives = 249/399 (62%), Gaps = 24/399 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEPA-PLKDDHGNPVDST  2544
             +KMKHLL +S+ ++SN LAIVS   D +  + +  L  RRLL++   P   +H   +D+ 
Sbjct  193   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRRLLQDSEIPSWVEHRILLDAM  252

Query  2543  DEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR-IVILIKAG  2367
                              + PK ++ VA DGSG +KSIN AL  +P   +    VI IKAG
Sbjct  253   TN--------------KSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKAG  298

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY+EYV +     +I FVG+G  K++ITGN+N  D     TY   TV ++G+ F   ++ 
Sbjct  299   VYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQGDHFTAINMG  356

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR+  D A  +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  357   FENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGN  416

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K +
Sbjct  417   AESVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSY  476

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEG---WSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM TFIDD++ P+G   W   +G + +DTC+Y EY N GPG+   KRV
Sbjct  477   LARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRV  536

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             KW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  537   KWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  573



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   348 bits (894),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/407 (43%), Positives = 246/407 (60%), Gaps = 34/407 (8%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLE-----------EPAP--LKD  2571
             M+  LKT+ ELTSN LA+VS++   + S ++    RRL+            +P P  + D
Sbjct  1     MRGFLKTAQELTSNGLAMVSEISRLVDSPKLNS-HRRLMSSSKGGQTKRNYKPVPGWMSD  59

Query  2570  DHGNPVDSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
              H + + +T E L P                ++VVA+DG+GKYK+IN AL  +P  +N  
Sbjct  60    RHLDLLTATPESLKP----------------NVVVAKDGTGKYKTINEALKEVPQKSNEA  103

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI IK G+Y+E V++  +  N+  +G+GPT T I+G+++  D     T    T    G 
Sbjct  104   FVIYIKKGMYEETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGIT--TMNTATFAAVGN  161

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
              F+ + +  EN+AG VKHQAVALR+ +D +  +NCH++AYQDTLYT +YRQFYRDCTI+G
Sbjct  162   YFVAKGIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITG  221

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+   +FQNCKM+VRKP   Q CMVTAQGR DR     I LQ+C I  EP   A
Sbjct  222   TVDFIFGDGVALFQNCKMVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMA  281

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK+F+R ++M + ID+ + PEGW+ W G  Y   C++ EY NRGP   
Sbjct  282   VKDKNKAYLGRPWKKFARVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRKD  341

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +RVKW   KR ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  342   MTQRVKWSTVKR-LTPDQAAAFTPARVFEGD-KWVKPSGVPYVPGMM  386



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   355 bits (911),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 253/408 (62%), Gaps = 20/408 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G KMK+LL +SM ++SNALAI+S++ D +  + +     R L E +      G  V   +
Sbjct  186   GNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDGHRELVEDSR----GGEHVFGHE  241

Query  2540  EILSPFADP---ATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
             E++  + +      R LL   P   K ++VVA+DGSGKYKSIN AL  +PA N +  VI 
Sbjct  242   EVIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIY  301

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVY EYV +  K  ++ FVG+G +KT ITGN+N  D     TYR  +V + G+ FI 
Sbjct  302   IKEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGI--NTYRTASVAILGDYFIA  359

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
              ++  ENSAG  KHQAVA+R+ AD +  Y C ++ YQDTLY H+ RQFYRDCTISGT+DF
Sbjct  360   INIGFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDF  419

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+A VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++    K     
Sbjct  420   VFGDAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKF---D  476

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGPGAST  1668
             NKV+L RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YAEY N GPG++ 
Sbjct  477   NKVYLARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYAEYNNTGPGSNK  536

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              KRVKW+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  537   SKRVKWRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  582



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   354 bits (909),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 249/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  191   GKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  245

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA DGSG +KSIN AL  +P  N +  VI IK 
Sbjct  246   ---RLLNENASPFKR-------KPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKE  295

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  296   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  353

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  354   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  413

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK 
Sbjct  414   NALAVFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKA  473

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  474   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  533

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  534   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  572



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   353 bits (906),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 249/400 (62%), Gaps = 23/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEP-APLKDDHGNPVDS  2547
             G+KMK  L TSM ++SNALA+V++L D I +L +  L  RRLL++  +P   DH    ++
Sbjct  187   GQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLLQDSESPSWVDHQGLPNA  246

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                + +               K ++ VAQDG+G +KSIN AL  +P  N +  VI IK G
Sbjct  247   NTSLFNH--------------KLNVTVAQDGNGDFKSINEALKQVPEKNKKPFVIYIKEG  292

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
              Y+EYV +     ++ F+G+G  KT I GN+N  D     TYR  TV ++G+ F+  ++ 
Sbjct  293   TYQEYVEVTKDMTHVVFIGDGGKKTRIIGNKNFIDGI--NTYRTATVAIQGDYFVAINMG  350

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN AG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  351   FENFAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  410

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC  +VRKPM NQ+C+VTAQGRK+++  + IV+Q   I+++P   +    NK +
Sbjct  411   ALAVFQNCTFVVRKPMKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAY  470

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK +SRT+IM T IDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV
Sbjct  471   LARPWKNYSRTIIMDTNIDDLIHADGYLPWQGPEGPTGMDTCFYAEYHNTGPGSDKSKRV  530

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              W G   N++ + A  F+P  F      W+    IP+ PG
Sbjct  531   NWSGI-WNLNSKAAHSFSPSKFFHG-TNWIQVTGIPYFPG  568



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   353 bits (906),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 248/401 (62%), Gaps = 21/401 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  +LK S+ELT+NAL I++ L  F+K L +  L+  L      L +D          
Sbjct  185   QTMAKVLKASLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSEDG---------  235

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
              L  +   + R LLAAP   K + VVAQDGSG++K++  AL  +P  N    VI +KAG+
Sbjct  236   -LPSWVSQSQRKLLAAPENVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGI  294

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             YKEYV +   ++++  +G+GPTKT+ TG+++  D     TY   T  V    F   ++  
Sbjct  295   YKEYVSVDKDRDHVTIIGDGPTKTIFTGSKSYADGVQ--TYNTATFGVNSAHFTALNVGF  352

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAGA KHQAVALR++AD A  YNC ++ YQDTLYT S RQFYRDCTISGT+DF+FG+A
Sbjct  353   ENSAGAAKHQAVALRVTADKALFYNCQMDGYQDTLYTQSKRQFYRDCTISGTIDFVFGDA  412

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK++VRKPMANQ+CMVTA GR      +A+V Q+C    EP +     P   +L
Sbjct  413   VGVFQNCKLVVRKPMANQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYL  471

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPW+ FS+ +I+ + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW G
Sbjct  472   GRPWRNFSKVVIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPG  531

Query  1643  YKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              K  IS   A ++ PG F       A + W+  + IP+S G
Sbjct  532   VK-TISAGEAAKYYPGKFYEIANGTARDDWITESGIPYSIG  571



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   352 bits (904),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/404 (43%), Positives = 249/404 (62%), Gaps = 9/404 (2%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLE--EPAPLKDDHGNPVDS  2547
             G+KM+  L+T+M +TSN LAI+S+L   +  + +    RRLL   +  P+     +  D 
Sbjct  184   GKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSGRRLLTAADDLPVLGHETDDFDL  243

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              D + S F      H+      A +VVA+DGSG + +IN AL  +P  N R  +I IK G
Sbjct  244   PDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFIIYIKEG  303

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY EYV +     ++  +G+G  K+ ITG++N  D    GTY+  +  + G+ F+   + 
Sbjct  304   VYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGV--GTYKTASAAIIGDFFVAIGMG  361

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AGA KHQAVALR+ +D +  Y C ++ YQDTLY H+ RQFYRDC ISGT+DF+FG+
Sbjct  362   FENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHAMRQFYRDCIISGTIDFVFGD  421

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  V QNC   VRKPMANQ+C+VTAQGRK+R   + I++    I+++P+       NK +
Sbjct  422   AVAVLQNCTFEVRKPMANQQCIVTAQGRKERNQPSGIIIHGGSIVSDPSYYPVRFDNKAY  481

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM ++IDD++ P+G+  WQ   G   +DTC+Y+E  N GPGA   KRV
Sbjct  482   LARPWKNFSRTIIMDSYIDDLITPDGYMPWQTVEGLSGMDTCFYSEINNHGPGADKSKRV  541

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW+G K ++S ++A  F P PF   D+ W+   ++P+  G   P
Sbjct  542   KWEGIK-SLSNDMATTFLPSPFFHGDD-WIRVTRVPYDSGLPSP  583



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   351 bits (901),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 185/401 (46%), Positives = 248/401 (62%), Gaps = 25/401 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-GLSRRLLE--EPAPLKDDHGNPVD  2550
             G+KMK LL   M ++SNALAIV+ L D +    I     RRLL+  E     D H     
Sbjct  186   GKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLLQDSELPSWVDQH-----  240

Query  2549  STDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                 +L+  A P  R       K ++ VA D SG +KSIN AL  +P  N +  VI IK 
Sbjct  241   ---RLLNENASPFKR-------KPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKE  290

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             GVY+EYV +  K  ++ F+GEG  KT I+GN+N  D     TYR  TV ++G+ F+  ++
Sbjct  291   GVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFID--GTNTYRTATVAIQGDHFVAINM  348

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FG
Sbjct  349   GFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFG  408

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA  VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK 
Sbjct  409   NALAVFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKA  468

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKR  1659
             +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KR
Sbjct  469   YLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKR  528

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             VKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  529   VKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   350 bits (899),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 253/402 (63%), Gaps = 29/402 (7%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL----SRRLLEEPAPLKDDHGNPVDST  2544
             M ++ K S +L+SN+LA+V+ L+    + E+ G     +R+LL               ST
Sbjct  179   MINIFKRSRQLSSNSLAMVTDLNS--NATELTGAFENNARKLL---------------ST  221

Query  2543  DEILSP-FADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
             +E   P +  P  R L+ AP     KA+ VVAQDGSG++K+IN ALN++P  N    VI 
Sbjct  222   EEDGVPTWVGPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIH  281

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK GVYKE V++  K   + F+G+GPTKTVITG+ N        TY    + VEGE F  
Sbjct  282   IKEGVYKEKVVVTRKMPYVTFIGDGPTKTVITGSLNF-GIGKVKTYLTAPLTVEGEHFTA  340

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             + + +EN+AG    QAVALR+S D A  ++C ++ YQDTLY HS RQFYRDCT+SGTVDF
Sbjct  341   KGIGMENTAGPEGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDF  400

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG++  + QNCK++VRKPMA Q CMVTAQGR D R    IVL +C I+ +PA       
Sbjct  401   IFGDSQCILQNCKIVVRKPMAGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTA  460

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             +K +LGRPWKEFSRT++M T +DD++ P GW  W G   L T +YAE+ N GPGA+  +R
Sbjct  461   SKAYLGRPWKEFSRTIVMKTIVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQR  520

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             VKW G K+ ++PE A  +T   FL  +  W+ R Q+P++ G 
Sbjct  521   VKWPGIKK-LTPEQALSYTGDRFLSGN-TWIPRTQVPYTAGM  560



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   350 bits (899),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 247/409 (60%), Gaps = 23/409 (6%)
 Frame = -2

Query  2714  KMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEI  2535
             KM+  L TS ELT N LA+V +  + + SL +P   RRLL        + G P       
Sbjct  173   KMRRALNTSQELTENILALVDEFSETLASLGLPSFHRRLL------AGNGGAP-------  219

Query  2534  LSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
              S   D A R +L A P     K D+ VA DGSG +K+INAAL  +P  +    V+ +KA
Sbjct  220   -SWMTDDAKRRVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVPTKSATAYVMYVKA  278

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G YKEYV +P    N+  VG+G TKTV+TG+++        T    T+ V G GF  R +
Sbjct  279   GTYKEYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNIT--TKDTATMEVIGNGFQMRGV  336

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              +EN+AGA  HQAVALR+ +DM+A Y C  + YQDTLYTH+ RQ+YRDC ++GT+DFIFG
Sbjct  337   GVENTAGARNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCVVTGTIDFIFG  396

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             NA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C +   P  +++    K 
Sbjct  397   NAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTVEPHPEFESSAGRLKT  456

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE SRTL + + I   V P+GW  W G   L TC+YAE +N GPGA T KR KW
Sbjct  457   YLGRPWKEHSRTLYIQSEIGGFVDPQGWLPWLGDFGLSTCYYAEVENHGPGADTSKRAKW  516

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
             KG K NI+ + A+Q       +  + WL +  +PF PG L P N+  ++
Sbjct  517   KGVK-NITYQQAQQKYTVERFIQGQTWLPKLGVPFIPGLL-PQNQTGRI  563



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   350 bits (899),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/398 (44%), Positives = 254/398 (64%), Gaps = 17/398 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS EL+SN+LA+V+++   I +  + GL+  L +        +   + ST++
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAK--------YARKLLSTED  230

Query  2537  ILSPFADPATRHLLAA------PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
              +  +  P  R L+AA      P KA+ VVAQDG+G++K+I  ALN++P  N    +I I
Sbjct  231   SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+YKE V +  K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  +
Sbjct  291   KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNF-GIGKVKTFLTATITIEGDHFTAK  349

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++ IEN+AG    QAVALR+SAD A  ++C ++ +QDTLY HS+RQFYRDCT+SGTVDFI
Sbjct  350   NIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFI  409

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       N
Sbjct  410   FGDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVN  469

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RV
Sbjct  470   KAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRV  529

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             KW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  530   KWPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   350 bits (899),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/398 (44%), Positives = 254/398 (64%), Gaps = 17/398 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + KTS EL+SN+LA+V+++   I +  + GL+  L +        +   + ST++
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAK--------YARKLLSTED  230

Query  2537  ILSPFADPATRHLLAA------PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
              +  +  P  R L+AA      P KA+ VVAQDG+G++K+I  ALN++P  N    +I I
Sbjct  231   SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+YKE V +  K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  +
Sbjct  291   KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNF-GIGKVKTFLTATITIEGDHFTAK  349

