BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i1 len=3287 path=[31329:0-343 25007:344-369 25033:370-1432
26095:1433-1533 26196:1534-1593 15876:1594-1669 4649:1670-1693
49376:1694-1707 49390:1708-1711 49394:1712-1712 49395:1713-1717
26373:1718-1741 26397:1742-1767 26423:1768-1780 49435:1781-1783
49438:1784-1872 26525:1873-1903 14258:1904-1913 26565:1914-1946
26598:1947-1985 26637:1986-1997 26649:1998-2009 2887:2010-2033
49607:2034-2045 44719:2046-2054 2932:2055-2068 49666:2069-2092
49690:2093-2095 49693:2096-2112 2990:2113-2171 3049:2172-2362
3240:2363-2420 3298:2421-2458 17269:2459-2516 3394:2517-2595
3473:2596-2600 3478:2601-2683 3561:2684-2702 3580:2703-2705
3583:2706-2734 12756:2735-2802 12824:2803-2891 12913:2892-2938
12960:2939-2942 12964:2943-2975 12997:2976-2986 13008:2987-3106
13128:3107-3134 13156:3135-3208 13230:3209-3242 13264:3243-3286]

Length=3287
                                                                      Score     E

ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     713   0.0      
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     709   0.0      
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     707   0.0      
ref|XP_009761202.1|  PREDICTED: pectinesterase                          705   0.0      
emb|CDO98832.1|  unnamed protein product                                703   0.0      
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    681   0.0      
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     678   0.0      
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     664   0.0      
emb|CDO98833.1|  unnamed protein product                                662   0.0      
emb|CDO98834.1|  unnamed protein product                                660   0.0      
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                640   0.0      
ref|XP_002512459.1|  Pectinesterase precursor, putative                 639   0.0      Ricinus communis
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                637   0.0      
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                637   0.0      
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     627   0.0      
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     624   0.0      
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     618   0.0      
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    614   0.0      
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         613   0.0      
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                610   0.0      
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                609   0.0      
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    607   0.0      
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     606   0.0      
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    605   0.0      
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    603   0.0      
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    603   0.0      
ref|XP_002314364.1|  putative pectinesterase family protein             597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    597   0.0      
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    597   0.0      
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     596   0.0      
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     596   0.0      
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     593   0.0      
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    593   0.0      
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     592   0.0      
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             592   0.0      
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    589   0.0      
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    588   0.0      
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     587   0.0      
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          588   0.0      
dbj|BAO02509.1|  predicted pectin esterase ortholog                     587   0.0      
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     586   0.0      
ref|XP_004252915.1|  PREDICTED: pectinesterase                          586   0.0      
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    586   0.0      
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                584   0.0      
ref|XP_002872255.1|  pectinesterase family protein                      588   0.0      
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     584   0.0      
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    584   0.0      
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     583   0.0      
gb|EPS72184.1|  pectinesterase family protein                           583   0.0      
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     582   0.0      
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     581   0.0      
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     583   0.0      
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             581   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    583   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         576   0.0      
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    578   0.0      
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    575   0.0      
gb|EPS70728.1|  pectinesterase                                          572   0.0      
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    572   0.0      
ref|XP_002516960.1|  Pectinesterase precursor, putative                 572   0.0      Ricinus communis
ref|XP_006382447.1|  pectin methylesterase family protein               571   0.0      
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         570   0.0      
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    570   0.0      
emb|CBI39537.3|  unnamed protein product                                577   0.0      
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    570   0.0      
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    569   0.0      
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             569   0.0      
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                583   0.0      
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    572   0.0      
ref|XP_002884519.1|  pectinesterase family protein                      570   0.0      
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    568   0.0      
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             572   0.0      
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    566   0.0      
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    570   0.0      
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    564   0.0      
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    565   0.0      
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    565   0.0      
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    566   0.0      
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             564   0.0      
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    563   0.0      
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    563   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY05188.1|  BnaC05g46150D                                          565   0.0      
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             567   0.0      
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    563   0.0      
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             564   0.0      
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             562   0.0      
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    573   0.0      
ref|XP_003626199.1|  Pectinesterase                                     562   0.0      
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                566   0.0      
emb|CDP21547.1|  unnamed protein product                                565   0.0      
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    560   0.0      
emb|CDX99968.1|  BnaC09g03330D                                          563   0.0      
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    562   0.0      
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    563   0.0      
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    559   0.0      
emb|CDY27751.1|  BnaA05g31600D                                          561   0.0      
dbj|BAC42986.1|  putative pectinesterase                                562   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    558   0.0      
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             558   0.0      
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    558   0.0      
emb|CBI22967.3|  unnamed protein product                                580   0.0      
ref|XP_003591166.1|  Pectinesterase                                     557   0.0      
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    562   0.0      
ref|XP_002865716.1|  pectinesterase family protein                      556   0.0      
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    556   0.0      
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    557   0.0      
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    559   0.0      
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     558   0.0      
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    558   0.0      
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    554   0.0      
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    553   0.0      
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    555   0.0      
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    553   0.0      
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    556   2e-180   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             551   2e-180   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             552   2e-180   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             551   4e-180   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    550   4e-180   
emb|CDY68790.1|  BnaAnng28400D                                          555   7e-180   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             548   3e-179   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          549   4e-179   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    554   4e-179   
ref|XP_003604119.1|  Pectinesterase                                     550   4e-179   
ref|XP_003591168.1|  Pectinesterase                                     548   5e-179   
emb|CDX74137.1|  BnaA03g29100D                                          553   6e-179   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    554   6e-179   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             552   1e-178   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    546   2e-178   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    546   2e-178   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    546   5e-178   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             545   7e-178   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    545   1e-177   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     545   1e-177   
emb|CDX80613.1|  BnaC07g28310D                                          548   2e-177   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    544   3e-177   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    543   4e-177   
gb|EPS59322.1|  pectinesterase                                          541   8e-177   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    542   1e-176   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    542   1e-176   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    542   1e-176   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    541   2e-176   
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     541   2e-176   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          542   3e-176   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    541   3e-176   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    539   2e-175   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    546   2e-175   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   538   3e-175   
ref|XP_003591164.1|  Pectinesterase                                     536   2e-174   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    535   4e-174   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          539   4e-174   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    535   7e-174   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    535   8e-174   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    534   3e-173   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    533   4e-173   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    533   4e-173   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    532   8e-173   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     531   2e-172   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          531   3e-172   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    534   4e-172   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    530   6e-172   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    529   1e-171   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    529   1e-171   
ref|XP_007031044.1|  Pectinesterase, putative                           530   2e-171   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     528   3e-171   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     528   3e-171   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    528   3e-171   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          527   7e-171   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    526   1e-170   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     524   4e-170   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 524   9e-170   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     523   1e-169   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    523   4e-169   
ref|XP_003604120.1|  Pectinesterase                                     523   7e-169   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     520   9e-169   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    521   1e-168   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             521   1e-168   
gb|EPS69059.1|  hypothetical protein M569_05708                         537   6e-167   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     516   9e-167   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    516   9e-167   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    518   1e-166   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     513   5e-166   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    512   4e-165   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    510   2e-164   
emb|CDY33925.1|  BnaA02g30620D                                          509   4e-164   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     508   6e-164   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     506   2e-163   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    506   7e-163   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 505   9e-163   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    504   3e-162   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    501   4e-161   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          501   6e-161   Sorghum bicolor [broomcorn]
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    501   2e-160   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 500   2e-160   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    499   3e-160   
gb|AEL79481.1|  pectin methylesterase-like protein                      497   1e-159   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    496   2e-159   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 496   4e-159   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   497   4e-159   
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             496   5e-159   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    494   8e-159   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              495   9e-159   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    496   1e-158   
dbj|BAC42959.2|  putative pectin methylesterase                         494   2e-158   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    492   1e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    492   3e-157   
gb|AAF63815.1|  pectin methylesterase, putative                         491   3e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             491   4e-157   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    490   5e-157   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    488   3e-156   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    488   4e-156   
gb|EPS65387.1|  pectinesterase                                          486   1e-155   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    486   1e-155   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             486   2e-155   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    486   3e-155   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             490   7e-155   
ref|XP_002882495.1|  pectinesterase family protein                      485   7e-155   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    485   8e-155   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             490   9e-155   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             489   1e-154   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             489   1e-154   
emb|CDY24663.1|  BnaA05g30620D                                          484   1e-154   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    498   1e-154   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    484   2e-154   
ref|NP_001049858.1|  Os03g0300500                                       482   7e-154   Oryza sativa Japonica Group [Japonica rice]
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                481   1e-153   
emb|CAB65290.2|  pectin methyl-esterase PER                             481   4e-153   Medicago truncatula
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 481   6e-153   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    477   6e-152   
dbj|BAK06954.1|  predicted protein                                      476   1e-151   
emb|CDY05295.1|  BnaC05g45080D                                          476   2e-151   
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             476   3e-151   
emb|CDY34927.1|  BnaA01g32580D                                          474   6e-151   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    474   7e-151   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 473   2e-150   
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             473   4e-150   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             470   4e-149   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               469   7e-149   Ricinus communis
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     464   2e-148   
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    459   4e-147   
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 464   5e-147   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            463   2e-146   Medicago truncatula
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     458   3e-146   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     462   3e-146   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     461   1e-145   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     460   2e-145   
ref|NP_001060715.1|  Os07g0691100                                       460   2e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    455   3e-143   
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          454   3e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     453   7e-143   
gb|EAZ05229.1|  hypothetical protein OsI_27427                          452   3e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    451   5e-142   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             450   1e-141   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     450   1e-141   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             445   4e-141   
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 451   8e-141   
tpg|DAA64233.1|  TPA: pectinesterase                                    447   1e-140   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         446   2e-140   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          447   4e-140   
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          446   5e-140   Sorghum bicolor [broomcorn]
ref|XP_002275000.1|  PREDICTED: pectinesterase                          445   1e-139   Vitis vinifera
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     445   1e-139   
emb|CBI26012.3|  unnamed protein product                                445   2e-139   
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...    444   5e-139   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     441   2e-138   
emb|CDX74078.1|  BnaA03g29690D                                          441   7e-138   
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    432   1e-137   Petunia integrifolia [violet-flowered petunia]
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     440   2e-137   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    434   2e-137   Medicago sativa [alfalfa]
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     438   3e-137   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          441   3e-137   Sorghum bicolor [broomcorn]
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    439   4e-137   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     437   1e-136   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     437   1e-136   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    437   1e-136   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     437   2e-136   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    439   3e-136   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    436   4e-136   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    437   4e-136   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    436   4e-136   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    435   4e-136   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     435   2e-135   
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    433   3e-135   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    434   3e-135   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          433   3e-135   
ref|XP_002324181.2|  pectinesterase family protein                      434   3e-135   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          433   6e-135   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    433   7e-135   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     433   7e-135   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     432   9e-135   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          432   2e-134   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     432   2e-134   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     431   4e-134   
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    430   5e-134   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     430   5e-134   
emb|CDY19737.1|  BnaA09g03900D                                          428   5e-134   
gb|ACF79975.1|  unknown                                                 430   6e-134   
ref|NP_001151322.1|  pectinesterase-1 precursor                         430   7e-134   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             431   7e-134   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               429   9e-134   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    430   1e-133   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     429   1e-133   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    429   2e-133   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    429   2e-133   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     429   2e-133   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     428   3e-133   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                429   3e-133   
ref|NP_001052981.1|  Os04g0458900                                       428   4e-133   
gb|EAY94388.1|  hypothetical protein OsI_16156                          427   5e-133   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     428   5e-133   
emb|CAH67075.1|  OSIGBa0097P08.5                                        427   1e-132   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     427   1e-132   
gb|EAY94391.1|  hypothetical protein OsI_16158                          426   1e-132   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    426   4e-132   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             424   7e-132   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    426   8e-132   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                424   2e-131   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                424   2e-131   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    423   3e-131   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              422   5e-131   
gb|EPS66234.1|  hypothetical protein M569_08543                         423   7e-131   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     423   8e-131   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       421   2e-130   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    421   4e-130   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          420   4e-130   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    421   4e-130   
gb|ABZ89800.1|  pectin methylesterase-like protein                      420   4e-130   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    412   9e-130   
emb|CDP19930.1|  unnamed protein product                                420   9e-130   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               420   9e-130   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    419   1e-129   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    418   1e-129   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     419   1e-129   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          418   1e-129   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    418   2e-129   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             418   2e-129   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    417   4e-129   
gb|AFB77929.1|  pectin methylesterase                                   417   4e-129   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     417   5e-129   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     417   5e-129   
gb|KHG08631.1|  Pectinesterase 3                                        417   6e-129   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    417   1e-128   
gb|AFW03475.1|  pectin methylesterase 1                                 416   1e-128   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     416   1e-128   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    417   1e-128   
gb|AFW03480.1|  pectin methylesterase 1                                 416   1e-128   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    426   3e-128   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          414   3e-128   
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    411   6e-128   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               414   7e-128   
ref|NP_001274969.1|  pectin methyl esterase                             414   9e-128   
dbj|BAA89480.1|  pectin methylesterase                                  414   9e-128   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     414   1e-127   
gb|ABQ42392.1|  pectin methylesterase-like protein                      414   1e-127   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             414   1e-127   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    414   1e-127   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             413   2e-127   
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    414   2e-127   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     413   2e-127   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    412   2e-127   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    413   3e-127   
ref|XP_007012506.1|  Pectinesterase                                     412   9e-127   
dbj|BAK05856.1|  predicted protein                                      412   1e-126   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    411   2e-126   
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     409   3e-126   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    410   5e-126   
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    410   5e-126   
gb|ACN40984.1|  unknown                                                 410   6e-126   
emb|CAB95025.1|  pectin methylesterase                                  409   1e-125   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     410   1e-125   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     408   1e-125   
ref|XP_010543643.1|  PREDICTED: probable pectinesterase/pectinest...    408   1e-125   
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    408   1e-125   
ref|XP_003627458.1|  Pectinesterase                                     408   2e-125   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          409   2e-125   
ref|XP_007011069.1|  Root hair specific 12                              409   2e-125   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    407   3e-125   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  407   3e-125   
gb|AFQ23194.1|  pectin methylesterase                                   407   3e-125   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    409   3e-125   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          407   3e-125   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    407   4e-125   
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             407   4e-125   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     406   7e-125   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    406   7e-125   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    406   8e-125   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     405   1e-124   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          405   2e-124   
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...    405   2e-124   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    405   2e-124   
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    405   2e-124   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         405   2e-124   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             405   2e-124   
ref|XP_002304257.2|  pectinesterase family protein                      405   2e-124   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    404   5e-124   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                     403   5e-124   
ref|NP_001063246.1|  Os09g0433700                                       405   5e-124   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    405   5e-124   
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                403   6e-124   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     404   8e-124   
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    403   8e-124   
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    403   9e-124   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    403   9e-124   
emb|CAC01624.1|  putative pectin methylesterase                         403   1e-123   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    403   1e-123   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    403   1e-123   
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    403   1e-123   
gb|AAO85706.1|  pectin methyl-esterase                                  403   1e-123   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    402   2e-123   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     403   2e-123   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     402   2e-123   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     402   2e-123   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             401   3e-123   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             402   3e-123   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          405   3e-123   
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    402   4e-123   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             400   5e-123   
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690          401   5e-123   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    401   8e-123   
ref|XP_003609936.1|  Pectinesterase                                     401   9e-123   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     399   1e-122   
ref|NP_001132793.1|  pectinesterase                                     401   2e-122   
ref|XP_006289946.1|  hypothetical protein CARUB_v10003572mg             399   2e-122   
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             400   2e-122   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          399   2e-122   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    399   3e-122   
ref|NP_001169525.1|  pectinesterase                                     400   4e-122   
gb|EPS69324.1|  hypothetical protein M569_05439                         399   5e-122   
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g             398   5e-122   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    399   6e-122   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     398   9e-122   
ref|XP_010558236.1|  PREDICTED: probable pectinesterase/pectinest...    397   1e-121   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    397   1e-121   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     397   2e-121   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    397   2e-121   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     397   2e-121   
emb|CDX80932.1|  BnaC03g01860D                                          396   3e-121   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             397   3e-121   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    396   3e-121   
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                396   4e-121   
gb|AFI23411.1|  pectin methylesterase                                   396   5e-121   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     395   5e-121   
ref|XP_010423512.1|  PREDICTED: probable pectinesterase/pectinest...    395   5e-121   
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...    395   6e-121   
gb|KDP34079.1|  hypothetical protein JCGZ_07650                         395   6e-121   
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg             396   8e-121   
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    395   8e-121   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     395   8e-121   
emb|CDY11322.1|  BnaA03g01580D                                          395   1e-120   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    395   1e-120   
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    396   1e-120   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    395   1e-120   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    395   2e-120   
ref|XP_002871126.1|  hypothetical protein ARALYDRAFT_487283             394   2e-120   
ref|XP_009130851.1|  PREDICTED: probable pectinesterase/pectinest...    394   2e-120   
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    394   3e-120   
ref|XP_010491027.1|  PREDICTED: probable pectinesterase/pectinest...    394   3e-120   
ref|XP_003598363.1|  Pectinesterase                                     394   3e-120   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g             393   4e-120   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    394   4e-120   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28     393   4e-120   
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             394   5e-120   
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               394   5e-120   
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             394   7e-120   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     393   8e-120   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g             392   8e-120   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                   392   9e-120   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               392   9e-120   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     393   1e-119   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    393   1e-119   
ref|XP_004146219.1|  PREDICTED: probable pectinesterase/pectinest...    393   1e-119   
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2             392   1e-119   
ref|NP_196115.1|  putative pectinesterase/pectinesterase inhibito...    392   2e-119   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    395   2e-119   
ref|XP_009122673.1|  PREDICTED: putative pectinesterase/pectinest...    391   2e-119   
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1             392   2e-119   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                     391   2e-119   
ref|NP_001275859.1|  pectinesterase 1 precursor                         392   2e-119   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     385   3e-119   
ref|XP_007012502.1|  Pectin methylesterase 3                            391   3e-119   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             392   3e-119   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         391   4e-119   
ref|XP_010486686.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    390   4e-119   
gb|ABJ99595.1|  pectinesterase inhibitor                                391   5e-119   
ref|XP_007145106.1|  hypothetical protein PHAVU_007G210300g             390   5e-119   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460          392   5e-119   
ref|NP_187682.1|  root hair specific 12                                 390   5e-119   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             390   6e-119   
ref|XP_003591319.1|  Pectinesterase                                     390   7e-119   
ref|XP_011032980.1|  PREDICTED: putative pectinesterase/pectinest...    390   9e-119   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        390   9e-119   
ref|XP_003588521.1|  Pectinesterase                                     391   1e-118   
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...    391   1e-118   
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    390   1e-118   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    390   1e-118   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     390   1e-118   
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    390   1e-118   
ref|XP_006363205.1|  PREDICTED: probable pectinesterase/pectinest...    389   1e-118   
ref|XP_010067062.1|  PREDICTED: probable pectinesterase/pectinest...    389   1e-118   
gb|AAO42295.1|  unknown protein                                         389   2e-118   



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/566 (61%), Positives = 421/566 (74%), Gaps = 28/566 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGE---SADGGGEISTASKSVKEICAPTDYKETC  3042
             KK+A+  VASI LVACVVAA +S  +  E   S      +ST++KSV+ IC PTDYKETC
Sbjct  4     KKLAIASVASILLVACVVAAAISFTKKNEDKSSNSTDSRLSTSTKSVQAICQPTDYKETC  63

Query  3041  ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKS-ELLKEADKDPRTSDALDTCKELLH  2865
             E+SLA AK+ +DPKELIK+AF  T+ +++D I  S  L+ EA KDPRT DAL TC+ L+ 
Sbjct  64    EKSLANAKNINDPKELIKVAFNATINDLSDVIKNSASLIDEAKKDPRTKDALQTCQGLVD  123

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +IDDL RSF K + F+++ IK+YT+DLK WLS AIT QETC+DAFENTTGDTGEKMK L
Sbjct  124   VAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKMKKL  183

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LK A EL+SNGLAM++ F E++ +L IPGVN  RRLL A                    R
Sbjct  184   LKNAGELTSNGLAMVSSFGEVVANLNIPGVN--RRLLDAH------------------ER  223

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             +L+    S+K ++VVA DGSGQYKS+ EAL AVP  N +  VIFIKAGVYNE VE+PRKM
Sbjct  224   MLSD---SLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNEHVEIPRKM  280

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             N IVF+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG  KHQAVA
Sbjct  281   NNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVA  340

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRVS DM IFHNC ID YQDTLY HSYRQF+RDCTI+GT+DFIFG+A  VFQNCKMIVRK
Sbjct  341   LRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRK  400

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LGRPWKEFSRT+IM
Sbjct  401   PMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIM  460

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY++ I+P+VA QF
Sbjct  461   QSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQF  520

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             TPG F+M DE W+  + +P+ PG ++
Sbjct  521   TPGVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/566 (61%), Positives = 421/566 (74%), Gaps = 28/566 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGE---SADGGGEISTASKSVKEICAPTDYKETC  3042
             KK+A+  VASI LVACVVAA +S  +  E   S      +ST++KSV+ IC PTDYKETC
Sbjct  4     KKLAIASVASILLVACVVAAAISFTKRNEDHSSNSTDSHLSTSTKSVQAICQPTDYKETC  63

Query  3041  ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKS-ELLKEADKDPRTSDALDTCKELLH  2865
             E+SLA AK+ +DPKELIK+AF  T+ ++++ I  S  L+ EA KDPRT DAL TC+ LL 
Sbjct  64    EKSLANAKNINDPKELIKVAFNATINDLSNVIKNSASLIDEAKKDPRTKDALQTCQGLLD  123

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +IDDL RSF K + F+++ IK+YT+DLK WLS AIT QETC+DAFENTTGDTGEKMK L
Sbjct  124   VAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKMKKL  183

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LK A EL+SNGLAM++ F E++ +L IPGVN  RRLL A                    R
Sbjct  184   LKNAGELTSNGLAMVSSFGEVVANLNIPGVN--RRLLDAH------------------ER  223

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             +L+    S+K +++VA DGSGQYKS+ EAL AVP KN +  VIFIKAGVYNE VE+PRKM
Sbjct  224   MLSD---SLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNEHVEIPRKM  280

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             N I+F+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG  KHQAVA
Sbjct  281   NNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVA  340

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRVS DM IFHNC ID YQDTLY HSYRQF+RDCTI+GT+DFIFG+A  VFQNC+MIVRK
Sbjct  341   LRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRK  400

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LGRPWKEFSRT+IM
Sbjct  401   PMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIM  460

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY++ I+P+VA QF
Sbjct  461   QSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQF  520

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             TP  F+M DE W+  + +P+ PG ++
Sbjct  521   TPAVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/565 (61%), Positives = 439/565 (78%), Gaps = 20/565 (4%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGR---------SGESADGGGEISTASKSVKEICAPTD  3057
             K+A+ G+ASI +VACVVAA V++ +         SG+      +IST++KSVK +C PTD
Sbjct  4     KIAIAGLASILVVACVVAAAVTITKRNSSDSSSSSGDPVSNDSQISTSTKSVKAMCQPTD  63

Query  3056  YKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             YKE CE+SLA AK+T DPKELIK+AF  T+ +I +A+  + L++EA KDPRT DAL TC+
Sbjct  64    YKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQEAAKDPRTKDALQTCE  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
              LL+ SIDDL+RSF KV  FD+  IK+YT+DLK W+S +IT QETC+DAFENTTG+TGEK
Sbjct  124   SLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFENTTGETGEK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LLKTA EL+SNGLAM+T F E+L +L +PG++  RRLLT +++          FV+A
Sbjct  184   MKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGIS--RRLLTTDSEYTS------AFVEA  235

Query  2516  ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
              +RRLL    A  K + VVA+DGSGQYK++ EAL+AVP KN++T VI IKAG Y E V++
Sbjct  236   GSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDI  293

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
             PR +  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDGF+AR+IGFEN+AGA KH
Sbjct  294   PRSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAGAKKH  353

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DCTI+GT+DFIFG+A VVFQNCKM
Sbjct  354   QAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKM  413

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             IVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  +A PP K +LGRPWKE+SR
Sbjct  414   IVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSR  473

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+I+ ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ DKRVKW GYKRNISP+ 
Sbjct  474   TIIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQE  533

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFS  1542
             A+++ P  F+  D  W+ +  I ++
Sbjct  534   AEKYAPAHFIDQD-NWIKKTGISYA  557



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/564 (61%), Positives = 436/564 (77%), Gaps = 20/564 (4%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGR---------SGESADGGGEISTASKSVKEICAPTD  3057
             K+A+ G+ASI +VACVVAA V++ +         SG+      +IST++KSV+ +C PTD
Sbjct  4     KIAIAGLASILVVACVVAAAVTITKRNSSDSSSNSGDPVSNDSQISTSTKSVQAMCQPTD  63

Query  3056  YKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             YKE CE+SLA AK+T DPKELIK+AF  T+ +I +A+  + L++EA KDPRT DAL TC+
Sbjct  64    YKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQEAAKDPRTKDALQTCE  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
              LL+ SIDDL+RSF KV  FD+  IK+YT+DLK W+S +IT QETC+DAFENTTG+TGEK
Sbjct  124   SLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFENTTGETGEK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LLKTA EL+SNGLAM++ F E+L +L IPG++  RRLLT +++          FV+A
Sbjct  184   MKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGIS--RRLLTTDSEYTS------AFVEA  235

Query  2516  ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
              +RRLL    A  K + VVA+DGSGQYK++ EAL+AVP KN++T VI IKAG Y E V++
Sbjct  236   GSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVILIKAGEYKEMVDI  293

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
             PR M  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDGF+AR+IGFEN+AGA KH
Sbjct  294   PRSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVARDIGFENTAGAKKH  353

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DCTI+GT+DFIFG+A  VFQNCKM
Sbjct  354   QAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKM  413

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             IVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  +  PP K +LGRPWKE+SR
Sbjct  414   IVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSR  473

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ DKRVKW GYKRNISP+ 
Sbjct  474   TIIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQE  533

Query  1616  AKQFTPGPFLMADEQWLGRAQIPF  1545
             A+++ P  F+  D  W+ +  I +
Sbjct  534   AEKYAPAHFIDQD-NWIKKTGISY  556



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/572 (59%), Positives = 430/572 (75%), Gaps = 18/572 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVA-ATVSVGRSG-ESADGGG---EISTASKSVKEIC  3069
             MGS E  KK A+ GV+SI LVA VV   T SVGR G E+A  GG   ++ST+SKSV+ +C
Sbjct  1     MGS-EGKKKAAILGVSSILLVAAVVGTVTYSVGRHGTETATSGGGSDQVSTSSKSVESVC  59

Query  3068  APTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDAL  2889
                DYK+TCE+SL+GAK+T DP+ELIKLAF   V+NI   I  S LL+ A KDPRT  AL
Sbjct  60    KHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQAL  119

Query  2888  DTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
             +TCK  L+ SI+DL+RSF+ V  FD+  I +Y  DLK WLS A T QETC+DAFENTTGD
Sbjct  120   ETCKYALNTSIEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTGD  179

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPG  2529
             TGE+MK LLKTA EL+SNGLAM+T  +E+L +  I G  FKRRL+++  +        P 
Sbjct  180   TGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQG--FKRRLMSSSVE--------PD  229

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             FVDA  R+L+    AS+K + VVA+DGSGQ+KS++ A+  VP KN++T VIFIKAG+Y E
Sbjct  230   FVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKE  289

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              V +P+ +N IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAG
Sbjct  290   YVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAG  349

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRVS D TI +NC IDAYQDTLYTH+YRQ+YR+CTISGT+DFIFG+A  VFQ
Sbjct  350   AVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQ  409

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             +CKM+VRKPM NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K +LGRPWK
Sbjct  410   DCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWK  469

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM T ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+WKG K+ I
Sbjct  470   EFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-I  528

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +P++A+ FTPG ++  D  W+  + +P++PG 
Sbjct  529   TPQIAQSFTPGAYIQGDA-WITASGVPYAPGM  559



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/520 (62%), Positives = 404/520 (78%), Gaps = 14/520 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLK  2925
             +ST++KSVK IC PTDYKETCE+SLA AK+T DPKELIK+AF  T+ +I +AI  ++L+K
Sbjct  47    VSTSTKSVKAICQPTDYKETCEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIK  106

Query  2924  EADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQE  2745
             +A KDPRT +AL TC+ LL  SIDDL+RSF KV  FD+  IK+YT+DLK W+S +IT QE
Sbjct  107   DAAKDPRTKEALHTCEGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQE  166

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+DAF+NT+GDTGEKMK LLKTA EL+SNGLAMIT F ++L S+ IPG++  RRLL  +
Sbjct  167   TCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGIS--RRLLAND  224

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                      +  FV+  +RRLL    +S K + VVA DGSGQ+K++ EAL+ VP KN + 
Sbjct  225   ---------YTSFVEDGSRRLLQV--SSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQP  273

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI IKAG Y E V+VPR +  +VF+GEGPTKT+ITG+++  DG  T+HTATVA+ GDGF
Sbjct  274   YVILIKAGEYKEIVDVPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGF  333

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +AR+IGFEN+AGA KHQAVALRVSAD  +F+NC+ID YQDTLYTHSYRQFY+DC+ISGT+
Sbjct  334   VARDIGFENTAGAMKHQAVALRVSADKAVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTI  393

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG+A  VFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVL++CEI AEPA  +  
Sbjct  394   DFIFGDASAVFQNCKMIVRKPGNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQ  453

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP K +LGRPWKE+SRT+IM T ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TD
Sbjct  454   PPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTD  513

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             KRVKW GYKRNISP+ A+++ P  F+  D  W+ +  I +
Sbjct  514   KRVKWAGYKRNISPQEAEKYAPNIFIDQDS-WIKKTGISY  552