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++ IEN+AG    QAVALR+SAD A  ++C ++ +QDTLY HS+RQFYRDCT+SGTVDFI
Sbjct  350   NIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFI  409

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       N
Sbjct  410   FGDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVN  469

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RV
Sbjct  470   KAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRV  529

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             KW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  530   KWPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|XP_007149854.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
 gb|ESW21848.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
Length=460

 Score =   346 bits (888),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/400 (43%), Positives = 248/400 (62%), Gaps = 23/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL--SRRLLEEPAPLKDDHGNPVDS  2547
             G+KMK LL   ME++SN LAIV++L D I +  +  L   R L    +P  +DH   ++ 
Sbjct  65    GKKMKDLLMIGMEMSSNVLAIVTELADTITNSNVTNLLGHRHLQGSESPSWNDHHRLLNE  124

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                +++               K ++ VA+DG+G +K+IN AL  +P  N R  VI IK G
Sbjct  125   NASLVNH--------------KPNVTVAKDGNGDFKNINEALKQVPEKNKRPFVIYIKEG  170

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +Y+EYV +     ++ F+G+G  KT ITGN+N  D     TY+  T+ ++G+ F+  ++ 
Sbjct  171   IYQEYVQVTKDMTHVVFIGDGGKKTRITGNKNFIDGI--NTYKTSTIAIQGDYFVAINMG  228

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN AG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  229   FENFAGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  288

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNC  +VRKP+ NQ+C+VTAQGRK+++  + IV+Q   I+++P   +    NK +
Sbjct  289   ALAVFQNCTFVVRKPLKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSIRFENKAY  348

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG++  KRV
Sbjct  349   LARPWKNYSRTIIMDTYIDDLIHADGYLPWQGLEGPSGMDTCFYAEYHNTGPGSNKSKRV  408

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              W G   N++ +    F+P  F    + W+    IP  PG
Sbjct  409   HWSGI-WNLNSKAIHWFSPSKFFHGTD-WIHVTGIPCFPG  446



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   350 bits (898),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/394 (46%), Positives = 246/394 (62%), Gaps = 19/394 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK LL   M ++SNALAIV+ L D +    +  LSRR L + + L      PV    
Sbjct  181   GKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRRRLLQDSKL------PVWVDQ  234

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
               L    +   RH      K ++ VA DGSG +KSIN AL  +P  N +  VI IK GVY
Sbjct  235   HRLLNENESLLRH------KPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVY  288

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV +  K  ++ F+GEG  KT ITGN+N  D     TYR  TV ++G+ F+  ++  E
Sbjct  289   QEYVEVTKKMTHVVFIGEGGKKTRITGNKNFID--GTNTYRTATVAIQGDYFVAINMGFE  346

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  347   NSAGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNAL  406

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              +FQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L 
Sbjct  407   AIFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLA  466

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKW  1650
             RPWK +SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW
Sbjct  467   RPWKNYSRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKW  526

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
              G   N++ + A+ F+   F    + W+    IP
Sbjct  527   AGI-WNLNSKAARWFSASKFFHGTD-WIEVTGIP  558



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   350 bits (897),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/402 (44%), Positives = 248/402 (62%), Gaps = 21/402 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+ M  +L  S+EL++NAL I++ L  F+K L +   +  L      L +D         
Sbjct  184   GQTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASALNNNRKLLSEDG--------  235

Query  2540  EILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
               L  +   + R LLAAP   K ++VVAQDGSG++K++  AL ++P  N    VI +KAG
Sbjct  236   --LPSWVSQSQRKLLAAPQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAG  293

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             +YKEYV + + ++++  +G+GP KT+ TG+++  D     TY   T  V    F   ++ 
Sbjct  294   IYKEYVALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQ--TYNTATFSVNSAHFTAFNVG  351

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAGA KHQAVALR++AD A  YNC +N YQDTLYT S RQFYRDCTI+GT+DF+FG+
Sbjct  352   FENSAGAAKHQAVALRVTADKALFYNCEMNGYQDTLYTQSKRQFYRDCTITGTIDFVFGD  411

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK+IVRKPMA Q+CMVTA GR      +A+V Q+C    EP +    P    +
Sbjct  412   AVGVFQNCKLIVRKPMATQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQPK-IAY  470

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPW+ FS+ +I+ + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW 
Sbjct  471   LGRPWRNFSKVVIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWP  530

Query  1646  GYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             G K  IS   A ++ PG F       A + W+  + IP++ G
Sbjct  531   GVK-TISAGEAAKYYPGKFYEIANATARDDWITESGIPYAMG  571



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   360 bits (925),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 188/430 (44%), Positives = 257/430 (60%), Gaps = 39/430 (9%)
 Frame = -2

Query  2714  KMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS-RRLLE----EPAPLKDDHGNPV-  2553
             K++ +L+TSME++SN LAIV+ L     +L+I   + RRLL           DD GN V 
Sbjct  171   KVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATYKVHRRLFGDDDGNNVL  230

Query  2552  ----------------------DSTDEILSPFADPATRHLLAAP-------PKADIVVAQ  2460
                                    S D +L  + D   R LLA+P        KA++VVAQ
Sbjct  231   LSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASPMLTDDLKAKANVVVAQ  290

Query  2459  DGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITG  2280
             DGSGK+K+I  A+  IP       +I IK GVY EY+++     N+ FVG+GPTKT IT 
Sbjct  291   DGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMTNVVFVGDGPTKTRITN  350

Query  2279  NRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHL  2100
             N+N  D     T++  T+ V G+ F+ +D+ +ENSAGA+KHQAVA R  +D +  +NCH 
Sbjct  351   NKNYADG--TKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAFRAQSDKSIFFNCHF  408

Query  2099  NAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRK  1920
             + YQDTLYTH+YRQFYRDC I+GT+DFIFG+A V FQNC  +VRKP+ NQ C+VTAQGR 
Sbjct  409   DGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLENQNCIVTAQGRM  468

Query  1919  DRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSI  1740
             +R     I++ + +  A+P        NK +LGRPWKE+S+T+IM + I D++ PEGW  
Sbjct  469   ERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLIQPEGWLP  528

Query  1739  WQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGR  1560
             W+G   LDT +Y EY N G GA    RVKW+G K  I    A++F P P L  ++ W+  
Sbjct  529   WEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFMP-PILYENDDWIRD  586

Query  1559  AQIPFSPGFL  1530
             + IP+ P  +
Sbjct  587   SGIPYDPALI  596



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   349 bits (896),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/399 (45%), Positives = 247/399 (62%), Gaps = 20/399 (5%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEIL  2532
             M ++ K+S EL+SN+LA+ + L   + +  I GL+  L +        +   +  T++ +
Sbjct  179   MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK--------YARKLLYTEDGI  230

Query  2531  SPFADPATRHLLAAPPK---------ADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
               +  P  R L+ A PK         A++ VAQDGSG +K+I  AL  +P  N    +I 
Sbjct  231   PTWVGPHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIH  290

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK G+YKE V +  K   + F+G+GP KT ITGN N        T+   T+ +EGE F  
Sbjct  291   IKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNF-GIGKVKTFLTSTLTIEGEHFTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++ IEN+AG    QAVALR+SAD A  Y+C ++ YQDTLY HS RQFYRDCT+SGTVDF
Sbjct  350   KNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +VL +C I+ EPA       
Sbjct  410   IFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGEPAYIRVKSV  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T +YAE+ N GPG++   R
Sbjct  470   NKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             VKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  530   VKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   349 bits (895),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 184/409 (45%), Positives = 251/409 (61%), Gaps = 30/409 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI--------PGLSRRLLEEPAPLKDDHG  2562
             ++MK  L  + +LTSNALAI S + + ++S  I        P  SRRLLE        H 
Sbjct  174   KQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPSSSRRLLE--------HN  225

Query  2561  NPVDSTDEILSPFADPATRHLLAAPPKADI----VVAQDGSGKYKSINAALNSIPAINNR  2394
             N  D   +  S F   A R LLA+     +    VVA+DGSG+YK+I AAL + P     
Sbjct  226   N--DEQGQYPSWFR-AADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAALAAYPKGLKG  282

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIV  2220
             R +I +KAG+Y EYV +   + N+   G+GP KT++TG+++    W  G  T    T   
Sbjct  283   RYIIYVKAGIYNEYVTVTKDQVNVFMYGDGPRKTMVTGSKS----WADGITTQNTATFAA  338

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
              G GF+ + +  +N+AGA KHQAVALR+ ++M+A +NC ++AYQDTLY  ++RQFYR+C 
Sbjct  339   IGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHRQFYRNCV  398

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGTVDFIFG++P + QNC +IVRKPM  Q+  VTAQGR+D+R    IV+Q+C I+ E A
Sbjct  399   ISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNCRIVPEQA  458

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
             L       K +LGRPWK +SR +IM + + D + P GW  W G   LDT ++AEY NRGP
Sbjct  459   LFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFAEYGNRGP  518

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GA T+ RV+WKG+    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  519   GAVTNGRVRWKGFHVIRNRNEALQFTTGPFLLGD-QWLRNTGVPYFTGL  566



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   349 bits (896),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/400 (45%), Positives = 242/400 (61%), Gaps = 23/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLL--EEPAPLKDDHGNPVDS  2547
             G KMK LL +S+ ++SNALAI+S   D +       + RR L  +   P   DH    ++
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRHLLHDSETPSSVDHHKQHNA  247

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                +         +H      K ++ VA DGSG +KSIN AL  +P  + +  VI IK G
Sbjct  248   MKNVF--------KH------KPNVTVALDGSGDFKSINEALTRVPEKSKKPFVIYIKEG  293

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY EYV +     ++ FVG+G  KT+ITGN+N  D     TYR  +V ++G+ F+  ++ 
Sbjct  294   VYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGV--NTYRTASVAIQGDHFVAINMG  351

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR+  D    +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  352   FENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  411

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +
Sbjct  412   ALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAY  471

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV
Sbjct  472   LARPWKNFSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKSKRV  531

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              W G   N++ + A  F P  F    + W+    IPF  G
Sbjct  532   NWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  569



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   348 bits (894),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 251/409 (61%), Gaps = 30/409 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI--------PGLSRRLLEEPAPLKDDHG  2562
             ++MK  L  + +LTSNALAI S + + ++S  I        P  SRRLLE        H 
Sbjct  174   KQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPSSSRRLLE--------HN  225

Query  2561  NPVDSTDEILSPFADPATRHLLAAPPKADI----VVAQDGSGKYKSINAALNSIPAINNR  2394
             N  D   +  S F   A R LLA+     +    VVA+DGSG+YK+I AAL + P     
Sbjct  226   N--DEQGQYPSWFR-AADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAALAAYPKGLKG  282

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGG--TYRCGTVIV  2220
             R +I +KAG+Y EY+ +   + N+   G+GP KT++TG+++    W  G  T    T   
Sbjct  283   RYIIYVKAGIYNEYITVTKDQVNVFMYGDGPRKTMVTGSKS----WADGITTQNTATFAA  338

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
              G GF+ + +  +N+AGA KHQAVALR+ ++M+A +NC ++AYQDTLY  ++RQFYR+C 
Sbjct  339   IGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHRQFYRNCV  398

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGTVDFIFG++P + QNC +IVRKPM  Q+  VTAQGR+D+R    IV+Q+C I+ E A
Sbjct  399   ISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNCRIVPEQA  458

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
             L       K +LGRPWK +SR +IM + + D + P GW  W G   LDT ++AEY NRGP
Sbjct  459   LFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFAEYGNRGP  518

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GA T+ RV+WKG+    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  519   GAVTNGRVRWKGFHVIRNRNEALQFTAGPFLLGD-QWLRNTGVPYFTGL  566



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   348 bits (894),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 179/394 (45%), Positives = 246/394 (62%), Gaps = 19/394 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             G+KMK LL   M ++SNALAIV+ L D +    +  LSRR L + + L      PV    
Sbjct  181   GKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRRRLLQDSKL------PVWVDQ  234

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
               L    +   RH      K ++ VA DGSG ++SIN AL  +P  N +  VI IK GVY
Sbjct  235   HRLLNENESLLRH------KPNVTVAIDGSGDFESINEALKQVPKENRKPFVIYIKEGVY  288

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV +  K  ++ F+GEG  KT ITGN+N  D     TYR  TV ++G+ F+  ++  E
Sbjct  289   QEYVEVTKKMTHVVFIGEGGKKTRITGNKNFID--GTNTYRTATVAIQGDYFVAINMGFE  346

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALR+ AD +  YNC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  347   NSAGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNAL  406

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              +FQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L 
Sbjct  407   AIFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLA  466

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKW  1650
             RPWK +SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW
Sbjct  467   RPWKNYSRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKW  526

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
              G   N++ + A+ F+   F    + W+    IP
Sbjct  527   AGI-WNLNSKAARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   348 bits (894),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 244/400 (61%), Gaps = 22/400 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPG-LSRRLLEEP-APLKDDHGNPVDS  2547
             G KMK LL +S+ ++SNALAI+S   D +        L RRLL +   P   DH +   +
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRRLLHDSETPSSVDHHHKQHN  247

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                        A +++    P  ++ VA DGSG +KSIN AL  +P  + +  VI IK G
Sbjct  248   -----------AKKNVFKHKP--NVTVALDGSGDFKSINEALTQVPKKSKKPFVIYIKEG  294

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY EYV +     ++ FVG+G  KT+ITGN+N  D     TYR  +V ++G+ F+  ++ 
Sbjct  295   VYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFID--GVNTYRTASVAIQGDHFVAINMG  352

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR+  D    +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  353   FENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  412

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +
Sbjct  413   ALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAY  472

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV
Sbjct  473   LARPWKNFSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRV  532

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              W G   N++ + A  F P  F    + W+    IPF  G
Sbjct  533   NWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  570



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   341 bits (875),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 218/319 (68%), Gaps = 5/319 (2%)
 Frame = -2