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/561 (59%), Positives = 429/561 (76%), Gaps = 20/561 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGG-----GEISTASKSVKEICAPTDYKE  3048
             KK+ + G+ASI +VACVVAA V++ +   S DGG     G IST++KSV+ +C PTDYKE
Sbjct  3     KKLVIGGIASILVVACVVAACVTITKKNAS-DGGDGASNGGISTSTKSVQAMCQPTDYKE  61

Query  3047  TCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
              CE+SLA AK+T DPKELIK+AF  T+ +I +AI  ++L+K+A  DPRT +AL+TC  LL
Sbjct  62    ACEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIKDAANDPRTKEALNTCDGLL  121

Query  2867  HNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               SIDDL+RSF KV  FD+  IK+YT+DLK W+S +IT QETC+DAF+NT+GDTGEKMK 
Sbjct  122   DVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQETCLDAFQNTSGDTGEKMKK  181

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
             LLKTA EL+SNGLAMIT F ++L ++ IPG++  RRLL  +         +  FV+  +R
Sbjct  182   LLKTAGELTSNGLAMITSFGDMLTNMNIPGIS--RRLLADD---------YTSFVEDGSR  230

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             RLL    ++ K + VVA DGSGQ+K++ EAL+ VP KN +  VI IKAG Y E V++PR 
Sbjct  231   RLLQV--SNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEMVDIPRG  288

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
             +  +VF+GEGPTKT+ITG+++  DG  T+HT+TVA+ GDGF+A++IGFEN+AGA KHQAV
Sbjct  289   VTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGFVAKDIGFENTAGAMKHQAV  348

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DC+ISGT+DFIFG+A  VFQNCKMIVR
Sbjct  349   ALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVR  408

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP ANQ CMVTAQGRKD RG  AI+L++CEI AEPA     PP K +LGRPWKE+SRT+I
Sbjct  409   KPGANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTII  468

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TD+RVKW GYK++ISP+ A++
Sbjct  469   MQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEK  528

Query  1607  FTPGPFLMADEQWLGRAQIPF  1545
             + P  F+  D  W+ +  I +
Sbjct  529   YAPNIFIDQDS-WIKKTGISY  548



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/569 (57%), Positives = 413/569 (73%), Gaps = 28/569 (5%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSV-----GRSGESADGGGEISTASKSVKEICAPTDYKET  3045
             KVA+  +AS+ LVACVVAA +S        +  + +   +IST++KSV  IC  TDYKET
Sbjct  5     KVAIGSIASLLLVACVVAAAISTTSKRNEDNSSNNNNDSQISTSAKSVNVICQQTDYKET  64

Query  3044  CERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELL-KEADKDPRTSDALDTCKELL  2868
             C +SLA A +T+DPK+L+K+AF  T+ ++ D I  S LL  EA KDPRT DAL TC +LL
Sbjct  65    CVKSLAKANNTNDPKDLLKVAFGATINDLFDVIKNSALLINEASKDPRTKDALKTCGDLL  124

Query  2867  HNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               +IDD++RSF ++  FD    K+Y +DLK WLS +IT QETC+DAFENTTG+TGEKM+ 
Sbjct  125   DVAIDDVRRSFDEIGVFDATKFKDYADDLKTWLSASITYQETCLDAFENTTGETGEKMRK  184

Query  2687  LLKTANELSSNGLAMITHFTELLQ--SLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             LLK A EL+SN LAM++ F ++L   +L+IPGVN  RRLL A                  
Sbjct  185   LLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVN--RRLLNAHE----------------  226

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              R L   +   +K ++VVA DGSGQYKS+ EALRAVP KN +  VIFIKAG+Y E +++P
Sbjct  227   -RMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIFIKAGIYKEYIDIP  285

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             +KMN IVF+GEGPTKT+ITG+++  DGIGT+ TATVAI GD F+A++IG EN+AGA KHQ
Sbjct  286   KKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAINGDNFMAKDIGIENTAGAIKHQ  345

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRVS D  IFHNC  D YQDTLY H+YRQF+RDCTI+GT+DFIFG+A  VFQ+CKMI
Sbjct  346   AVALRVSGDKAIFHNCQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKMI  405

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPMANQ CMVTAQGRKDRRG  AIV+Q+CEI AE    +  P  K +LGRPWKEFSRT
Sbjct  406   VRKPMANQACMVTAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRT  465

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + ID  + P+GWS+W G   L T +YAEY+NRG GA+++ RV W+GYK+NI  E+A
Sbjct  466   IIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIA  525

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
               F PG F++ADE W+  + +P+  G ++
Sbjct  526   AGFAPGVFILADE-WVRLSGVPYESGLMK  553



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/567 (58%), Positives = 416/567 (73%), Gaps = 24/567 (4%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             MGS E  KK A+ GV+SI LVA VV  TV+              ST+SKSV+ +C   DY
Sbjct  1     MGS-EGKKKAAILGVSSILLVAAVVG-TVTYSVV----------STSSKSVESVCKHVDY  48

Query  3053  KETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             K+TCE+SL+GAK+T DP+ELIKLAF   V+NI   I  S LL+ A KDPRT  AL+TCK 
Sbjct  49    KQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQALETCKY  108

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
              L+ SI+DL+RSF+ V  FD+  I +Y  DLK WLS A T QETC+DAFENTTGDTGE+M
Sbjct  109   ALNTSIEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTGDTGEQM  168

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K LLKTA EL+SNGLAM+T  +E+L +  I G  FKRRL+++  +        P FVDA 
Sbjct  169   KKLLKTAGELTSNGLAMVTDISEVLTNFNIQG--FKRRLMSSSVE--------PDFVDAT  218

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              R+L+    AS+K + VVA+DGSGQ+KS++ A+  VP KN++T VIFIKAG+Y E V +P
Sbjct  219   ARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLP  278

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + +N IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAGA KHQ
Sbjct  279   KHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAGAVKHQ  338

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRVS D TI +NC IDAYQDTLYTH+YRQ+YR+CTISGT+DFIFG+   VFQ CKM+
Sbjct  339   AVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMV  398

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPM NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K +LGRPWKEFSRT
Sbjct  399   VRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRT  458

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM T ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+WKG K+ I+P++A
Sbjct  459   IIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIA  517

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             + FTPG ++  D  W+  + + ++ G 
Sbjct  518   QSFTPGAYIQGDA-WITASGVTYASGM  543



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/569 (57%), Positives = 429/569 (75%), Gaps = 16/569 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGE---ISTASKSVKEICAPTDY  3054
             +NKK+A+  V+SI LVA VV      S  ++ ES   G +   ++++SK+++ +C  TDY
Sbjct  8     RNKKLAILSVSSILLVAAVVGVVTYGSSHKNVESPSAGADATPVTSSSKAIQSLCQHTDY  67

Query  3053  KETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             KETCE SL+ AK+T DP+EL+K+AF+ TV+N+ + I  S LL+ A KDPRTSDALD CKE
Sbjct  68    KETCEDSLSKAKNTSDPRELVKVAFQTTVDNLGEVIKNSSLLQNAAKDPRTSDALDICKE  127

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L+ +IDD KRSF KV++FD++ + +Y  DLK WLSGAIT Q+TC+DAFENTTGDTGEKM
Sbjct  128   VLNTAIDDFKRSFDKVQDFDISKLDDYAADLKTWLSGAITLQQTCLDAFENTTGDTGEKM  187

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K L++TA +LSSNGLA++T F+E+L +L IPG++  RRLL+AE +  ++E     FV+  
Sbjct  188   KQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLS--RRLLSAEKRKLDEE----NFVE--  239

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              RRLL  DP+SIK + ++A+DGSG +K++ +A+  VP  N    VI IKAGVY E + +P
Sbjct  240   -RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKEVILIP  298

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             R++N +V +GEGP  T+IT +++  DGIGT+HTATVAI GDG I R+IG ENSAG  KHQ
Sbjct  299   RRINNVVIMGEGPNVTKITANKNYVDGIGTFHTATVAINGDGCILRDIGIENSAGPEKHQ  358

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRVS D TI +NC ID YQDTLY+H+YRQFYRD TISGT+DFIFG+A  VFQNCK+I
Sbjct  359   AVALRVSGDRTIVYNCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLI  418

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR P+ NQ CMVTAQGR + R   AIVLQ+C I+A+PAL +A+PP + +LGRPWKE+SRT
Sbjct  419   VRMPLVNQACMVTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRT  478

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + ID  + P+GWS W GT  L T +YAEYQNRGPGA+TD+RV W G + +I+P+VA
Sbjct  479   IIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQ-HITPQVA  537

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + FTPG + + D  W+  +  P+ PG L+
Sbjct  538   ESFTPGKYFIGDS-WITASGFPYVPGMLK  565



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/587 (55%), Positives = 407/587 (69%), Gaps = 20/587 (3%)
 Frame = -1

Query  3233  MGSPEQNKK-VAVTGVASIFLVACVVAATVSV------GRSGESADGGGEISTASKSVKE  3075
             MG  + NKK + V G+AS+ LVA VV  T+ V      G +  S  GGG +ST++K+V+ 
Sbjct  1     MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  3074  ICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             IC+PTDYKETCE SLAGA +T DPKELI+LAF   V NI DAI  S L K+A  D  T D
Sbjct  61    ICSPTDYKETCESSLAGA-NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTKD  119

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             A D C ++L ++IDDLKR+  KV  FD   + EY  DLKVWLS  IT QETCIDAFENTT
Sbjct  120   AFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENTT  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP--GVNFKRRLLTAETK---Gee  2550
             GDT EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ E +   G +
Sbjct  180   GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLYGGD  239

Query  2549  qeeEFPG-----FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
               +  PG          +RRLL+   A +K + VVA DGSGQ+K++ +A+  +P KN + 
Sbjct  240   PTDYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQP  299

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VIFIKAG+Y E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F
Sbjct  300   FVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDF  359

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +A++IGFEN+AGA  HQAVALRVS D  IF N  ID YQDTLY H+YRQ+YRD TISGT+
Sbjct  360   MAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTI  419

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG++   FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEPA  A  
Sbjct  420   DFIFGDSLAYFQNCKFIVRKPMENQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATT  479

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP   +LGRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG G+   
Sbjct  480   PPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLA  539

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KRV WKG K+ I+PE+A  +T G     D+ W+  + +P++P F+QP
Sbjct  540   KRVTWKGIKK-ITPEIALSWTAGLAFKGDD-WIKSSGVPYNPSFMQP  584



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/579 (54%), Positives = 412/579 (71%), Gaps = 17/579 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG--RSGESADG-------GGEISTASKSVKEIC  3069
             ++ K++A+ GV+S  LVA VVA TVS+G    GES D          E+S + K++K +C
Sbjct  8     KRKKRLAIIGVSSFLLVAMVVAVTVSIGFNNDGESEDDINGKNHKSKEVSASMKAIKTLC  67

Query  3068  APTDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT YK+TCERSLA  A +T DPKELIK+AF++  + I  A  KS  L E +KDPRT  A
Sbjct  68    QPTYYKQTCERSLAKSAGNTTDPKELIKIAFKLAEKQIDSASKKSLTLLELEKDPRTRGA  127

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             L++CKEL+  SI++L+ S +KV +FD + + E   D+K WLS AIT +ETC+DAFENTT 
Sbjct  128   LNSCKELMTMSINELRSSLEKVADFDFSQLDELMADIKTWLSAAITYEETCLDAFENTTT  187

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK---Geeqee  2541
             + GEKMK  LKTA E+SSNGL +++  + +L  L+IPGV+  RRLL  +       +  +
Sbjct  188   NAGEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVS--RRLLQDDIPVAGHGDISQ  245

Query  2540  EFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAG  2361
              FP ++D  TRRLL+  P++IK D+VVAKDGSG YK+++EAL  +P K++ET V++IK G
Sbjct  246   AFPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPKKSNETFVLYIKEG  305

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             +Y E VE  R M  +V +G+GP KTRITGS++  DGI TY TATVA+ GD F+ARNIGFE
Sbjct  306   IYEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATVAVIGDNFVARNIGFE  365

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAGA KHQAVALRVS+D  +F+NC +D YQDTLYTH+ RQFYRDCT+SGT+DF+FG+AP
Sbjct  366   NSAGAIKHQAVALRVSSDYAVFYNCSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAP  425

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
             VVFQNC  +VRKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P L+      K +LG
Sbjct  426   VVFQNCTFLVRKPLENQQCIVTAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLG  485

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKEFSRT+IM TFIDD++ PEGWS W G+  L TCWY EY N GPG+    RVKW G 
Sbjct  486   RPWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGI  545

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             K  +S + A  FTPG FL  D  W+    +P++P   +P
Sbjct  546   KP-VSRQHAIDFTPGRFLRGD-SWIKPTGVPYAPYLTRP  582



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/579 (55%), Positives = 404/579 (70%), Gaps = 23/579 (4%)
 Frame = -1

Query  3233  MGSPEQNKK-VAVTGVASIFLVACVVAATVSV------GRSGESADGGGEISTASKSVKE  3075
             MG  + NKK + V G+AS+ LVA VV  T+ V      G +  S  GGG +ST++K+V+ 
Sbjct  1     MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  3074  ICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             IC+PTDYKETCE SL+GA +T DPKELI+LAF   V NI DAI  S L K+A  D  T D
Sbjct  61    ICSPTDYKETCESSLSGA-NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTKD  119

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             A D C ++L ++IDDLKR+  KV  FD   + EY  DLKVWLS  IT QETCIDAFENTT
Sbjct  120   AFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENTT  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP--GVNFKRRLLTAETKGeeqee  2541
             GDT EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ +        
Sbjct  180   GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSED--------  231

Query  2540  EFPGFVDAA-TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
               P ++ +  TRRLL+   A +K + VVA DGSGQ+K++ +A+  +P KN +  VIFIKA
Sbjct  232   --PYWIKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKA  289

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             G+Y E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F+A++IGF
Sbjct  290   GLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFMAKDIGF  349

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGA  HQAVALRVS D  IF N  ID YQDTLY H+YRQ+YRD TISGT+DFIFG++
Sbjct  350   ENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDS  409

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
                FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEPA  A  PP   +L
Sbjct  410   LAYFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYL  469

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG G+   KRV WKG
Sbjct  470   GRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKG  529

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              K+ I+PE+A  +T G     D+ W+  A +P++P F+Q
Sbjct  530   IKK-ITPEIALSWTAGLAFKGDD-WIKTAGVPYNPSFMQ  566



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/590 (53%), Positives = 418/590 (71%), Gaps = 27/590 (5%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSV-GRSGESAD-----GGGEISTASKSVKEI  3072
             MG   + KK+AV G+ SI LVA VVA  V +  ++G+  D     GGG +S  +K+V+ I
Sbjct  1     MGDDSKKKKMAVAGLCSILLVAMVVAVAVGIPKKNGDETDDAPTNGGGGVSATTKAVQAI  60

Query  3071  CAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
             C+PTDYK+TC  SL+GA  TD PKELIK+AF  TV+NI ++I  S L K+A  D RT  A
Sbjct  61    CSPTDYKQTCTESLSGANSTD-PKELIKVAFEYTVKNIKESIKNSTLYKDAAADERTKGA  119

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LD C E+L+ SI+DL+RSF+K+  FDM+ + +  +D+K WLSGAIT QETC+DAFENTTG
Sbjct  120   LDVCSEVLNTSIEDLERSFEKIGEFDMSKVDDLVDDVKTWLSGAITYQETCLDAFENTTG  179

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK---------  2559
             DTGEKMK+LL+T+ EL SNGLAM+T F+ +L SL   G    RRLL+ E +         
Sbjct  180   DTGEKMKNLLQTSGELLSNGLAMVTDFSSILSSL---GGFSSRRLLSDEGRSLYHLDPTD  236

Query  2558  ---GeeqeeEF---PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                GE+ +  F   P FVD+  R+LL   PA++K + VVAKDGSGQY ++  AL+ +P K
Sbjct  237   YAPGEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKK  296

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T VI++KAGVY E V +PR +N IV +G+GP KTRI G+++  DG+ T+HTA +A+ 
Sbjct  297   TNQTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQTFHTAVLAVN  356

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GDGF+A++IG EN+AGAAKHQAVA+RVS D  IF+N H+D YQDTLY H+YRQFYRDC I
Sbjct  357   GDGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYAHAYRQFYRDCQI  416

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFG+A  +FQ C+++VR+PM +Q CMVTAQGRKD+R     VLQ C+I+A+PA 
Sbjct  417   TGTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQRSVGVTVLQGCDIVADPAF  476

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A  PP   +LGRPWKE+SRT++M + ID  + PEGWS W G   L T +Y EYQNRG G
Sbjct  477   LAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAG  536

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +    RV WKG K+ I+P +A+ FTPG  +  ++ W+  + IP+  G LQ
Sbjct  537   SGLSGRVTWKGIKK-ITPAIAQSFTPG-VVYKNDTWVSTSGIPYVSGMLQ  584



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/569 (53%), Positives = 401/569 (70%), Gaps = 25/569 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KK+A+ G++SI LVAC+V A V++ + G       ++ST++K+V+ +C PT YKETCE+S
Sbjct  7     KKIAIAGISSILLVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYKETCEKS  66

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+T DPKELIK AF  T+  I  +I  S   KEA  DPRT DAL  C E+L  SI+
Sbjct  67    LSSAKNTSDPKELIKTAFDSTINEIASSIKNSAPFKEAANDPRTKDALKVCDEVLDRSIE  126

Query  2852  DLKRSFQKVENFDM-AHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             ++KRSF K ++ D+ + +K+Y  DL+ WLS A+T + TCIDAF NTTGDTGEKMK+LLK 
Sbjct  127   EIKRSFNKFDSSDVKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGEKMKNLLKN  186

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             A+ELS+N L +++ F + ++ L+I G+N  RRLLT               V+A  RRLL 
Sbjct  187   AHELSTNALDIVSSFEKQVEDLQILGIN-NRRLLT---------------VEAGNRRLLQ  230

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P  +K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VIFIKAG+YNE V+V   M  +
Sbjct  231   VAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNEYVQVANTMTNV  288

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG  KHQAVALRV
Sbjct  289   VFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRV  348

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP--  1962
             SA+M +F NC ID YQ TL TH  RQFYRDCTI+GT+DFIFG+A  VFQNCK+I RKP  
Sbjct  349   SAEMAVFQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEE  408

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLIM  1785
             M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK +LGRPWK +SRT+IM
Sbjct  409   MQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIM  468

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV WK Y +N +P+V  +F
Sbjct  469   QSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKF  528

Query  1604  TPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             TPG  L   +    W+ +  +P+ PG ++
Sbjct  529   TPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/569 (53%), Positives = 400/569 (70%), Gaps = 25/569 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KK+A+ G+ASI +VAC+V A V++ + G       ++ST++K+V+ +C PT YKETCE+S
Sbjct  7     KKIAIAGIASILVVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYKETCEKS  66

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+T DPKELIK AF  +V  I  +I  S   KEA  DPRT DAL  C E+L  SI+
Sbjct  67    LSSAKNTSDPKELIKTAFDSSVNEIASSIKNSAPFKEAANDPRTKDALKVCDEVLDRSIE  126

Query  2852  DLKRSFQKVENFDM-AHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             ++KRSF K ++ D+ + +K+Y  DL+ WLS A+T + TCIDAF NTTGDTGEKMK+LLK 
Sbjct  127   EIKRSFNKFDSSDLKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGEKMKNLLKN  186

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             A+ELS+N L +++ F E +++L+I G+N  RRLLT               V+A  RRLL 
Sbjct  187   AHELSTNALDIVSSFEEQVENLQILGIN-NRRLLT---------------VEAGNRRLLQ  230

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P  +K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VI IKAG+YNE V+V   M  +
Sbjct  231   VAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNEYVQVANTMTNV  288

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG  KHQAVALRV
Sbjct  289   VFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRV  348

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP--  1962
             SA+M +F NC ID YQ TL TH  RQ YRDCTI+GT+DFIFG+A  VFQNCK+I RKP  
Sbjct  349   SAEMAVFQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEE  408

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLIM  1785
             M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK +LGRPWK +SRT+IM
Sbjct  409   MQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIM  468

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV WK Y +N +P+V  +F
Sbjct  469   QSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKF  528

Query  1604  TPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             TPG  L   +    W+ +  +P+ PG ++
Sbjct  529   TPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/544 (55%), Positives = 394/544 (72%), Gaps = 12/544 (2%)
 Frame = -1

Query  3137  RSGESADGGGEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVEN  2961
              SG +++ GG IST S K+V+ ICAPTDYKETCE SL+ A  T+ P ELIK AF  TV+N
Sbjct  34    ESGSASNDGGSISTGSTKAVQSICAPTDYKETCESSLSHANSTN-PNELIKAAFDFTVKN  92

Query  2960  ITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDL  2781
             I D I+ S L KEA  D  T  AL+ C+E+L  +IDDLKRSF  V+ FD+ +  EY  +L
Sbjct  93    IGDIITNSPLFKEAANDDGTKQALEICQEVLDTAIDDLKRSFDSVDEFDITNASEYVENL  152

Query  2780  KVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP  2601
             K WLS  IT QETCIDAFENTTGDTGEKMK+LLKTA E+SSNGLAM+   +  L SL++ 
Sbjct  153   KTWLSAVITNQETCIDAFENTTGDTGEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLG  212

Query  2600  GVNFKRRLLTAETK-GeeqeeEFPG-----FVDAATRRLLTTDPASIKHDIVVAKDGSGQ  2439
                 ++ LL+ +   G +  +  PG      +D+  RRLL+    S+K + VVA+DGSGQ
Sbjct  213   NAASRKLLLSGKIGYGGDPTDYAPGEEPHFNLDSNRRRLLSA--TSLKPNAVVAQDGSGQ  270

Query  2438  YKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK  2259
             + ++  A+ +VP KN++T VI +KAGVY E V++P+K+NKIV +G+GP KTRI+G ++  
Sbjct  271   FNTISAAIASVPPKNNQTFVIHVKAGVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYA  330

Query  2258  DGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTL  2079
             +G+ TYHTATVA+  D F+A++IGFEN+AGAA HQAVALRVS D  +F+N HID YQDTL
Sbjct  331   EGVKTYHTATVAVNADDFLAKDIGFENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTL  390

Query  2078  YTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAA  1899
             Y H+YRQ+YRDC+ISGT+DFIFG++  +FQNCK +VRKPMANQ CMVTAQGR +R    A
Sbjct  391   YAHTYRQYYRDCSISGTIDFIFGDSQALFQNCKFVVRKPMANQACMVTAQGRVERHSLGA  450

Query  1898  IVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL  1719
              ++Q+ + +AEPAL  A+PP+KV+LGRPWK  SRT+IM + I   + PEGW+ W GT  L
Sbjct  451   TIIQNGDFVAEPALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAEWSGTFAL  510

Query  1718  DTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             DT +YAEYQNRGPG+    RVKWKG +  +SP++A+ +T G F   DE W+  + +P+ P
Sbjct  511   DTLYYAEYQNRGPGSDLKNRVKWKGIQ-TLSPQMAESWTGGKFYGGDE-WVKNSGVPYIP  568

Query  1538  GFLQ  1527
               +Q
Sbjct  569   TMMQ  572



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/574 (52%), Positives = 411/574 (72%), Gaps = 17/574 (3%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG--------EISTASKSVKEICAPT  3060
             NK++A+   +S+ LVA VVA TV V +   +   G         +I T+ K++K IC PT
Sbjct  8     NKRIAIISASSLILVAMVVAVTVGVNQHPTAGSDGTKTVSNDDEQIQTSMKAIKAICQPT  67

Query  3059  DYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKETC +SL+ A  +T DPK+L+K+AF++  + I +A+++S +LKE +KDPR S AL  
Sbjct  68    DYKETCIKSLSSAAGNTTDPKDLVKIAFKIATKQIKEAVNRSVVLKELEKDPRASKALAN  127

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C+EL+  +ID+L  SF ++ + D+  I +   +LK+WLS ++T QETC+D F+NTTG+ G
Sbjct  128   CRELMDYAIDELNSSFDELGSIDIDDIDDALENLKIWLSASLTYQETCLDGFQNTTGNAG  187

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe---eqeeEFP  2532
             E M+  LKTA EL+ NGLAM+T    +L SL++P    KRRLL++E + +     E+EFP
Sbjct  188   ESMRKALKTAGELTQNGLAMVTEVASILTSLQMPS---KRRLLSSEQQSQCPFAMEDEFP  244

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
              +  AA RRLL    A+IK +I VAKDGSG+YK++ EALR VP  ++ET VI IKAGVY+
Sbjct  245   TWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPKNSNETFVIHIKAGVYH  304

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E+V++ R M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GDGF+A++IGFENSA
Sbjct  305   EQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVAVIGDGFMAKDIGFENSA  364

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  KHQAVALRV +DM+IF+NC ID YQDTLY H++RQFYR+CTISGT+DFIFGN+ VV 
Sbjct  365   GPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVVL  424

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             Q C+++VRKP+ NQ+ +VTA GRKDRR   AI+LQSC I+A+P L       + +LGRPW
Sbjct  425   QKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGRPW  484

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             KE+SRT+IM T IDD++ P+GW  W G   L TC+YAEY NRGPGA   +RVKW+G K +
Sbjct  485   KEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKTS  544

Query  1631  I-SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             I +PE A+QFT G F+  D  W+    +P+  G 
Sbjct  545   IMTPEKAQQFTAGRFIRGDS-WIKPTGVPYDSGL  577



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/585 (53%), Positives = 401/585 (69%), Gaps = 19/585 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRS--GESAD-------GGGEISTASKSV  3081
             M     NK++A+ G++SI LVA VVA T+ VG S  GES D         GEIS + K++
Sbjct  1     MADDANNKRLAIIGISSILLVAMVVAVTIGVGFSENGESEDITGKSHKSTGEISASMKAI  60

Query  3080  KEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPR  2904
             K IC P DYK+TCE+SL   A +T DPKELIK AF++  + I +A  KS  L+E +KDPR
Sbjct  61    KSICQPADYKKTCEKSLEKSAGNTTDPKELIKAAFKIAQKKIREAAKKSATLEELEKDPR  120

Query  2903  TSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFE  2724
             T DAL +CKEL+  SI +L+ SF KV +FD+  + ++  DL+ WLS  IT + TC+D FE
Sbjct  121   TRDALQSCKELMDMSISELQNSFDKVADFDITMLDDFMADLRTWLSAVITYEGTCLDGFE  180

Query  2723  NTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-ETKGeeq  2547
             NTT D GEKMK  +K A E+S+NGL +I   +  L  L+I GVN  RRLL   E  G + 
Sbjct  181   NTTSDAGEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVN--RRLLQEDEVLGHDD  238

Query  2546  e-eEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK---NDETVV  2379
                +FP +VDA TRRLL   P+ IK ++ VAKDGSG +K++  AL ++P     + +T V
Sbjct  239   VPSKFPSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFV  298

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             ++IKAGVY E VE  + M+ ++ +G+GP KTRITG+++  DG+ TYHTATV + GD FIA
Sbjct  299   LYIKAGVYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGVNTYHTATVVVLGDNFIA  358

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +NIGFENSAGA KHQAVALRVSAD  +F+NC +D YQDTLYTH+ RQFYR+C+ISGT+DF
Sbjct  359   KNIGFENSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLYTHAKRQFYRECSISGTIDF  418

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+APVVFQNCK +VRKP+ NQ+C+VTAQGRK RR  + I++Q+    A P L      
Sbjct  419   VFGDAPVVFQNCKFLVRKPLENQQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQ  478

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWK+FSRT+IM ++IDDI+ PEGW  W GT  L TCWY E+ N GPG+    R
Sbjct  479   YKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLKTCWYTEFNNYGPGSDKKAR  538

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             VKW G K  I  + A  FTPG FL  D  W+    IP+SP   +P
Sbjct  539   VKWNGIK-TIDRQHALDFTPGRFLRGD-TWIKPTGIPYSPFLTRP  581



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/581 (54%), Positives = 401/581 (69%), Gaps = 30/581 (5%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGR--SGESA------DGGGEISTASKSVK  3078
             MG   + KK+ + G+AS+ LVA VV  TV V +  +G++A        GG ISTA+K+V 
Sbjct  1     MGDDGKKKKILIGGLASVLLVAMVVCVTVGVQKNSAGDAAAPSTGGGSGGGISTANKAVH  60

Query  3077  EICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTS  2898
              IC+PTDYKETCE SL+GA +T DPKELIK+AF   V NI +AI  S LLK+A  D  T 
Sbjct  61    AICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNSTK  119

Query  2897  DALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALD C ++L ++IDDLKR+  KV +FD + + EY  DLKVWLS  IT QETCIDAFENT
Sbjct  120   DALDICNDVLESAIDDLKRAGDKVGSFDASKVDEYVEDLKVWLSAVITYQETCIDAFENT  179

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGee  2550
             TGDT EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +     
Sbjct  180   TGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND-----  234

Query  2549  qeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
                      D   RR+L    A  K + VVA+DGSGQ+K++ EA+ +VP  N++T VI+I
Sbjct  235   ---------DWIKRRVLR-GKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYI  284

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  2190
             KAGVY E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+NI
Sbjct  285   KAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEFTAKNI  344

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             GFEN+AGA  HQAVALRVS D  +F+N  ID YQDTLY H+YRQFY DC+ISGT+DFIFG
Sbjct  345   GFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFG  404

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  A  P    
Sbjct  405   DSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDA  464

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+    RV W
Sbjct  465   YLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTW  524

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             KG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  525   KGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  563



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 398/582 (68%), Gaps = 30/582 (5%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGR-SGESADG-------GGEISTASKSVK  3078
             MG   + KK+ + G+AS+ LVA V+  TV V R SG +A         GG ISTA+K+V 
Sbjct  1     MGDDGKKKKILIGGLASVLLVAMVICVTVGVERNSGGNAAAPSTGGGSGGGISTANKAVH  60

Query  3077  EICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTS  2898
              IC+PTDYKETCE SL+GA +T DPKELIK+AF   V NI +AI  S LLK+A  D  T 
Sbjct  61    AICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNSTK  119

Query  2897  DALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALD C ++L ++IDDLKR+  KV  FD   + EY  DLKVWLS  IT QETCIDAFENT
Sbjct  120   DALDICNDVLESAIDDLKRAGDKVGAFDATKVDEYVEDLKVWLSAVITYQETCIDAFENT  179

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGee  2550
             TGDT EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +     
Sbjct  180   TGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND-----  234

Query  2549  qeeEFPGFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
                      D   RR+L     A  K + VVA+DGSGQ+K++ EA+ +VP  N++T VI+
Sbjct  235   ---------DWINRRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIY  285

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+N
Sbjct  286   IKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEEFTAKN  345

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IGFEN+AGA  HQAVALRVS D  +F+N  ID YQDTLY H+YRQFY DC+ISGT+DFIF
Sbjct  346   IGFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIF  405

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  A  P   
Sbjct  406   GDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAID  465

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+    RV 
Sbjct  466   AYLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVT  525

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             WKG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  526   WKGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  565



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/576 (54%), Positives = 406/576 (70%), Gaps = 16/576 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG------EISTASKSVKEI  3072
             M    +NKK A+ GV+S+FLVA VVA  V V R+  +A GGG      EIST++K+VK +
Sbjct  1     MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAEISTSTKAVKAL  60

Query  3071  CAPTDYKETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             C PTDY+ETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP    
Sbjct  61    CQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPMAKQ  120

Query  2894  ALDTCKELLHNSIDDLKRSFQKV-ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALD C EL+  +IDDL  SFQ++ +NFDM  + +Y  DLKVWLSGA+T QETCID FEN 
Sbjct  121   ALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGFENV  180

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             TGDTGEKM  LL+T+ EL+ NGL M++  T +L S  +P +   RRL+T E+  + +E  
Sbjct  181   TGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIG--RRLMTEESNEQREE--  236

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              P +V    R LL    A+IK D VVAKDGSG+YK+V  AL  VP K+++T VI++KAGV
Sbjct  237   -PSWV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGV  294

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFEN
Sbjct  295   YQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFEN  354

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAGAAKHQAVALRV +DM++F+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGN  V
Sbjct  355   SAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAV  414

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P        NK FLGR
Sbjct  415   VFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGR  474

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TDKRVKWKG K
Sbjct  475   PWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  535   K-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  568



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/576 (54%), Positives = 404/576 (70%), Gaps = 16/576 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG------EISTASKSVKEI  3072
             M    +NKK A+ GV+S+FLVA VVA  V V R   + D  G      EIST++K+V+ +
Sbjct  1     MSDGGKNKKAALIGVSSLFLVAMVVAVAVGVNRKNPTTDSSGGDGATAEISTSTKAVQAL  60

Query  3071  CAPTDYKETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             C PTDYKETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP    
Sbjct  61    CQPTDYKETCEKALSEAGTNTSDPRELIKSGFHVAVNEIKWAIGNSTQLKEAASDPMAKQ  120

Query  2894  ALDTCKELLHNSIDDLKRSFQKV-ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALD C EL+  +IDDL  SF ++ +NFD+  + +Y  DLK+WLSGA+T QETCID FEN 
Sbjct  121   ALDACGELMDYAIDDLVISFDRITDNFDVQKLNDYVEDLKIWLSGALTYQETCIDGFENV  180

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             TGDTGEKM  LLKT+ EL+SNGL M++    ++ S  +P V   RRLLT E+  +E+E  
Sbjct  181   TGDTGEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVG--RRLLTEESNQQEEEPS  238

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
             + G      R LL    A++K D+VVAKDGSG+YK+V EAL  VP K+++T VI +KAGV
Sbjct  239   WVG----DRRGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGV  294

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFEN
Sbjct  295   YQEQVMVDKSMTWVMMIGDGPTKTKITAGKNYVDGTPTFKTATVSVIGSNFIAKDIGFEN  354

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAGAAKHQAVALRV +DM+IF+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGNA  
Sbjct  355   SAGAAKHQAVALRVQSDMSIFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAA  414

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I ++P        NK +LGR
Sbjct  415   VFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGR  474

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK++SRT+IM   IDD++ PEGW  W G   L T +YAE  NRGPGA+TDKRVKWKG K
Sbjct  475   PWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + I+P+ A  FT G F+  D  W+    +P+S G +
Sbjct  535   K-ITPQHALDFTVGRFIRGDP-WIKPTGVPYSSGMM  568



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/579 (54%), Positives = 406/579 (70%), Gaps = 19/579 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG---------EISTASKSV  3081
             M    +NKK A+ GV+S+FLVA VVA  V V R+  +A GGG         EIST++K+V
Sbjct  1     MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAATAEISTSTKAV  60

Query  3080  KEICAPTDYKETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPR  2904
             K +C PTDY+ETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP 
Sbjct  61    KALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPM  120

Query  2903  TSDALDTCKELLHNSIDDLKRSFQKV-ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAF  2727
                ALD C EL+  +IDDL  SFQ++ +NFDM  + +Y  DLKVWLSGA+T QETCID F
Sbjct  121   AKQALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGF  180

Query  2726  ENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             EN TGDTGEKM  LL+T+ EL+ NGL M++  T +L S  +P +   RRL+T E+  + +
Sbjct  181   ENVTGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIG--RRLMTEESNEQRE  238

Query  2546  eeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
             E   P +V    R LL    A+IK D VVAKDGSG+YK+V  AL  VP K+++T VI++K
Sbjct  239   E---PSWV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVK  294

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
             AGVY E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IG
Sbjct  295   AGVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIG  354

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAGAAKHQAVALRV +DM++F+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGN
Sbjct  355   FENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGN  414

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
               VVFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P        NK F
Sbjct  415   GAVVFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAF  474

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TDKRVKWK
Sbjct  475   LGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWK  534

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K+ I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  535   GIKK-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  571



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/573 (51%), Positives = 401/573 (70%), Gaps = 16/573 (3%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVG-RSGES------ADGGGEISTASKSVKEICAPTDY  3054
             KKVA+ G +SI LVA VV   V+V  R+G S      A  GG IST+ K+++ IC PTDY
Sbjct  15    KKVALMGFSSILLVAMVVGTVVTVNHRNGSSSSATDDAQAGGGISTSVKAIQAICQPTDY  74

Query  3053  KETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             KE C  SL  AK +T DPKEL++ AF+V +  I+ A+  S  L++ +KDPRT  AL+ C 
Sbjct  75    KEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCH  134

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  +IDDL+ SF K+  FD++ I +Y  DLK+WLSGA+T QETC+D FENTTGD GEK
Sbjct  135   ELMDYAIDDLRNSFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTGDAGEK  194

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAET-KGeeqe---eEFPG  2529
             MK LLK+A EL+SNGLAMI   + +L +L+IPG++  RRLL+ E+ KGE +      +P 
Sbjct  195   MKALLKSAGELTSNGLAMIDEISSVLTNLQIPGIS--RRLLSDESGKGEYRSDEGGLYPS  252

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +     R+L    P +IK +++VA+DGSG+YK++ EAL  +P   + T V+++K GVY E
Sbjct  253   WASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKE  312

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V   + M  ++ +G+GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFEN+AG
Sbjct  313   QVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAG  372

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A+KHQAVALRV +DM IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG++ VVFQ
Sbjct  373   ASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQ  432

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NC ++VRKP+ NQ+C+VTAQGR +RR    IVLQ+C I A           K +LGRPWK
Sbjct  433   NCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWK  492

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
              FSRT+IM + IDD++ PEGW  W G   L+TC+YAEY NRGP ++T  RV W+G K+ I
Sbjct  493   AFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-I  551

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + +    FT G F+ +   WLG + +P++   +
Sbjct  552   TGQHVNDFTVGRFI-SGHLWLGASGVPYTSDMM  583



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/582 (53%), Positives = 407/582 (70%), Gaps = 24/582 (4%)
 Frame = -1

Query  3245  SLIKMGSPEQNKKVAVTGVASIFLVACVVAATVSVGRS------GESADGGGEISTASKS  3084
             S +KMG     KKVA+  V S+FLVA VVA  V V RS      G  A   GEIST++K+
Sbjct  118   SCLKMG-----KKVAIISVCSVFLVAMVVAVAVGVSRSHGGRGNGGGATPTGEISTSTKA  172

Query  3083  VKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPR  2904
             +K IC PTDY+ETCE+SL+ A +T DPKELIK+ F+  +  I   I+ S  +KE  KDP 
Sbjct  173   IKAICQPTDYRETCEKSLSSA-NTTDPKELIKIGFQAAISEIKKVIANSSTVKEVAKDPM  231

Query  2903  TSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFE  2724
                AL+ C EL+  +IDDLK SF ++  FD + + EY  +LK+WL GAIT Q+TC+D F 
Sbjct  232   ARQALENCHELMDYAIDDLKNSFNQLGEFDFSKLDEYIENLKIWLGGAITYQQTCLDGFM  291

Query  2723  NTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV---NFKRRLLTAETKGe  2553
             NTTG+ G+KM+ LLKT+ EL+SNGLAM++  + +L +L I  +   +  +R L AE    
Sbjct  292   NTTGEAGKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRRLFAEN---  348

Query  2552  eqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
                  FP +V +  R  +   PA+IK ++VVAKDGSG+Y S+ EAL+ VP  N  T VI+
Sbjct  349   ----GFPMWVSSEQRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKDNPTTFVIY  404

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E+V V + M  ++F+G+G TKT+ITG  +  DG GT+ TATV + GDGFIA++
Sbjct  405   IKAGVYKEQVIVTKSMTNVMFIGDGRTKTKITGDLNYADGTGTFRTATVGVVGDGFIAKD  464

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IGFEN+AGA KHQAVALRV +D +IF+NC +D YQDTLY HS+RQFYRDCTISGT+DFIF
Sbjct  465   IGFENTAGAIKHQAVALRVQSDQSIFYNCQMDGYQDTLYAHSHRQFYRDCTISGTIDFIF  524

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G++  V QNCK+IVRKP+ NQ+C+VTAQGR +RR  +A+VLQ+C I  +P        NK
Sbjct  525   GDSATVLQNCKIIVRKPLENQQCIVTAQGRIERREVSALVLQNCTISGDPEYLPVKDKNK  584

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKEFSRTLIM + IDDI+ PEGW  W G   L+T WYAE+ NRGPGA    RV 
Sbjct  585   AYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPGAVQTHRVT  644

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             W+G K+ I+  +A++FTPG FL  D+ W+ +A +P++PG ++
Sbjct  645   WRGIKK-INAAIARRFTPGVFLRGDD-WIPKAGVPYTPGLIR  684



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/573 (51%), Positives = 401/573 (70%), Gaps = 16/573 (3%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRS-GES---ADGGGEISTASKSVKEICAP  3063
             GS    KK A+ GV+SI LVA VVA  V +G S G+S   +   G+IST SKS+K IC P
Sbjct  7     GSNAGKKKFAIIGVSSIILVAMVVAVAVGIGGSPGDSKQESSPKGQISTTSKSIKAICQP  66

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+ETCE SL+  A +T DP +L++  F+VT+E + +AI++S  LKE  KDP  S ALD
Sbjct  67    TDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALD  126

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C+EL+ ++I +L+ SF  +E+F  +   EY N+LKVWLS  IT Q TC+D FENTTG  
Sbjct  127   NCRELMDDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFENTTGSA  186

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             GEKMK LL  +++L+SNGLAM+   T +L+ L IPG+   RRLL A+ +       FP +
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLT-SRRLLEADDE-------FPSW  238

Query  2525  VDAATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             V+   R LL  + PA+IK D +VA+DGSGQYK++ EA+  +P K +ET VI+IK GVY E
Sbjct  239   VNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKE  298

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSAG
Sbjct  299   QVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAG  358

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A  HQAVALRV ADM++F+NC ID YQDTLY H+ RQFYRDCTI+GT+DFIFG+A  VFQ
Sbjct  359   AIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQ  418

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +LGRPW+
Sbjct  419   NCKLVVRKPLDNQQCIVTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWR  478

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E SRT++M + IDD++ PEGW  W G+  L+T +Y+EY N+G GA    RVKW G K+ +
Sbjct  479   ELSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIKK-L  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  538   TPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/573 (51%), Positives = 401/573 (70%), Gaps = 16/573 (3%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRS-GES---ADGGGEISTASKSVKEICAP  3063
             GS    KK A+ GV+SI LVA VVA  V +G S G+S   +   G+IST SKS+K IC P
Sbjct  7     GSNAGKKKFAIIGVSSIILVAMVVAVAVGIGGSHGDSKQESSPKGQISTTSKSIKAICQP  66

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+ETCE SL+  A +T DP +L++  F+VT+E + +AI++S  LKE  KDP  S ALD
Sbjct  67    TDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALD  126

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C+EL+ ++I +L+ SF  +E+F  +   EY N+LKVWLS  IT Q TC+D F+NTTG  
Sbjct  127   NCRELMDDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFDNTTGSA  186

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             GEKMK LL  +++L+SNGLAM+   T +L+ L IPG+   RRLL A+ +       FP +
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLT-SRRLLEADDE-------FPSW  238

Query  2525  VDAATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             V+   R LL  + PA+IK D +VA+DGSGQYK++ EA+  +P KN+ET V++IK GVY E
Sbjct  239   VNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKE  298

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSAG
Sbjct  299   QVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAG  358

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A  HQAVALRV ADM++F+NC ID YQDTLY H+ RQFYRDCTI+GT+DFIFG+A  VFQ
Sbjct  359   AIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQ  418

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +LGRPW+
Sbjct  419   NCKLVVRKPLENQQCIVTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWR  478

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E SRT++M + IDD++ PEGW  W G   L+T +Y+EY N+G GA    RVKW G K+ +
Sbjct  479   ELSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIKK-L  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  538   TPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/571 (51%), Positives = 399/571 (70%), Gaps = 14/571 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG------EISTASKSVKEICAPT  3060
             ++ KK+A+ G +++ LVA VVA  V   RS   +           +ST +K+++ IC PT
Sbjct  12    QRKKKIAIIGTSALILVAMVVAVAVGFNRSESDSQSAAPTSPPPSVSTTTKAIQAICQPT  71

Query  3059  DYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DY+ETCE SL + A +T DPKELIK AF V +++I+ AI  S  LKE  KD RT+ AL  
Sbjct  72    DYRETCENSLTSAAGNTSDPKELIKAAFNVAIDHISAAIRNSSTLKELAKDSRTNQALSN  131

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C ELL  +IDDLK SF ++  F+   + EY +DLK+WLSGAIT ++TC+D FENTTG+ G
Sbjct  132   CDELLKYAIDDLKESFDRIGPFEYEKLDEYVDDLKIWLSGAITYEQTCLDGFENTTGEAG  191

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
              +MK +L+++ EL+SNGLAM+T  + +L S  +P  N  RRLL++E   + +      ++
Sbjct  192   LRMKAMLRSSQELTSNGLAMVTEISSILASYNLP-FNVSRRLLSSEDGDDTELS----WL  246

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL     +IK D+VVAKDGSG+Y++V EAL+ +P K ++T VI+IK GVY E+V
Sbjct  247   SDGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKEQV  306

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
                + M  ++ +G+GPTKTRITGS +  DG+ T+ TATV++ G  FIA++IGFENSAG  
Sbjct  307   MFAKSMTHVMIIGDGPTKTRITGSLNFIDGVQTFKTATVSVIGSNFIAKDIGFENSAGPQ  366

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV +DM+IF+NCH+D YQDTLY H++RQFYRDC I+GT+DFIFG++  VFQNC
Sbjct  367   KHQAVALRVQSDMSIFYNCHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNC  426

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             KM++RKP+ NQ C+VTAQGR +RR A A+VLQ+C I  +PA       NK +LGRPWKEF
Sbjct  427   KMVIRKPLDNQNCIVTAQGRTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEF  486

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM + IDD++ PEGW  W G   L+TC+Y E  NRGPG+  D RVKW+G K+ +  
Sbjct  487   SRTIIMNSRIDDVIAPEGWLPWAGDFALNTCFYTEILNRGPGSKLDGRVKWRGIKK-VPA  545

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A ++TPG F+  D  W+  A +P+  G L
Sbjct  546   QRAVEYTPGRFIRGD-WWIKAAGVPYVSGML  575



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/583 (50%), Positives = 401/583 (69%), Gaps = 34/583 (6%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK+A+  ++SI LVA V+               G   + ++K+   +C   DYK TC
Sbjct  3     DKMKKIAMASLSSILLVAMVLPLAT-----------GDSPTNSNKAAHALCTSVDYKITC  51

Query  3041  ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
             E+SL+GA ++ DP+ELIK+AF   + +I +AI  S L K+A  D RT  AL+ C+E+L  
Sbjct  52    EKSLSGA-NSSDPQELIKVAFNHAITDIQEAIKNSTLYKQAALDHRTKGALEVCEEVLDT  110

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             SIDDL+RSF +V N D+  +K+Y  D+KVWLSGAIT  ETC+DAF+NTTGDTGEKMK+LL
Sbjct  111   SIDDLRRSFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKMKNLL  170

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE---------TKGeeqeeEF--  2535
              ++  + SNGLAM+   + +  SL + G    RRLL  E         T GE+ +  F  
Sbjct  171   HSSGMMLSNGLAMVGDISSIFSSLSLGGFT-SRRLLEEEGSLAYGVDQTDGEDPKTAFDG  229

Query  2534  --------PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVV  2379
                     P FVDA  RR++T +  ++K +IVVA+DGSGQ+K++  A+ ++P K D   V
Sbjct  230   KVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPKKGDGPFV  289

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             I +KAG Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA + + GDGFIA
Sbjct  290   IHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVLGVNGDGFIA  349

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             ++IG EN+AG  KHQAVA+RVS D +IF+N H++++QDTLY H+YRQ+YRDCTI+GT+DF
Sbjct  350   KDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYAHAYRQYYRDCTITGTIDF  409

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C ILAEPA  +  PP
Sbjct  410   IFGDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAEPAFLSTKPP  469

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWK+FSRT+IM T ID  + PEGW+ W+G   LDT +Y E++NRGPG+   +R
Sbjct  470   VKAYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNRGPGSDMSRR  529

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             V+WKG +  I+P +A+ FTPG     DE W+ ++ +P+  G +
Sbjct  530   VRWKGIQ-TITPAIAESFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/561 (52%), Positives = 392/561 (70%), Gaps = 31/561 (6%)
 Frame = -1

Query  3134  SGESADGGGEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENI  2958
             SG +++G  +IS  S K+V+ ICAPTDYK+TCE+ L+ A +T +P+ELIK AF  TV+NI
Sbjct  36    SGSASNGDRQISAGSTKAVQSICAPTDYKDTCEKGLSHA-NTTNPQELIKAAFEFTVKNI  94

Query  2957  TDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLK  2778
              D +  S L KEA  D  T +AL+ C+ +L  +IDDLK SF  V+ FD+ +  EY  DLK
Sbjct  95    GDVVKNSPLFKEASHDKSTKEALEICQLVLEIAIDDLKMSFDSVDEFDVTNASEYVEDLK  154

Query  2777  VWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG  2598
              WLS  IT QETCIDAF+NTTGDTGEKMK+LLKTA E+SSNGLAM+T  + +L SL++  
Sbjct  155   TWLSAVITNQETCIDAFDNTTGDTGEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQLGN  214

Query  2597  VNFKRRLLTAETK-------------------GeeqeeEFPG-----FVDAATRRLLTTD  2490
             V   R+LL+ E +                   G +  +  PG      +D+  R LL+  
Sbjct  215   VA-SRKLLSEEGRFASKPNAGRKLQLSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSA-  272

Query  2489  PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVF  2310
               S+K + VV++DGSGQ+ ++  A+  VP KND+T VI +KAGVY E+V +P+ MNKIV 
Sbjct  273   -TSLKPNAVVSQDGSGQFNTISAAIATVPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVL  331

Query  2309  VGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSA  2130
             +G+GP KTR+TG  +  +G+ TYHTATVA+  D F+A++IGFEN+AGA  HQAVALR S 
Sbjct  332   IGDGPLKTRVTGRLNFAEGVKTYHTATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASG  391

Query  2129  DMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQ  1950
             D  +F+N HID YQDTLY H+YRQ+YRDCTISGT+DFIFG+A  +FQNC+ ++RKP+ NQ
Sbjct  392   DRAVFYNVHIDGYQDTLYAHTYRQYYRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQ  451

Query  1949  ECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFID  1770
              CM+TAQGR DRR   AIV+Q+ +I AEPAL  A+PP+K++LGRPWK+FS T+IM + I 
Sbjct  452   ACMITAQGRVDRRSVGAIVIQNGDIAAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIG  511

Query  1769  DIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1590
               + PEGWS W GT  LDT +YAEY+NRGPG+    RV+WKG +  +SP++A+ +T G  
Sbjct  512   GFIAPEGWSPWAGTFALDTLYYAEYKNRGPGSDVKNRVQWKGIQ-TLSPQMAESWTGGKI  570

Query  1589  LMADEQWLGRAQIPFSPGFLQ  1527
                DE W+  + +P+ P  +Q
Sbjct  571   YGGDE-WIRISGVPYVPTMMQ  590



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/568 (53%), Positives = 400/568 (70%), Gaps = 21/568 (4%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             NKKV + G+ASI +VACVVAA V++ +  E++  G +++T++KSV+ +C PT YK+TCE+
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTQKDETSSTG-QVTTSTKSVEAMCQPTPYKQTCEK  61

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             +L+ AK+  DPK+ IK+AF  TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I
Sbjct  62    TLSSAKNVTDPKDFIKVAFEATVTDIKNAIMNTDLIMKAASDPKTKDALHACEELFDLAI  121

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +DL+ S  K+E+FD+  IK+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T
Sbjct  122   EDLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMAKLLNT  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELS NGLAM+  F E++           R+LLT +            FV+A+ R+LL 
Sbjct  182   TRELSINGLAMVNSFGEMITQT----TGLSRKLLTTDESS---------FVEASNRKLLQ  228

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                A  K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E V+V + M  +
Sbjct  229   ISNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVDVEKGMTNV  286

Query  2315  VFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
             VF+GEG TKT+ITG+++ K+ GIG T+HT TV + G+GF+AR+IGFEN+AGA K QAVAL
Sbjct  287   VFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENTAGAVKEQAVAL  346

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             RV+AD  + +NC ID YQDTLY HS RQFYRDC I+GT+DF+FG+A  VFQNCK+IVRKP
Sbjct  347   RVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKP  406

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
                Q CMVTAQGR       A+V+Q+CEI AEP   A  PP K FLGRPWKE+SRT+IM 
Sbjct  407   GDGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQ  466

Query  1781  TFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQ  1608
             ++ID  + P GW+ W  T + + TCWYAEYQNRGPGAS DKR+  W+GY++ IS +VA  
Sbjct  467   SYIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANS  526

Query  1607  FTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             FT G F+   D  +L +A IP+  G ++
Sbjct  527   FTAGLFINPTDSSFLPKADIPYEAGMMK  554



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/575 (50%), Positives = 394/575 (69%), Gaps = 12/575 (2%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRS---GESADGGGEISTASKSVKEICAPT  3060
             G   + KK+A+  V+S+FLVA V+A TV V  S   G S    G+ +T++K+++ IC PT
Sbjct  3     GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSWSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  3059  DYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKETC++SL  A  ++ +PKELIK  F+V ++ + + I  S  L+E  KDP  + AL+ 
Sbjct  63    DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +I DL  SF K+  FD++ I  Y  DLK+WLS A+T ++TC+D F+NTTGD G
Sbjct  123   CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE---FP  2532
             EKMK LL +  EL+SNGLAM++  T +L S  +     +RRLL A   G  ++      P
Sbjct  183   EKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVK--QSQRRLLAAGAGGGTKKNTPKVIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAGVY  2355
              ++D  T  +    P S+K D+ VAKDGSGQ KS+ EA++ +P  N D+T VI++K GVY
Sbjct  241   VWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFENS
Sbjct  301   NEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENS  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A VV
Sbjct  361   AGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K +LGRP
Sbjct  421   FQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRP  480

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+
Sbjct  481   WKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK  540

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  541   -LTPEHAVDFTAGR-LMEGDKWIKPSGVPYVAGMV  573



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/568 (53%), Positives = 398/568 (70%), Gaps = 21/568 (4%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             NKKV + G+ASI +VACVVAA V++ ++ E++  G +++T++KSVK +C PT YK+TCE+
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTKNDETSSSG-QVTTSTKSVKAMCQPTPYKQTCEK  61

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             +L+ AK+  +PK+ IK+AF  TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I
Sbjct  62    TLSSAKNASEPKDFIKVAFEATVTDIRNAIMNTDLIMQAASDPKTKDALHACEELFDLAI  121

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +DL+ S  K+E+FD+  IK+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T
Sbjct  122   EDLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMVKLLNT  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELS NGLAM+  F E++           R+LLT +            FV+A+ R+LL 
Sbjct  182   TRELSINGLAMVNSFGEMITQT----TGLSRKLLTTDESS---------FVEASNRKLLQ  228

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                A  K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E VEV + M  +
Sbjct  229   ISNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVEVEKGMTNV  286

Query  2315  VFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
             VF+GEG TKT+ITG++S K  GIG T+HT TV + G+GF+AR+IGFEN+AG A+ QAVAL
Sbjct  287   VFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPAQEQAVAL  346

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             RV+AD  + +NC ID YQDTLY HS RQFYRDC ISGT+DF+FG+A  VFQNCK+IVR+P
Sbjct  347   RVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLIVRRP  406

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
                Q CMVTAQGR       A V+Q+CEI AEP   AA P  K FLGRPWKE+SRT+IM 
Sbjct  407   GDGQNCMVTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRTIIMQ  466

Query  1781  TFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQ  1608
             +FID  + P GW+ W  T + + TCWYAEYQNRG GAS DKRV  W+GY+R IS +VA  
Sbjct  467   SFIDGFIDPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGDVANS  526

Query  1607  FTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             FT G F+   D  +L +A IP+  G ++
Sbjct  527   FTAGVFINPTDNSFLPKADIPYEAGMMK  554



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/575 (50%), Positives = 394/575 (69%), Gaps = 12/575 (2%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRS---GESADGGGEISTASKSVKEICAPT  3060
             G   + KK+A+  V+S+FLVA V+A TV V  S   G S    G+ +T++K+++ IC PT
Sbjct  3     GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  3059  DYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKETC++SL  A  ++ +PKELIK  F+V ++ + + I  S  L+E  KDP  + AL+ 
Sbjct  63    DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +I DL  SF K+  FD++ I  Y  DLK+WLS A+T ++TC+D F+NTTGD G
Sbjct  123   CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE---FP  2532
             EKMK LL +  EL+SNGLAM++  T +L S  +     +RRLL A   G+ ++      P
Sbjct  183   EKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVK--QSQRRLLAAGAGGDTKKNTPKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAGVY  2355
              ++D     +    P S+K D+ VAKDGSGQ KS+ EA++ +P  N D+T VI++K GVY
Sbjct  241   VWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFENS
Sbjct  301   NEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENS  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A VV
Sbjct  361   AGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K +LGRP
Sbjct  421   FQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRP  480

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+
Sbjct  481   WKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK  540

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  541   -LTPEHAVDFTAGR-LMEGDRWIKPSGVPYVAGMV  573



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/568 (49%), Positives = 392/568 (69%), Gaps = 18/568 (3%)
 Frame = -1

Query  3206  VAVTGVASIFLVACVVAATVSVGRSGESADGGG--------EISTASKSVKEICAPTDYK  3051
             +A+  V+S+ LVA VVA TV +  +     G G        EIS+++K+++ IC PTDYK
Sbjct  17    IAIISVSSLILVAMVVAVTVGINNAPYEEHGEGDQGSKTTPEISSSTKAIQAICQPTDYK  76

Query  3050  ETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             ETCE+SL A A +T DPKEL+K+ F++   ++ +AI  S  L+E  KDPRT+ AL  C+E
Sbjct  77    ETCEKSLMAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTTLQELSKDPRTNQALQNCRE  136

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL  +IDDL  SF+++  F M+ + E+  DLK+WLSGA+T ++TC+D FENTTGD G +M
Sbjct  137   LLEYAIDDLNESFERIGTFQMSKLDEFVADLKIWLSGALTYEQTCLDGFENTTGDAGTRM  196

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             +  LK+A E+++NGL ++   + +L SL+IPG+   RRLL  +        E P ++   
Sbjct  197   QEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMT-GRRLLEDDDH------EMPSWISDG  249

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              RRL+    A +K D++VA+DGSG+YK++  AL  VP K+++T VI++KAG+Y E V +P
Sbjct  250   KRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKEIVVIP  309

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + M  +   G+GPTKT +TGS +  DGI T+ TAT +  G  F AR++GFEN+AG+AKHQ
Sbjct  310   KHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAGSAKHQ  369

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV +D +IF+NC ID YQDTLY H++RQFYRDCTISGT+DF+FGNA   FQNCK++
Sbjct  370   AVALRVQSDRSIFYNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLV  429

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKPM NQ+C+VTA GR +R+   A++ Q C  + +PA       NK +LGRPWK++SRT
Sbjct  430   VRKPMDNQQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRT  489

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +I+ + IDDI+ PEGW  W G   L+T +YAE QN+GPGA   KRVKW+G K +I+P+ A
Sbjct  490   IIIGSQIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGPGAVETKRVKWRGIK-HITPQHA  548