Query  2483  KADIVVAQDGSGKYKSINAALNSIPAIN-NRRIVILIKAGVYKEYVMIPSKKNNIAFVGE  2307
             K D VVA+DGSG+Y++I  A+  IP  N ++  VI +K GVY EYVMI     N+  +G+
Sbjct  47    KPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGD  106

Query  2306  GPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISAD  2127
             G  KT +TG++N        T++  TV+V G+ FI +D+ IENSAGA  HQAVALR+ +D
Sbjct  107   GAXKTKVTGSKNFAAGVQ--TFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSD  164

Query  2126  MAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQE  1947
             ++  Y C ++ YQDTLYT ++RQFYRDCTISGT+DFIFG+A VVFQNCKMIVRKPM NQ 
Sbjct  165   LSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQA  224

Query  1946  CMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDD  1767
             CMVTAQGR DRR  + I+LQ+C I  +P        NK +LGRPWK  +RT++M + ID 
Sbjct  225   CMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDG  284

Query  1766  IVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFL  1587
             I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K N+S + A  FT G F+
Sbjct  285   IIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFV  343

Query  1586  MADEQWLGRAQIPFSPGFL  1530
               D +W+  + +P+  G +
Sbjct  344   EGD-KWIKPSGVPYVAGMV  361



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   348 bits (893),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 247/399 (62%), Gaps = 20/399 (5%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEIL  2532
             M ++ K+S EL+SN+LA+ + L   + +  I GL+  L +        +   +  T++ +
Sbjct  179   MLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK--------YARKLLYTEDGI  230

Query  2531  SPFADPATRHLLAAPPK---------ADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
               +  P  R L+ A PK         A++ VAQDGSG +K+I  AL  +P  N    +I 
Sbjct  231   PTWVGPHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKTITDALKVVPKNNRMPFIIH  290

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK G+YKE V +  K   + F+G+GP KT ITGN N        T+   T+ +EGE F  
Sbjct  291   IKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNF-GIGKVKTFLTSTLTIEGEHFTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++ IEN+AG    QAVALR+SAD A  Y+C ++ YQDTLY HS RQFYRDCT+SGTVDF
Sbjct  350   KNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +VL +C I+ +PA       
Sbjct  410   IFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGDPAYIRVKSV  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T +YAE+ N GPG++   R
Sbjct  470   NKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             VKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  530   VKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   348 bits (892),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/400 (45%), Positives = 251/400 (63%), Gaps = 19/400 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M  + +TS EL+SN+LA+V+ +   + +  I GL+  L         ++   + ST++
Sbjct  179   QDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGALA--------NYARKLLSTED  230

Query  2537  ILSPFADPATRHLLAAPP--------KADIVVAQDGSGKYKSINAALNSIPAINNRRIVI  2382
              +  +  P  R L+AA          KA+ VVAQDGSG++K+I  ALN +P  N    VI
Sbjct  231   GIPNWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALNGVPKGNTVPFVI  290

Query  2381  LIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFI  2202
              IK G+YKE VM+  K   + F+G+GP KTVITG+ N        T+   T+ VEG+ F 
Sbjct  291   HIKQGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNF-GIGKVKTFLTATITVEGDHFT  349

Query  2201  CRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVD  2022
              +++ IEN+AG    QAVALR+SAD A  ++C ++ +QDTLY HS+RQFYRDCT+SGTVD
Sbjct  350   AKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVD  409

Query  2021  FIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANP  1842
             FIFG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA      
Sbjct  410   FIFGDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPVKS  469

Query  1841  PNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDK  1662
              NK +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +
Sbjct  470   VNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQ  529

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             RVKW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  530   RVKWPGIKK-LTPQDALLYTGDRFLRGDT-WIPQTQVPYT  567



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   348 bits (892),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 255/415 (61%), Gaps = 29/415 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS---RRLLEEPAPLKDDHGNPVD  2550
             G KMK+LLK++M ++SNALAI+S+L D +  + +       R+L+E+     D+H   V 
Sbjct  163   GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSG---DEH---VF  216

Query  2549  STDEILSPFADP-------ATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAIN  2400
                +++  + +          R LL   A   K ++VVA+DGSGKYKSIN AL  +P  N
Sbjct  217   GQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKN  276

Query  2399  NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIV  2220
              +  VI IK GVY EYV +  K  ++ FVG+G  KT ITGN+N  D     TYR  +V V
Sbjct  277   QKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGL--NTYRTASVAV  334

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
             EG+ F+  ++  ENSAG  KHQAVA+R+ AD +  Y C ++ YQDTLY H+ RQFYRDCT
Sbjct  335   EGDYFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCT  394

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGTVDF+FG+A  VFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++   
Sbjct  395   ISGTVDFVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN--  452

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQN  1689
                 N  NK +L RPWK  SRT+ M T+I+ ++ PEG+  WQG   L   D C+YAEY N
Sbjct  453   -HTENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNN  511

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              GPG++  KRVKW+G    ++ E   +++P  F   D+ W+   +IP+      P
Sbjct  512   TGPGSNKSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVTAP  564



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   348 bits (893),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/415 (44%), Positives = 255/415 (61%), Gaps = 29/415 (7%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS---RRLLEEPAPLKDDHGNPVD  2550
             G KMK+LLK++M ++SNALAI+S+L D +  + +       R+L+E+     D+H   V 
Sbjct  186   GNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSG---DEH---VF  239

Query  2549  STDEILSPFADP-------ATRHLL---AAPPKADIVVAQDGSGKYKSINAALNSIPAIN  2400
                +++  + +          R LL   A   K ++VVA+DGSGKYKSIN AL  +P  N
Sbjct  240   GQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKN  299

Query  2399  NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIV  2220
              +  VI IK GVY EYV +  K  ++ FVG+G  KT ITGN+N  D     TYR  +V V
Sbjct  300   QKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGL--NTYRTASVAV  357

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
             EG+ F+  ++  ENSAG  KHQAVA+R+ AD +  Y C ++ YQDTLY H+ RQFYRDCT
Sbjct  358   EGDYFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCT  417

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGTVDF+FG+A  VFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++   
Sbjct  418   ISGTVDFVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN--  475

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQN  1689
                 N  NK +L RPWK  SRT+ M T+I+ ++ PEG+  WQG   L   D C+YAEY N
Sbjct  476   -HTENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNN  534

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              GPG++  KRVKW+G    ++ E   +++P  F   D+ W+   +IP+      P
Sbjct  535   TGPGSNKSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVTAP  587



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   348 bits (892),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 242/397 (61%), Gaps = 23/397 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL-SRRLLEEP-APLKDDHGNPVDS  2547
             G KMK LL +SM + SNALAI+S   D +       +  RRLL +   P   DH   +D+
Sbjct  188   GAKMKELLTSSMHMGSNALAIISDFADTLADWNATKVFGRRLLHDSETPSWVDHRQLIDT  247

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
                          RH      K ++ VA DG+G +K+IN AL  +P    +  +I IK G
Sbjct  248   KTNTF--------RH------KPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIKEG  293

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VY EYV +  +  ++ FVG+G  K+VITGN+N  D     TYR  +V ++G+ F   ++ 
Sbjct  294   VYSEYVEVTKRMTHVVFVGDGGKKSVITGNKNFIDGV--NTYRTASVAIQGDHFTAINMG  351

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              ENSAG  KHQAVALR+  D +  +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  352   FENSAGPHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  411

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +
Sbjct  412   ALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAY  471

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM  FIDD++ P+G+  WQ   G   +DTC+YAEY N GPG+   KRV
Sbjct  472   LARPWKNFSRTIIMDAFIDDLIHPDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRV  531

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              W G   N++ + A  F P  F    + W+    IPF
Sbjct  532   HWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPF  566



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   348 bits (893),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 248/408 (61%), Gaps = 14/408 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-------PGLSRRLLEEPAPLKDDHG  2562
             G KM+ +LKTS+ELT NA+A+VSK+   + +L+I           R L+E  A +    G
Sbjct  189   GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  248

Query  2561  NPVDSTDEILSPFADPATRHLLA----APPKADIVVAQDGSGKYKSINAALNSIPAINNR  2394
               V    ++   +  P  R LL     A  K D+VVA+DGSG   +IN ALN IP  +N+
Sbjct  249   IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  308

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEG  2214
                I IK G+Y+E V +      +  +G+G  KT ITGN N  D  P  T    TV V G
Sbjct  309   TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTP--TMHTATVSVLG  366

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             E F+ +++  ENSAG  KHQAVALR+ ADM+  YNC ++ YQDTLYTH+ RQ+YRDCTI+
Sbjct  367   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  426

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  427   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  486

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  487   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  546

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   RV W+G K     E A +FT G F   D+ W+    +P+  GF+
Sbjct  547   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYVSGFV  593



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   348 bits (892),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/407 (43%), Positives = 252/407 (62%), Gaps = 22/407 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDD---HGNPVD  2550
             G+KMK +L+TSM ++SN L+I+++L    + ++ P   RRLL+E    ++D   HG   +
Sbjct  186   GKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPA-GRRLLKESVDGEEDVLGHGGDFE  244

Query  2549  STDEILSPFAD--PATRHLL----AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRI  2388
                  L  + D     R LL        +A +VVA+DGSG + +I  AL  +P  N +  
Sbjct  245   -----LPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEALKHVPKKNLKPF  299

Query  2387  VILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEG  2208
             VI IK GVYKEYV +     ++ F+G+G  KT ITGN+N  D    GT++  +V + G+ 
Sbjct  300   VIYIKEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGV--GTFKTASVAITGDF  357

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             F+   +  ENSAG  KHQAVALR+ +D +  Y C ++ YQDTLY H+ RQFYRDC ISGT
Sbjct  358   FVGIGIGFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGT  417

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG++  V QNC  +VRKP+ NQ+C+VTAQGRK++     +++Q   I+A+P     
Sbjct  418   IDFVFGDSIAVLQNCTFVVRKPLENQQCIVTAQGRKEKNQPTGLIIQGGSIVADPKYYPV  477

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPG  1677
                NK +L RPWK+FSRT+ + T+I D++ PEG+  WQ   G    DTC+Y EY NRGPG
Sbjct  478   RLKNKAYLARPWKDFSRTIFLDTYIGDMITPEGYMPWQTPAGITGTDTCYYGEYNNRGPG  537

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             +   +RVKW+G K  I+ E A  F P  F   D+ W+   ++P+SPG
Sbjct  538   SDVKQRVKWQGVK-TITSEGAASFVPIRFFHGDD-WIRVTRVPYSPG  582



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   347 bits (890),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 252/403 (63%), Gaps = 27/403 (7%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEI----PGLSRRLLEEPAPLKDDHGNPVDST  2544
             M + L  + +LTSNALAIVS++   +K+L++       +RRLL       + +G P    
Sbjct  179   MNNGLLNATQLTSNALAIVSEVAKILKALDVHLDGTKTNRRLL-------NVNGYPT---  228

Query  2543  DEILSPFADPATRHLLAAPPKADI----VVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                   +   A R LLA+     +    VVA+DGSG++K+I AAL + P  NN R VI +
Sbjct  229   ------WFSSADRKLLASQDNGRLTPNAVVAKDGSGQFKTIAAALAAYPKKNNGRYVIYV  282

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             KAGVY+EY+ +  ++ N+   G+GPTKT+ITG +N     P  T++  +    G+GFI +
Sbjct  283   KAGVYEEYITVTKEQVNVFMYGDGPTKTIITGRKNNRQGVP--TFQTASFTAIGKGFIAK  340

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              +  +N+AG   HQAVALR+ +DM+A +NC ++ YQDTLY  ++RQFYR+C I+GT+DFI
Sbjct  341   SIGFQNTAGPEGHQAVALRVQSDMSAFFNCRMDGYQDTLYVQTHRQFYRNCVITGTIDFI  400

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++  V QN  +IVRKPM NQ+  VTA GRKD+     +V+Q+C I+ E  L       
Sbjct  401   FGDSSTVIQNSLIIVRKPMDNQQNTVTAHGRKDKGERTGLVIQNCRIVPEEKLFPQRFKI  460

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             + +LGRPWKE+SRT+IM + I D++ PEGW  W G   LDT +YAEY NRGPGA+T KRV
Sbjct  461   RSYLGRPWKEYSRTVIMESTIGDLIQPEGWMPWSGDFALDTLFYAEYGNRGPGAATGKRV  520

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              WKG+K   +   A QFT GPFL  D +WL     PF  G  Q
Sbjct  521   NWKGFKVITNKREALQFTAGPFLEGD-KWLPGTTTPFDLGLTQ  562



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   347 bits (890),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 250/399 (63%), Gaps = 16/399 (4%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
              E M   +K S ++TSNALA++++ D+ + S  I   + R L     L     N      
Sbjct  179   AEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISSHAGRKL-----LSGTRAN------  227

Query  2540  EILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
             E     +    R L  AP   K ++ VAQDG+G +K+I+ AL  +P  NN   VI +KAG
Sbjct  228   EFPWWMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFVIYVKAG  287

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKE V++     ++  +G+GPTKT ITG+ +V  +    T++  TV V GE F    L 
Sbjct  288   VYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVI-QGKISTFKTATVAVAGEWFTGMGLG  346

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG   HQAVALR++AD +  YNC ++ YQDTLY HS RQFYRDCTI+GT+DFIFG+
Sbjct  347   FENTAGPQNHQAVALRVNADRSVFYNCRMDGYQDTLYAHSGRQFYRDCTITGTIDFIFGD  406

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             +  + QNC +IVRKPM NQ+ +VTA GR DR+G  A+V+Q+C I ++PA   +      +
Sbjct  407   SATMLQNCMIIVRKPMDNQQNIVTAHGRIDRQGNGALVIQNCTITSDPAYYPSRKKLPTY  466

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK +SRTLI+ + +DD+V P+GW  W G + LDTC+YAE  NRGPGA+  KRV W 
Sbjct  467   LGRPWKPYSRTLILQSQLDDLVHPDGWMPWNGNIGLDTCFYAELDNRGPGANLTKRVTWP  526

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K+ +S + A++FT   +L   + W+ R  +PF PG L
Sbjct  527   GIKK-LSYDEAQRFTVEHYLFG-QTWIPRTGVPFIPGLL  563



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   348 bits (892),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 185/408 (45%), Positives = 248/408 (61%), Gaps = 14/408 (3%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEI-------PGLSRRLLEEPAPLKDDHG  2562
             G KM+ +LKTS+ELT NA+A+VSK+   + +L+I           R L+E  A +    G
Sbjct  193   GVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGHGG  252

Query  2561  NPVDSTDEILSPFADPATRHLLA----APPKADIVVAQDGSGKYKSINAALNSIPAINNR  2394
               V    ++   +  P  R LL     A  K D+VVA+DGSG   +IN ALN IP  +N+
Sbjct  253   IHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKSNK  312

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEG  2214
                I IK G+Y+E V +      +  +G+G  KT ITGN N  D  P  T    TV + G
Sbjct  313   TTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTP--TMHTATVSILG  370

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             E F+ +++  ENSAG  KHQAVALR+ ADM+  YNC ++ YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   RV W+G K     E A +FT G F   D+ W+    +P+  GF+
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYVSGFV  597



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   347 bits (889),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 244/397 (61%), Gaps = 20/397 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             +KMKHLL +S+ ++SN LAIVS   D +  + +  L  R L + + +      P      
Sbjct  175   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRCLLQDSEI------PSWVEHR  228

Query  2537  ILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR-IVILIKAGVY  2361
             IL    D  T     + PK ++ VA DGSG +KSIN AL  +P   +    VI IK GVY
Sbjct  229   IL---LDAMTN---KSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVY  282

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV +     +I FVG+G  K++ITGN+N  D     TY   TV ++ + F   ++  E
Sbjct  283   REYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQEDHFTAINMGFE  340

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALR+  D A  +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  341   NSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAE  400

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K +L 
Sbjct  401   SVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLA  460

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEG---WSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
              PWK FSRT+IM TFIDD++ P+G   W   +G + +DTC+Y EY N GPG+   KRVKW
Sbjct  461   CPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKW  520

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  521   AGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  555



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   346 bits (887),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 252/399 (63%), Gaps = 25/399 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPG-LSRRLLEEPAPLKDDHGNPVDSTD  2541
             + M  + KTS EL+SN+LA+V+++   I +  +    +R+LL               ST+
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTAKYARKLL---------------STE  223

Query  2540  EILSPFADPATRHLLAA------PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
             + +  +  P  R L+AA      P KA+ VVAQDG+G++K+I  ALN++P  N    +I 
Sbjct  224   DSIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIH  283

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK G+YKE V +  K  ++ F+G+GP KT+ITG+ N        T+   T+ +EG+ F  
Sbjct  284   IKEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNF-GIGKVKTFLTATITIEGDHFTA  342

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++ IEN+AG    QAVALR+SAD A  ++C ++ +QDTLY HS+RQFYRDCT+SGTVDF
Sbjct  343   KNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  402

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       
Sbjct  403   IFGDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSV  462

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +R
Sbjct  463   NKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQR  522

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             VKW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  523   VKWPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  559



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   339 bits (869),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 223/332 (67%), Gaps = 6/332 (2%)
 Frame = -2

Query  2525  FADPATRHLLAAPP---KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKE  2355
             +  P TR L+AAP    K ++VVA+DGSG+YKSIN AL ++P  N    VI IK GVYKE
Sbjct  40    WVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINNKVPFVIYIKQGVYKE  99

Query  2354  YVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENS  2175
              V++  +  ++ F+G+GPTKT ITG+ N        TY   ++ VEG+ F+ +++ IEN+
Sbjct  100   KVVVTKQMYHVTFIGDGPTKTKITGSVNFGIG-KVRTYLTSSLTVEGDNFVAKNMGIENT  158

Query  2174  AGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AG    QA ALR+SAD   ++NC ++ YQDTLY HS+RQFYRD TISGTVDFIFG++  +
Sbjct  159   AGPPGGQAAALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAI  218

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ EPA       NK +LGRP
Sbjct  219   FQNCNIVVRKPMGGQGCMVTAQGRTDVREPTAIVLHNCRIIGEPAYLPVKNINKAYLGRP  278

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WKEF+RT++M T I D++ P GWS W G   L T +YAEY+N GPG++  +RVKW G +R
Sbjct  279   WKEFARTIVMRTTISDVIDPAGWSAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQR  338

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
                P+ A  F PG FL +   W+ +  +P+ P
Sbjct  339   ITRPQ-ALGFAPGRFL-SGGSWIPQTGVPYLP  368



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   346 bits (887),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 252/398 (63%), Gaps = 17/398 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             + M+++ +TS EL+SN+LA+VS +     S    GL+  L         ++   + S ++
Sbjct  179   QDMQNIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTLT--------NYARKLLSAED  230

Query  2537  ILSPFADPATRHLLAA------PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
              +  +  P  R LLAA      P KA+ VVAQDGSG++K+I  ALN++P  N    VI I
Sbjct  231   GIPTWVRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHI  290

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+YKE V++  K   + F+G+GP KTVITG+ N        T+  G++ +EG+ F  +
Sbjct  291   KQGIYKEKVIVTRKMPYVTFIGDGPNKTVITGSLNF-GIGKVKTFLTGSITIEGDHFTAK  349

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++ IEN+AG    QAVALR+SAD AA  +C ++ +QDTLY HS+RQFYRDCT+SGTVDFI
Sbjct  350   NIGIENTAGPEGGQAVALRVSADYAAFQSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFI  409

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL +C I  + A       +
Sbjct  410   FGDAKCILQNCKIVVRKPKKGQSCMVTAQGRSNVRESTGLVLHNCHITGDSAYIPVKSES  469

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKEFSRT++M T IDD++ P GW  W G   L T +YAE+ N GPG++   RV
Sbjct  470   KAYLGRPWKEFSRTIVMKTAIDDVIDPAGWLPWSGDFALKTLYYAEHLNTGPGSNQAHRV  529

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             KW G K+ ++P+ A  +T   FL   E W+ + Q+P++
Sbjct  530   KWPGIKK-LTPQDALLYTGDKFL-GGETWIPQTQVPYT  565



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   345 bits (886),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 179/401 (45%), Positives = 240/401 (60%), Gaps = 24/401 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             EKM+  LK+S ELT N LAIV +  D + +L+I G SRRLL        D G PV     
Sbjct  175   EKMRKALKSSQELTENILAIVDQFADTLANLDITGFSRRLL-------GDDGVPV-----  222

Query  2537  ILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                 +   A R LL A P     K D+ VA DGSG +K+IN AL  +P  +    V+ +K
Sbjct  223   ----WMSNAKRRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVPVKSTGTYVMYVK  278

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG YKEYV +     N+  +G+G TKT+ITGN++        T    T+   G GF  R 
Sbjct  279   AGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNIT--TKDTATMEAIGNGFFMRG  336

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             + +EN+AG+  HQAVALR+ +D +A Y C  + +QDTLYTH+ RQ+YRDCTI+GT+DFIF
Sbjct  337   IGVENTAGSKNHQAVALRVQSDQSAFYECQFDGHQDTLYTHTSRQYYRDCTITGTIDFIF  396

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA VV QNC++ VR+ M NQ+ +VTAQGRK++  A   V+ +C I      KA     K
Sbjct  397   GNAQVVLQNCRIQVRRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHEDFKADAAKFK  456

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE +NRG GA   KR K
Sbjct  457   TFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGDGADMSKRAK  516

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K     +  +++T   F+   + WL +  +PF PG L
Sbjct  517   WRGVKTVTYQQAQQKYTVERFIQG-QTWLPKFGVPFIPGLL  556



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   347 bits (889),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 242/385 (63%), Gaps = 17/385 (4%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFADPATR  2505
              + SNALA++  + D   + E   ++R+L+EE    +D+ G P          +     R
Sbjct  243   HMCSNALAMIKNMTDTDIAREREAMNRKLMEE----RDESGWP---------KWLSAGDR  289

Query  2504  HLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSKKN  2328
              LL ++    D+VVA DGSG YK+++AA+ + P  +++R +I IKAGVYKE V +  KK 
Sbjct  290   RLLQSSSVTPDVVVAADGSGDYKTVSAAVAAAPEKSSKRYIIGIKAGVYKENVEVGKKKT  349

Query  2327  NIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAV  2148
             NI F+G+G + T+ITG++NV D     T+   TV V GE FI RD+T +N+AG  KHQAV
Sbjct  350   NIMFLGDGRSNTIITGSKNVVD--GSTTFNSATVAVVGEKFIARDITFQNTAGPSKHQAV  407

Query  2147  ALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALR+ +D++A Y C + AYQDTLY HS RQFY +C ++GTVDFIFGNA  VFQ+C +  R
Sbjct  408   ALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGNAAAVFQDCDIHAR  467

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             +P + Q+ M+TAQGR D      IV+Q C I A   L+A     K +LGRPWKE+SRT++
Sbjct  468   RPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSRTVV  527

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M T I +++ P GW  W G+  L T +Y EYQN G GA T KRV WKG+K   S   A+ 
Sbjct  528   MQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASEAQG  587

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGF  1533
             FTPG F+ A   WLG    P+S G 
Sbjct  588   FTPGTFI-AGSSWLGSTGFPYSLGL  611



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   347 bits (890),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 244/397 (61%), Gaps = 20/397 (5%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             +KMKHLL +S+ ++SN LAIVS   D +  + +  L  R L + + +      P      
Sbjct  175   KKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKLFGRCLLQDSEI------PSWVEHR  228

Query  2537  ILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR-IVILIKAGVY  2361
             IL    D  T     + PK ++ VA DGSG +KSIN AL  +P   +    VI IK GVY
Sbjct  229   IL---LDAMTN---KSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVY  282

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +EYV +     +I FVG+G  K++ITGN+N  D     TY   TV ++ + F   ++  E
Sbjct  283   REYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVT--TYHTTTVAIQEDHFTAINMGFE  340

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALR+  D A  +NC ++ YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  341   NSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAE  400

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K +L 
Sbjct  401   SVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLA  460

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEG---WSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
              PWK FSRT+IM TFIDD++ P+G   W   +G + +DTC+Y EY N GPG+   KRVKW
Sbjct  461   CPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKW  520

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  521   AGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  555



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   346 bits (887),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 245/406 (60%), Gaps = 21/406 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS---RRLLEEPAPLKDDHGNPVD  2550
             G+ M  +L  S+E++ NAL IV+      K L     +   R+LL E  PL       VD
Sbjct  186   GKTMTRVLNASLEMSHNALDIVNGASALFKGLNFTSFAASNRKLLSEE-PL-------VD  237

Query  2549  STDEILSPFADPATRHLLA-APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                +    +     R +L  A PK D+VVA DGSG+   I+ AL  +P  N +  VI IK
Sbjct  238   GLVDGFPSWVTEGQRKILEDANPKPDVVVALDGSGQVTKIHEALKLVPKNNKKPFVIYIK  297

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+Y+EYV +    + +  +G+GPT+T ITGN+N  D     TY   T       F+ ++
Sbjct  298   AGIYQEYVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQ--TYNTATFGANAANFMAKN  355

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  ENSAGA KHQAVALR++AD A  YNCH++ YQDTLYT S RQFYRDCT+SGT+DF+F
Sbjct  356   IGFENSAGAEKHQAVALRVTADKAVFYNCHMDGYQDTLYTQSQRQFYRDCTVSGTIDFVF  415

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCK +VRKPM NQ+CMVTA GR      +A+V QSC    EP L A  P   
Sbjct  416   GDAVAVFQNCKFVVRKPMENQQCMVTAGGRSKIDSPSALVFQSCTFTGEPDLVAVTPKIS  475

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPW+ +S+ +I+ + IDDI VPEG+  W G+ + DTC Y E+ NRGPGA+T  RV 
Sbjct  476   -YLGRPWRIYSKVVIIDSQIDDIFVPEGYMPWMGSAFRDTCTYYEFNNRGPGANTAGRVT  534

Query  1652  WKGYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPGFL  1530
             W G+K  I+P  A ++ PG F         + W+  + +P+S G L
Sbjct  535   WPGFKV-INPTEAAEYYPGKFFEIANSTDRDAWILESGVPYSLGSL  579



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   345 bits (886),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/407 (43%), Positives = 249/407 (61%), Gaps = 19/407 (5%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTD  2541
             GEKMK +L+T+M ++SN L+I+++L      ++  G  RRLL++   L     + V   D
Sbjct  185   GEKMKEILQTAMHMSSNGLSIINELSKTFTEMKPAG--RRLLKDDGEL-----HVVGRGD  237

Query  2540  EILSPFADP--ATRHLLAAPPK---ADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
                  + D     R LL    +   A +VVA+DG+G + +IN AL  +P  N R  VI I
Sbjct  238   FEFPEWVDDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALKHVPKKNLRPFVIYI  297

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+Y EYV +     ++ F+G+G  K+ ITGN+N  D    GTYR  TV + G+ F+  
Sbjct  298   KEGIYNEYVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGV--GTYRTATVAILGDFFVGI  355

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              +  ENSAG  KHQAVALR+ AD +  Y C ++ YQDTLY H+ RQFYRDC I+GT+DF+
Sbjct  356   GIGFENSAGPEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCVITGTIDFV  415

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++  V QNC  +VRKP+ NQ+C+VTAQGRK+R   + +++Q   I+++P        N
Sbjct  416   FGDSVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLIIQGGSIVSDPKYFPVRFDN  475

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK FSRT+ M T+I D++ P+G+  WQ   G    +TC+YAEY NRGPG+   
Sbjct  476   KAYLARPWKNFSRTIFMDTYIGDLITPDGYMPWQTIEGITGTETCYYAEYNNRGPGSDIT  535