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               FTP  F+  D  W+    IP+S G +
Sbjct  549   ADFTPRRFIDGDA-WIPAKGIPYSSGMM  575



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/525 (53%), Positives = 377/525 (72%), Gaps = 7/525 (1%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLK  2925
             ST+ KS++ IC PTDY+ETC +SL+ A  ++ DPK+LI+  F+V +  +  AI  S ++K
Sbjct  59    STSMKSIQSICEPTDYRETCVKSLSAAGGNSTDPKDLIRTGFQVAINQVKAAIENSTVVK  118

Query  2924  EADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQE  2745
             +  KDPR+  AL+TC+ LL  SIDDL+ SF+++  FD++++ +Y  DL VWLSGAIT QE
Sbjct  119   DLAKDPRSKQALETCQHLLEYSIDDLQSSFERLGAFDVSNLDKYMADLHVWLSGAITFQE  178

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             +C+D FENTTG   +KMK +L+ + EL+SNGLAM+T  + LL SL IP V+  RRLLT E
Sbjct  179   SCLDGFENTTGAAAKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVS--RRLLTEE  236

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
               G  +   FP +VD   R+LL   P  IK D+VVA+DGSG+YK++ EAL  VP KN++T
Sbjct  237   QDGIPE---FPSWVDEGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKT  293

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI+IK GVY E+V V +K   ++ +G+GPTKT ITGS +  DG+ T +TAT    G  F
Sbjct  294   FVIYIKEGVYKEKVLVDKKTTNVMIIGDGPTKTVITGSLNYVDGVQTCNTATFTAIGSYF  353

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             IA++I FENSAGA KHQAVALRV +DM++ +NCH+DA+QDTLY H++RQFYRDCTISGT+
Sbjct  354   IAKDIKFENSAGAEKHQAVALRVQSDMSVIYNCHMDAFQDTLYAHAHRQFYRDCTISGTI  413

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG+A  VFQNC+M V+KP+ NQ+C+VTA GR +RR A+AIVLQ+C I A+PA     
Sbjct  414   DFIFGDALAVFQNCQMFVKKPLENQQCIVTASGRSERRSASAIVLQNCTISADPAYYPLR  473

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
               NK +LGRPWK++SRT+IM + IDD++ P+GW  W G   L+TC+YAEY NRG G++T 
Sbjct  474   NINKAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWMGNFALNTCFYAEYGNRGAGSATT  533

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              R KW+G K   +  +   FTP  F   D+ W+    +P+SP  +
Sbjct  534   GRAKWRGIKSMTAQHIV-DFTPKAFFKGDDAWITATGVPYSPKLM  577



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 371/529 (70%), Gaps = 18/529 (3%)
 Frame = -1

Query  3110  GEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G IS  S K+V+ +CAPTDYK+TCE+SL+ A +T DPKELIK AF  T +NI D I  S 
Sbjct  34    GSISAGSTKAVQNVCAPTDYKDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSP  92

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             L KEA  D  T  AL  C+E+L  +IDDLKRSF KV  FD +   EY  DLK WLS  IT
Sbjct  93    LFKEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDASKANEYLEDLKTWLSAVIT  152

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               ETCIDAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G    R+LL
Sbjct  153   NHETCIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSTASRKLL  211

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E            F+    RRL+   P     + VVA+DGSGQ+K++  A+  VP KN
Sbjct  212   SEEEADL--------FISIKQRRLMGLQP-----NAVVAQDGSGQFKTISAAIATVPQKN  258

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++  VI +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  
Sbjct  259   NQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNA  318

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F A++IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YRDC+IS
Sbjct  319   DEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSIS  378

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL 
Sbjct  379   GTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALL  438

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
              A PP KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+
Sbjct  439   QAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGS  498

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              T  RV+W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  499   DTKNRVQWPGIQ-HFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/581 (50%), Positives = 396/581 (68%), Gaps = 36/581 (6%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTAS-KSVKEICAPTDYKETCER  3036
             KK+A+  ++S+ LVA V+                G+I T S K+ + +C   DYK TCE+
Sbjct  6     KKIAMASLSSVLLVAMVLPLAT------------GDIPTISNKAAQALCTSVDYKITCEK  53

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             SL+ A  ++ P+ELIK+AF   + +I +AI  S L K+A  D RT  AL+ C+E+L  SI
Sbjct  54    SLSDAHSSN-PQELIKVAFNHAITDIQEAIKNSTLYKQAATDHRTKGALEVCEEVLDTSI  112

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             DDL+RSF +V N D+  +K+Y  D+KVWLSGAIT  ETC+DAF+NTTGDTGEKMK+LL +
Sbjct  113   DDLRRSFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKMKNLLHS  172

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE---------TKGeeqeeEF----  2535
             +  + SNGLAM+   + +  SL + G     RLL  E         T GE+ +  F    
Sbjct  173   SGMILSNGLAMVGDISSIFSSLSLGGFT-SGRLLEEEGSLAYGVDQTDGEDLKTAFDGKV  231

Query  2534  ------PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
                   P FVDA  RR++T +  ++K +IVVA+DGSGQ+K++  A+ ++P K D   VI 
Sbjct  232   TDAAGPPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPKKGDGPFVIH  291

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             +KAG Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA + + GDGFIA++
Sbjct  292   VKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVLGVNGDGFIAKD  351

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IG EN+AG  KHQAVA+RVS D +IF+N H++ +QDTLY H+YRQ+YRDCTI+GT+DFIF
Sbjct  352   IGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYAHAYRQYYRDCTITGTIDFIF  411

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C ILAEPA  +  PP K
Sbjct  412   GDAAAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAEPAFLSTTPPLK  471

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWK+FSRT+IM T ID  + PEGW+ WQG   LDT +Y E++NRGPG+   +RV+
Sbjct  472   AYLGRPWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGEFKNRGPGSDMSRRVR  531

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             WKG +  I+P +A  FTPG     DE W+ ++ +P+  G +
Sbjct  532   WKGIQ-TITPAIADSFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/568 (53%), Positives = 400/568 (70%), Gaps = 21/568 (4%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             NKKV + G+ASI +VACVVAA V++ ++ E++  G +++T++KSV+ +C PT YK+TCE+
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTKNDETSSSG-QVTTSTKSVESMCQPTPYKQTCEK  61

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             +L+ AK+  DPK+ IK+AF  TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I
Sbjct  62    TLSSAKNASDPKDFIKVAFEATVTDIKNAIMNTDLIMQAASDPKTKDALHACEELFDLAI  121

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +DL+ S  K+++FD++ IK+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T
Sbjct  122   EDLRTSVSKLDSFDLSKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMVKLLNT  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELS NGLAM+  F E++           R+LLT   +          F++A+ R+LL 
Sbjct  182   TRELSINGLAMVNSFGEMITQT----TGLSRKLLTTTEESS--------FIEASNRKLLQ  229

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                +S K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E VEV + M  +
Sbjct  230   I--SSAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKEYVEVEKGMTNV  287

Query  2315  VFVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
             VF+GEG TKT+ITG++  K  GIG T+HT TV + G+GF+AR+IGFEN+AG    QAVAL
Sbjct  288   VFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPTLEQAVAL  347

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             RV+AD  + +NC ID YQDTLY HS RQFYRDC ISGT+DF+FG+A  VFQNCK+IVRKP
Sbjct  348   RVNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLIVRKP  407

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
             + +Q CMVTAQGR       AIV+Q+CEI A+P   AA P    +LGRPWKE+SRT+IM 
Sbjct  408   LDSQNCMVTAQGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYLGRPWKEYSRTIIMQ  466

Query  1781  TFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQ  1608
             +FID  + P GWS W  T + L TCWYAEYQNRGPGAS DKRV  W+GY+R IS +VA  
Sbjct  467   SFIDGFIDPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGDVANS  526

Query  1607  FTPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             FT G F+  +   +L +A IP+  G ++
Sbjct  527   FTAGQFINPSGSSFLPKADIPYEAGMMK  554



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 371/529 (70%), Gaps = 18/529 (3%)
 Frame = -1

Query  3110  GEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G IS  S K+V+ ICAPTDY++TCE+SL+ A +T DPKELIK AF  T +NI D I  S 
Sbjct  34    GSISAGSTKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSP  92

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             L KEA  D  T  AL  C+E+L  +IDDLKRSF KV  FD     EY  DLK WLS  IT
Sbjct  93    LFKEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVIT  152

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               ETCIDAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +  R+LL
Sbjct  153   NHETCIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSSASRKLL  211

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E            F+    R L+   P     + VVA+DGSGQ+K++  A+ +VP KN
Sbjct  212   SEEEADL--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKN  258

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++  VI +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ TYHTATV++  
Sbjct  259   NQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVSVNA  318

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F A++IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YRDC+IS
Sbjct  319   DEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSIS  378

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL 
Sbjct  379   GTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALL  438

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
              A PP KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+
Sbjct  439   QAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGS  498

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              T  RV+W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  499   DTKNRVQWPGIQ-HFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/570 (52%), Positives = 390/570 (68%), Gaps = 26/570 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVS-VGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             KK+ + G+ASI LVACVV A V+   ++ +S   GGEIS+++KSV+ +C PT YKETC +
Sbjct  7     KKIVIAGIASILLVACVVGAAVTFTKKNDDSTSNGGEISSSTKSVQAMCQPTQYKETCAK  66

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             SL  AK+T +PKELIK AF  T+  IT++I  S   KEA  DPRT +AL  C E+L  SI
Sbjct  67    SLGSAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFKEAANDPRTKNALKVCDEVLDRSI  126

Query  2855  DDLKRSFQKVENFDMAH-IKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             +++KRSF K+++ D+   IKEY  D++ WLS A+T +ETCIDAF NTTGDTGEKMK++LK
Sbjct  127   EEIKRSFSKIDSNDLDKLIKEYIYDVRSWLSSAVTLEETCIDAFANTTGDTGEKMKNILK  186

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             TA+ELSS  L +++ F E +  L+  G+   RRLL AE               A  RRLL
Sbjct  187   TASELSSVALDIVSSFEEQMVGLQGLGIT-NRRLLVAE---------------AGNRRLL  230

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 A++K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VIFIKAG+YNE +EV   M  
Sbjct  231   QI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENIEVANTMTN  288

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +VF+GEG  KT+IT +++  DG+  + TATV+I G GF+A++I FENSAG  K +AVALR
Sbjct  289   VVFIGEGSNKTKITSNKNYLDGLPIFQTATVSISGQGFVAKDIAFENSAGPLKKEAVALR  348

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP-  1962
             VSA+MT F NC ID YQ TL TH  RQFYRDCTISGT+DFIFG+A  V QNCK+I RKP 
Sbjct  349   VSAEMTAFQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVLQNCKIIARKPE  408

Query  1961  -MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLI  1788
              M  Q   + AQGR +  G   I++Q+C I AEPAL A NPP NK FLGRP K +SRT++
Sbjct  409   EMQTQAITIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRNKAFLGRPAKMYSRTIV  468

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + ID  + PEGW+ + GT  L+T ++ EYQNRGPGA+TD+RV WK Y +N   +V  +
Sbjct  469   MQSQIDGFIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYMKNPPQDVIAK  528

Query  1607  FTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             F PG  L   +    W+ +  +P+ P  ++
Sbjct  529   FAPGVVLKGGDNTDGWVTKTGVPYEPAMMK  558



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/572 (51%), Positives = 396/572 (69%), Gaps = 6/572 (1%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRS-GESADG-GGEISTASKSVKEICAPT  3060
             M S  + KK+A+  V+S+ LV  VVA    V  S G+S  G   E+S + K+++ +C P 
Sbjct  1     MASEGKKKKLAIVAVSSLILVVAVVAVVAGVTMSKGDSKQGETKEVSASMKAIEAMCQPA  60

Query  3059  DYKETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKE+C +SL  A  +  DPKELIK  F V ++ I++A  KS  LKE  KDPRTS AL  
Sbjct  61    DYKESCVKSLETAGPNVTDPKELIKAGFNVAMKKISEAAEKSVTLKELAKDPRTSQALQN  120

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +IDDL+ SF K+   DM+ + ++  DLK WL  +IT QETC+D FENTT D G
Sbjct  121   CKELMEYAIDDLQSSFDKLGGLDMSKVDDFLADLKTWLGASITYQETCLDGFENTTSDAG  180

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             EKM+  L    EL+SNGLAM+T  + +L +L +  ++  RRLL           EFP ++
Sbjct  181   EKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGNRRLLQDSEVQVLGHGEFPMWM  240

Query  2522  DAATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             D   RRLL      ++K D+VVAKDGSG+YK++ EAL+ +P ++++T V+++K GVY E+
Sbjct  241   DPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVYREQ  300

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             +   +KM ++  +G+GPTKTRI  + +  DG+ T+ TATVA+ G+ F+A++IGFEN AGA
Sbjct  301   IIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGVNTFKTATVAVLGEQFLAKDIGFENDAGA  360

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV +D ++F+NCH+D YQDTLYTH++RQFYRDCTISGT+DFIFG+A  +FQN
Sbjct  361   IKHQAVALRVQSDFSVFYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQN  420

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CKM+VRKP+ NQ+C+VTAQGRK+RR  +AI+LQ+C I A+ +        + FLGRPWKE
Sbjct  421   CKMLVRKPLDNQQCIVTAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKE  480

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM +FIDDI+ PEGW  W G   + TC+Y+E+ NRGPG+S   RVKWKG K  I+
Sbjct  481   YSRTIIMQSFIDDIIQPEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-TIT  539

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             P  A  FT G FL  +  WL +  +PFS G +
Sbjct  540   PAHAVDFTVGTFLRGN-TWLPKFGVPFSAGMV  570



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/559 (53%), Positives = 381/559 (68%), Gaps = 39/559 (7%)
 Frame = -1

Query  3149  VSVGRSGESADGG--------GEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKEL  2994
             V+VG SG +  GG        G +ST++K+V  IC PTDYKETCE SLAGA +T DPKEL
Sbjct  5     VTVGVSGRNKSGGDAAASSSNGGVSTSTKAVHAICTPTDYKETCESSLAGA-NTTDPKEL  63

Query  2993  IKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFD  2814
             IK+AF   V NI DAI  S L+K+A  D  T DALD C ++L +++DDL+R+  KV  FD
Sbjct  64    IKVAFNAAVNNIADAIKNSTLMKDAAADNSTKDALDVCNDVLESAVDDLRRAGDKVGEFD  123

Query  2813  MAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITH  2634
                + EY  DLKVWLS  IT QETCIDAFENTTGDT EKMK+LLKTA ELSSN LAM++ 
Sbjct  124   ATKMDEYVEDLKVWLSAVITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNSLAMVSD  183

Query  2633  FTELLQSLEIPG-----VNFKRRLLTAE-----TKGeeqeeEFPGFVDAATRRLLTTDPA  2484
              + +L  L++        +  RRL++ E     TKG                RLL  +P 
Sbjct  184   ISSILGQLQLGNLGGGGASSGRRLMSEEEEPYWTKG----------------RLLAANP-  226

Query  2483  SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVG  2304
              +K + VVA+DGSGQ+K++ EA+  +P KN++T +I+IKAG+Y E VE+P+K+NK+VF+G
Sbjct  227   -LKPNAVVAQDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGLYKEHVEIPKKVNKVVFIG  285

Query  2303  EGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADM  2124
             +GP KTRITGS+S   G+ T+ TATVA+ G+ F A+NI FEN+AGA  HQAVALRVSAD 
Sbjct  286   DGPFKTRITGSKSFAGGVKTFQTATVAVNGEEFTAKNIAFENTAGAEGHQAVALRVSADK  345

Query  2123  TIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQEC  1944
              IF N  ID YQDTLY H+YRQ+YRDCTISGT+DFIFG++  +FQNC  IVRKPM NQ C
Sbjct  346   AIFQNVAIDGYQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDNQAC  405

Query  1943  MVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDI  1764
             MVTAQGR D R   AIV+Q+  I AEPA  +  P    +LGRPWKE SRT+IM + ID  
Sbjct  406   MVTAQGRVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGF  465

Query  1763  VVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM  1584
             + P+GWS W G   LDT +Y EYQNRG G+    RV WKG  ++++ + A+++T G    
Sbjct  466   ISPKGWSPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGI-QHMTQQKAEEWTGGAAFR  524

Query  1583  ADEQWLGRAQIPFSPGFLQ  1527
              DE W+  + +P+ P  +Q
Sbjct  525   GDE-WITSSGVPYVPTLMQ  542



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/565 (50%), Positives = 383/565 (68%), Gaps = 13/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ K+  +  ++S+ L++ VVA T+ V  +     G GEI+T+ K++K++CAPTDYKETC
Sbjct  10    KRKKRYVIISISSVLLISMVVAVTIGVSVNKSDNGGEGEITTSVKAIKDVCAPTDYKETC  69

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   AK+T DP EL+K AF  T++ I+D   KS+ + E  KDPRT  ALD CKEL+ 
Sbjct  70    EDTLRKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRTKMALDQCKELMD  129

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L +SF+++  F+   + E    L++WLS  I+ ++TC+D F+ T G+ GE +K  
Sbjct  130   YAIGELSKSFEELGRFEFHKVDEALIKLRIWLSATISHEQTCLDGFQGTQGNAGETIKKA  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ NGLAM++  +  L  ++IP +N  RRLL+ E         FP ++D   RR
Sbjct  190   LKTAVQLTHNGLAMVSEMSNYLGQMQIPEMN-SRRLLSQE---------FPSWMDGRARR  239

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IKAG+Y E V+V R M
Sbjct  240   LLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTFVVHIKAGIYKEYVQVNRSM  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +VF+G+GP KT I+GS+S KDGI TY TATVAI GD FIA+NIGFEN+AGA KHQAVA
Sbjct  300   THLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIGFENTAGAIKHQAVA  359

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRK
Sbjct  360   IRVLSDESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRK  419

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K +LGRPWKE+SRT+IM
Sbjct  420   PLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIM  479

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D + PEGW  W G   L+T +Y+E QN GPGA   KRV W G K+ +S E    F
Sbjct  480   NTFIPDFIPPEGWQPWLGDFGLNTLFYSEVQNTGPGAPITKRVTWPGIKK-LSEEEILTF  538

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  D  W+    +P+ PG  
Sbjct  539   TPAQYIQGD-AWIPGKGVPYIPGLF  562



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/528 (54%), Positives = 370/528 (70%), Gaps = 15/528 (3%)
 Frame = -1

Query  3110  GEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G +S  S K+V+ ICAPTDYKETCE SL+ A +T DPKEL+K AF  T +NI + I  S 
Sbjct  33    GSVSAGSTKAVQSICAPTDYKETCESSLSHA-NTTDPKELVKAAFEFTEKNIGEVIKNSS  91

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             L +EA KD  T  AL+ C+E+L  +IDDLKRSF     FD     EY  DLK WLS  IT
Sbjct  92    LFQEAAKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVIT  151

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               ETCIDAFENTTGDTGEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I G++  R+LL
Sbjct  152   NHETCIDAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLS-SRKLL  210

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E            F+    RRLL    +S+K + VVA DGSGQ+ ++  A+ +VP KN
Sbjct  211   SEEEGAL--------FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKN  260

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T VI++KAG+Y E V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  
Sbjct  261   NQTFVIYVKAGLYKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSA  320

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A++IGFEN+AG   HQAVALRVS D  +F N HID YQDTLY H+YRQ+YRDC+IS
Sbjct  321   DEFMAKDIGFENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSIS  380

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL 
Sbjct  381   GTIDFIFGDALALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALL  440

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
              A PP KV+LGRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+
Sbjct  441   QATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGS  500

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                 RVKW G + + + ++A+ +T G     DE W+  +  P+ P  +
Sbjct  501   DMKNRVKWPGIQ-HFTQQMAESWTGGRIYGGDE-WIRISGTPYVPTMM  546



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/569 (49%), Positives = 394/569 (69%), Gaps = 19/569 (3%)
 Frame = -1

Query  3206  VAVTGVASIFLVACVVAATVSVGRSGESADGGG---------EISTASKSVKEICAPTDY  3054
             +A+  V+S+ LVA VVA TV V  +    + G          EI++++K+++ IC PTDY
Sbjct  17    IAIISVSSLILVAMVVAVTVGVNNAPHGEEHGDDNHGSETTPEITSSTKAIQAICQPTDY  76

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             KETCE+SL A A +T DPKEL+K+ F++   ++ +AI  S  LKE  KDPRT+ AL  C+
Sbjct  77    KETCEKSLEAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTTLKELAKDPRTNQALQNCR  136

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL  +IDDL +SF+++  F M+ + ++  DLK+WLSGA+T ++TC+D FENTTGD G +
Sbjct  137   ELLEYAIDDLNQSFERIGTFQMSKLDDFVADLKIWLSGALTYEQTCLDGFENTTGDAGVR  196

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             M+  LK+A ++++NGL ++   + +L SL++PG++  RRLL  + +      E P +V  
Sbjct  197   MQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMS-GRRLLEDDDR------EMPSWVSD  249

Query  2516  ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
               RRL+    A++K D+VVA+DGSG+YK++  AL  VP K+++T VI +KAG+Y E V +
Sbjct  250   GKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIHVKAGIYKEIVVI  309

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
             P+ M  +   G+GPTKT +TGS +  DGI T+ TAT +  G  F AR++GFEN+AGAAKH
Sbjct  310   PKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARDMGFENTAGAAKH  369

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRV +D +IF NC ID YQDTLY H++RQFYRDCTISGT+DF+FGNA   FQNCK+
Sbjct  370   QAVALRVQSDRSIFFNCQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKL  429

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ+C+VTA GR +R+   A++ QSC  + +PA       NK +LGRPWKE+SR
Sbjct  430   VVRKPLDNQQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSR  489

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+I+ + IDDI+ PEGW  W G   L+T +YAE QN+G GA   KRVKW+G K +I+P+ 
Sbjct  490   TIIIGSTIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGAGADESKRVKWRGIK-HITPQH  548

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A  FTP  F+  D  W+    IP+S G +
Sbjct  549   AADFTPRRFIDGDA-WIPAKGIPYSSGMM  576



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/528 (54%), Positives = 369/528 (70%), Gaps = 15/528 (3%)
 Frame = -1

Query  3110  GEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G +S  S K+V+ ICAPTDYKETCE SL+ A +T DPKEL+K AF  T +NI + I  S 
Sbjct  33    GSVSAGSTKAVQSICAPTDYKETCESSLSDA-NTTDPKELVKAAFEFTEKNIGEVIKNSS  91

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             L +EA KD  T  AL+ C+E+L  +IDDLKRSF     FD     EY  DLK WLS  IT
Sbjct  92    LFQEAAKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVIT  151

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               ETCIDAFENTTGDTGEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I G++  R+LL
Sbjct  152   NHETCIDAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLS-SRKLL  210

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E            F+    RRLL    +S+K + VVA DGSGQ+ ++  A+ +VP KN
Sbjct  211   SEEEGAL--------FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKN  260

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T VI++KAG+Y E V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  
Sbjct  261   NQTFVIYVKAGLYKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSA  320

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A++IGFEN+AG   HQAVALRVS D  +F N HID YQDTLY H+YRQ+YRDC+IS
Sbjct  321   DEFMAKDIGFENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSIS  380

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL 
Sbjct  381   GTIDFIFGDALALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALL  440

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
              A PP KV+LGRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+
Sbjct  441   QATPPVKVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGS  500

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                 RVKW G + + + ++A+ +T G     DE W+     P+ P  +
Sbjct  501   DMKNRVKWPGIQ-HFTQQMAESWTGGRIYGGDE-WIRITGTPYVPTMM  546



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/520 (54%), Positives = 365/520 (70%), Gaps = 8/520 (2%)
 Frame = -1

Query  3092  SKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADK  2913
             +KSV+ IC+PTDYK+TCE SLAGA  TD PK LIKLAF+ TV+ I  AI  S L +EA  
Sbjct  49    TKSVQAICSPTDYKQTCEESLAGANSTD-PKYLIKLAFQNTVKGIRSAILNSTLYREAAA  107

Query  2912  DPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCID  2733
             DP T  AL  C+E+L NS+DDL+RSF +VE FD+  + EY +D+K WLSGAI  +E CID
Sbjct  108   DPNTKGALQVCEEVLDNSVDDLQRSFDQVEAFDVNRMDEYIDDIKTWLSGAIANKEACID  167

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe  2553
             A   T+GDT EKMK LL T +E+ SNGLA++T F+ +  SL++     +RRL+     GE
Sbjct  168   AVNGTSGDTAEKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLM-----GE  222

Query  2552  eqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
              +E    GFV +A RRLL  +  +IK ++ VA+DGSGQ+K++  AL  +P K+++T VI 
Sbjct  223   GEENPDDGFVQSARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIH  282

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             +KAGVY E V VP+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+A++
Sbjct  283   VKAGVYKETVIVPKKVNNVVIYGDGPEKTRVVNNKNYADGVQTFHTATLAVNSDGFMAKD  342

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             I FENSAG  KHQAVA+RVS D  +F+N  +D YQDTLY H YRQFYR+CTISGT+DF+F
Sbjct  343   IAFENSAGPTKHQAVAVRVSGDKAVFYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVF  402

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQ C+ IVRKP  NQ CMVTAQGRKD R     V+Q+ EI+ E    A  P   
Sbjct  403   GDATAVFQKCRFIVRKPDINQNCMVTAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKID  462

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRTLIM TFID  + P GWS W G   L+T +Y EYQN+GPGA T KRV 
Sbjct  463   AFLGRPWKEYSRTLIMNTFIDGFIDPAGWSPWMGNYGLNTLYYGEYQNKGPGADTSKRVT  522

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKG ++ I+PE+A  FT     + D  W+  + +P++PG 
Sbjct  523   WKGIQK-ITPEIALSFTAQKVYLND-GWVTNSSVPYTPGL  560



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 372/535 (70%), Gaps = 22/535 (4%)
 Frame = -1

Query  3131  GESADGGGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITD  2952
             GES   G     ++K+V+ +CAPTDYK+TCE+SL+ A +T DPKELIK AF  T +NI D
Sbjct  33    GESVSAG-----STKAVQSVCAPTDYKDTCEQSLSHA-NTTDPKELIKAAFEFTEKNIGD  86

Query  2951  AISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVW  2772
              I  S L KEA  D  T  AL  C+E+L  +IDDLKRSF KV  FD     EY  DLK W
Sbjct  87    VIKNSPLFKEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTW  146

Query  2771  LSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN  2592
             LS  IT  ETCIDAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +
Sbjct  147   LSAVITNHETCIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSS  205

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+ E            F+    R L+   P     + VVA+DGSGQ+K++  A+ 
Sbjct  206   ASRKLLSEEEADL--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIA  252

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
             +VP KN++  VI +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTA
Sbjct  253   SVPQKNNQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTA  312

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV++  D F A++IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+Y
Sbjct  313   TVSVNADEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYY  372

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             R C+ISGT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +
Sbjct  373   RACSISGTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFV  432

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
             AEPAL  A PP KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQ
Sbjct  433   AEPALLQAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQ  492

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             NRGPG+ T  RV+W G  ++ SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  493   NRGPGSDTKNRVQWPGI-QHFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/529 (53%), Positives = 370/529 (70%), Gaps = 18/529 (3%)
 Frame = -1

Query  3110  GEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G IS  S K+V+ ICAPTDY++TCE+SL+ A +T DPKELIK AF  T +NI D I  S 
Sbjct  34    GSISAGSTKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSP  92

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             L KEA  D  T  AL  C+E+L  +IDDLKRSF KV  FD     EY  DLK WLS  IT
Sbjct  93    LFKEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVIT  152

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               ETCIDAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +  R+LL
Sbjct  153   NHETCIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSSASRKLL  211

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E            F+    R L+   P     + VVA+DGSGQ+K++  A+ +VP KN
Sbjct  212   SEEEADL--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKN  258

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++  VI +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  
Sbjct  259   NQPFVIHVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNA  318

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F A++IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YR C+IS
Sbjct  319   DEFFAKDIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSIS  378

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL 
Sbjct  379   GTIDFIFGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALL  438

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
              A PP KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+
Sbjct  439   QAAPPVKVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGS  498

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              T  RV+W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  499   DTKNRVQWPGIQ-HFSPQMAESWTENVMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/587 (50%), Positives = 388/587 (66%), Gaps = 58/587 (10%)
 Frame = -1

Query  3125  SADGGGEISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDA  2949
             +++GGG IS  S K+V+ ICAPTDYKETCE SL+ A +T +PKELI+ AF  TV+NI D 
Sbjct  38    ASNGGGSISAGSTKAVQSICAPTDYKETCESSLSHA-NTTNPKELIQAAFDFTVKNIGDI  96

Query  2948  ISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWL  2769
             +  S L KEA  D  T  AL  C+E+L  +IDDL RSF KV   D A   EY  DLK WL
Sbjct  97    VKNSPLFKEAANDDDTKQALQICQEVLDVAIDDLTRSFDKVGELDAAKATEYVEDLKTWL  156

Query  2768  SGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF  2589
             S  +T QETC+DAFENTTGDTGEKMK+LLKTA E+SSNGLAM+   + L+ SL++ G   
Sbjct  157   SAVVTNQETCMDAFENTTGDTGEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQL-GNAA  215

Query  2588  KRRLLTAET--KGeeqeeEFPG-----FVDAATRRLLTT---------------------  2493
              R+LL +E    G +  +  PG      +D+  RRLL+                      
Sbjct  216   SRKLLLSEKIGYGGDPTDYAPGEEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGY  275

Query  2492  --DPA-----------------------SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
               DP                        S+K + VVA+DGSGQ+ ++  A+ +VP KN++
Sbjct  276   GGDPTDYAPGEEPHFNLDSNRRHLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQ  335

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
               VI +KAGVY E V++P+KMNKIV +G+GP KTRI+G ++  +G+ TYHTATVA+  D 
Sbjct  336   IFVIHVKAGVYKEYVQIPKKMNKIVLIGDGPLKTRISGRKNFAEGVKTYHTATVAVNADD  395

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F+A++IGFEN+AGA  HQAVALRVS D  +F+N HID YQDTLY H+YRQ+YRDC+ISGT
Sbjct  396   FLAKDIGFENTAGALGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGT  455

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG+A  +FQNCK +VRKP  NQ CM+TAQGR +R      V+Q+ +I+AEPAL  A
Sbjct  456   IDFIFGDALALFQNCKFVVRKPGPNQACMITAQGRVERHSLGVTVIQNGDIVAEPALLQA  515

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
             +PP+KV+LGRPWK  SRT+IM + I   + PEGW+ W GT  LDT +YAEYQNRGPG+  
Sbjct  516   SPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAPWAGTFALDTLYYAEYQNRGPGSDL  575

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
               RV WKG ++ +SP++A+ +T G     DE W+  + +P+ P  +Q
Sbjct  576   KARVTWKGIQK-LSPQMAESWTGGKLFGGDE-WIRGSGVPYVPTMMQ  620



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/571 (51%), Positives = 397/571 (70%), Gaps = 16/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG--------GGEISTASKSVKEICA  3066
             ++ +++A+ GV+S+ LVA VVA TV VG + +  DG          ++S + K+VK IC 
Sbjct  8     KRKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDGLNGSSHKSTSQVSASVKAVKAICQ  67

Query  3065  PTDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDAL  2889
             PTDY++TCE SL   A +T DPKELIK+AF++  + I +A  KS+LL+E  KDPRT  AL
Sbjct  68    PTDYRKTCEESLQKAAGNTTDPKELIKIAFKIAEKQINEASEKSKLLEELSKDPRTRGAL  127

Query  2888  DTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
              +CKEL++ S+ +LK+S  KV +FD++ +++   D+K WLS +IT QETC+D FENTT D
Sbjct  128   QSCKELMNMSVGELKQSLDKVTDFDLSELEKMMADVKTWLSASITYQETCLDGFENTTTD  187

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF-KRRLLTAETKGeeqeeEFP  2532
              G+KMK  +K   ELS+N L +++  +  + SLE    +F  RRLL  +       ++FP
Sbjct  188   AGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE----SFTHRRLLQDDLPVLGHGDQFP  243

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
              + D  TRRLL    + IK DIVVAKDGSG + ++ EAL+ VP K+ +  V+ IKAGVY 
Sbjct  244   TWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQ  303

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E +E+ + M  +V +G+G   TRI G+++  DGI T+HTATVA+ GD F+A+NIGFEN+A
Sbjct  304   EYLEISKGMINLVVIGDGKENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNA  363

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             GA KHQAVALRVSAD  IF+NC +D +QDTLYTH+ RQFYRDC+ISGT+DF+FG+A  VF
Sbjct  364   GAIKHQAVALRVSADYAIFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVF  423

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNCK +VRKP+ NQ+C+VTAQGRK RR  +A+++QS  I A P L       K +LGRPW
Sbjct  424   QNCKFLVRKPLENQQCIVTAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPW  483

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             KE+SRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S + RVKW G K  
Sbjct  484   KEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-T  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             I+ + A  FTPG FL  D  W+    IP++P
Sbjct  543   INRQHAMDFTPGRFLKGDS-WIKATGIPYTP  572



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/565 (50%), Positives = 381/565 (67%), Gaps = 13/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ K+  +  ++S+ L++ VVA T+ V  +     G  EI+T+ K++K++CAPTDYKETC
Sbjct  11    KRKKRYVIISISSVLLISMVVAVTIGVSVNKSDNAGDEEITTSVKAIKDVCAPTDYKETC  70

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   AKDT DP EL+K AF  T++ I+D   KS+ + E  KDPR   ALD CKEL+ 
Sbjct  71    EDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMD  130

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L +SF+++  F+   + E    L++WLS  I+ ++TC+D F+ T G+ GE +K  
Sbjct  131   YAIGELSKSFEELGKFEFHKVDEALVKLRIWLSATISHEQTCLDGFQGTQGNAGETIKKA  190

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+ E         FP ++DA  RR
Sbjct  191   LKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLSQE---------FPSWMDARARR  240

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IK G+Y E V+V R M
Sbjct  241   LLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTFVVHIKEGIYKEYVQVNRSM  300

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +VF+G+GP KT I+GS+S KDGI TY TATVAI GD FIA+NI FEN+AGA KHQAVA
Sbjct  301   THLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFIAKNIAFENTAGAIKHQAVA  360

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV AD +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRK
Sbjct  361   IRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRK  420

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K +LGRPWKE+SRT+IM
Sbjct  421   PLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIM  480

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D V PEGW  W G   L+T +Y+E QN GPGA+  KRV W G K+ +S E   +F
Sbjct  481   NTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIKK-LSDEEILKF  539

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  D  W+    +P+  G  
Sbjct  540   TPAQYIQGDA-WIPGKGVPYILGLF  563



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 388/573 (68%), Gaps = 16/573 (3%)
 Frame = -1

Query  3233  MGSPE-QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGG---GEISTASKSVKEICA  3066
             +G P  + KK A+ GV S  LVA V+A    +  SG+  DG     EI+T+SKSV+ IC 
Sbjct  6     VGDPTGKKKKYAIFGVTSFLLVAMVIAVAYGI-NSGDHQDGSNPSAEITTSSKSVQSICQ  64

Query  3065  PTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDAL  2889
             PTDY+E CE+SL   A +T DP +L++  F+VT++ +  A+  S  LKE  KDP    AL
Sbjct  65    PTDYREICEKSLRKAAGNTTDPHKLVQAGFQVTIDALQQALQNSSTLKEVAKDPMAKQAL  124

Query  2888  DTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
             D CKEL+ ++I DLK SF++V +FD++ + EY  +LK+WLS  IT Q+TC+D F+NTTG 
Sbjct  125   DNCKELMDDAIHDLKVSFEEVGHFDVSKMDEYLENLKIWLSATITYQQTCLDGFDNTTGP  184

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPG  2529
              G KMK +L  +++LSSNGLAMIT  + +L+ L + G+   RRLL   ++       FP 
Sbjct  185   AGAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLT-GRRLLKDNSE-------FPS  236

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             ++    RRLL   P ++K DIVVAKDGSGQYK++ EA+  +P   + T VI+IK G+Y E
Sbjct  237   WLSHEKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKE  296

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V + R +  I+ +G+G TKTRITG  +   G+ T  T+TV++ G+ FIA++IGFEN+AG
Sbjct  297   QVTISRSVTHIMMIGDGATKTRITGDLNYAAGVQTLQTSTVSVSGNHFIAKDIGFENTAG  356

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A  HQAVALRV +DM+IF+NC +D YQDTL+ H++RQFYRDCTI+GT+DFIFG+A  VFQ
Sbjct  357   AIGHQAVALRVQSDMSIFYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQ  416

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+P        NK +LGRPWK
Sbjct  417   NCKIVVRKPLENQNCVVTAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWK  476

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E+SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV WKG K+ +
Sbjct  477   EYSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-L  535

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             S + A  FT   F+  D  W+    + ++ G +
Sbjct  536   SAQDAAAFTVAKFIGGD-LWIPATGVSYASGMM  567



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/570 (49%), Positives = 385/570 (68%), Gaps = 20/570 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRS-GESAD----GGGEISTASKSVKEICAPTD  3057
             ++ K+  +  ++S+ L++ VVA TV V  +  ++AD    G GEI+ + K++KE+CAPTD
Sbjct  10    KKRKRYVIISISSVLLISMVVAVTVGVSMNKSDNADKKTGGNGEITASVKAIKEVCAPTD  69

Query  3056  YKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             YK+TCE +L   AK+T DP EL+K AF VT++ I +A  KS+ L E  KDPRT  ALD C
Sbjct  70    YKKTCEETLTKNAKNTTDPMELVKTAFDVTMKQIAEAAKKSQTLVELQKDPRTKMALDQC  129

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             +EL++ +ID+LK SF+++  F+   + E   +L++WLS AI+ + TC++ FE T G+ GE
Sbjct  130   RELMNYAIDELKSSFEELGKFEFHKLDEALINLRIWLSAAISHETTCLEGFEQTQGNAGE  189

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVD  2520
              MK  LKTA +L+ NGLAM++  +  +  L+IPG+N  RRLL+++         +P +V 
Sbjct  190   TMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLN-SRRLLSSD---------YPSWVG  239

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
               +R LL      +K DIVVA+DGSGQYK++ EAL  +P K + T V+ IKAG+Y E ++
Sbjct  240   PRSRHLLAA--TEVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKEYIQ  297

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             V R M  +VF+G+GP KT I+G +  KDGI T+ T TVAI GD FIA+NIGFEN+AGA K
Sbjct  298   VNRSMTNLVFIGDGPDKTIISGDKGFKDGITTFRTQTVAIIGDNFIAKNIGFENTAGAIK  357

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVA+RV +DM +FHNC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG++  VFQNC 
Sbjct  358   HQAVAVRVQSDMAVFHNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCT  417

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ C +TA GR+D R     V Q C I  EP   A    +K +LGRPWKE+S
Sbjct  418   LLVRKPLPNQACPITAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYS  477

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM TFI D V P+GW  W     L T +Y+E QN GPG+    RV W G K+  S +
Sbjct  478   RTIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIKKLTSKD  537

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +  QFTP  F+  D  W+    +P++PG L
Sbjct  538   I-DQFTPAKFIQGDS-WIPATGVPYTPGLL  565



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/570 (49%), Positives = 397/570 (70%), Gaps = 13/570 (2%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG----EISTASKSVKEICAPTDYK  3051
             + KK+A+ G +SIFLVA  +   V    S  S+D G     EIS++ K+++ IC PTDYK
Sbjct  12    KKKKLAIIGFSSIFLVA--MVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYK  69

Query  3050  ETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             + C  SL   A +T DPK+L++ AF   +E+++ A   S LL+E +KDPR S AL  C++
Sbjct  70    DACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCED  129

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L++ +IDDLK+SF +V +FD + +     D+K+WLS  IT QETC+D FENTTGD GEKM
Sbjct  130   LVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEKM  189

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG--eeqeeEFPGFVD  2520
             + +LKT+ ELSSNGLA++   + +L +L++   N  RRLL+ +        ++EFP +  
Sbjct  190   RQILKTSMELSSNGLAIVGEVSSILSNLQL--ANLNRRLLSDDPADPDNHIDDEFPYWSH  247

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
             +  R+LL  + + +K ++ VAKDGSG +K++ EA+R +P  +++T +++IK G+Y E+V+
Sbjct  248   SEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQ  307

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             + +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENSAGAAK
Sbjct  308   INKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENSAGAAK  367

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV +D +IF+NC +D YQDTLYTH+ RQFYRDCTISGT+DFIFG+A V+FQNC 
Sbjct  368   HQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCT  427

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
              +VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K +LGRPWKEFS
Sbjct  428   FVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFS  487

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW+G K  I P 
Sbjct  488   RTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPS  546

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  F PG FL  D +W+    +P++ G  
Sbjct  547   HAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/521 (53%), Positives = 367/521 (70%), Gaps = 13/521 (2%)
 Frame = -1

Query  3092  SKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADK  2913
             +K+V+ IC+PTDYK+TCE SLAGA +T DPKELIKLAF  TV+ +  AI  S L K+A  
Sbjct  48    TKAVQAICSPTDYKQTCEESLAGA-NTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAAA  106

Query  2912  DPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCID  2733
             DPRT  AL  C+E+L N IDDL+RSF +V +F++  + EY +D+K WLSGAI  +E CID
Sbjct  107   DPRTKGALKVCEEVLDNCIDDLQRSFDQVNDFNVNQMDEYIDDIKTWLSGAIANKEACID  166

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe  2553
             A +NTTGDT EKMK +L   +E+ SNGLA++T F+ +  SL++ G    RRL+  + + +
Sbjct  167   AVQNTTGDTAEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQL-GSFTSRRLMGEDEQQQ  225

Query  2552  eqeeEFPG---FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV  2382
                   PG   FV+ A R+LL  +  S+K +  VA+DGSG +K++  AL  +P K++ T 
Sbjct  226   ------PGIDSFVEFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATF  279

Query  2381  VIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFI  2202
             VI +KAGVY E V +P+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+
Sbjct  280   VIHVKAGVYKETVIIPKKVNNVVIYGDGPNKTRVVNNKNYADGVETFHTATLAVNSDGFM  339

Query  2201  ARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVD  2022
             A++I FENSAGA+KHQAVA+RVS D  IF+N  +D YQDTLY H YRQ YR+CTISGT+D
Sbjct  340   AKDIAFENSAGASKHQAVAVRVSGDKAIFYNVVMDGYQDTLYAHGYRQLYRNCTISGTID  399

Query  2021  FIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANP  1842
             FIFG+A  VFQ C+MIVRKP  NQ CMVTAQGRKD+R     V+Q  EI+ EP   A  P
Sbjct  400   FIFGDATAVFQKCRMIVRKPDINQNCMVTAQGRKDQRSIGITVIQDSEIVPEPGFTAVVP  459

Query  1841  PNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDK  1662
                 FLGRPWKE+SRT+IM T+ID  + P GWS W G   L+T +Y EYQNRGPG+ T K
Sbjct  460   KIDAFLGRPWKEYSRTIIMQTYIDGFIDPAGWSPWMGNYALNTLYYGEYQNRGPGSDTSK  519

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             RV WKG K+ I+PE+A+ FT     + D  W+  + +P++P
Sbjct  520   RVTWKGIKK-ITPELAQTFTAQKVFLND-GWVTNSSVPYTP  558



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/576 (51%), Positives = 392/576 (68%), Gaps = 19/576 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSV-----GRSGESADGGGEISTASKSVKEICAPTDY  3054
             + KK A+ GV+S+ LVA VVA TV V     G  G     GG ++T++K++K IC PTDY
Sbjct  7     KKKKFAIIGVSSVILVAMVVAVTVGVTAKNKGGGGHKNSDGGHVTTSTKAIKAICQPTDY  66

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             KETCERSL + A ++ +PK+LIK  F VT++ +   I  S  L+E  KD  T+ AL+ CK
Sbjct  67    KETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQALENCK  126

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL  +IDD+  SFQK+  FD++ I +Y  DLKVWLS AIT Q+TC+D F+NT GD GEK
Sbjct  127   ELLEYAIDDITTSFQKLGPFDISKIDDYAEDLKVWLSAAITYQQTCLDGFQNTKGDAGEK  186

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE---TKGeeqeeEFPGF  2526
             MKH L T  +L+SNGLAM+T  T +L SL +     +RRLL      +  +   +  P +
Sbjct  187   MKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKA--NRRRLLAGGGGGSNAKNAPKVIPTW  244

Query  2525  VDAATRRLL---TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAGV  2358
             ++   +R L   T  P SIK D VVAKDGSGQY+++ EA++ +P  N D+T VI++K GV
Sbjct  245   IN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEGV  302

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y+E V + + M  ++ +G+G TKT++TGS++   G+ T+ TATV + GD FIA++IG EN
Sbjct  303   YSEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDIGIEN  362

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAGA  HQAVALRV +D++IF+ C +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A V
Sbjct  363   SAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAV  422

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I  +P        NK +LGR
Sbjct  423   VFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGR  482

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G K
Sbjct  483   PWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSDMSKRVKWSGIK  542

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              N+  + A  FT G F+  D +W+  + +P+  G +
Sbjct  543   -NLGADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/572 (49%), Positives = 388/572 (68%), Gaps = 17/572 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSV-------GRSGESADGGGEISTASKSVKEICAPT  3060
             + KK AV GV+SI LVA VVA  V V       G S   +   G++ST++KS++ IC PT
Sbjct  16    RKKKFAVIGVSSIILVAMVVAVAVGVNDGKEKGGESSPLSGSSGQLSTSTKSIQAICQPT  75

Query  3059  DYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE SL   A +T DP +L++  F+V ++ +  AI  S  LKE  KDP    ALD 
Sbjct  76    DYKQTCEDSLNKAAGNTSDPHKLVQAGFQVAIDALKVAIENSTTLKEVAKDPMAKQALDN  135

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL++ +I DLK SFQ+V +FD++ + EY  +LK+WLS  IT Q+TC+D F+NTTG  G
Sbjct  136   CKELMNTAISDLKTSFQQVGDFDISKLDEYVANLKIWLSATITYQQTCLDGFDNTTGPAG  195

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             +KMK +L T+++L+SNGLAM+T  + +LQ L++ G+  ++ L             FP ++
Sbjct  196   QKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLAQGNDN-------FPSWL  248

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               A RRLL   PA+IK ++VVA+DGSGQYK++ EA++ +P   + T V++IK GVY E V
Sbjct  249   SPAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVV  308

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
                R +  I+ +G+GPTKT+ITG  S   G+  Y TATV++ G  F+A++IGFENSAGA 
Sbjct  309   TFSRSLTHIMLIGDGPTKTKITGDLSFAGGVQIYKTATVSVSGSHFMAKDIGFENSAGAT  368

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
              HQA+AL+V +DM++F+NC ID YQ+TL++H+YRQFYR+CTI+GT+DFI G+A  VFQNC
Sbjct  369   GHQAIALKVQSDMSVFYNCQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNC  428

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             KM+VRKP+ NQ C +TAQGR + R     VLQ+C I AE         +  FLGRPWK +
Sbjct  429   KMVVRKPLENQRCTITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPY  488

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT++M + IDDI+ P+GW+ W GT  +DTC  +EY NRGPGA+   RV WKG  + +SP
Sbjct  489   SRTIVMQSSIDDIIDPKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LSP  547

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + A+ FT G FL  D  W+    +P++ G ++
Sbjct  548   QDAEAFTAGKFLEGDS-WIAATGVPYTSGMMK  578



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/570 (49%), Positives = 389/570 (68%), Gaps = 15/570 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESAD--------GGGEISTASKSVKEICAP  3063
             + +++AV G++S  LVA VVA +V VG   +  +           ++S + K+VK IC P
Sbjct  9     RKRRIAVIGISSFLLVAMVVAVSVGVGLGNDGNEDLNDSNHKSTNQVSASMKAVKAICQP  68

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY++TCE +L   A +T DP+ELIK+AF++  +++ +A  KS++L+E  KDPRT  AL 
Sbjct  69    TDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHVNEASKKSKVLEELSKDPRTRGALQ  128

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
             +C+EL+  S+D+LK+S  KV +FD+  I++   D+K WLS +IT QETC+D F+NTT + 
Sbjct  129   SCRELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITYQETCLDGFQNTTTNA  188

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq-eeEFPG  2529
             G++MK  LK + ELS+N LA+++  +  + SLE  G   +RRLL  +       ++ FP 
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG---QRRLLQDDLPVLGHGDQIFPT  245

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             + D   RRLL    + IK DIVVAKDGSG + ++ +AL  VP K+ +T V++IKAG+Y E
Sbjct  246   WTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSSKTFVLYIKAGIYQE  305

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + GD F+A+NIGFEN+AG
Sbjct  306   YIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFENNAG  365

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRVSAD  +F+NC +D +QDT+YTH+ RQFYRDC+ISGT+DF+FG+A  VFQ
Sbjct  366   AIKHQAVALRVSADYALFYNCSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQ  425

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK ++RKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P L       K +LGRPWK
Sbjct  426   NCKFLIRKPLENQQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWK  485

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S   RVKW G K  I
Sbjct  486   EFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TI  544

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
               + A  FTPG F      W+    IP++P
Sbjct  545   DRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/572 (49%), Positives = 386/572 (67%), Gaps = 16/572 (3%)
 Frame = -1

Query  3230  GSPE-QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGG---GEISTASKSVKEICAP  3063
             G P  + KK A+ GVAS  LVA V+A    +  SG+  +G     EIST+SKSV+ IC P
Sbjct  7     GDPTGKKKKYAIFGVASFLLVAMVIAVAYGI-NSGDHQNGSNASAEISTSSKSVQAICQP  65

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+E C +SL+  A +T DP +L++  F+VT++ +  A+  S  LK+  KDP    ALD
Sbjct  66    TDYREICGKSLSKAAGNTTDPLKLVQAGFQVTIDALQQALQNSSTLKDVAKDPMAKQALD  125

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              CKEL+ ++I DLK SF++VE+FD+  + EY  +LK WLS  IT Q+TC+D F+NTTG  
Sbjct  126   NCKELMDDAIHDLKVSFEEVEHFDVNKMDEYLANLKTWLSATITYQQTCLDGFDNTTGPA  185

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             G KMK +L  +++LSSNGLA+IT  +  L+ L + G    RRLL   ++       FP +
Sbjct  186   GAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFT-GRRLLKDNSE-------FPSW  237

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             +    RRLL   P +IK DIVVAKDGSGQYK++ EA+  +P K + T VI+IK G+Y ++
Sbjct  238   LSHEKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQQ  297

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V + R ++ I+ +G+G TKT+ITG  +   G+ T+ T+TV++ G  FIA++IGFEN+AGA
Sbjct  298   VTISRSLSHIMMIGDGATKTKITGDLNYAAGVQTFKTSTVSVSGSHFIAKDIGFENTAGA  357

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
               HQAVALRV +DM+IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG+A  VFQN
Sbjct  358   IGHQAVALRVQSDMSIFYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQN  417

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CK++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+         NK +LGRPWKE
Sbjct  418   CKIVVRKPLENQNCIVTAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKE  477

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV WKG K+ +S
Sbjct  478   YSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LS  536

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + A  FT   F+  D  W+    I ++ G +
Sbjct  537   AQDADAFTVAKFIGGD-LWIPDTGISYASGMM  567



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/576 (48%), Positives = 401/576 (70%), Gaps = 18/576 (3%)
 Frame = -1

Query  3224  PEQNKKVAVTGVASIFLVACVVAATVSVG--------RSGESADGGGEISTASKSVKEIC  3069
             P + +++A+  V+S  LV  V+ A V+ G        ++ ++++   E+S + K+++ IC
Sbjct  7     PRRRRRIAIIVVSSFILV--VIGAAVTFGMYTASVSSQASKASEKTSEVSASIKAIEGIC  64

Query  3068  APTDYKETCERSL--AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
              PTDYKE C RSL  AGA +T DPKELIK +F+  +++I +A  KS +LKE +K PR   
Sbjct  65    QPTDYKEACVRSLREAGA-NTADPKELIKASFKAAMKHIAEAAKKSTVLKELEKTPRAQQ  123

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             AL  CK+L+  +I+DL+RSF K+   + + + +   DLKVWLS  +T Q+TC+D F+NTT
Sbjct  124   ALSNCKKLMGFAINDLERSFDKLGELEFSKLDDALADLKVWLSAVVTYQDTCLDGFQNTT  183

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEF  2535
             G+ G KM+  LK++ EL+SN LAM+   +  L  + +   NF R+LL+ +       ++F
Sbjct  184   GNAGHKMREALKSSEELTSNVLAMVDEISLALAKMNL--TNFNRKLLS-DDNVIGHGDDF  240

Query  2534  PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
               +  +  R+LL+   A +K ++VVAKDGSG+++++ EAL+ +P  + +T V+ IKAGVY
Sbjct  241   SMWATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTFVLHIKAGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
              E+V    KM  ++ VG+GPTKTRI+ +++  DG  T+ TATV++ GD FIAR+IGFENS
Sbjct  301   KEQVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFGDNFIARDIGFENS  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVAL V +DM IFHNCH+D YQDTLY HS RQFYRDCTI+GT+DF+ G+A  V
Sbjct  361   AGAIKHQAVALMVRSDMAIFHNCHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKM++RKP+ NQ+C+VTAQGR  RR A+A++LQ+C I A+P+          +LGRP
Sbjct  421   FQNCKMLIRKPLDNQQCIVTAQGRSKRREASALILQNCTITADPSYTPFKGQILSYLGRP  480

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK +SRT+IM ++IDDI+ P+GW  W G   L+TC+YAEY+NRGPGAST +RVKWKG K+
Sbjct  481   WKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIKK  540

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              I+P+ A +FT G F+  D +W+  A +P+  G L 
Sbjct  541   -ITPQHAVEFTAGRFMKGD-RWIRTAGVPYVAGMLN  574



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/570 (49%), Positives = 399/570 (70%), Gaps = 13/570 (2%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG----EISTASKSVKEICAPTDYK  3051
             + KK+A+ G +SIFLVA  +   V    S  S+D G     EIS++ K+++ IC PTDYK
Sbjct  12    KKKKLAIIGFSSIFLVA--MVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYK  69

Query  3050  ETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             + C  SL + A +T DPK+L++ AF   +E+++ A   S LL+E +KDPR S AL  C++
Sbjct  70    DACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCED  129

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L++ +IDDLK+SF +V +FD + +     D+K+WLS  IT QETC+D FENTTGD GEKM
Sbjct  130   LVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEKM  189

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG--eeqeeEFPGFVD  2520
             + +LKT+ ELSSNGLA++   + +L +L++  +N  RRLL+ +        ++EFP +  
Sbjct  190   RQILKTSMELSSNGLAIVGEVSSILSNLQLANLN--RRLLSDDPADPDNHIDDEFPYWSH  247

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
             +  R+LL  + + +K ++ VAKDGSG +K++ EA+R +P  +++T +++IK G+Y E+V+
Sbjct  248   SEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQ  307

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             + +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENSAGAAK
Sbjct  308   INKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENSAGAAK  367

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV +D +IF+NC +D YQDTLYTH+ RQFYRDCTISGT+DFIFG+A V+FQNC 
Sbjct  368   HQAVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCT  427

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
              +VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K +LGRPWKEFS
Sbjct  428   FVVRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFS  487

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW+G K  I P 
Sbjct  488   RTIIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPS  546

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  F PG FL  D +W+    +P++ G  
Sbjct  547   HAIDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/579 (49%), Positives = 389/579 (67%), Gaps = 19/579 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG----RSGESADGGGEISTASKSVKEICAPTDY  3054
             ++ +++A+ GV++I LVA VVAATVSVG       E A     IS++ K+V+ IC PTDY
Sbjct  8     QKKRRIAIIGVSTILLVAMVVAATVSVGFGKNVEAEDASKDSHISSSVKAVQTICEPTDY  67

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ CE SL A A +  DP+EL+K+AF +T+  I+D +SK++LL E + D RT +ALDTCK
Sbjct  68    RKECEESLTAQAGNITDPRELVKIAFNITITKISDGLSKTQLLHEVESDERTKEALDTCK  127

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L++ SID+ KRS +K  NFD+ ++      LKVWLSGAIT QETC+DAFENTT + GEK
Sbjct  128   QLMNLSIDEFKRSLEKFSNFDLNNLDRVLTSLKVWLSGAITYQETCLDAFENTTTNAGEK  187

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqee---EFPGF  2526
             MK +L+TA  +SSNGL++I   ++    ++  G    RRLL  + +         EFP +
Sbjct  188   MKEILQTAMHMSSNGLSIINELSKTFTEMKPAG----RRLLKDDGELHVVGRGDFEFPEW  243

Query  2525  VD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
             VD     R+LL      ++  +VVAKDG+G + ++ EAL+ VP KN    VI+IK G+YN
Sbjct  244   VDDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALKHVPKKNLRPFVIYIKEGIYN  303

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E VEV R M  +VF+G+G  K+RITG+++  DG+GTY TATVAI GD F+   IGFENSA
Sbjct  304   EYVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGVGTYRTATVAILGDFFVGIGIGFENSA  363

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYRDC I+GT+DF+FG++  V 
Sbjct  364   GPEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCVITGTIDFVFGDSVAVL  423

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNC  +VRKP+ NQ+C+VTAQGRK+R   + +++Q   I+++P        NK +L RPW
Sbjct  424   QNCTFVVRKPLENQQCIVTAQGRKERNQPSGLIIQGGSIVSDPKYFPVRFDNKAYLARPW  483

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             K FSRT+ M T+I D++ P+G+  WQ   G    +TC+YAEY NRGPG+   KRVKW+G 
Sbjct  484   KNFSRTIFMDTYIGDLITPDGYMPWQTIEGITGTETCYYAEYNNRGPGSDITKRVKWEGV  543

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             K  I+ E A  F P  F   D+ W+   ++P+ PG   P
Sbjct  544   K-TITSEGANTFLPTAFFHGDD-WIRVTRVPYYPGGAAP  580



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/571 (51%), Positives = 393/571 (69%), Gaps = 16/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRS--------GESADGGGEISTASKSVKEICA  3066
             ++ +++A+ GV+S+ LVA VVA TV VG +        G S     ++S + K+VK IC 
Sbjct  8     KRKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDDLNGSSHKSTSQVSASVKAVKAICQ  67

Query  3065  PTDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDAL  2889
             PTDY++TCE SL   A +T +PKELIK+AF++  + I +A  KS+LL+E  KD RT  AL
Sbjct  68    PTDYRKTCEESLQKAAGNTTNPKELIKIAFKIAEKQINEASEKSKLLEELSKDARTRGAL  127

Query  2888  DTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
              +CKEL++ S  +LK+S  KV +FD++ ++    D+K WLS +IT QETC+D FENTT D
Sbjct  128   QSCKELMNMSAGELKQSLNKVTDFDLSELETLMADVKTWLSASITYQETCLDGFENTTTD  187

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF-KRRLLTAETKGeeqeeEFP  2532
              G+KMK  +K   ELS+N L +++  +  + SLE    +F  RRLL  +       ++FP
Sbjct  188   AGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE----SFTHRRLLQDDLPVLGHGDQFP  243