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KRVKW+G K  I+ E A  F P  F   D+ W+   ++P+ PG   P
Sbjct  536   KRVKWEGVK-TITSEGANTFLPTAFFHGDD-WIRVTRVPYYPGGAAP  580



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   344 bits (883),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 249/404 (62%), Gaps = 15/404 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             EKM   +K   ELT N LA+ +   D +   +  G  RRLL +   +     N  D   E
Sbjct  172   EKMMEFMKLGKELTINGLALANGFSDLLLPND-HGAGRRLLADSNKMG--LINKADYIGE  228

Query  2537  ILSPFADPATRHLLAAPP--KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
                 +A    R L AAP   K  + VA+DGSG + +I  AL S+P   N   +I IKAGV
Sbjct  229   HWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVPLSCNDTYIIYIKAGV  288

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGT--YRCGTVIVEGEGFICRDL  2190
             Y+E +++ +   ++ F+G+GP  T ITGN++      GGT  +   TV V+G+ FI +D+
Sbjct  289   YQENIIVGTSMWSVMFIGDGPNATKITGNKSK----VGGTETFWTATVGVDGDNFIAKDI  344

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
               ENSAGA  HQAVALR S D +  +NC ++ YQDT++ H++RQF+RDCTISGT+DFIFG
Sbjct  345   GFENSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFAHNHRQFFRDCTISGTIDFIFG  404

Query  2009  NAPVVFQNCKMIVRKPMANQE-CMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             NA  VFQNC ++VRKP+ NQ+ C+VTA+GR      +AIVLQ+C IL  P     +P  K
Sbjct  405   NARAVFQNCTLLVRKPLENQKACLVTAEGRTTINETSAIVLQNCRILPAPEYPVNDPTYK  464

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT-MYLDTCWYAEYQNRGPGASTDKRV  1656
              +LGRPWK +SRT+IM + +D +V PEGW+ W  T  +LDTCWYAE  N+GPGA   +RV
Sbjct  465   TYLGRPWKPYSRTVIMDSHLDSLVDPEGWAPWNVTSAHLDTCWYAELNNKGPGADLSRRV  524

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              W G K+ I+   A  FTPG F++ D  W+    IP+  G + P
Sbjct  525   AWPGIKK-ITVNEADDFTPGQFMVGD-SWIAGKGIPYDSGLILP  566



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   344 bits (882),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/392 (45%), Positives = 232/392 (59%), Gaps = 20/392 (5%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDD-----FIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFA  2520
              L SN+LA+V             +  +    RRLL       DDHG P          + 
Sbjct  204   HLVSNSLAMVCNFSQQANLALGNADSLSDRRRRLLSNDFMSSDDHGFP---------SWM  254

Query  2519  DPATRHLLAAPPK---ADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYV  2349
                 R LL  P +   A+ VVA+DGSG Y +I+AA+ + P  +  R VI IK GVY+E V
Sbjct  255   SAGDRRLLQTPAQNINANAVVAKDGSGSYTTISAAVAAAPEKSTSRYVIHIKKGVYQENV  314

Query  2348  MIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAG  2169
              IP  K+N+ F+G+G   TV+T NRNV D +   T+   T  V G+GF+ RD+T +N+AG
Sbjct  315   DIPKNKHNLMFIGDGKDVTVVTANRNVVDGYT--TFHSATAAVTGKGFVARDMTFKNTAG  372

Query  2168  AVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
               KHQAVALR+ +D++A   C    YQDTLY HS RQFYR+C + GTVDF+FGNA VV Q
Sbjct  373   PTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYRECDVYGTVDFVFGNAAVVLQ  432

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NC ++ RKP ANQ+ M TAQGR+D      I +Q+C + A   L AA    +V+LGRPWK
Sbjct  433   NCNIMARKPSANQKIMYTAQGREDPNQNTGISIQNCRLSATSDLVAAKSSFQVYLGRPWK  492

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             ++SRT+I+ + +DD++ P GW  W G   L T +Y EY NRGPGA+T  RVKW G++   
Sbjct  493   QYSRTVILQSHLDDLIHPAGWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHRVIT  552

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             S   A QFT   FL  D  WL    + ++ GF
Sbjct  553   SSSEANQFTVNQFLQGDS-WLPATGVQYTAGF  583



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   343 bits (880),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 252/401 (63%), Gaps = 28/401 (7%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL----SRRLLEEPAPLKDDHGNPVDST  2544
             M ++ K S +L+SN+LA+V+ L+    + E+ G     +R+LL               ST
Sbjct  179   MINIFKRSRQLSSNSLAMVTDLNS--NATELTGAFENNARKLL---------------ST  221

Query  2543  DEILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
             ++ +  +  P  R L+ AP     KA+ VVAQDGSG++K+IN ALN++P  N    VI I
Sbjct  222   EDGVPTWVGPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHI  281

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K GVYKE V++  K   + F+G+GPTKTVI+G+ N        TY    + VEGE F  +
Sbjct  282   KEGVYKEKVVVTRKMPYVTFIGDGPTKTVISGSLNF-GIGKVKTYLTAPLTVEGEHFTAK  340

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              + +EN+AG    QAVALR+S D A  ++C ++ YQDTLY HS RQFYRDCT+SGTVDFI
Sbjct  341   GIGMENTAGPEGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFI  400

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++  + QNCK++VRKPMA Q CMVTAQGR D R    IV+ +C I+ +PA       +
Sbjct  401   FGDSQCILQNCKIVVRKPMAGQSCMVTAQGRSDVREPTGIVVHNCHIVGDPAYIPVRTAS  460

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+++ T +DD++ P GW  W G   L T +YAE+ N GPGA+  +RV
Sbjct  461   KAYLGRPWKEFSRTIVIKTTVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRV  520

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             KW G K+ ++ E A  +T   FL  +  W+ R Q+P++ G 
Sbjct  521   KWPGIKK-LTHEQALSYTCDRFLSGN-TWIPRTQVPYTAGM  559



>ref|XP_004495869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=576

 Score =   344 bits (882),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 186/416 (45%), Positives = 253/416 (61%), Gaps = 32/416 (8%)
 Frame = -2

Query  2717  EKMKHLLKTS----ME-LTSNALAIVSKLDDFIKS----LEIPGLSRRLLEEPAPLKDDH  2565
             +++K LLKT     ME LT   L IV+ +   +++    +++   SRRLL+         
Sbjct  173   DQVKELLKTESLDQMEKLTGMTLDIVTSMTHILQTFDLKMDLNPASRRLLDV--------  224

Query  2564  GNPVDSTDEILSPFADPATRHLLA-----APPKADIVVAQDGSGKYKSINAALNSIPAIN  2400
              N +D  +E L  +   + R LL+       P  ++VVA+DGSGK+K++  A++S P   
Sbjct  225   -NELD--NEGLPTWFSISDRKLLSKTNNGGNPPPNVVVAKDGSGKFKTVKEAIDSYPKDF  281

Query  2399  NRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIV  2220
               R +I +KAGVY EY+ IP K  NI   G+GPTKT++TG++N  D     T +  T   
Sbjct  282   KERYIIYVKAGVYDEYITIPKKSINILMYGDGPTKTIVTGHKNFVDGVK--TMQTATFAN  339

Query  2219  EGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCT  2040
                GFI + +  EN+AG  KHQAVA R   DM A ++C ++ YQDTLY  + RQFYR+C 
Sbjct  340   VANGFIAKSMAFENTAGPEKHQAVAFRNQGDMTAFFDCAMHGYQDTLYVQTNRQFYRNCE  399

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGTVDFIFG +P + QN K+++RKP  NQ   VTA G K R  A  IVLQ+CEI+AE A
Sbjct  400   ISGTVDFIFGASPTLIQNSKIVIRKPGPNQFNTVTADGTKQRSMATGIVLQNCEIVAESA  459

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
             L+      K +LGRPWKE+S+T++M + I D++ PEGWS+W GT +LDT +YAEY N GP
Sbjct  460   LQPVRFEFKSYLGRPWKEYSKTVVMESNIGDLIQPEGWSVWDGTQFLDTLYYAEYANTGP  519

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMAD-----EQWLGRAQIPFSPGFLQ  1527
             GA   KRV WKGY  NI+   A QFT G FL A      + WL    IP++ GF +
Sbjct  520   GADVSKRVNWKGYHPNINSNEAAQFTAGQFLRAGPTGKADDWLKATGIPYTIGFTK  575



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   343 bits (880),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 231/387 (60%), Gaps = 20/387 (5%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEI--LSPFADPA  2511
              + SNALA++  + D   + E   + R+L E              ST EI     +    
Sbjct  211   HMCSNALAMIKNMTDTDMAEEKLKMGRKLGE--------------STGEIDGFPGWLSAG  256

Query  2510  TRHLLAAPPKA-DIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSK  2334
              R LL A     D+ VA DGSG YK+++ A+ + P  +N+R +I IKAGVYKE V +  K
Sbjct  257   DRRLLQASTVTPDVTVASDGSGNYKTVSEAVAAAPINSNKRYIIRIKAGVYKENVDVSKK  316

Query  2333  KNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQ  2154
             K NI FVG+G   T+ITG+RNV D     T+   TV   GEGF+ RD+T +N+AG  KHQ
Sbjct  317   KKNIMFVGDGRKNTIITGSRNVVD--GSTTFHSATVAAVGEGFLARDITFQNTAGPSKHQ  374

Query  2153  AVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALR+ +D +A Y C + AYQDTLY HS RQFY DC I GTVDFIFGNA  VFQNC + 
Sbjct  375   AVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDFIFGNAAAVFQNCDIH  434

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
              R+P + Q+ M+TAQGR D      IV+Q+C I A   L+A       +LGRPWKE+SRT
Sbjct  435   ARRPNSGQKNMLTAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSSFPTYLGRPWKEYSRT  494

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + I D++ P GW  W G   L T +YAEYQN GPGA+T  RV WKGYK   S   A
Sbjct  495   VIMQSTISDVIHPAGWHEWSGNFALTTLYYAEYQNTGPGAATANRVSWKGYKVITSATEA  554

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              +FT   F+ A   WLG    PFS G 
Sbjct  555   LRFTVSNFI-AGGSWLGSTGFPFSSGL  580



>ref|XP_006414405.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
 gb|ESQ55858.1| hypothetical protein EUTSA_v10024582mg [Eutrema salsugineum]
Length=684

 Score =   346 bits (888),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 224/328 (68%), Gaps = 10/328 (3%)
 Frame = -2

Query  2510  TRHLLAAPPK---ADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIP  2340
             +R LLAAP K   A++VVA+DGSGK K+I  AL  +P  N R+ VI IK GVYKE V + 
Sbjct  360   SRRLLAAPAKRINANVVVAKDGSGKCKTIAQALAMVPMRNTRKFVIHIKQGVYKETVEVT  419

Query  2339  SKKNNIAFVGEGPTKTVITGNRNVEDKWPG--GTYRCGTVIVEGEGFICRDLTIENSAGA  2166
              K  N+ FVG+GPTKT+ITG+       P   GTYR  TV V G+ F+ +D+  EN+AGA
Sbjct  420   KKMANVVFVGDGPTKTIITGDIAF---LPNRVGTYRTATVAVNGDYFMAKDIGFENTAGA  476

Query  2165  VKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              +HQAVALR+SAD A  +NCH+N YQDTLY H++RQFYRDC ISGT+DF+FG+A  VFQN
Sbjct  477   ARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQN  536

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C+ ++R+PM NQ+C+VTAQGRKDRR    IV+ +  I  +         N+ FLGRPWKE
Sbjct  537   CEFVIRRPMDNQQCIVTAQGRKDRRETTGIVIHNSRITGDATYLPVKAKNRAFLGRPWKE  596

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM T IDD++ PEGW  W  T  L+T +Y+EY+NRG G S   R       R +S
Sbjct  597   YSRTIIMNTEIDDVIDPEGWLKWNETFALNTLFYSEYRNRGRG-SGQARRVRWRGIRRMS  655

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
                AK+F+PG FL  +  W+ + ++P++
Sbjct  656   DRDAKEFSPGNFLRGNA-WIPQTRVPYN  682



>ref|XP_003536855.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=574

 Score =   343 bits (879),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 244/402 (61%), Gaps = 32/402 (8%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKS----LEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFAD  2517
             +LT   L IV+ L   ++S    L++   SRRLLE      D  G P          +  
Sbjct  190   KLTGIVLDIVTNLSKILQSFDLKLDLNPASRRLLE-----LDAEGYPT---------WFS  235

Query  2516  PATRHLLA------APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKE  2355
              A R LLA      APP  + VVA DGSG++KS+  A++S P     R +I +KAG+Y E
Sbjct  236   AADRRLLAKMNQGGAPP-PNAVVALDGSGQFKSVKQAIDSYPKNFKGRFIIYVKAGIYNE  294

Query  2354  YVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENS  2175
             Y+ IP K  NI   G+GPTK++ITGN+N  D     T +  T      GFI + +  EN+
Sbjct  295   YITIPKKSENILIYGDGPTKSIITGNKNFIDGVK--TMQTATFANTAPGFIAKSIAFENT  352

Query  2174  AGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVA R   DM+A+++C ++ YQDTLYT + RQFYR+C ISGT+DFIFG AP +
Sbjct  353   AGAKKHQAVAFRNQGDMSAMFDCAMHGYQDTLYTQANRQFYRNCEISGTIDFIFGAAPTL  412

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
              QN ++IVRKP ANQ   VTA G K +  A  IVLQ+CEIL E AL       K +LGRP
Sbjct  413   IQNSRIIVRKPEANQFNTVTADGTKQKNMATGIVLQNCEILPEQALFPTRFQTKSYLGRP  472

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK+F+RT++M + I D + PEGW+ W G ++LDT +YAEY N GPG++   RVKWKGY  
Sbjct  473   WKDFARTVVMESNIGDFIQPEGWTPWSGNLFLDTLYYAEYANVGPGSNVQGRVKWKGYHP  532