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
              + D  TRRLL    + IK DIVVAKDGSG + ++ EAL+ VP K+ +  V+ IKAGVY 
Sbjct  244   TWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKKAFVLHIKAGVYQ  303

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E +E+ + M  +V +G+G   TRI G+++  DGI T+HTATVA+ GD F+A+NIGFEN+A
Sbjct  304   EYLEISKGMINLVVIGDGRENTRIIGNKNFVDGINTFHTATVAVLGDNFVAKNIGFENNA  363

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             GA KHQAVALRVSAD  +F+NC +D +QDTLYTH+ RQFYRDC+ISGT+DF+FG+A  VF
Sbjct  364   GAIKHQAVALRVSADYAVFYNCSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVF  423

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNCK +VRKP+ NQ+C+VTAQGRK RR  +A+++Q+  I A P L       K +LGRPW
Sbjct  424   QNCKFLVRKPLENQQCIVTAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPW  483

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             KE+SRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S + RVKW G K  
Sbjct  484   KEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-T  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             I+ + A  FTPG FL  D  W+    IP++P
Sbjct  543   INRQHAMDFTPGRFLKGDS-WIKATGIPYTP  572



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/575 (50%), Positives = 390/575 (68%), Gaps = 15/575 (3%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S      GGE  ST++K+++ IC PTDY
Sbjct  4     GEVQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  3053  KETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDPR + AL  CK
Sbjct  64    KKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPRANQALQNCK  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL  +IDDL  SF K+  FD   +  Y  DLKVWLS A+T ++TC+D FENTTGD GEK
Sbjct  124   ELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAGEK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-----ETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L +SL I      RRLL A     + K  ++ +  P
Sbjct  184   MRQFLKTSQELTSNGLAMVSEVSTLFKSLNI---KTGRRLLQAAATATDEKRFQRAKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  241   AWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG R+  DG  TY TATV + GD FIA+++GFEN+
Sbjct  301   DEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQTYLTATVGVVGDYFIAKDVGFENT  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  361   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTAQGR DRR  +A++LQ+C I  E         NK +LGRP
Sbjct  421   FQNCKMIVRKPLENQACMVTAQGRLDRRSPSALILQNCTISGERGYD--KELNKAYLGRP  478

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK ++R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W+G K+
Sbjct  479   WKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRGMKK  538

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  539   -LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/569 (49%), Positives = 383/569 (67%), Gaps = 21/569 (4%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCE  3039
             + KK+A+  V S+ LVA VVA  +  G   E  D   ++S++ K++  IC  TDY++TC 
Sbjct  5     KKKKIAIVSVCSLILVAMVVALVIG-GTENEEEDTVPDVSSSQKAISSICETTDYQQTCM  63

Query  3038  RSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNS  2859
              SLAG   T+ PK+LI++AF+  V  I  A   S  L+  + DP    AL  C++L + +
Sbjct  64    NSLAGHNSTN-PKDLIEVAFQAAVNYINQAAENSSTLQHLETDPMAKSALQVCQDLANRA  122

Query  2858  IDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             I+DL+RSF K  NFD+ ++ +   DLK+WLSGAIT QETC+D FE+  G++G+KMK  LK
Sbjct  123   INDLQRSFAKFSNFDIINVDDILLDLKIWLSGAITHQETCLDGFEDVPGESGQKMKDALK  182

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
              + EL+SN LAM+   +  L+++                 G +   E P + D   R+LL
Sbjct  183   ISMELTSNALAMVAEISTFLEAM-----------------GMQSFSELPDWADFNKRKLL  225

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
             T  P  +K D+VVAKDGSG+Y+++ EAL+ +P K+++T V++IK GVY E+V++   +  
Sbjct  226   TASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEEKVQINSSLTH  285

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             ++ VG+GPTKTRITG  +  DG GTY TATVA+QGD FIA+ IGFENSAGAAKHQAVALR
Sbjct  286   LMMVGDGPTKTRITGHLNFIDGTGTYQTATVAVQGDDFIAKEIGFENSAGAAKHQAVALR  345

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             VSAD +IF+NCH+D YQDTLY H+YRQFY+DC ISGTVDFIFG++  VFQ C ++VRKPM
Sbjct  346   VSADKSIFYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPM  405

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ+C+VTAQGRKD R    IV+Q+C  +A+P L         +LGRPWKE+SRT+IM +
Sbjct  406   DNQQCIVTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMES  465

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
             F+DD + P+GW  W  T  L+T +Y E+ NRGP A   KRVKW G K  + P   ++FTP
Sbjct  466   FLDDFIQPDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVKE-LPPSRVQRFTP  524

Query  1598  GPFLMADEQWLGRAQIPFSPGFLQP*NKQ  1512
             G FL  + +W+   Q+P++ GF+ P  K+
Sbjct  525   GEFLDGN-RWIPPTQVPYAAGFIFPVPKE  552



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/566 (50%), Positives = 387/566 (68%), Gaps = 16/566 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTAS-KSVKEICAPTDYKET  3045
             ++ ++  V  ++S+ LV+ VVA  V++G S  S +G  E  TAS K++K++CAPTDYK+T
Sbjct  11    KRKRRYVVISISSVLLVSMVVA--VTIGVSVNSDNGTKEEITASVKAIKDVCAPTDYKKT  68

Query  3044  CERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
             CE +L   AKDT DP EL++ AF  T++ I++   KS  + E  KDPRT  ALD C EL+
Sbjct  69    CEDTLRKDAKDTSDPLELVRTAFNATMKQISNVAKKSLTMIELQKDPRTKMALDQCTELM  128

Query  2867  HNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               +I +L +SF ++  F++  + +    LKVWLS  I+ ++TC+D F+ T GD GE MK 
Sbjct  129   DFAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISHEQTCLDGFQGTQGDAGETMKK  188

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
              LKTA +L+ NGLAM++     L  +E+P +N  RRLL+ E         FP +VD   R
Sbjct  189   ALKTAVQLTHNGLAMVSEMLNYLGQMELPEMN-SRRLLSQE---------FPSWVDGRVR  238

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             RLL    + +K D+VVA+DGSGQYK++ EALR VP KN+ T V+ IK+G Y E V+V R 
Sbjct  239   RLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVVHIKSGTYKEYVQVNRT  298

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
             M  +VF+G+GPTK+ I+G++S KDGI TY TATVAI GD FIA+N+GFEN+AGA  +QAV
Sbjct  299   MPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALNYQAV  358

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             A+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTI+GT+DF+FG+A  VFQNC ++VR
Sbjct  359   AVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVR  418

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP+ANQ C +TA GRKD R +   VLQ C I  E    A    +K +LGRPWKE+S+T+I
Sbjct  419   KPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTII  478

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M TFI D +  EGWS WQG   LDT +Y+E +N GPGA+   RV W+G K+ +S E   +
Sbjct  479   METFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEIVE  537

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +TP  ++  D+ W+    +P++PGF 
Sbjct  538   YTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/569 (49%), Positives = 386/569 (68%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  V  ++S+ L++ VVA TV  S+ ++   ++G GEI+ + K+VK++CAPTDY++
Sbjct  10    KRKRRYVVITISSVLLISMVVAVTVGVSLNKNDGDSEGKGEITASVKAVKDVCAPTDYRK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDTLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL          E FP ++D   
Sbjct  190   KALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL---------AEGFPSWLDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A   +K DIVVA+DGSGQY ++ EAL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTFVVHIKAGLYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI G+ FIA+NIGFEN+AGA KH
Sbjct  300   NKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRV +D +IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVALRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R     V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSDED  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +FTP  ++  D  W+    +P++PG L
Sbjct  539   ILKFTPAQYIQGD-TWVPGKGVPYTPGLL  566



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/582 (49%), Positives = 392/582 (67%), Gaps = 19/582 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAA-------TVSVGRSGESA--DGGGEISTASKSVKEIC  3069
             E+ K++AV   +S+ LVA VVA        T      GES   D GG+I ++ K++K IC
Sbjct  11    EKKKRIAVISASSLILVAMVVAVAVGVNHNTSDASGDGESVSKDSGGDIQSSMKAIKAIC  70

Query  3068  APTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PTDYKETC +SL+ A  +T DPKEL+++ F+V +++I +A+S+SE LKE +KDPR   A
Sbjct  71    QPTDYKETCVQSLSSAAGNTTDPKELVRVGFQVAMKHIREALSQSETLKEVEKDPRAKQA  130

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             L +C+EL+  +IDDLK SF K+  FD++ +     DLKVWL+   T Q TC D FENTTG
Sbjct  131   LLSCQELMDYAIDDLKNSFDKLGAFDISKVDNILADLKVWLTSVNTYQVTCTDGFENTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE--  2538
             D GE+MK  LKT+ EL+ N LAM+   + +L  L+IP +N +R   T E+    +     
Sbjct  191   DAGERMKKALKTSGELTENALAMVDEISSILNQLQIPALNRRRLFSTKESAESSETPTTA  250

Query  2537  ---FPGFVDAATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRAVP-FKNDETVVIF  2373
                 P ++    R+LL T P  ++K D+VVAKDG+G + +++EAL ++P  K ++T++++
Sbjct  251   EDDIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEALESLPKTKENKTIIMY  310

Query  2372  IKAGVYNERVEVPRKMN-KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             IK GVY+E VE+ R +    +  G+GPT+T+ITGS +  DG  T+ TATV++   GFI +
Sbjct  311   IKEGVYSEIVEISRNLTGSFIMYGDGPTRTKITGSLNFIDGTPTFKTATVSVNAHGFICK  370

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IG EN+AGA KHQAVAL+V ADM +F NC +D YQDTLY HS R F+RDCTISGT+D+I
Sbjct  371   DIGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTLYAHSGRHFFRDCTISGTIDYI  430

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FGN   +FQNCKM++RKPM NQ  +VTAQGRK  R  +AIVLQ C I A+P+L       
Sbjct  431   FGNGESIFQNCKMVIRKPMVNQANIVTAQGRKTEREVSAIVLQGCTISADPSLVPEKNVF  490

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKEFSRT+IM T IDD + P+GW  W G   L TC+YAE+ NRGPGA    RV
Sbjct  491   KSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQTCYYAEFNNRGPGAVLTNRV  550

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW G K  ++PE A+++T  P++ AD+ W+    IP+ PG +
Sbjct  551   KWPGIKTPLTPEQAQEYTAAPYIQADD-WVKPLGIPYVPGLM  591



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/565 (50%), Positives = 380/565 (67%), Gaps = 15/565 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ K+  +  V+S+ L++ VVA  V++G S    +G  EI+T+ K++KE+CAPTDYK+TC
Sbjct  11    KRRKRYIIISVSSVLLISMVVA--VTIGVSVNKNEGEEEITTSVKAIKEVCAPTDYKKTC  68

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   A++T DP EL+K AF VT++ I+D   KS+ + E  KDPR   ALD CKEL+ 
Sbjct  69    EDTLRKDAQNTSDPLELVKTAFNVTMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMD  128

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L  SF+++  F+   I E    L++WLS  I+ +ETC++ F+ T GD GE +K  
Sbjct  129   YAIGELSNSFEELGKFEFHKIDEALVKLRLWLSATISHEETCLEGFQGTQGDAGETIKKA  188

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ NGLAM++  +  L  L+IP ++  RRLL+ +         FP ++DA  RR
Sbjct  189   LKTAVQLTHNGLAMVSEMSSYLGQLQIPEMS-SRRLLSQD---------FPSWMDARARR  238

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IK G+Y E V+V R M
Sbjct  239   LLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTFVVHIKGGIYKEYVQVNRSM  298

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +VF+G+G  KT ITG ++ KDGI TY TATVAI GD FIA+NIGFEN+AG  KHQAVA
Sbjct  299   THLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGDHFIAKNIGFENTAGPIKHQAVA  358

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV AD +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRK
Sbjct  359   IRVLADQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRK  418

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GRKD R +   VLQ C I+ EP   A    +K +LGRPWKEFSRT+IM
Sbjct  419   PLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIM  478

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D + PEGW  W G   L+T +Y+E +N GPG+   KRV W G K+ +S E    F
Sbjct  479   NTFIPDFIPPEGWQPWLGNFGLETLFYSEVRNIGPGSGLTKRVTWPGIKK-LSEEEILTF  537

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  D  W+    +P+ PG  
Sbjct  538   TPAQYIQGD-AWIPGKGVPYIPGLF  561



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/577 (50%), Positives = 393/577 (68%), Gaps = 21/577 (4%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVS------VGRSGESADGGGEISTASKSVKEICAPTD  3057
             + KK A+ GV+S+ LVA VVA TV       VG   +++DGG  ++T++K++K IC PTD
Sbjct  7     KKKKFAIIGVSSVILVAMVVAVTVGVTTKNKVGGGHKNSDGG-HVTTSTKAIKAICQPTD  65

Query  3056  YKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             YKETCERSL + A ++ +PK+LIK  F VT++ +   I  S  L+E  KD  T+ AL+ C
Sbjct  66    YKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQALENC  125

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             KELL  +IDDL  SFQK+  FD++ I +Y  DLKVWLS AIT Q+TC+D F+NT GD G+
Sbjct  126   KELLEYAIDDLTTSFQKLGPFDISKIDDYAEDLKVWLSAAITYQQTCLDGFQNTKGDAGD  185

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAET---KGeeqeeEFPG  2529
             KMK  L T  +L+SNGLAM+T  T +L SL +     +RRLL         +   +  P 
Sbjct  186   KMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKA--NRRRLLAGGGGGGNAKNAPKVIPT  243

Query  2528  FVDAATRRLL---TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAG  2361
             +++   +R L   T  P SIK D VVAKDGSGQY+++ EA++ +P  N D+T VI++K G
Sbjct  244   WIN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKMIPKNNADKTFVIYVKEG  301

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY+E V + + M  ++ +G+G  KT++TGS++   G+ T+ TATV + GD FIA++IG E
Sbjct  302   VYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAGVQTFQTATVVVVGDYFIAKDIGIE  361

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAGA  HQAVALRV +D++IF+ C +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A 
Sbjct  362   NSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  421

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
             VVFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I  +P        NK +LG
Sbjct  422   VVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLG  481

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+NRGPG+   KRVKW G 
Sbjct  482   RPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGI  541

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K N+S + A  FT G F+  D +W+  + +P+  G +
Sbjct  542   K-NLSADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/569 (49%), Positives = 384/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ K+  V  ++S+ L++ VVA TV  S+ +SG+ +DG GEI+++ K+VK++CAPTDYK+
Sbjct  10    KRKKRFIVITISSVLLISMVVAVTVGVSLNKSGDDSDGNGEITSSVKAVKDVCAPTDYKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L     +T DP EL+K AFR T++ ITDA  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDTLIKNGNNTSDPVELVKTAFRATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   ++++WLS AI+ +ETC++ F++T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL+         E  P +VD   
Sbjct  190   KALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLS---------EGIPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A    K DIVVA+DGSGQY ++ EAL+ VP K + T V+ IKAG+YNE V+V
Sbjct  240   RKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTFVVHIKAGIYNEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+G++S KDGI TY T TVAI GD FIA+NIGFEN+AGA KH
Sbjct  300   NKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG++  VFQNC +
Sbjct  360   QAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+S+
Sbjct  420   LVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSK  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEE  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                FTP  ++  D  W+    +P++PG L
Sbjct  539   VLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/557 (50%), Positives = 373/557 (67%), Gaps = 7/557 (1%)
 Frame = -1

Query  3191  VASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSL-AGAKD  3015
             V S+  VA +VA  V V  S +SA      +++ K+++ IC  T YKETC+ SL   A D
Sbjct  15    VFSVMGVAMIVAVAVGVTCSRKSAKQNKGTASSKKAIETICQTTSYKETCQSSLEKAAGD  74

Query  3014  TDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSF  2835
             T DPKELIK  F+V  + + + I  S  LK+  KDP  S ALD CKE+L  S +DL  + 
Sbjct  75    TSDPKELIKAGFQVAADKLDEVIQNSNTLKDLAKDPMASQALDVCKEMLDTSTEDLLAAV  134

Query  2834  QKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSN  2655
              K+  FD + + EY  DLKVWLS A+  Q+TC+DAFE T G+ GEKMK  LKTA EL+SN
Sbjct  135   DKMGPFDASKMNEYVEDLKVWLSAAVNHQQTCLDAFEGTKGEAGEKMKGFLKTAQELTSN  194

Query  2654  GLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE--FPGFVDAATRRLLTTDPAS  2481
             GLAM++  + LL SL     + +RRLL + + G+ +      P ++ A    LLT  P S
Sbjct  195   GLAMVSEISSLLGSLN--SNSHRRRLLGSSSGGQSKRVYKPLPSWIGARKLDLLTATPQS  252

Query  2480  IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGE  2301
             +K ++VVA+DG+G+YKS+ EAL+ VP K+ +  VI+IK GVY E V V ++M  +V +G+
Sbjct  253   LKPNVVVAQDGTGKYKSITEALKEVPKKSAQPFVIYIKEGVYKEYVIVDKEMTNVVMIGD  312

Query  2300  GPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMT  2121
             GPTKTRI+GS++  DG  T +TAT A  GD F+A+ IGFEN+AGAAKHQAVALRV +D +
Sbjct  313   GPTKTRISGSKNYADGTATMYTATFAAVGDYFVAKGIGFENTAGAAKHQAVALRVQSDFS  372

Query  2120  IFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECM  1941
             IF+NC+IDAYQDTLYT +YRQ+YRDCTISGTVDFIFG+   +FQNC+M+VRKP  +Q CM
Sbjct  373   IFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKPGDSQSCM  432

Query  1940  VTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIV  1761
             VTAQGR D+    AIVLQ+C I  EP   A    NK +LGRPWK F+R +++ + IDD +
Sbjct  433   VTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDDAI  492

Query  1760  VPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
              PEGW+ W G  +  +C+ AE  NRG GA   KRVKW+  K+ ++PE A  FTP      
Sbjct  493   APEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLKK-LTPEQAAAFTPARLFEG  551

Query  1580  DEQWLGRAQIPFSPGFL  1530
             D +W+  + +P+  G +
Sbjct  552   D-KWVKPSGVPYVSGMM  567



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/579 (49%), Positives = 386/579 (67%), Gaps = 22/579 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG-RSGESA------DGGGEISTASKSVKEICAP  3063
             E+ K+ AV G++S+ LVA V+A TV V   +G+S+      DG  E+S + K++K IC P
Sbjct  8     EKRKRYAVIGISSVLLVAMVIAVTVGVSLNNGQSSPASSNKDGSHEVSASMKAIKSICQP  67

Query  3062  TDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDYKE C  SL+  + +T DPK+LI+  F+V ++ +++A  KS +L++ +KDPR S AL 
Sbjct  68    TDYKEECINSLSSESGNTTDPKKLIQAGFKVAMKYLSEAAKKSVVLQDLEKDPRASKALG  127

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              CK+L+ NSIDDLK S  K+  FD++   +   DLK+WLS  +T QETC+D F+NTTG+ 
Sbjct  128   HCKQLMENSIDDLKHSVDKLGEFDISKFDQMLMDLKIWLSATVTYQETCLDGFQNTTGEA  187

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
              EKMK  LKT+  LSSNGL M++  + +   L++  +   RRL + E + E       G 
Sbjct  188   AEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMG--RRLFSDEEESELPVL---GH  242

Query  2525  VDAA------TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
              D A       RRL+   P  +K +IVVAKDGSG+Y ++ EAL+ +P +++ T VI+IK 
Sbjct  243   SDEAEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKE  302

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             GVY E V + R M  ++ +G+G  KTRITG ++  DG  T  TATV + GD F AR+IGF
Sbjct  303   GVYKEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTATVVVLGDHFRARDIGF  362

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGA KHQAVALRV+AD  IF+ C +D YQDTLYTH+ RQFYRDC +SGT+DF+FG+A
Sbjct  363   ENTAGAHKHQAVALRVNADEAIFYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDA  422

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNC+ IVR+PM NQ+C+VTAQGRK+RR  +AI++Q+   +A+P           +L
Sbjct  423   AAVFQNCRFIVRRPMDNQQCIVTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYL  482

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA-STDKRVKWK  1647
             GRPWKEFSRT+IM +FIDD++ P GW  W G   L TC+Y E+ NRGPGA    +R KWK
Sbjct  483   GRPWKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWK  542

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K NI+ + A+ FTPG F   D  W+ R  IP+  G  
Sbjct  543   GVK-NITAKHARDFTPGSFFKGD-WWIKRTGIPYVSGMF  579



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/570 (49%), Positives = 385/570 (68%), Gaps = 15/570 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAP  3063
             + +++AV G++S  LVA VVA +V VG            S     ++S + K+VK IC P
Sbjct  9     RKRRIAVIGISSFLLVAMVVAVSVGVGLGNNGNEDLNDSSHKSTNQVSASMKAVKAICQP  68

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY++TCE +L   A +T DP+ELIK+AF++  +++ +A  KS++L+E  KDPRT  AL 
Sbjct  69    TDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHLNEASKKSKVLEELSKDPRTRGALQ  128

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
             +CKEL+  S+D+LK+S  KV +FD+  I++   D+K WLS +IT QETC+D F+NTT + 
Sbjct  129   SCKELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITYQETCLDGFQNTTTNA  188

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq-eeEFPG  2529
             G++MK  LK + ELS+N LA+++  +  + SLE  G   +RRLL  +       ++ FP 
Sbjct  189   GKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG---QRRLLQDDLPVLGHGDQIFPT  245

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             + D   RRLL    + IK DIVVAKDGSG + ++ EAL  VP K+ +T V++IKAG+Y E
Sbjct  246   WTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSSKTFVLYIKAGIYQE  305

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + GD F+A+NIGFE +AG
Sbjct  306   YIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGDNFVAKNIGFEKNAG  365

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRVSAD  +F+NC +D +QDTLYT + RQF RDC++SGT+DF+FG+A  VFQ
Sbjct  366   AIKHQAVALRVSADYALFYNCSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQ  425

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK ++RKP+ NQ+C+VTAQGRK RR  +AIV+Q+  I A P L       K +LGRPWK
Sbjct  426   NCKFLIRKPLENQQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWK  485

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+S   RVKW G K  I
Sbjct  486   EFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TI  544

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
               + A  FTPG F      W+    IP++P
Sbjct  545   DRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/571 (49%), Positives = 380/571 (67%), Gaps = 19/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG----GGEISTASKSVKEICAPTDY  3054
             ++ K+  +  ++S+ L++ VVA TV V  +     G     G+I+ + K+VK+ICAPTDY
Sbjct  10    KRKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPTDY  69

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE SL     +T DP EL+K AF VT++ ITDA  KS+ + +  KDPRT  ALD CK
Sbjct  70    KKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQCK  129

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  ++ +L  SF+++   +   + E   +L++WLS AI+ +ETC++ F+ T G+ GE 
Sbjct  130   ELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAGET  189

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL  E          P +VD 
Sbjct  190   MKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN-SRRLLAQE---------IPSWVDQ  239

Query  2516  ATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               RRLL   ++ +  K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E V
Sbjct  240   RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             +V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+AGA 
Sbjct  300   QVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGAI  359

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC
Sbjct  360   KHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  419

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+
Sbjct  420   TLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEY  479

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   RV W G K   + 
Sbjct  480   SRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNE  539

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E+ K FTP  ++  D  W+    +P++PG L
Sbjct  540   EILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/569 (49%), Positives = 376/569 (66%), Gaps = 21/569 (4%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRS--GESADGGGEISTASKSVKEICAPTDYKET  3045
             + KK  + G+ +  LV  V+A  + + R+  G     G +I T +K+V+E+CAPTDYKET
Sbjct  8     KKKKCIIAGIITALLVVMVIAVAIIMSRNTIGSETIAGVQIKTTTKAVQEVCAPTDYKET  67

Query  3044  CERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKE  2874
             C  SL  A  D+  P ELIKL F +T+++I D+I K+  EL  +A KD  T DAL+ C+ 
Sbjct  68    CVNSLMKASPDSTQPLELIKLGFNITIQSIKDSIKKASEELKAKAAKDNETKDALELCES  127

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L+ ++ DDLK+     + F + HI++   DL+VWLSG+I  Q+TC+D F+    +  + M
Sbjct  128   LMTDATDDLKKCLDNFDGFSITHIEDLVEDLRVWLSGSIAYQQTCMDTFDEINSNLSQDM  187

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqeeEFPG  2529
               + KT+ EL+SNGLAMIT  +  L    + G+     ++ R+LL+ +       +  P 
Sbjct  188   HKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDLGHYARKLLSTK-------DGIPS  240

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +V   TRRL+ T    +K ++VVA+DGSGQYK++ EAL  VP  N    VI+IK GVYNE
Sbjct  241   WVGPNTRRLMATQ-GVVKPNVVVAQDGSGQYKTINEALNLVPKANQNPFVIYIKQGVYNE  299

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSA  2172
             +V V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVA+ GD F A+NIGFEN+A
Sbjct  300   KVNVTKKMTHVTFIGDGPTKTKITGSLNYHIGKVKTYHTATVAVNGDNFTAKNIGFENTA  359

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQFYRDCTISGTVDFIFG+  VV 
Sbjct  360   GPEGHQAVALRVSADYAVFHNCQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVVL  419

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNC ++VRKPM NQ CM+TAQGR D R +  +VL +C I+ EP        NK +LGRPW
Sbjct  420   QNCNIVVRKPMKNQSCMITAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYLGRPW  479

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT+IM T ID+++ P GW  W G   L T +YAE++N GPG+   +RVKW G K+ 
Sbjct  480   KEFSRTIIMRTNIDNVIDPAGWLPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPGIKK-  538

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  539   LSPKQALRFTPARFLRGN-LWIPPNRVPY  566



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/570 (48%), Positives = 374/570 (66%), Gaps = 8/570 (1%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYK  3051
              S  + KK+A+  V  + LVA +VA TV V  + +      ++    K+++ IC  T YK
Sbjct  3     ASESKKKKIAIIAVLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQATTYK  62

Query  3050  ETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             ETC+ SL     DT DPK+LIK  F+V  + + + I  S  LKE  KDP  S AL  CKE
Sbjct  63    ETCQSSLEKETGDTTDPKDLIKAEFQVAADKVNEVIKNSNTLKEYAKDPMASQALGVCKE  122

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL  +++DL  +  K+  FD++ I +Y  DLKVWLS A+  Q TC+DAFE+T G+ GEKM
Sbjct  123   LLETAVEDLLGAVDKMGPFDVSKISDYLADLKVWLSAAVNHQATCLDAFEDTKGEAGEKM  182

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE--FPGFVD  2520
             +  LKTA EL+SNGLAM++  + L+ S   P +N  RRL+++   G+ +      PG++ 
Sbjct  183   RGFLKTAQELTSNGLAMVSEISRLVDS---PKLNSHRRLMSSSKGGQTKRNYKPVPGWMS  239

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
                  LLT  P S+K ++VVAKDG+G+YK++ EAL+ VP K++E  VI+IK G+Y E V 
Sbjct  240   DRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVI  299

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             V ++M  +V +G+GPT TRI+GS+S+ DGI T +TAT A  G+ F+A+ IGFEN+AG  K
Sbjct  300   VDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFENTAGHVK  359

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV +D +IF NCH+DAYQDTLYT +YRQFYRDCTI+GTVDFIFG+   +FQNCK
Sbjct  360   HQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCK  419

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             M+VRKP   Q CMVTAQGR DR     I LQ+C I  EP   A    NK +LGRPWK+F+
Sbjct  420   MVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFA  479

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             R ++M + ID+ + PEGW+ W G  Y   C++ EY NRGP     +RVKW   KR ++P+
Sbjct  480   RVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPD  538

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FTP      D +W+  + +P+ PG +
Sbjct  539   QAAAFTPARVFEGD-KWVKPSGVPYVPGMM  567



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 384/573 (67%), Gaps = 21/573 (4%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADG--GGEISTASKSVKEICAPTDYKET  3045
             + KK  + GV +  LV  VVA  ++  R+   ++     +I TA+ +V+ +CAPTDYKET
Sbjct  8     KKKKCIIAGVITALLVLMVVAVGITTSRNTSHSEKIVPVQIKTATTAVEAVCAPTDYKET  67

Query  3044  CERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKE  2874
             C  SL  A  D+  P +LIKL F VT+ +I D+I K+  EL  +A  D  T  AL+ C++
Sbjct  68    CVNSLMKASPDSTQPLDLIKLGFNVTIRSIEDSIKKASVELTAKAANDKDTKGALELCEK  127

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L++++ DDLK+     + F +  I+++  DL+VWLSG+I  Q+TC+D FE T     + M
Sbjct  128   LMNDATDDLKKCLDNFDGFSIPQIEDFVEDLRVWLSGSIAYQQTCMDTFEETNSKLSQDM  187

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGeeqeeEFPG  2529
             + + KT+ EL+SNGLAMIT+ + LL    + GV      + R+LL+AE       +  P 
Sbjct  188   QKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLGKYARKLLSAE-------DGIPS  240

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +V   TRRL+ T    +K ++VVA DGSGQYK++ EAL AVP  N +  VI+IK GVYNE
Sbjct  241   WVGPNTRRLMATK-GGVKANVVVAHDGSGQYKTINEALNAVPKANQKPFVIYIKQGVYNE  299

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSA  2172
             +V+V +KM  + F+G+GPTKT+ITGS +   G + TY TATVAI GD F A+NIGFEN+A
Sbjct  300   KVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYLTATVAINGDNFTAKNIGFENTA  359

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G   HQAVALRVSAD+ +F+NC ID YQDTLY HS+RQF+RDCT+SGTVDFIFG+  VV 
Sbjct  360   GPEGHQAVALRVSADLAVFYNCQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFGDGIVVL  419

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNC ++VRKPM +Q CM+TAQGR D+R +  +VLQ+C I  EPA       NK +LGRPW
Sbjct  420   QNCNIVVRKPMKSQSCMITAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLGRPW  479