Query  1634  NISPEVAKQFTPGPFLMAD-----EQWLGRAQIPFSPGFLQP  1524
             NI+   A+QFT G FL        + WL    +P++ GF +P
Sbjct  533   NINKNEAEQFTAGQFLRGGPSGNADDWLKATGVPYTIGFTKP  574



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   342 bits (878),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/401 (44%), Positives = 238/401 (59%), Gaps = 24/401 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             EKMK+ LK+S ELT N LA+V +  D + +L++P  SRRLL                 D+
Sbjct  175   EKMKNALKSSQELTENILALVDQFGDTLANLDLPSFSRRLL----------------GDD  218

Query  2537  ILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
              L  +   A R LL A P     K D+ VA DGSG +K+IN AL  +P       V+ +K
Sbjct  219   GLPGWISDAKRRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPIKATATYVMYVK  278

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG YKEYV +     N+  +G+G TKT+ITGN++        T    T+   G GF  R 
Sbjct  279   AGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNIT--TKDTATMEAIGNGFFMRG  336

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             + +EN+AGA  HQAVALR+ +D +  Y C  + YQDTLYTH+ RQ+YR+CTI+GT+DFIF
Sbjct  337   IGVENTAGAKNHQAVALRVQSDQSVFYQCQFDGYQDTLYTHTSRQYYRECTITGTIDFIF  396

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA VVFQNC +  R+ M NQ+ +VTAQGRK++  A   V+ +C I      KA     +
Sbjct  397   GNAQVVFQNCLIQARRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHADFKADAAKFR  456

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE +NRG GA   KR K
Sbjct  457   TFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGAGADMSKRAK  516

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             W+G K     +  +++T   F+   +QW+ +  +PF PG L
Sbjct  517   WRGVKTVTYQQAQQKYTVERFIQG-QQWIPKYGVPFIPGLL  556



>gb|KHN00313.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=574

 Score =   342 bits (878),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 244/402 (61%), Gaps = 32/402 (8%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKS----LEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFAD  2517
             +LT   L IV+ L   ++S    L++   SRRLLE      D  G P          +  
Sbjct  190   KLTGIVLDIVTNLSKILQSFDLKLDLNPASRRLLE-----LDAEGFPT---------WFS  235

Query  2516  PATRHLLA------APPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKE  2355
              A R LLA      APP  + VVA DGSG++KS+  A++S P     R +I +KAG+Y E
Sbjct  236   AADRRLLAKMNQGGAPP-PNAVVALDGSGQFKSVKQAIDSYPKNFKGRFIIYVKAGIYNE  294

Query  2354  YVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENS  2175
             Y+ IP K  NI   G+GPTK++ITGN+N  D     T +  T      GFI + +  EN+
Sbjct  295   YITIPKKSENILIYGDGPTKSIITGNKNFIDGVK--TMQTATFANTAPGFIAKSIAFENT  352

Query  2174  AGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVA R   DM+A+++C ++ YQDTLYT + RQFYR+C ISGT+DFIFG AP +
Sbjct  353   AGAKKHQAVAFRNQGDMSAMFDCAMHGYQDTLYTQANRQFYRNCEISGTIDFIFGAAPTL  412

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
              QN ++IVRKP ANQ   VTA G K +  A  IVLQ+CEIL E AL       K +LGRP
Sbjct  413   IQNSRIIVRKPEANQFNTVTADGTKQKNMATGIVLQNCEILPEQALFPTRFQTKSYLGRP  472

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK+F+RT++M + I D + PEGW+ W G ++LDT +YAEY N GPG++   RVKWKGY  
Sbjct  473   WKDFARTVVMESNIGDFIQPEGWTPWSGNLFLDTLYYAEYANVGPGSNVQGRVKWKGYHP  532

Query  1634  NISPEVAKQFTPGPFLMAD-----EQWLGRAQIPFSPGFLQP  1524
             NI+   A+QFT G FL        + WL    +P++ GF +P
Sbjct  533   NINKNEAEQFTAGQFLRGGPSGNADDWLKATGVPYTIGFTKP  574



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   342 bits (878),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/406 (43%), Positives = 246/406 (61%), Gaps = 31/406 (8%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGL----SRRLLEEPAPLKDDHGNPV  2553
             G+ M  +L  S+EL++NA+ IV+ +  F+K L +  L    SR+LL E            
Sbjct  186   GQTMAKVLNASLELSNNAMDIVNGVAGFVKGLNLSSLTSAMSRKLLSEDG----------  235

Query  2552  DSTDEILSPFADPATRHLLAAPPKA--DIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
                   +  +   + R LL AP     +++VAQDGSG++K++N AL  +P  N    VI 
Sbjct  236   ------IPSWVGQSQRRLLEAPHDVTPNVIVAQDGSGQFKTLNEALELVPKKNKIPFVIY  289

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             +KAGVY EYV +   K+++  +G+GPTKT+ TGN+N  D     TY   T  +    F+ 
Sbjct  290   VKAGVYNEYVALDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQ--TYNTATFSINAADFMA  347

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
              ++  ENSAGA KHQAVALR++AD A  YNC ++ +QDTLYT S RQFYRDCT+SGT+DF
Sbjct  348   INVGFENSAGAEKHQAVALRVTADKAVFYNCQMDGFQDTLYTQSKRQFYRDCTVSGTIDF  407

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  VFQNCK+IV+KPM NQ+CMVTA GR       A+V Q+C    EP + A  P 
Sbjct  408   IFGDAAGVFQNCKLIVKKPMENQQCMVTAGGRTKVDSPTALVFQNCHFTGEPDVVALKPK  467

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
                +LGRPW+E+S+ +IM + IDDI +PEG+  W G+   +TC Y EY N+G GA+T+ R
Sbjct  468   IS-YLGRPWREYSKVVIMDSVIDDIFLPEGYMAWMGSANKETCTYYEYNNKGLGANTEHR  526

Query  1658  VKWKGYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             VKW   K  I+   A  + P  F         + W+ ++ +P+S G
Sbjct  527   VKWPNVK-TIAANEAVNYYPEKFFELVNSTQRDAWIVQSGVPYSIG  571



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   341 bits (875),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 244/399 (61%), Gaps = 20/399 (5%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEIL  2532
             M ++ KTS EL+SN+LA+ + L   + +    GL+  L +        +   +  T++ +
Sbjct  179   MLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLTGALAK--------YARKLLYTEDGI  230

Query  2531  SPFADPATRHLLAAPPK---------ADIVVAQDGSGKYKSINAALNSIPAINNRRIVIL  2379
               +  P  R L+A  PK         A+ VV QDGSG +K+I  AL  +P  N    +I 
Sbjct  231   PTWVGPHARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKTITDALKVVPKNNRMPFIIH  290

Query  2378  IKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFIC  2199
             IK G+YKE V +  K   + F+G+GP KT ITGN N        T+   T+ +EGE F  
Sbjct  291   IKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNF-GIGKVKTFLTSTLTIEGEHFTA  349

Query  2198  RDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +++ IEN+AG    QAVALR+SAD A  Y+C ++ YQDTLY HS RQFYRDCT+SGTVDF
Sbjct  350   KNIGIENTAGPKGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  + QNCK++VRK    Q CMVTAQGR D R +  +VL +C I+ EPA       
Sbjct  410   IFGDAKCILQNCKIVVRKAKRGQSCMVTAQGRSDVRESTGLVLHNCHIMGEPAYIPVKSV  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T +YAE+ N G G++   R
Sbjct  470   NKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKTLYYAEHLNAGAGSNEALR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             VKW G K+ +SPE A  +T G FL+ D  W+ + Q+P++
Sbjct  530   VKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYT  566



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   341 bits (875),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 245/411 (60%), Gaps = 25/411 (6%)
 Frame = -2

Query  2714  KMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEI  2535
             KM+  L +S ELT N LA+V +  + + +L IP   RRLL        DH   V S    
Sbjct  175   KMRRALNSSQELTENILALVDEFSETLANLGIPSFHRRLLA-------DHAGGVPS----  223

Query  2534  LSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
                +   A R L    P     K D+ VA+DGSG +++INAAL  +P  +    V+ +KA
Sbjct  224   ---WMPDAKRRLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPVKSAATYVMYVKA  280

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G Y+EYV +P    N+  VG+G TKTVITG+++        T    T+   G GF+ R +
Sbjct  281   GTYREYVSVPRNVTNLVMVGDGATKTVITGDKSFMMNIT--TKDTATMEALGNGFLMRGI  338

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
              +EN+AGA  HQAVALR+ +DM+A Y C  + YQDTLYTH+ RQ+YR+C I+GT+DFIFG
Sbjct  339   GVENTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRECVITGTIDFIFG  398

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK--AANPPN  1836
             NA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C I   P  +  A +   
Sbjct  399   NAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTIEPHPEFEKSAGDGKL  458

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             + FLGRPWKE SRTL + + I   + P+GW  W G   L TC+YAE +NRG GA T KRV
Sbjct  459   RTFLGRPWKEHSRTLYIQSEIGGFIDPKGWLPWLGDFGLSTCYYAEVENRGAGADTSKRV  518

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
             KW+G K        +++T   F+   + WL +  +PF PG L P N+  ++
Sbjct  519   KWRGVKNITYQHALQKYTVESFIQG-QHWLPQLGVPFIPGLL-PQNQSGRI  567



>ref|XP_004508050.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cicer arietinum]
Length=593

 Score =   342 bits (877),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 179/397 (45%), Positives = 240/397 (60%), Gaps = 15/397 (4%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEIL  2532
             +++L   S E  SN+LAIVS++  F+ +++  G  R LL       D+  +PV S D   
Sbjct  206   LQNLFVDSKEFVSNSLAIVSQVSTFLSTMQTFGRGRMLLS------DNSNSPVASLDSDG  259

Query  2531  SP-FADPATRHLLAAP---PKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGV  2364
              P +     R +L A    P  ++ VAQDG+G +K+I+ AL +IPAI   R V+ +K GV
Sbjct  260   FPSWVHSEERRVLKASSIRPTPNVTVAQDGTGDFKTISEALAAIPAIYPGRYVVYVKEGV  319

Query  2363  YKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTI  2184
             Y E V I  K  N+   G+G  K++ITG++N  D     T+   + +V GEGF+   +  
Sbjct  320   YDETVTITKKMQNLTMYGDGSQKSIITGSKNFRDGVR--TFLTASFVVLGEGFLGLAMGF  377

Query  2183  ENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
              N+AG   HQAVA R+ AD A   NC    YQDTLYT ++RQFYR C +SGT+DFIFG+A
Sbjct  378   RNTAGPDGHQAVAARVQADRAVFANCRFEGYQDTLYTQTHRQFYRSCIVSGTIDFIFGDA  437

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
              VVFQNC M+VR+PM NQ+ MVTAQGR D++ A   VL  C+I A+  L       K +L
Sbjct  438   AVVFQNCIMVVRRPMDNQQNMVTAQGRMDKQQATGTVLHKCQIKADEKLVPVKDTIKSYL  497

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKEFSRT++M + I D + P+GW+ W G   LDT +YAE+ N GPGAST  RVKW G
Sbjct  498   GRPWKEFSRTIVMESEIGDFIHPDGWTPWMGNFALDTLYYAEFNNTGPGASTSARVKWPG  557

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             YK  I  E A Q+T G FL     W+  + +P   G 
Sbjct  558   YKV-IDKEEASQYTVGAFLKG--AWVQTSGVPSQQGL  591



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   340 bits (873),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 247/405 (61%), Gaps = 23/405 (6%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP----GLSRRLLEEPAPLKDDHGNPVD  2550
             ++M + +  + ELTSNALAIVS +   + S +IP      SRRLLEE A  +D  G+P  
Sbjct  173   KQMSNGMLNATELTSNALAIVSAISGILTSFKIPFNNTASSRRLLEE-ADAEDADGHPSW  231

Query  2549  STDEILSPFADPATRHLLAAPPKADI----VVAQDGSGKYKSINAALNSIPAINNRRIVI  2382
              + E          R L+A   K  +    VVA+DGSG Y +I AAL + P  N  R VI
Sbjct  232   WSRE---------DRKLMARQAKGQVTPNAVVAKDGSGHYSTIAAALAAYPKNNKGRYVI  282

Query  2381  LIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVI--VEGEG  2208
              +KAGVY EY+ +   + NI   G+GP KT+ITG +   D     T+R  +    V G G
Sbjct  283   YVKAGVYNEYITVTKDQVNILMYGDGPRKTMITGKKCNRDGVS--TFRSASFFAAVIGNG  340

Query  2207  FICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGT  2028
             FI + +  +N+AG   HQAVALR+ +DMAA +NC ++ YQDTLY  ++RQFYR+C +SGT
Sbjct  341   FIGKSMGFQNTAGPEGHQAVALRVQSDMAAFFNCRMDGYQDTLYVQAHRQFYRNCVVSGT  400

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             VDFIFG+A  V QN  ++VRKPM NQ+  VTA GR D+     +V+Q+C I+ E  L   
Sbjct  401   VDFIFGDAAAVIQNSLIVVRKPMDNQQNTVTAHGRTDKHETTGLVIQNCRIVPEQKLYPV  460

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                   +LGRPWK++SRT+IM + I D++ P G+  W G   LDT +YAEY NRGPGA+T
Sbjct  461   RLQIPSYLGRPWKQYSRTVIMESTIGDLIQPAGYMPWSGNFALDTLYYAEYANRGPGAAT  520

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             DKRVKWKG+    +   A QFT  PF+  + QWL    +P+  GF
Sbjct  521   DKRVKWKGFHVIKNRNEALQFTASPFIQGN-QWLKPTGMPYLLGF  564



>ref|XP_004298254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=577

 Score =   341 bits (874),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 245/406 (60%), Gaps = 15/406 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP-------GLSRRLLEEPAPLKDDHGN  2559
             ++M   ++ + +LTSNALAIVS L + + +  IP         +RRLL+      D+HG 
Sbjct  174   KQMSEAMQNAEQLTSNALAIVSSLSNILGNFNIPLKPNNNPSTARRLLDVEME-TDEHGT  232