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             KEFSRT+IM T IDD++ P GW  W G   L+T +YAEY+N GPG++  +RVKW G K+ 
Sbjct  480   KEFSRTIIMGTTIDDVIDPAGWLPWNGDFALNTLYYAEYENNGPGSNQAQRVKWPGIKK-  538

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +SP+ A +FTP  FL  +  W+   ++P+   F
Sbjct  539   LSPKQALRFTPARFLRGN-LWIPPNRVPYMGNF  570



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/572 (50%), Positives = 383/572 (67%), Gaps = 21/572 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRS-----GESADGGGEISTASKSVKEICAPTD  3057
             ++ K+ AV  ++S+ L++ VVA TV V  S     G+S +G G+I+ + K+VK+ICAPTD
Sbjct  10    KRKKRYAVISISSVLLISMVVAVTVGVNLSKNDGKGDS-EGNGQITASVKAVKDICAPTD  68

Query  3056  YKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             YK+TCE SL    K+T DP EL+K AF VT++ ITDA  KS+ + +  KDPRT  ALD C
Sbjct  69    YKKTCEDSLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQC  128

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             KEL+  ++ +L  SF+++   +   + E   +L++WLS AI+ +ETC++ F+ T G+ GE
Sbjct  129   KELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAGE  188

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVD  2520
              MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  R LL  E          P +VD
Sbjct  189   TMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGLN-SRGLLAQE---------IPSWVD  238

Query  2519  AATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
                 RLL   +  +  K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E 
Sbjct  239   QRGPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEY  298

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+AGA
Sbjct  299   VQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGA  358

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQN
Sbjct  359   IKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQN  418

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE
Sbjct  419   CTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKE  478

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   RV W G K   +
Sbjct  479   YSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSN  538

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              E+ K FTP  ++  D  W+    +P++PG L
Sbjct  539   EEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/571 (50%), Positives = 381/571 (67%), Gaps = 18/571 (3%)
 Frame = -1

Query  3227  SPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG--GGEISTASKSVKEICAPTDY  3054
             S  + + VA+T ++S+ L++ VVA T+ V  +   AD    GEI+ + K+VK++CAPTDY
Sbjct  9     SKRKRRFVAIT-ISSVLLISMVVAVTIGVSLNKNDADSEDKGEITASVKAVKDVCAPTDY  67

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++TCE +L    ++T DP EL+K AF  T++ ITD   KS+ + E  KDPRT  ALD C 
Sbjct  68    RKTCEDTLIQNGQNTTDPMELVKTAFSATMKQITDVAKKSQTMMELQKDPRTRMALDQCT  127

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE 
Sbjct  128   ELMDYALGELSSSFEELGKFEFHKLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGET  187

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL          E FP +VD 
Sbjct  188   MKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL---------AEGFPSWVDQ  237

Query  2516  ATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               RRLL    A   +K DIVVA+DGSGQY ++ +AL  VP K + T V+ IKAG+Y E V
Sbjct  238   RGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVVHIKAGIYKEYV  297

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             +V + M  +VF+G+GP KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+AGA 
Sbjct  298   QVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAI  357

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC
Sbjct  358   KHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNC  417

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+
Sbjct  418   TLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEY  477

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM TFI D V P+GW  WQG   L T +Y+E QN GPGA+   RV W G K  +S 
Sbjct  478   SRTIIMNTFIPDFVQPQGWQPWQGDFGLKTLFYSEVQNTGPGATVANRVTWAGIK-TLSD  536

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P++ G L
Sbjct  537   EDILKFTPAQYIQGD-TWVPGKGVPYTSGLL  566



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/569 (49%), Positives = 385/569 (68%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESAD--GGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  V  ++S+ L++ VVA TV V  +    D  G  E++ + K+VK++CAPTDY++
Sbjct  10    KRKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ + E  KD RT  ALD CKEL
Sbjct  70    TCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++D+L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE MK
Sbjct  130   MDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL          E FP +VD   
Sbjct  190   KALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL---------AEGFPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A   +K DIVVA+DGSGQYK++ EAL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M+ +VF+G+GP KT I+G+++ KDGI TY TATVAI G+ FIA+NIGFEN+AGA KH
Sbjct  300   NKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEED  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +FTP  ++  D+ W+    +P++ G L
Sbjct  539   ILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/577 (49%), Positives = 389/577 (67%), Gaps = 17/577 (3%)
 Frame = -1

Query  3230  GSPEQNK--KVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPT  3060
             G   QNK  K+A+ GV+++ LVA VVA TV V  S      GGE  ST++K+++ IC PT
Sbjct  3     GGEAQNKRKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPT  62

Query  3059  DYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDP ++ AL  
Sbjct  63    DYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSSNQALQN  122

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +IDDL  SF K+  FD   +  Y  DLKVWLS A+T ++TC+D FENTTGD G
Sbjct  123   CKELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-----ETKGeeqeeE  2538
             EKM+  LKT+ EL+SNGLAM++  + L ++L I      RRLL A     + K  ++ + 
Sbjct  183   EKMRQFLKTSQELTSNGLAMVSEVSTLFKALNI---KTGRRLLQAAATATDEKRFQKAKI  239

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAG  2361
              P ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K G
Sbjct  240   IPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEG  299

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++IGFE
Sbjct  300   VYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGFE  359

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A 
Sbjct  360   NTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  419

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP+ NQ CMVTA GR DRR   A++LQ+C I  E         NK +LG
Sbjct  420   AVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTALILQNCTISGESGYD--KELNKAYLG  477

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK ++R ++M + IDD++ PEGW  W G    +TCW+ E+ NRG GA   KRV W+G 
Sbjct  478   RPWKSYARAIVMQSQIDDVIAPEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRGM  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  538   KK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  572



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/569 (50%), Positives = 381/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG-RSGE-SADGGGEISTASKSVKEICAPTDYKE  3048
             ++ K++ +  ++S+ L+  VVA TV    + GE + D  G+I+ + K+VK++CAPTDYK+
Sbjct  10    KRKKRLVLISISSVLLITLVVALTVGFSLKKGEVNGDSEGQINASVKAVKDVCAPTDYKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L     +T DP EL+K AF VT++ ITDA  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDTLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHKLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  +EIPG+N  RRLL  E          P +VD   
Sbjct  190   KALKTAIELTHNGLAIISEMSNFVGQMEIPGLN-SRRLLAQE---------IPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             RRLL    A    K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVVHIKAGLYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI GD FIA+NIGF N+AG  KH
Sbjct  300   NKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGPIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLYTHS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V P+GW  W G   LDT +Y+E QN GPGA+   RV W G K   + E+
Sbjct  480   TIIMNTFIPDFVQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALASRVTWPGIKTLSNDEI  539

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K FTP  ++  +  W+    +P++PG L
Sbjct  540   LK-FTPDQYIQGN-VWVPGKGVPYTPGLL  566



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/572 (49%), Positives = 378/572 (66%), Gaps = 8/572 (1%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             M +  + KK+A+  V S+  VA +VA  V V  S +SA      S++ K+++ IC  T Y
Sbjct  1     MAADSKKKKIALIIVFSVIGVAMIVAVAVGVTCSRKSAKQNKGTSSSKKAIETICQTTSY  60

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             KETC+ SL   A DT DPKELIK  F+V  + + + I  S  LK+  KDP  S ALD CK
Sbjct  61    KETCQSSLEKAAGDTSDPKELIKTGFQVAADKLDEVIKNSNTLKDLAKDPMASQALDVCK  120

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             E+L  + +DL  +  K+  FD + + EY  DLKVWLS A+  Q+TC+DAFE T G+ GEK
Sbjct  121   EMLDTAAEDLLGAVDKMGPFDASKMNEYVEDLKVWLSAAVNHQQTCLDAFEGTKGEAGEK  180

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL---TAETKGeeqeeEFPGF  2526
             MK  LKTA EL+SNGLAM++  + LL S  +     +RRLL   + + K +   +  P +
Sbjct  181   MKGFLKTAQELTSNGLAMVSEISSLLGS--VNSNTHRRRLLGSSSGDQKSKRVYKPLPSW  238

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             + A    LLT  P S+K ++VVA+DG+G+YKS+ EAL+ VP K+ +  VI+IK GVY E 
Sbjct  239   IGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKSAQPFVIYIKEGVYKEY  298

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V V + M  +V +G+GPTKTRI+GS++  DG  T +TAT A  GD F+A+ IGFEN+AGA
Sbjct  299   VIVDKDMTNVVMIGDGPTKTRISGSKNYADGTTTMYTATFAAVGDYFVAKGIGFENTAGA  358

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
             AKHQAVALRV +D +IF+NC+IDAYQDTLYT +YRQ+YRDCTISGTVDFIFG+   +FQN
Sbjct  359   AKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQN  418

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C+M+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK +LGRPWK 
Sbjct  419   CRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKG  478

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             F+R +++ + ID+ + PEGW+ W G  +  +C+ AE  NRG GA   KRVKW+   + ++
Sbjct  479   FARVVVIQSQIDNAIAPEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLMK-LT  537

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             PE A  FTP      D +W+  + +P+  G +
Sbjct  538   PEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  568



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/565 (49%), Positives = 378/565 (67%), Gaps = 13/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ K+  +  ++S+ L++ VVA T+ V  +     G  EI+T+ K++K++CAPTDYK+TC
Sbjct  11    KRKKRYVIISISSVLLISMVVAVTIGVSVNKNDNGGDEEITTSVKAIKDVCAPTDYKKTC  70

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   A++T DP EL+K AF  T++ IT+   KS+ + E  KDPRT  ALD CKEL+ 
Sbjct  71    EDTLRKDAQNTSDPLELVKTAFNATMKQITEVAKKSQTMIELQKDPRTKMALDQCKELMD  130

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L +SF+++  F+   + E    L+VWLS  I+ ++TC+D F+ T GD GE +K  
Sbjct  131   YAIGELSKSFEELGRFEFHKVDEALVKLRVWLSATISHEQTCLDGFQGTQGDAGETIKKA  190

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+ E         FP ++D  TRR
Sbjct  191   LKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLSQE---------FPSWMDGRTRR  240

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IK G+Y E V+V R M
Sbjct  241   LLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQVNRSM  300

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +VF+G+GP KT I+G ++ KDGI TY TATVAI GD FIA+N+GFEN+AGA KHQAVA
Sbjct  301   THLVFIGDGPDKTVISGDKNYKDGITTYKTATVAIVGDHFIAKNMGFENTAGAIKHQAVA  360

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQ+C ++VRK
Sbjct  361   IRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSCTLLVRK  420

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GRKD R +   VLQ C I+ EP        +K +LGRPWKE+SRT+ M
Sbjct  421   PLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFM  480

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D + PEGW  W G   L+T +Y+E  N GPGA   KRV W G K+ +S E   + 
Sbjct  481   NTFIPDFIPPEGWQPWLGNFGLETLFYSEVGNTGPGADVTKRVTWPGIKK-LSEEEILKI  539

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  D  W+    +P+ PG  
Sbjct  540   TPAEYIQGD-AWIPGKGVPYIPGLF  563



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/583 (48%), Positives = 388/583 (67%), Gaps = 23/583 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVG-----RSGESADGGGEISTASKSVKEICA  3066
             G  ++NK++A+ GV++  LVA VVA TV+VG       GE       +S + K+VK +CA
Sbjct  5     GDAKRNKRLAIIGVSTFLLVAMVVAVTVNVGFNNKKEPGEETSKESHVSQSVKAVKTLCA  64

Query  3065  PTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDAL  2889
             PTDYK+ CE SL A A +  +PKELIK+AF +T+  I++ + K+ LL+EA+KD RT  AL
Sbjct  65    PTDYKKECEDSLIAHAGNITEPKELIKIAFNITIAKISEGLKKTHLLQEAEKDERTKQAL  124

Query  2888  DTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
             DTCK+++  SID+ +RS ++  NFD+  +      LKVWLSGAIT QETC+DAFENTT D
Sbjct  125   DTCKQVMQLSIDEFQRSLERFSNFDLNSLDRVLTSLKVWLSGAITYQETCLDAFENTTTD  184

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqee----  2541
              G+KMK +L+T+  +SSNGL++I   ++  + ++ P     RRLL     GEE       
Sbjct  185   AGKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPA---GRRLLKESVDGEEDVLGHGG  241

Query  2540  --EFPGFVD--AATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
               E P +VD  A  R+LL       ++  +VVAKDGSG + ++ EAL+ VP KN +  VI
Sbjct  242   DFELPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEALKHVPKKNLKPFVI  301

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVY E VEV + M  +VF+G+G  KTRITG+++  DG+GT+ TA+VAI GD F+  
Sbjct  302   YIKEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGVGTFKTASVAITGDFFVGI  361

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              IGFENSAG  KHQAVALRV +D +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+
Sbjct  362   GIGFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFV  421

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++  V QNC  +VRKP+ NQ+C+VTAQGRK++     +++Q   I+A+P        N
Sbjct  422   FGDSIAVLQNCTFVVRKPLENQQCIVTAQGRKEKNQPTGLIIQGGSIVADPKYYPVRLKN  481

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK+FSRT+ + T+I D++ PEG+  WQ   G    DTC+Y EY NRGPG+   
Sbjct  482   KAYLARPWKDFSRTIFLDTYIGDMITPEGYMPWQTPAGITGTDTCYYGEYNNRGPGSDVK  541

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             +RVKW+G K  I+ E A  F P  F   D+ W+   ++P+SPG
Sbjct  542   QRVKWQGVK-TITSEGAASFVPIRFFHGDD-WIRVTRVPYSPG  582



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/574 (50%), Positives = 385/574 (67%), Gaps = 15/574 (3%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC-ER  3036
             KK+A+  V S+ LVA VVA   +   +G + DG  ++S + KS++ +C  TDY+ETC   
Sbjct  7     KKIAIVSVCSLLLVAMVVALFTTRHGNGNT-DGEQDVSASQKSIQTLCQNTDYQETCVNS  65

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
               +   ++ DPKELI++AF+  ++ I DA + S +  E +KDPR  +AL++C+EL   +I
Sbjct  66    LTSSGSNSSDPKELIEIAFQAAIKQIRDAANNSTVFHEVEKDPRGKEALESCRELADRAI  125

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +DL+RSF K  NFD+  ++    DLK+WLSGAIT QETCID FE   GD  EKMK LLKT
Sbjct  126   NDLQRSFDKFNNFDITDVENILADLKIWLSGAITYQETCIDGFEEVPGDATEKMKELLKT  185

Query  2675  ANELSSNGLAMITHFTELLQSLEIPG--VNFKRRLLT----AETKGeeqeeEFPGFVDAA  2514
               E++SNGLAM+T  + +LQS+   G      RRLL+     +  G   +E  PG++D+ 
Sbjct  186   GMEMTSNGLAMVTGISSVLQSIGGLGSYTTTSRRLLSNNDIIQIIGNSDDE-MPGWIDSN  244

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR----AVPFKNDETVVIFIKAGVYNER  2346
              R LL +    IK ++VVAKDGSG Y +V EALR     +  KN++T V++IK GVY E+
Sbjct  245   RRNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTFVLYIKEGVYEEK  304

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V V   +  ++F+G+GPTKT+ITG  +  DG  TY TATVAIQGD FIAR+IGFENSAGA
Sbjct  305   VVVNSSLTNLMFLGDGPTKTKITGRLNFIDGTNTYQTATVAIQGDHFIARDIGFENSAGA  364

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRVSADM IF+NC +D YQDTLY H+YRQFYRDC ISGT+DFIFG++  VFQ 
Sbjct  365   EKHQAVALRVSADMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISGTIDFIFGDSAAVFQG  424

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C ++VRKP+ NQ+C+VTAQGRKD R    +VLQ+C  + +PA       NK +LGRPWKE
Sbjct  425   CSLVVRKPLDNQDCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYPVRNTNKAYLGRPWKE  484

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT+IM ++I D     GW  W     LDT +YAE+ NRGP ++   RVKW G K  + 
Sbjct  485   FSRTIIMESYISDSFQAAGWLPWFEDFALDTLFYAEFNNRGPSSNKTDRVKWHGIKE-LP  543

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              +  K+FT   FL   E+W+ R ++P+  GF+ P
Sbjct  544   AKRVKRFTADEFLDG-ERWIPRTKVPYDGGFIFP  576



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/564 (49%), Positives = 383/564 (68%), Gaps = 5/564 (1%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KK A+ G+AS+ LVA VVA T+    S         +S + K+++ IC PTDYKETC ++
Sbjct  7     KKFAILGIASLVLVAMVVAVTLGTQNSDTDNYNHQAVSDSQKAIQTICEPTDYKETCIKT  66

Query  3032  L-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             L A A ++ DPKELI+ AF+ T   I +A   S +L+E  KDPRT  AL+ CKEL H ++
Sbjct  67    LQAEAGNSTDPKELIQAAFKATTNYINEAAKNSTVLQELQKDPRTKLALENCKELAHQAV  126

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +DL+RSF K + FD ++I +   D+KVWLSGA+T Q+TC+D FE   GD GEKM+  L+T
Sbjct  127   EDLERSFAKFQTFDFSNIDDMLADIKVWLSGALTYQQTCLDGFEGAEGDAGEKMRQSLET  186

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             + EL+SNGLAMI   + +L SLE+P     RRLL+ +  G   +   P ++D   RRLL 
Sbjct  187   SMELTSNGLAMINDISSVLTSLELPAFT-NRRLLSDDILGHGMDI-LPSWIDEGRRRLLR  244

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P  +K D++VAKDGSG + ++ EAL  +    ++  V++IK GVY E+V   + +  +
Sbjct  245   AKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEKEFVLYIKEGVYEEKVTFHKNLLHL  304

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
               +G+GPTKTRITG  +  DG+ TYHTATVA+ GD FIA++IGFEN+AG  KHQAVA+RV
Sbjct  305   TVIGDGPTKTRITGKLNFIDGVPTYHTATVAVLGDFFIAKDIGFENAAGPEKHQAVAVRV  364

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMA  1956
              AD TIF+NCH D +QDTLY H+YRQFYR+C ISGT+DF+FG++  V QNC + VRKP+ 
Sbjct  365   GADKTIFYNCHFDGFQDTLYAHTYRQFYRNCKISGTIDFVFGDSAAVLQNCTLEVRKPLD  424

Query  1955  NQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTF  1776
             NQ+C+VTAQGRKD R    +VLQ+C  +A+PA        K +LGRPWKEFSRT+IM +F
Sbjct  425   NQQCIVTAQGRKDVRQPTGLVLQNCSFVADPAYFPYRFQLKSYLGRPWKEFSRTIIMESF  484

Query  1775  IDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPG  1596
             IDD++ PEGW  W G+  LDT +YAE+ NRGP ++   R +W G K   S  V ++F P 
Sbjct  485   IDDLIQPEGWLAWNGSFALDTLFYAEFNNRGPSSNKMLRAQWNGVKELPSSRV-ERFLPS  543

Query  1595  PFLMADEQWLGRAQIPFSPGFLQP  1524
              F+  +  W+  A++P++ GF+ P
Sbjct  544   KFIDGN-HWIKSARVPYNSGFIYP  566



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/566 (50%), Positives = 383/566 (68%), Gaps = 17/566 (3%)
 Frame = -1

Query  3206  VAVTGVASIFLVACVVAATVSVGRSGESADGGGE---ISTASKSVKEICAPTDYKETCER  3036
             +A+ G ++  L+  VV A + V R   S  G  +    +T SK++K IC PTDYKE CE 
Sbjct  25    LAIIGGSAAILLCMVVGAVIGVSRYNSSKGGSSDSRGFTTTSKAIKSICQPTDYKEICES  84

Query  3035  SLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNS  2859
             SL   A +  DPK L++ AF VT+  I DA   S +L+   KDPRTSDALD CK+LL  +
Sbjct  85    SLTKAAGNASDPKVLVEAAFNVTISYIRDAFDHSSVLQATAKDPRTSDALDDCKKLLDYA  144

Query  2858  IDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             ID+L+ SF K    DM H+ +  +DLK+WLS A+T QETC+D FEN TGD  E M+  L 
Sbjct  145   IDELRNSFTKFGQLDMNHVDDVIDDLKIWLSAAVTYQETCLDGFENITGDAAESMREALN  204

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             ++  L+SN LA+I   + +L ++ +P +  KRR L+ E +G  +   +P +V    RRLL
Sbjct  205   SSQALTSNALAIIDEISSVLSTVRVPFL--KRRFLSHEEEGSGE---YPSWVANGKRRLL  259

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                   IK +I+VA+DGSG YK++ EAL A+P  ++   VI+IK GVY E+V + + M  
Sbjct  260   ALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSIFVIYIKEGVYKEQVWLDKSMMN  319

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ GDGFIA+N+GFENSAGA KHQAVALR
Sbjct  320   VMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGDGFIAKNLGFENSAGAEKHQAVALR  379

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V +D +IF+NC +D +QDTLY+H+ RQFYRDCTI+GT+DFIFG+A  +FQNC + VRKP+
Sbjct  380   VQSDRSIFYNCQMDGFQDTLYSHTKRQFYRDCTITGTIDFIFGDAASIFQNCIIRVRKPL  439

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEP---ALKAANPPNKVFLGRPWKEFSRTLI  1788
             ANQ+C+VTA GRKDRR A AI+L +C I A+P    L+A NP    +LGRPWK +SRTL+
Sbjct  440   ANQQCIVTASGRKDRREATAIILHNCTIGADPDYLPLRARNPS---YLGRPWKPYSRTLV  496

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             + + IDD + P+GW  W G   L+TC+YAE  NRGPGA+  KRV WKGYK+ I    A++
Sbjct  497   VQSQIDDFIHPQGWLPWLGDFGLNTCFYAEVDNRGPGATIAKRVAWKGYKK-IDYSHAQK  555

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFL  1530
             FT   F+  +  WL    +P+ PG L
Sbjct  556   FTVEQFIQGNS-WLKPTGVPYIPGLL  580



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/565 (49%), Positives = 382/565 (68%), Gaps = 14/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ ++  V  ++S+ LV+ VVA T+ V  + ++     EI+ + K++K++CAPTDYK+TC
Sbjct  11    KRKRRYVVISISSVLLVSMVVAVTIGVSFNNDNGTKE-EITASVKAIKDVCAPTDYKKTC  69

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   AKDT DP EL++ AF  T++ I++   KS  + E  KDPRT  ALD C EL+ 
Sbjct  70    EDTLRKDAKDTSDPLELVRTAFNATMKQISNVGKKSLTMIELQKDPRTKMALDQCTELMD  129

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L +SF ++  F++  + +    LKVWLS  I+ ++TC+D F+ T GD GE MK  
Sbjct  130   YAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISHEQTCLDGFQGTQGDAGETMKKA  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ NGLAM++     L  +E+P +N  RRLL+ E         FP +VD   RR
Sbjct  190   LKTAVQLTHNGLAMVSEMLNYLGQMELPEMN-SRRLLSQE---------FPSWVDGRVRR  239

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    + +K D+VVA+DGSGQYK++ EAL+ VP KN+ T VI IK+G Y E V+V R M
Sbjct  240   LLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATFVIHIKSGTYKEYVQVNRTM  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +VF+G+GP K+ I+G++S KDGI TY TATVAI GD FIA+N+GFEN+AGA  +QAVA
Sbjct  300   PNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGDNFIAKNMGFENTAGALNYQAVA  359

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTI+GT+DF+FG+A  VFQNC ++VRK
Sbjct  360   VRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRK  419

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ANQ C +TA GR D R +   VLQ C I  E    A    +K +LGRPWKE+S+T+IM
Sbjct  420   PLANQACPITAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIM  479

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D +  EGWS WQG   LDT +Y+E +N GPGA+   RV W G K+ +S E   ++
Sbjct  480   ETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWPGIKK-LSEEEIVEY  538

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  D+ W+    +P++PGF 
Sbjct  539   TPAKYIQGDD-WIPGKGVPYTPGFF  562



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/570 (49%), Positives = 381/570 (67%), Gaps = 18/570 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE---ISTASKSVKEICAPTDYK  3051
             ++ K + +  ++S+ L++ VVA TV V  +   ++G  E   I+ + K+VK++CAPTDYK
Sbjct  10    KRKKSMVIISISSVLLISMVVAVTVGVTLNKSDSNGNSEDTEITPSVKAVKDVCAPTDYK  69

Query  3050  ETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             +TCE +L    K+T DP EL+K AFR+T+  ITDA  KS+ ++E  KDPRT  ALD CKE
Sbjct  70    KTCEDTLIKNGKNTTDPVELVKTAFRITMNQITDAAKKSQTMRELQKDPRTRMALDQCKE  129

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L+  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE M
Sbjct  130   LMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETM  189

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K  LKTA EL+ NGLA+I+  +  +  +++PG+N  RRLL  E          P +VD  
Sbjct  190   KKALKTAIELTHNGLAIISEMSNYVGQMQMPGLN-SRRLLADEV---------PSWVDQR  239

Query  2513  TRRLL-TTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
              RRLL    P S  K DIVVA+DGSGQY ++ +A++ VP K + T V+ IKAG+Y E V+
Sbjct  240   GRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVVHIKAGIYKEYVQ  299

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             V R M  +VF+G+GP KT I+G+++ KDGI TY TATVAI GD FIA+NIGFEN+AGA K
Sbjct  300   VNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIVGDHFIAKNIGFENTAGAIK  359

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVA+RV +D  IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC 
Sbjct  360   HQAVAVRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQNCT  419

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKP+ NQ C +TA GR+D R     V Q C I  EP   A    +K +LGRPWKE+S
Sbjct  420   LLVRKPLPNQACPITAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYS  479

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM +FI D V P+GW  W G   L T +Y+E QN GPGA+   RV W G K   + E
Sbjct  480   RTIIMNSFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNIGPGAALASRVTWAGIKTLSNEE  539

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + K F P  F+ +D  W+    +P+ PG L
Sbjct  540   ILK-FAPAEFIQSDA-WVPGKGVPYIPGLL  567



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 382/569 (67%), Gaps = 16/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRS----GESADGGGEISTASKSVKEICAPTDY  3054
             ++ K+  +  ++S+ L++ VVA TV V  +    G+   G G+++ + K++KE+CAPTDY
Sbjct  11    KKRKRYVIITISSVLLISMVVAVTVGVSLNKEDNGDGEGGNGQVTASVKAIKEVCAPTDY  70

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L   A +T DP EL+K AF VT++ I +A +KS+ L E  KDPRT  ALD CK
Sbjct  71    KKTCEDTLRKNANNTSDPLELVKTAFEVTMKQIAEAAAKSKTLIEIQKDPRTKMALDQCK  130

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  + D+LK SF ++  F+   + E   +L++WLS AI+ + TC++ FE T G+ GE 
Sbjct  131   ELMDYAFDELKSSFDELGKFEFHKLDEALINLRIWLSAAISHETTCLEGFEQTQGNAGET  190

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK  LKTA +L+ NGLA++T  ++ +  ++I G+N  RRLL++          +P +VDA
Sbjct  191   MKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLN-SRRLLSSN--------GYPSWVDA  241

Query  2516  ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
               RRLL      +K DIVVA+DGSGQY ++ EAL  VP K + T V+ IKAGVY E ++V
Sbjct  242   RARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIKAGVYKEYIQV  301

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+G +  KDGI TY T TVAI GD FIA++IGFEN+AGA KH
Sbjct  302   NKSMTDLVFIGDGPDKTIISGDKGFKDGITTYRTQTVAIVGDRFIAKDIGFENTAGAIKH  361

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +DM++F+NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC +
Sbjct  362   QAVAVRVQSDMSVFYNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTL  421

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR+D R     V Q C+I  EP   +    +K +LGRPWK +SR
Sbjct  422   LVRKPLPNQACPITAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSR  481

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V P+GW  W G   L T +Y+E QN GPG+    RV W G K+  + ++
Sbjct  482   TIIMNTFIPDFVQPQGWQPWNGDFGLSTLFYSEIQNTGPGSDVVNRVTWAGIKKLTNNDL  541

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               QFTP  F+  D  W+    +P++PGF 
Sbjct  542   L-QFTPAQFIQGDS-WIPATGVPYTPGFF  568



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/557 (49%), Positives = 365/557 (66%), Gaps = 8/557 (1%)
 Frame = -1

Query  3191  VASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSLAG-AKD  3015
             V  + LVA +VA TV V  + +      ++    K+++ IC PT YKETC+ SL   A D
Sbjct  16    VLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQPTTYKETCQSSLEKEAGD  75

Query  3014  TDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSF  2835
             T DPK+LIK  F+V  + + + I  S  LKE  KDP TS AL  CKELL  +++DL  + 
Sbjct  76    TTDPKDLIKAGFKVAADKVNEVIKNSNTLKEHAKDPMTSQALGVCKELLETAVEDLLGAV  135

Query  2834  QKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSN  2655
              K+  FD + I +Y  DLKVWLS A+  Q TC+DAF++T G+ GEKMK  LKTA EL+SN
Sbjct  136   DKMGPFDASKIDDYLADLKVWLSAAVNHQATCLDAFKDTKGEAGEKMKGFLKTAQELTSN  195

Query  2654  GLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE--FPGFVDAATRRLLTTDPAS  2481
             GLAM++  + L+ S   P +N  RRL+++   G+        PG++      LLT  P S
Sbjct  196   GLAMVSEISRLVGS---PKLNSHRRLMSSSKGGQRNRNYKPVPGWMSDRDLDLLTATPES  252

Query  2480  IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGE  2301
             +K ++VVAKDG+G+YK++ EAL+ VP K+ E  VI+IK GVY E V V ++M  +V +G+
Sbjct  253   LKPNVVVAKDGTGKYKTINEALKEVPQKSKEAFVIYIKKGVYEETVIVDKQMTNVVMIGD  312