Query  2558  -PV---DSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRR  2391
              P     +  ++++               K + VVA+DGSG+YK+I AAL + P     R
Sbjct  233   FPTWFSAADRKLIAKQNKKNNNAGNGQAVKPNAVVAKDGSGQYKTIGAALAAYPKGFQGR  292

Query  2390  IVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGE  2211
              VI +KAG+Y EYV +   +NN+   G+GP +T++TG ++  D     T    T IV G 
Sbjct  293   YVIYVKAGIYNEYVTVAKNQNNVFMYGDGPRETMVTGRKSFADGIT--TQDTATFIVVGH  350

Query  2210  GFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISG  2031
             GFI R +  +N+AG  KHQAVALR+ +DM+A +NC ++ YQDTLY  +YRQFYR+C ISG
Sbjct  351   GFIARGMGFQNTAGPEKHQAVALRVQSDMSAFFNCRMDGYQDTLYVQAYRQFYRNCVISG  410

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG++  V QN  +IVRKP+ANQ+  VTA GRKD+R +  +V+Q+C I+ E AL  
Sbjct  411   TVDFIFGDSTTVIQNSLIIVRKPLANQKNTVTANGRKDQRESTGLVIQNCRIVPEEALFP  470

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                    +LGRPWK +SRT+IM +   D + P GW  WQG   LDT +YAEY NRGPGA 
Sbjct  471   LRFQIMSYLGRPWKMYSRTVIMESEFGDFIQPAGWLEWQGNFALDTLYYAEYANRGPGAV  530

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             T  RVKWKG+       VA QFTPG FL A   WL     P+  G 
Sbjct  531   TTGRVKWKGFHVITDRNVALQFTPGNFL-AGGLWLKGTGAPYFLGL  575



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   340 bits (873),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 183/410 (45%), Positives = 254/410 (62%), Gaps = 30/410 (7%)
 Frame = -2

Query  2717  EKMKHLLKTSM----ELTSNALAIVSKLDDFIKSLEI-------PGLSRRLLEEPAPLKD  2571
             E+++ L+K S+    +LTSNALAI + +   +++  I       P  S R+LE+     D
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIATSIAQILENFNITLNKDLRPTSSSRILEQE---ND  226

Query  2570  DHGNPVDSTDEILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPAI  2403
              HG            +   A R LLA       K + VVA+DGSG++K+I AAL + P  
Sbjct  227   GHGQ--------YPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKG  278

Query  2402  NNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVI  2223
                R +I +KAGVY EYV +   + N+   G+GP KT++TG+++  D     T    T  
Sbjct  279   LQGRYIIYVKAGVYNEYVTVTKNQVNVFMYGDGPRKTMVTGSKSFADGIT--TQNTATFA  336

Query  2222  VEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDC  2043
               G GF+ + +  +N+AGA KHQAVALR+ ++M+A +NC ++AYQDTLY  ++RQFYR+C
Sbjct  337   AIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNC  396

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
              ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E 
Sbjct  397   VISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEE  456

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
              L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YAEY NRG
Sbjct  457   VLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRG  516

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             PGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL    IP+  G 
Sbjct  517   PGAATNQRVRWKGYHV-INRNDAVQFTAGPFLLAD-RWLKTTGIPYFAGL  564



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   340 bits (873),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 256/411 (62%), Gaps = 31/411 (8%)
 Frame = -2

Query  2717  EKMKHLLKTSM----ELTSNALAIVSKLDDFIKSLEIP--------GLSRRLLEEPAPLK  2574
             E+++ L+K S+    +LTSNALAI S +   +++  I           SRRLLE+     
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQE---N  226

Query  2573  DDHGNPVDSTDEILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPA  2406
             D H       D+  S F   A R LLA       K + VVA+DGSG++K+I AAL + P 
Sbjct  227   DGH-------DQYPSWFP-AADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPK  278

Query  2405  INNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTV  2226
                 R +I +KAGVY EYV +   + N+   G+GP  T++TG+++  D     T    T 
Sbjct  279   GLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGIT--TQNTATF  336

Query  2225  IVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRD  2046
                G GF+ + +  +N+AGA KHQAVALR+ ++M+A +NC ++AYQDTLY  ++RQFYR+
Sbjct  337   AAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRN  396

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             C ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E
Sbjct  397   CVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPE  456

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
               L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YAEY NR
Sbjct  457   EVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNR  516

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GPGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  517   GPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   341 bits (874),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 236/385 (61%), Gaps = 18/385 (5%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDEILSPFADPATR  2505
             +L SNALA++  + D     E     R+L EE     + +G P          +     R
Sbjct  220   KLCSNALAMIKNMTDTDMERESEAGGRKLEEE-----ETNGWP---------NWLSAGDR  265

Query  2504  HLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSKKN  2328
              LL ++   AD+VVA DGSG +K+++AA+ + P  ++RR VI IKAGVY+E V +P KK 
Sbjct  266   RLLQSSTVTADVVVAADGSGDFKTVSAAVEAAPEKSSRRYVIRIKAGVYRENVEVPKKKT  325

Query  2327  NIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQAV  2148
             NI F+G+G TKT+IT +RNV D     T+   TV   GE F+ RDLT +N+AG+ KHQAV
Sbjct  326   NIMFLGDGRTKTIITASRNVVD--GSTTFHSATVAAVGERFLARDLTFQNTAGSSKHQAV  383

Query  2147  ALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALR+ +D++A Y C + A+QDTLY HS RQFY +C I+GTVDFIFGN   VFQ+C +  R
Sbjct  384   ALRVGSDLSAFYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGNGAAVFQDCDIHAR  443

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
              P + Q+ MVTAQGR D      IV+Q C I A   L+        FLGRPWKE+SRT++
Sbjct  444   LPGSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSRTVV  503

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + + D++ P GW  W G   L T +YAEYQN G GA T  RVKWKGYK   S   A+ 
Sbjct  504   MQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAEAQA  563

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGF  1533
             FTPG F+  +  WLG    PF+ G 
Sbjct  564   FTPGRFIDGNS-WLGATGFPFALGL  587



>ref|XP_002445591.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
 gb|EES15086.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
Length=626

 Score =   342 bits (877),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 245/408 (60%), Gaps = 16/408 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS--RRLLEEPAPLKDDHGNP-VDS  2547
             ++M   +++  ELTSNALAI+ K    + +L IPG +  RRLL +    ++    P V  
Sbjct  220   KQMTATMESGKELTSNALAIIEKASSVLVALHIPGFTAHRRLLGDNDEAENMENQPEVKH  279

Query  2546  TDEILSPFADPAT----RHLL-----AAPPKADIVVAQDGSGKYKSINAALNSIPAINNR  2394
             +   L    D A     R LL      A  + ++VVA+DGSGK+K+IN ALN++P     
Sbjct  280   SGMSLGELEDEAMAADKRRLLKGNNFQAKLRPNVVVAKDGSGKFKTINDALNAMPKQYTG  339

Query  2393  RIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEG  2214
             R +I +K GVY+EYV I     N+   G+G  KTVITG+RN  D     TY+  T  V+G
Sbjct  340   RYLIYVKQGVYQEYVTITRAMENVTMYGDGAMKTVITGSRNFADGLT--TYKTATFNVQG  397

Query  2213  EGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTIS  2034
             +GFI   L   N+AGA KHQAVAL + +D +   NC ++AYQDTLY HS  QFYR+C IS
Sbjct  398   DGFIAIALGFRNTAGAAKHQAVALLVQSDRSIFLNCRMDAYQDTLYAHSKAQFYRNCVIS  457

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNC +++R+P+ +Q+ + TAQGR D R +   V Q C   AE  L+
Sbjct  458   GTIDFVFGDAAAVFQNCILLLRRPLDSQQNIATAQGRADGRESTGFVFQYCRFAAEAGLR  517

Query  1853  -AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A+ PP + +L RPW+EFSRTLIM + I   +   G+  W G   L T WYAEY NRGPG
Sbjct  518   DASRPPIRSYLARPWREFSRTLIMESEIPAFIDKAGYLPWNGDFGLKTLWYAEYGNRGPG  577

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             A T  RV W GYK+ IS E A +FT   FL A E WL     P   GF
Sbjct  578   ADTAGRVAWPGYKKVISKEEADKFTVQNFLHA-EPWLKPTGTPVKYGF  624



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   340 bits (872),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 256/411 (62%), Gaps = 31/411 (8%)
 Frame = -2

Query  2717  EKMKHLLKTSM----ELTSNALAIVSKLDDFIKSLEIP--------GLSRRLLEEPAPLK  2574
             E+++ L+K S+    +LTSNALAI S +   +++  I           SRRLLE+     
Sbjct  170   EELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQE---N  226

Query  2573  DDHGNPVDSTDEILSPFADPATRHLLAAPP----KADIVVAQDGSGKYKSINAALNSIPA  2406
             D H       D+  S F   A R LLA       K + VVA+DGSG++K+I AAL + P 
Sbjct  227   DGH-------DQYPSWFP-AADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPK  278

Query  2405  INNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTV  2226
                 R +I +KAGVY EYV +   + N+   G+GP  T++TG+++  D     T    T 
Sbjct  279   GLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGIT--TQNTATF  336

Query  2225  IVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRD  2046
                G GF+ + +  +N+AGA KHQAVALR+ ++M+A +NC ++AYQDTLY  ++RQFYR+
Sbjct  337   SAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRN  396

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             C ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E
Sbjct  397   CVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPE  456

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
               L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YAEY NR
Sbjct  457   EVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNR  516

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GPGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  517   GPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   340 bits (871),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 176/404 (44%), Positives = 248/404 (61%), Gaps = 23/404 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS----RRLLEEPAPLKDDHGNPV  2553
             G+ M  +L  S+EL++NAL IV+ +    K L +   S    R+LL E   L D  G P 
Sbjct  156   GKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEETALVD--GFP-  212

Query  2552  DSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                    +  ++   R L A  PK D+VVAQDGSG+ K+I+ AL  +P  N +  VI IK
Sbjct  213   -------TWVSEGQRRLLQAVDPKPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIK  265

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+Y EY+++      +  +G+GPTKT ITG++N  D     TY   T  V    F+ ++
Sbjct  266   AGIYNEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQ--TYNTATFGVNAANFMAKN  323

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA KHQAVALR++AD A  YNC+++ +QDTLYT S RQFYRDCT++GT+DF+F
Sbjct  324   IGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVF  383

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCK IVR P+ NQ+C+VTA GR      +A+V QSC    EP + A   P  
Sbjct  384   GDAVAVFQNCKFIVRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALT-PKI  442

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPW+ +++ +IM + IDDI VPEG+  W G+ + DT  Y E+ NRGPGA+T  R+ 
Sbjct  443   AYLGRPWRLYAKVVIMDSQIDDIFVPEGYMAWMGSAFKDTSTYYEFNNRGPGANTIGRIT  502

Query  1652  WKGYKRNISPEVAKQFTPGPFLM-----ADEQWLGRAQIPFSPG  1536
             W G+K  ++P  A ++ PG F         + W+  + +P+S G
Sbjct  503   WPGFKV-LNPIEAVEYYPGKFFQIANSTERDSWILGSGVPYSLG  545



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   340 bits (871),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 235/387 (61%), Gaps = 15/387 (4%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDDFIKSLEIPGLSRRLLEE--PAPLKDDHGNPVDSTDEILSPFADPA  2511
             +L SNALA++  + D   + E     R+L E   P     + G P          +    
Sbjct  190   KLISNALAMIKNMTDTDMAAERSAAGRKLEENNLPESFAGEDGFPA---------WMSAG  240

Query  2510  TRHLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYVMIPSK  2334
              R LL ++    ++VVA DGSG +K++ AA+ + P  +++R VI IKAGVY+E V +P K
Sbjct  241   DRRLLQSSSVTPNVVVAADGSGDFKTVAAAVAAAPEKSSKRYVIRIKAGVYRENVEVPKK  300

Query  2333  KNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAGAVKHQ  2154
             K NI F+G+G  KT+ITG++NV+D     T+R  TV   GE F+ RD+T +N+AG  KHQ
Sbjct  301   KTNIMFLGDGRMKTIITGSKNVKD--GSTTFRSATVAAVGERFLARDITFQNTAGPSKHQ  358

Query  2153  AVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALR+ +D +A Y C + AYQDTLY HS RQFYR+C I GTVDFIFGNA  V QNC ++
Sbjct  359   AVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGNAAAVLQNCDIL  418

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
              R+P + Q+ MVTAQGR+D      I +  C I A+  L         +LGRPWKE+SRT
Sbjct  419   ARRPNSGQKNMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRT  478

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + I D++ P GW  W G   L+T +Y EYQN G GA T  RVKWKGYK   S   A
Sbjct  479   VIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEA  538

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             KQFT G F+     WLG    PF+ GF
Sbjct  539   KQFTVGDFINGG-SWLGSTGFPFTAGF  564



>sp|Q42920.1|PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=P65; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Medicago sativa]
 gb|AAA91128.1| putative pectinesterase [Medicago sativa]
Length=447

 Score =   335 bits (860),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 176/402 (44%), Positives = 243/402 (60%), Gaps = 26/402 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIP--GLSRRLLEEPAPLKDDHGNPVDS  2547
             GE M  +LKTSMEL+SNA+ ++  +   +K  +     +SRRLL               S
Sbjct  63    GETMTKVLKTSMELSSNAIDMMDAVSRILKGFDTSQYSVSRRLL---------------S  107

Query  2546  TDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAG  2367
              D I S   D   R L     + + VVAQDGSG++K++  AL ++P  N    VI +KAG
Sbjct  108   DDGIPSWVNDGHRRLLAGGNVQPNAVVAQDGSGQFKTLTDALKTVPPKNAVPFVIHVKAG  167

Query  2366  VYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLT  2187
             VYKE V +  + N +  +G+GPTKT  TG+ N  D     TY   T  V G  F+ +D+ 
Sbjct  168   VYKETVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGI--NTYNTATFGVNGANFMAKDIG  225

Query  2186  IENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
              EN+AG  KHQAVALR++AD A  YNC ++ +QDTLY  S RQFYRDC+ISGT+DF+FG 
Sbjct  226   FENTAGTGKHQAVALRVTADQAIFYNCQMDGFQDTLYVQSQRQFYRDCSISGTIDFVFGE  285

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
                VFQNCK++ R P   Q+C+VTA GR+ +  A+A+V QS     EPAL +  P    +
Sbjct  286   RFGVFQNCKLVCRLPAKGQQCLVTAGGREKQNSASALVFQSSHFTGEPALTSVTPKVS-Y  344

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK++S+ +IM + ID I VPEG+  W G+ + +TC Y EY N+GPGA T+ RVKW 
Sbjct  345   LGRPWKQYSKVVIMDSTIDAIFVPEGYMPWMGSAFKETCTYYEYNNKGPGADTNLRVKWH  404

Query  1646  GYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             G K  ++  VA ++ PG F       A + W+ ++ +P+S G
Sbjct  405   GVKV-LTSNVAAEYYPGKFFEIVNATARDTWIVKSGVPYSLG  445



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   340 bits (871),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/399 (43%), Positives = 250/399 (63%), Gaps = 17/399 (4%)
 Frame = -2

Query  2717  EKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLSRRLLEEPAPLKDDHGNPVDSTDE  2538
             ++M+H+ KT+ EL+SN+LA+V+ +   + +    G +            ++   + S ++
Sbjct  179   QEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFA--------NYARKLLSAED  230

Query  2537  ILSPFADPATRHLLAA------PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILI  2376
              +  +  P  R L+AA      P KA+ VVAQDGSG++K+I  ALN++P  N    VI I
Sbjct  231   GIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVPKGNTVPYVIHI  290

Query  2375  KAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICR  2196
             K G+YKE VM+  K   + F+G+G TKTVITGN N        T+    + +EG+ F  +
Sbjct  291   KQGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNY-GIGKVKTFLTAPLTIEGDHFTMK  349

Query  2195  DLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             ++ +EN+AG    QAVALR+SAD A  ++C  + +QDTLY HS+R F+R+CT+SGTVDFI
Sbjct  350   NIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRECTVSGTVDFI  409

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I  +PA       +
Sbjct  410   FGDAKCILQNCKIVVRKPKKGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVS  469

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWK+FSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RV
Sbjct  470   KSYLGRPWKQFSRTIIMKTMIDDVIDPAGWLAWSGDFALKTLYYAEHLNTGPGSNQAQRV  529

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             KW G  R ++P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  530   KWPGI-RKLTPQDALLYTGDRFLGGN-TWIPQTQVPYTP  566



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   339 bits (870),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 248/399 (62%), Gaps = 22/399 (6%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS----RRLLEEPAPLKDDHGNPVDST  2544
             M  +L+ + EL+SNALAI + L   +K L++        RRLL E    +D+ G PV   
Sbjct  179   MHSVLRNATELSSNALAITNSLGGLLKKLDLDMFKKDSRRRLLSE----QDEQGYPV---  231

Query  2543  DEILSPFADPATRHLLAA--PPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKA  2370
               + SP      R L+AA   PK + VVAQDGSG++KSI  A++++P  N  R VI +KA
Sbjct  232   -WMRSP-----ERKLMAAGNQPKPNAVVAQDGSGQFKSIQQAVDAMPKGNTGRYVIYVKA  285

Query  2369  GVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDL  2190
             G+Y E VMIP  K NI   G+GP KT +TG ++  D     T +  T  +E  GFIC+++
Sbjct  286   GLYNEMVMIPKDKVNIFMYGDGPKKTRVTGRKSFADGIT--TMKTATFSIEASGFICKNM  343

Query  2189  TIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
                N+AGA +HQAVALR+  D+AA YNC  +A+QDTLY H+ RQF+R+C ISGT+DFIFG
Sbjct  344   GFHNTAGAERHQAVALRVQGDLAAFYNCRFDAFQDTLYVHARRQFFRNCVISGTIDFIFG  403

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             N+  VFQNC +I R+PM NQ+  VTA GR D    + +V+Q+C ++ +  L         
Sbjct  404   NSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQNCRLVPDQKLFPDRFKIPS  463

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSR +IM + I D + PEG+  W G   L T +YAEY NRGPGA T +RVKW
Sbjct  464   YLGRPWKEFSRLVIMESTIADFIKPEGYMPWNGDFGLKTLYYAEYNNRGPGAGTSQRVKW  523

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              GY+  I+ + A+QFT GPF+     WL     P   GF
Sbjct  524   PGYRGVITRQEAEQFTAGPFIDG-ATWLKFTGTPNILGF  561



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   340 bits (871),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/404 (44%), Positives = 248/404 (61%), Gaps = 23/404 (6%)
 Frame = -2

Query  2720  GEKMKHLLKTSMELTSNALAIVSKLDDFIKSLEIPGLS----RRLLEEPAPLKDDHGNPV  2553
             G+ M  +L  S+EL++NAL IV+ +    K L +   S    R+LL E   L D  G P 
Sbjct  183   GKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEETALVD--GFP-  239

Query  2552  DSTDEILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIK  2373
                    +  ++   R L A  PK D+VVAQDGSG+ K+I+ AL  +P  N +  VI IK
Sbjct  240   -------TWVSEGQRRLLQAVDPKPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIK  292

Query  2372  AGVYKEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRD  2193
             AG+Y EY+++      +  +G+GPTKT ITG++N  D     TY   T  V    F+ ++
Sbjct  293   AGIYNEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQ--TYNTATFGVNAANFMAKN  350

Query  2192  LTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +  EN+AGA KHQAVALR++AD A  YNC+++ +QDTLYT S RQFYRDCT++GT+DF+F
Sbjct  351   IGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVF  410

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNCK IVR P+ NQ+C+VTA GR      +A+V QSC    EP + A   P  
Sbjct  411   GDAVAVFQNCKFIVRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALT-PKI  469

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPW+ +++ +IM + IDDI VPEG+  W G+ + DT  Y E+ NRGPGA+T  R+ 
Sbjct  470   AYLGRPWRLYAKVVIMDSQIDDIFVPEGYMAWMGSAFKDTSTYYEFNNRGPGANTIGRIT  529

Query  1652  WKGYKRNISPEVAKQFTPGPFLM-----ADEQWLGRAQIPFSPG  1536
             W G+K  ++P  A ++ PG F         + W+  + +P+S G
Sbjct  530   WPGFKV-LNPIEAVEYYPGKFFQIANSTERDSWILGSGVPYSLG  572



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   339 bits (870),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/392 (47%), Positives = 239/392 (61%), Gaps = 24/392 (6%)
 Frame = -2

Query  2684  ELTSNALAIVSKLDD-----FIKSLEIPGLS--RRLLEEPAPLKDDHGNPVDSTDEILSP  2526
              + SNALA+   + D     F ++  + G +  R+LLEE   +    G P          
Sbjct  214   HMCSNALAMTKNMTDKDIAEFEQTNMVLGSNKNRKLLEEENGV----GWP---------E  260

Query  2525  FADPATRHLL-AAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVYKEYV  2349
             +     R LL  +  KAD+VVA DGSG +K+++ A+ + P  +++R VI IKAGVYKE V
Sbjct  261   WISAGDRRLLQGSTVKADVVVAADGSGNFKTVSEAVAAAPLKSSKRYVIKIKAGVYKENV  320

Query  2348  MIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIENSAG  2169
              +P KK NI F+G+G T T+ITG+RNV D     T+   TV + G  F+ RD+T +N+AG
Sbjct  321   EVPKKKTNIMFLGDGRTNTIITGSRNVVD--GSTTFHSATVAIVGGNFLARDITFQNTAG  378

Query  2168  AVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
               KHQAVALR+ AD++A YNC + AYQDTLY H+ RQF+ +C ISGTVDFIFGN+ VVFQ
Sbjct  379   PAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGNSAVVFQ  438

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NC +  R+P + Q+ MVTAQGR D      IV+Q C I A   L+        +LGRPWK
Sbjct  439   NCDIHARRPNSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTYLGRPWK  498

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+ M + I D++ P GW  W G   L+T  Y EYQN GPGA T KRV WKG+K   
Sbjct  499   EYSRTVFMQSSISDVIDPVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWKGFKVIT  558

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             S   A+ FTPG F+     WLG    PFS G 
Sbjct  559   SAAEAQSFTPGNFI-GGSSWLGSTGFPFSLGL  589



>ref|XP_007012506.1| Pectinesterase [Theobroma cacao]
 gb|EOY30125.1| Pectinesterase [Theobroma cacao]
Length=592

 Score =   339 bits (870),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/396 (43%), Positives = 242/396 (61%), Gaps = 15/396 (4%)
 Frame = -2

Query  2711  MKHLLKTSMELTSNALAIVSKLDDFIKS-LEIPGLSRRLLEEPAPLKDDHGNP--VDSTD  2541
             +K  L +S ELTSN+LA+  +L   + S +E+P  SR LLE  +P  D  G P  ++  +
Sbjct  207   IKSTLNSSQELTSNSLAMARQLSSHVSSVMEMPAASRHLLESTSPSVDKDGLPNWLNHDE  266

Query  2540  EILSPFADPATRHLLAAPPKADIVVAQDGSGKYKSINAALNSIPAINNRRIVILIKAGVY  2361
               L   AD          P  ++ VA+DGSG + +I+ AL ++P   + R VI +KAG+Y
Sbjct  267   RRLLKGAD-------VEKPTPNVTVAKDGSGNFSTISEALAAMPQKYDGRYVIYVKAGIY  319

Query  2360  KEYVMIPSKKNNIAFVGEGPTKTVITGNRNVEDKWPGGTYRCGTVIVEGEGFICRDLTIE  2181
             +E V++  K  N+   G+G  KT++TGN+N  D  P  TY   T +  G+GF+ + +   
Sbjct  320   EETVLVTKKMVNLTIYGDGSQKTIVTGNKNYVDGVP--TYLTATFVASGDGFLAKAMGFR  377

Query  2180  NSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AG  KHQAVA R+ AD A   NC    YQDTLY  ++RQFYR C ++GT+DFIFG+A 
Sbjct  378   NTAGPEKHQAVAARVDADRAIFLNCRFEGYQDTLYVQTHRQFYRSCVVAGTIDFIFGDAA  437

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC + VRKPM NQ+ +VTAQGRKD+     IVLQ+C+IL + +  +     K +LG
Sbjct  438   AVFQNCLIYVRKPMDNQKNIVTAQGRKDKFETTGIVLQNCKILPDDSFTSFKSQFKSYLG  497

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKE+SRT++M + I+D++ P GW  W+G   L+T +YAEY N GPGA TD RVKW G 
Sbjct  498   RPWKEYSRTIVMESLIEDLIDPAGWLEWEGNFALNTLYYAEYNNNGPGAKTDARVKWPG-  556

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             ++ I+ + A +FT   FL     W+     P   G 
Sbjct  557   RKVINKDEAMKFTVETFLQG--TWIKATGAPVRMGL  590



>ref|NP_193333.1| putative pectinesterase/pectinesterase inhibitor 43 [Arabidopsis 
thaliana]
 sp|O23447.1|PME43_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
43; Includes: RecName: Full=Pectinesterase inhibitor 43; AltName: 
Full=Pectin methylesterase inhibitor 43; Includes: RecName: 
Full=Pectinesterase 43; Short=PE 43; AltName: Full=Pectin 
methylesterase 43; Short=AtPME43; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB10377.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB78640.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AEE83677.1| putative pectinesterase/pectinesterase inhibitor 43 [Arabidopsis 
thaliana]
Length=701

 Score =   342 bits (878),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 240/352 (68%), Gaps = 14/352 (4%)
 Frame = -2

Query  2579  LKDDHGNPVDSTDEILSPFADPATRHLLAAPP-----KADIVVAQDGSGKYKSINAALNS  2415
             LKD H     S +    P+  P +R LLA  P     KA++VVA+DGSGK K+I  AL  
Sbjct  356   LKDRHL----SEEGEFPPWVTPHSRRLLARRPRNNGIKANVVVAKDGSGKCKTIAQALAM  411

Query  2414  IPAINNRRIVILIKAGVYKEYVMIPSKKNNIAFVGEGPTKTVITGN-RNVEDKWPGGTYR  2238
             +P  N ++ VI IK GVYKE V +  K  ++ FVG+GPTKTVITG+   + D+   GTYR
Sbjct  412   VPMKNTKKFVIHIKEGVYKEKVEVTKKMLHVMFVGDGPTKTVITGDIAFLPDQV--GTYR  469

Query  2237  CGTVIVEGEGFICRDLTIENSAGAVKHQAVALRISADMAAVYNCHLNAYQDTLYTHSYRQ  2058
               +V V G+ F+ +D+  EN+AGA +HQAVALR+SAD A  +NCH+N YQDTLY H++RQ
Sbjct  470   TASVAVNGDYFMAKDIGFENTAGAARHQAVALRVSADFAVFFNCHMNGYQDTLYVHTHRQ  529

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
             FYR+C +SGT+DF+FG+A  VFQNC+ ++R+PM +Q+C+VTAQGRKDRR    IV+ +  
Sbjct  530   FYRNCRVSGTIDFVFGDAKAVFQNCEFVIRRPMEHQQCIVTAQGRKDRRETTGIVIHNSR  589

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             I  + +       N+ FLGRPWKEFSRT+IM T IDD++ PEGW  W  T  L+T +Y E
Sbjct  590   ITGDASYLPVKAKNRAFLGRPWKEFSRTIIMNTEIDDVIDPEGWLKWNETFALNTLFYTE  649

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             Y+NRG G+   +RV+W+G KR IS   A++F PG FL  +  W+ + +IP++
Sbjct  650   YRNRGRGSGQGRRVRWRGIKR-ISDRAAREFAPGNFLRGN-TWIPQTRIPYN  699



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8633184519432