Query  2300  GPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMT  2121
             GPT TRI+GS+S+ DG+ T  TAT A  G+ F+A+ IGFEN+AG  KHQAVALRV +D +
Sbjct  313   GPTMTRISGSKSHADGVTTMKTATFAALGNYFVAKGIGFENTAGHVKHQAVALRVQSDFS  372

Query  2120  IFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECM  1941
             IF NCH+DAYQDTLYT +YRQFYRDCTI+GTVDFIFG+   +FQNCKM+VRKP   Q CM
Sbjct  373   IFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKPGETQACM  432

Query  1940  VTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIV  1761
             VTAQGR D      I LQ+C I  EP   A    NK +LGRPWK F+R ++M + ID+ +
Sbjct  433   VTAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKNFARVVVMQSSIDEAI  492

Query  1760  VPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
              PEGW+ W G  Y   C++ EY N GPG+   +RVKW   KR ++P+ A  FTP      
Sbjct  493   APEGWTEWTGEEYHQNCFFGEYGNTGPGSDVTQRVKWSTVKR-LTPDQAAAFTPARVFEG  551

Query  1580  DEQWLGRAQIPFSPGFL  1530
             D +W+  + +P+ PG +
Sbjct  552   D-KWIKPSGVPYVPGMM  567



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/571 (49%), Positives = 379/571 (66%), Gaps = 19/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG----GGEISTASKSVKEICAPTDY  3054
             ++ K+  +  ++S+ L++ VVA TV V  +     G     G+I+ + K+VK+ICAPTDY
Sbjct  10    KRKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPTDY  69

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE SL     +T DP EL+K AF VT++ ITDA  KS+ + +  KDPRT  ALD CK
Sbjct  70    KKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQCK  129

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  ++ +L  SF+++   +   + E   +L++WLS AI+ +ETC++ F+ T G+ GE 
Sbjct  130   ELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISHEETCLEGFQGTQGNAGET  189

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N   RLL  E          P +V+ 
Sbjct  190   MKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN-SCRLLAQE---------IPSWVNQ  239

Query  2516  ATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               RRLL   ++ +  K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E V
Sbjct  240   RGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFVVHIKAGIYKEYV  299

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             +V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+AGA 
Sbjct  300   QVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIAKNIGFVNTAGAI  359

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC
Sbjct  360   KHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  419

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+
Sbjct  420   TLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEY  479

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   RV W G K   + 
Sbjct  480   SRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIKTLSNE  539

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E+ K FTP  ++  D  W+    +P++PG L
Sbjct  540   EILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/569 (49%), Positives = 384/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESAD--GGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  V  ++S+ L++ VVA TV V  +    D  G  E++ + K+VK++CAPTDY++
Sbjct  10    KRKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ + E  KD RT  ALD CKEL
Sbjct  70    TCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++D+L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G+ GE MK
Sbjct  130   MDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL          E FP +VD   
Sbjct  190   KALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL---------AEGFPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A   +K DIVVA+DGSGQYK++ EAL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M+ +VF+G+GP KT I+G+++ KDGI  Y TATVAI G+ FIA+NIGFEN+AGA KH
Sbjct  300   NKTMSHLVFIGDGPDKTIISGNKNYKDGITAYRTATVAIVGNYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQ+TLYTHS+RQF+RDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V P+GW  W G   L T +Y+E QN GPG++   RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEED  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +FTP  ++  D+ W+    +P++ G L
Sbjct  539   ILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/527 (51%), Positives = 369/527 (70%), Gaps = 8/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSEL  2931
             E++T SK+++ IC PTDY E C+ SLA  A +  DPK+L++L+F   ++++ +A + S +
Sbjct  57    ELTTTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAFNHSSV  116

Query  2930  LKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQ  2751
             L+EA KDPRTS+AL+ CKELL  +IDDLK S  +    DMA + +  +DLKVWLS  IT 
Sbjct  117   LQEAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDVVDDLKVWLSATITY  176

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NTTGD  + M   L +++ L+SN LA+I   + +L S ++  +   RRLL+
Sbjct  177   QQTCLDGFDNTTGDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLG--RRLLS  234

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              +   E +  EFP +V    R+LL      IK D+ VA+DGSG+YK++ +AL AVP K +
Sbjct  235   DD---EGERGEFPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGN  291

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T VI+IK GVY E V V R M  ++  G+GPTKT+ITGS +  DG  T+ TAT+A+ GD
Sbjct  292   ATFVIYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGD  351

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GFI +N+G EN+AGAAKHQAVALRV +D ++F+ C +D YQDTLYTH+ RQFYR+CTISG
Sbjct  352   GFIGKNLGVENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISG  411

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A VVFQNC M+VRKPMANQ+C+VTAQGRKDR  A  IVL +C I A+P L +
Sbjct  412   TIDFLFGDAAVVFQNCLMLVRKPMANQQCIVTAQGRKDRHEATGIVLHNCTISADPTLSS  471

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
             A+     +LGRPWKE+SRT+IM + ID ++  +GW  W G   L TC+Y E  NRGPGA+
Sbjct  472   ASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEFGLKTCFYTEIGNRGPGAA  531

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             T KRV WKGYK+ +    A ++T   F+   + WL +  +PF+PG +
Sbjct  532   TTKRVTWKGYKK-VDLTHAHKYTVQQFIQG-KTWLPKTGVPFTPGLM  576



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/587 (47%), Positives = 388/587 (66%), Gaps = 21/587 (4%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGG------GEISTASKSVKEI  3072
             MG   Q K++ + GV++  LVA VVA TVSVG + + A           ++++ K+VK +
Sbjct  1     MGGDAQKKRIVIIGVSTFLLVAMVVAVTVSVGLNNKGASEDETEARKSHVASSMKAVKTL  60

Query  3071  CAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             CAPTDY++ CE SL   A +  DP+ELIKLAF +T+  I+D + K++LL + + DPRT +
Sbjct  61    CAPTDYQKECEDSLNENAGNITDPRELIKLAFNITITRISDGLGKTQLLHDVESDPRTKE  120

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALDTCK+L+H SI++  RS Q+   F++  +      LKVWLSGA+T QETC+DAF+NTT
Sbjct  121   ALDTCKQLMHLSIEEFNRSLQRFNKFELNSLDRILTSLKVWLSGAVTYQETCLDAFDNTT  180

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK-----Gee  2550
              D G+KM+  L+TA  ++SNGLA+I+  ++ L  + +      RRLLTA         E 
Sbjct  181   TDAGKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSG--RRLLTAADDLPVLGHET  238

Query  2549  qeeEFPGFVDA--ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
              + + P +V++    RRLL          +VVAKDGSG + ++ +AL+ VP KN    +I
Sbjct  239   DDFDLPDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFII  298

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVY+E VEV R M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+A 
Sbjct  299   YIKEGVYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGVGTYKTASAAIIGDFFVAI  358

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              +GFEN+AGA KHQAVALRV +D +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+
Sbjct  359   GMGFENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHAMRQFYRDCIISGTIDFV  418

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  V QNC   VRKPMANQ+C+VTAQGRK+R   + I++    I+++P+       N
Sbjct  419   FGDAVAVLQNCTFEVRKPMANQQCIVTAQGRKERNQPSGIIIHGGSIVSDPSYYPVRFDN  478

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK FSRT+IM ++IDD++ P+G+  WQ   G   +DTC+Y+E  N GPGA   
Sbjct  479   KAYLARPWKNFSRTIIMDSYIDDLITPDGYMPWQTVEGLSGMDTCFYSEINNHGPGADKS  538

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KRVKW+G K ++S ++A  F P PF   D+ W+   ++P+  G   P
Sbjct  539   KRVKWEGIK-SLSNDMATTFLPSPFFHGDD-WIRVTRVPYDSGLPSP  583



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/577 (49%), Positives = 386/577 (67%), Gaps = 17/577 (3%)
 Frame = -1

Query  3230  GSPEQN--KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPT  3060
             G   QN  KK+A+ GV+++ LVA VVA TV V  S      GGE  ST++K+++ IC PT
Sbjct  3     GGEAQNMKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPT  62

Query  3059  DYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDP  + AL  
Sbjct  63    DYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSANQALQN  122

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +IDDL  SF K+  FD   +  Y  DLKVWLS A+T ++TC+D FENTTGD G
Sbjct  123   CKELLEYAIDDLGDSFDKLGPFDFTKLDAYVGDLKVWLSAAMTYEQTCLDGFENTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe-----eqeeE  2538
             EKM+  LKT+ EL+SNGLAM++  + L ++L I      RRLL A          ++ + 
Sbjct  183   EKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIKT---GRRLLQAAATATDENRFQRAKI  239

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAG  2361
              P ++D     L T  P ++K D+VV+  G G+YK++ EAL+ +P  N+  V VI++K G
Sbjct  240   IPAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVKEG  299

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++IGFE
Sbjct  300   VYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGFE  359

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A 
Sbjct  360   NTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  419

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LG
Sbjct  420   AVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYN--KELNKAYLG  477

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK ++R ++M + IDD++ PEGW  W GT   +TCW++E+ NRG GA   KRV W G 
Sbjct  478   RPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSGM  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  538   KK-LTPEHAADFTAGKFMFGD-RWILPSGVPYVAGMM  572



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/562 (51%), Positives = 384/562 (68%), Gaps = 34/562 (6%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KKVA+ G +SI LVA VV               GG IST+ K+++ IC PTDYKE C  S
Sbjct  15    KKVALMGFSSILLVAMVVGTV-----------AGGGISTSVKAIQAICQPTDYKEACVNS  63

Query  3032  LAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             L  AK +T DPKEL++ AF+V +  I+ A+  S  L++ +KDPRT  AL+ C EL+  +I
Sbjct  64    LTSAKANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCHELMDYAI  123

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             DDL+ SF K+  FD++ I +Y  DLK+WLSGA+T QETC+D FENTTGD GEKMK LLK+
Sbjct  124   DDLRNSFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTGDAGEKMKALLKS  183

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             A EL+SNGLAMI   + +L +L+IPG++  RRLL  +                  R+L  
Sbjct  184   AGELTSNGLAMIDEISSVLTNLQIPGIS--RRLLVGQ------------------RKLFQ  223

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P +IK +++VA+DGSG+YK++ EAL  +P   + T V+++K GVY E+V   + M  +
Sbjct  224   ATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKEQVNFTKSMTNV  283

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             + +G+GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFEN+AGA+KHQAVALRV
Sbjct  284   MLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAGASKHQAVALRV  343

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMA  1956
              +DM IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG++ VVFQNC ++VRKP+ 
Sbjct  344   GSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLD  403

Query  1955  NQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTF  1776
             NQ+C+VTAQGR +RR    IVLQ+C I A           K +LGRPWK FSRT+IM + 
Sbjct  404   NQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQ  463

Query  1775  IDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPG  1596
             IDD++ PEGW  W G   L+TC+YAEY NRGP ++T  RV W+G K+ I+ +    FT G
Sbjct  464   IDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQHVNDFTVG  522

Query  1595  PFLMADEQWLGRAQIPFSPGFL  1530
              F+ +   WLG + +P++   +
Sbjct  523   RFI-SGHLWLGASGVPYTSDMM  543



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/581 (48%), Positives = 386/581 (66%), Gaps = 28/581 (5%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESA----------DGGGEISTASKSV  3081
             G  ++ +++A+ GV+++ LVA VVA T+S+ ++              +    +++  K+V
Sbjct  4     GDAQKGRRIAIIGVSTLLLVAMVVAVTISINQNQNDVKDDFKDDLADNKKNHVASTLKAV  63

Query  3080  KEICAPTDYKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKD  2910
             + IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++E+  E +KD
Sbjct  64    QTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKD  123

Query  2909  PRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDA  2730
             PR+ DALDTCK+L+H SI +  RS   +  FD+ H+ +   +LKVWL+GA+T  +TC+D 
Sbjct  124   PRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDG  183

Query  2729  FENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee  2550
             FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F RRLL        
Sbjct  184   FENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRRLL--------  234

Query  2549  qeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIF  2373
             Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP + DET  VI+
Sbjct  235   QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIY  294

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQGD F A N
Sbjct  295   IKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAIN  354

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +GFENSAG  KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDCTISGT+DF+F
Sbjct  355   MGFENSAGPQKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+  G +AIV+Q   I+A+P        +K
Sbjct  415   GNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHK  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDK  1662
              +L RPWK FSRT+IM TFIDD++ P+G+  W    G + +DTC+YAEY N GPG++  K
Sbjct  475   SYLARPWKNFSRTIIMDTFIDDLIHPDGFFPWHTEVGPINMDTCFYAEYHNYGPGSNKSK  534

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             RVKW G   NI+ + A +F P  F    + W+    IP+ P
Sbjct  535   RVKWAGI-YNINSKAAHRFAPSKFFHGGD-WIKDTGIPYFP  573



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/567 (49%), Positives = 376/567 (66%), Gaps = 15/567 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESAD--GGGEISTASKSVKEICAPTDYKE  3048
             ++ K+  V  V+S+ L++ VVA T+ V  +         GEI+ + K++K++CAPTDYK+
Sbjct  11    KKKKRYVVISVSSVLLISMVVAVTIGVNVNNNDNGGDSDGEITASVKAIKDVCAPTDYKK  70

Query  3047  TCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L   AK+T DP EL+K AF  T++ I+D   KS+ + +  KDPRT  ALD CKEL
Sbjct  71    TCEDTLKKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIDLQKDPRTKMALDQCKEL  130

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L +SF+++  F++  + E    LK+WLS  I+ ++TC++ F+ T GD GE +K
Sbjct  131   MDYAVGELSKSFEELGKFELNKVDEALVKLKIWLSATISHEQTCLEGFQGTQGDAGETIK  190

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+ E         FP ++D   
Sbjct  191   KALKTAVQLTHNGLAMVTEMSNYLGQMQIPELN-SRRLLSQE---------FPSWMDGRA  240

Query  2510  RRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPR  2331
             R+LLT   + +K DIVVA+DGSGQY ++ EA+  VP K + T V+ IKAG+Y E V+V R
Sbjct  241   RKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKNMTFVVHIKAGIYKEFVQVNR  300

Query  2330  KMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQA  2151
              M  +VF+G+GP KT I+GS+S KDGI TY T TVAI GD FIA+N+GFEN+AGA KHQA
Sbjct  301   SMTHLVFIGDGPDKTVISGSKSFKDGITTYRTTTVAIVGDHFIAKNMGFENTAGAIKHQA  360

Query  2150  VALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIV  1971
             VA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC  +V
Sbjct  361   VAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTFLV  420

Query  1970  RKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKP+ NQ C +TA GRKD R     VLQ C I  E    A    +K +LGRPWKE+SRT+
Sbjct  421   RKPLPNQACPITAHGRKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTI  480

Query  1790  IMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM TFI D + PEGW  W     L+T +Y+E +N GPGA    RV W G K+    E+ K
Sbjct  481   IMNTFIPDFIPPEGWQPWLDNFGLETLFYSEVRNTGPGAPAMNRVTWPGIKKLGEEEILK  540

Query  1610  QFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              FTP  ++  D  W+    +P++PG  
Sbjct  541   -FTPAQYIQGD-AWIPGKGVPYTPGLF  565



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 380/573 (66%), Gaps = 22/573 (4%)
 Frame = -1

Query  3227  SPEQNKKVAVTGVASIFLVACVVAATVSVGR-SGESAD--GGGEISTASKSVKEICAPTD  3057
             S  + KK  + GV +  LV  VVA  +   R +  ++D     +I T + +V+ +CAPTD
Sbjct  5     SELKKKKCIIAGVITALLVIMVVAVAIITSRNTSHNSDKIAPVQIKTTTNAVEAVCAPTD  64

Query  3056  YKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALD  2886
             YKETC  SL  A  D+  P +LIKL F VT+ +I D I K+  EL  +A  D  T  AL+
Sbjct  65    YKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIKDGIKKASAELKAKAANDNETKGALE  124

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C++L++++ DDLK+     + F +  I+++  DL+VWLSG+I  Q+TC+D FE    + 
Sbjct  125   LCEKLMNDATDDLKKCLDNFDGFSITQIEDFVEDLRVWLSGSIAYQQTCMDTFEEIKSNL  184

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqee  2541
              + M  + KT+ EL+SNGLAMIT+ + LL    I G+     N+ R+LL+ E       +
Sbjct  185   SQDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDLGNYARKLLSTE-------D  237

Query  2540  EFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAG  2361
               P +V   TR+L+ T    +K ++VVA+DGSGQYK++ EAL  VP  N +  VI+IK G
Sbjct  238   GIPSWVGPNTRQLMATK-GGVKANVVVAQDGSGQYKTINEALNIVPKANQKPFVIYIKQG  296

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGF  2184
             VYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD F A+NIGF
Sbjct  297   VYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNFYIGKVKTYHTATVAINGDHFTAKNIGF  356

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG   HQAVALRVS D  +F+NC ID YQDTLY HS+RQF+RDCTISGTVDFIFG+A
Sbjct  357   ENTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFGDA  416

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
              VV QNC ++VRKPM  Q CM+TAQGR D R ++ +VLQ+C I  EPA       NK +L
Sbjct  417   KVVLQNCNIVVRKPMKGQSCMITAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKAYL  476

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKEFSRT+IM T ID+I+ P GW  W G   L+T +YAEY+N GPG+   +RVKW G
Sbjct  477   GRPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALNTLYYAEYENNGPGSDQAQRVKWPG  536

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              K+ ISP+ A++FTP  FL  +  W+   ++P+
Sbjct  537   IKK-ISPKQARRFTPARFLRGN-LWIPPNRVPY  567



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/571 (48%), Positives = 389/571 (68%), Gaps = 16/571 (3%)
 Frame = -1

Query  3218  QNKK-VAVTGVASIFLVACVVAATVSVGRSGE------SADGGGEISTASKSVKEICAPT  3060
             QNKK  A+ GV+S+ LVA VVA TV V  + +      + +   EIS++ K++K IC PT
Sbjct  9     QNKKRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKAICQPT  68

Query  3059  DYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+ C  SL A   ++ DP+EL++  F+  ++ I  A +KS  LK+ +KDPRTS AL  
Sbjct  69    DYKQECIASLKATGNNSSDPQELVQAGFKAAMKLIQAAANKSVDLKQLEKDPRTSKALAG  128

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +ID+LK S  K+  FD+  + E   D+++WLS  IT QETC+D F+NTTG+  
Sbjct  129   CKELMDFAIDELKYSMNKLGEFDITKLDEMLIDIRIWLSATITYQETCLDGFQNTTGNAA  188

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             EKMK  LKT+ +LSSNGLAM++ F+ +L  L+IPG++ +RRLL     G +    +P + 
Sbjct  189   EKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGIS-RRRLLEIPVLGHDD---YPDWA  244

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP-FKNDETVVIFIKAGVYNER  2346
             +   RRLL    + +K ++VVAKDGSGQ++++  AL  VP  KN+ T VI IKAGVY E 
Sbjct  245   NPGMRRLLAAG-SRVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQEY  303

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             +++ + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  + F+AR+IGFEN+AG 
Sbjct  304   LQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAVTAEHFMARDIGFENTAGP  363

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV AD  +F+NC +  YQDTLY H+ RQFYRDCT+SGT+DFIFG+A  +FQ 
Sbjct  364   QKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQG  423

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C I A+  L       + FLGRPWKE
Sbjct  424   CTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKE  483

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG++  KRVKW+G K  I+
Sbjct  484   YSRTIIMESYIGDLIQPEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVKWRGIK-TIT  542

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             P+ A  FT G F+M D +W+    +P+  G 
Sbjct  543   PQHALDFTAGRFVMGD-RWIKPTGVPYVSGM  572



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/586 (50%), Positives = 387/586 (66%), Gaps = 34/586 (6%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVG------------RSGESADGGGEISTASKSVKEIC  3069
             +++A+  V+  FLV+ VVA TV  G            + G S D     S ++K++K IC
Sbjct  13    RRIAIIVVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSIDK----SASTKAIKAIC  68

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PTDYK+ C  SL + A +T DP +LIK+ F+ T++ I +A  KS LL++ +KDPRTS A
Sbjct  69    QPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQKLEKDPRTSMA  128

Query  2891  LDTCKELLHNSIDDLKRSFQKV---ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFEN  2721
             LDTCKEL+  ++D+L++SF +V   ENF  +  K +  DLKVWLS +IT QE+C+DAFEN
Sbjct  129   LDTCKELMELAVDELRQSFNRVGDIENF--SKYKTFIMDLKVWLSASITYQESCLDAFEN  186

Query  2720  TTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             TT   D G++MK LLKT+  LSSNGLAM++     L  L  P  +  RR       G   
Sbjct  187   TTSSTDAGQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRRRRLLSLDGLPI  246

Query  2546  e----eEFPGFVDAATRRLLTTD----PASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
                   EFP + +A  R+LLT      P + K D VVAKDGSG YK++ EAL  VP   +
Sbjct  247   LGHGDLEFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEALEHVPKYGN  306

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             ET VI+IK GVYNE V V R M  ++ +G+G  KTRITG+++  DG  TY TATVAI GD
Sbjct  307   ETFVIYIKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTPTYRTATVAIHGD  366

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A +IGF+NSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH++RQFYRDCTISG
Sbjct  367   HFMAMDIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISG  426

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  +FQNC  +VRKP+ +Q C+VTAQGRK+RR  +AIV+Q+  I A+P    
Sbjct  427   TIDFVFGDAAAIFQNCTFVVRKPLPDQSCIVTAQGRKERRQPSAIVIQNSTITADPDYFP  486

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 N+ +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y E+ N GP A+
Sbjct  487   VKNVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLRTCFYTEFCNTGPAAN  546

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
               +RV W+G K+ I+   A QFTPG F   DE W+  + +P  PG 
Sbjct  547   KARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPCVPGL  590



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/569 (49%), Positives = 379/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ K+  V  ++S+ L++ VVA TV  S+ +    +DG GEI+++ K+VK++CAPTDYK+
Sbjct  10    KRKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDYKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L     +T DP EL+K AF+ T++ ITDA  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   ++++WLS AI+ +ETC++ F++T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL          +  P +VD   
Sbjct  190   KALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLA---------QGIPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A    K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+G  KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+AGA KH
Sbjct  300   NKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG++  VFQNC +
Sbjct  360   QAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEE  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                FTP  ++  D  W+    +P++PG L
Sbjct  539   VLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/587 (47%), Positives = 385/587 (66%), Gaps = 8/587 (1%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             M    + + V +  V S+ LVA VVA  +++ +  +S + G +++T+ K+++ IC  T Y
Sbjct  1     MAGNNRKRNVTIISVCSLILVAMVVAVAITM-KGKDSDNNGQDVTTSQKAIESICQTTRY  59

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             + TC  SL + A+ + DPKELI+ +F+VT+E I +AI  S +L++ +KDPR   AL+ C+
Sbjct  60    QHTCVESLESSAEGSSDPKELIQKSFQVTMEKIKEAIENSTMLQKLEKDPRAKLALENCQ  119

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT QETC+D FE TTG+T EK
Sbjct  120   KLAWQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEKTTGETEEK  179

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq-eeEFPGFVD  2520
             MK  L ++ EL+SN L MIT  + +  SL     + +RRLL  E        E  P +VD
Sbjct  180   MKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRRLLFDEAPVLGHGNELLPDWVD  239

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
                RRLL      IK DIVVAKDGSG+YK++ EAL+ +P   ++T V++IK G+YNE+VE
Sbjct  240   MRRRRLLAA--KEIKPDIVVAKDGSGKYKTINEALKNIPNNRNQTYVLYIKQGIYNEKVE  297

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
                 M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ GD FIA++IGFENSAG  K
Sbjct  298   FTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFIAKDIGFENSAGPEK  357

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV+AD +IF+NCHID YQDTL  H+YRQFYRDC I GT+DF+FG+   VFQNC 
Sbjct  358   HQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFVFGDGAAVFQNCT  417

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +        K +LGRPWKE+S
Sbjct  418   LAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYNEVKGEVKTYLGRPWKEYS  477

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+S  +RVKW+G K  +   
Sbjct  478   RTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKKERVKWQGVKE-LQIN  536

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
               ++FT   FL  D  W+    IP++PG FL P  +   +   P  D
Sbjct  537   RVQRFTASQFLDGD-AWIPSTGIPYTPGFFLSPPQQDTSVEYSPVDD  582



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 379/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ K+  V  ++S+ L++ VVA TV  S+ +    +DG GEI+++ K+VK++CAPTDYK+
Sbjct  10    KRKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDYKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L     +T DP EL+K AF+ T++ ITDA  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   ++++WLS AI+ +ETC++ F++T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISHEETCLEGFQDTKGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL          +  P +VD   
Sbjct  190   KALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLA---------QGIPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R+LL    A    K DIVVA+DGSGQY ++ +AL+ VP K + T V+ IKAG+Y E V+V
Sbjct  240   RKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTTFVVHIKAGIYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+G  KT I+G++S KDGI TY TATVAI GD FIA+NIGFEN+AGA KH
Sbjct  300   NKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYFIAKNIGFENTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTISGT+DF+FG++  VFQNC +
Sbjct  360   QAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R +   V Q C I  EP   A    +K +LGRPWKE+S+
Sbjct  420   LVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSK  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D + P+GW  W G   L T +Y+E +N GPGA    RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEE  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                FTP  ++  D  W+    +P++PG L
Sbjct  539   VLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/571 (49%), Positives = 384/571 (67%), Gaps = 16/571 (3%)
 Frame = -1

Query  3218  QNKK-VAVTGVASIFLVACVVAATVSVGRSGE------SADGGGEISTASKSVKEICAPT  3060
             QNKK  A+ GV+S+ LVA VVA TV V  + +      + +   EIS++ K++K IC PT
Sbjct  9     QNKKRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKAICQPT  68

Query  3059  DYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+ C  SL A   ++ DPKEL++  F+  ++ I  A +KS  L + +KDPR S AL  
Sbjct  69    DYKQECVASLKATGNNSSDPKELVQAGFKAAMKLIQAAANKSVALNQLEKDPRASKALAG  128

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +ID+LK S  K+  FD++ + E   D+++WLS  IT QETC+D F NTTG+  
Sbjct  129   CKELMDFAIDELKYSMNKLGEFDISKLDEMLIDIRIWLSATITYQETCLDGFANTTGNAA  188

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             EKMK  LKT+ +LSSNGLAM++  + +L  L+IPG++ +RRLL     G +    +P + 
Sbjct  189   EKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGIS-RRRLLEIPVLGHDD---YPDWA  244

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP-FKNDETVVIFIKAGVYNER  2346
             +   RRLL    + +K ++VVAKDGSGQ+K++ EA+  VP  KN+ T VI IKAGVY E 
Sbjct  245   NPGMRRLLAAG-SKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQEY  303

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V V + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  + F+AR+IGFEN+AG 
Sbjct  304   VLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAVTAEHFMARDIGFENTAGP  363

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV AD  +F+NC +  YQDTLY H+ RQFYRDCT+SGT+DFIFG+A  +FQ+
Sbjct  364   QKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQS  423

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C       L       + FLGRPWKE
Sbjct  424   CTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKE  483

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG+   KRVKW+G K NI+
Sbjct  484   YSRTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGIK-NIT  542

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             P+ A  FTPG FL  D +W+    +P+  G 
Sbjct  543   PQHAVDFTPGRFLKGD-RWIKPTGVPYVSGL  572



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/572 (49%), Positives = 380/572 (66%), Gaps = 18/572 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVG---RSGESADGGGEISTASKSVKEICAPTDYKE  3048
             + KK A+ G +++ LVA VVA TV      R G S+DG    ST++K+++ IC PTDYK+
Sbjct  9     KKKKFAIIGASALILVAMVVAVTVGGTVSRRGGGSSDG--HTSTSTKAIQAICQPTDYKK  66

Query  3047  TCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE SL+GA  +  DPKELIK+ F+VT++ +   I KS  LK+  KDP T DAL  CKEL
Sbjct  67    TCEESLSGAAGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLKDLAKDPSTGDALQNCKEL  126

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             L  +IDDL  SF ++  FDM+ +  Y  DLKVWLS A+T ++TC+D FENTTGD GEKM+
Sbjct  127   LEYAIDDLGDSFDRIGAFDMSKLDLYVEDLKVWLSAAMTYEQTCLDGFENTTGDAGEKMR  186

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAET----KGeeqeeEFPGFV  2523
               LKT+ EL++NGLAM+   + +  +L    V   RRLL A      K  ++ +  P ++
Sbjct  187   EFLKTSQELTNNGLAMVDQVSTMFGALN---VKSGRRLLEATAGTGAKKFQKAKVIPAWI  243

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVYNER  2346
             D     L T  P ++K D+VVAK G G+Y +V EAL+ +P  N   V VI++K GVY E 
Sbjct  244   DNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKDNAVKVFVIYVKEGVYEEH  303

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V   + M  ++ +G+GPTKT ITG ++  +G  T  TATV + GD FIA++IGFEN+AGA
Sbjct  304   VLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTKTMQTATVGVVGDYFIAKDIGFENTAGA  363

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
               HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  VFQN
Sbjct  364   VGHQAVALRVQSDLSIFYNCKMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQN  423

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CKMIVRKP+ NQ CMVTA GR DRR    I+LQ+C I  EP  +     NK +LGRPWK 
Sbjct  424   CKMIVRKPLENQACMVTAHGRLDRRSPTGIILQNCTISGEPGYE--KDLNKAYLGRPWKN  481

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             ++R ++M + IDD++ PEGW  W G+    +CW+ E+ NRG GA   KR  W+G K  ++
Sbjct  482   YARAIVMQSQIDDVIAPEGWMEWIGSNNHQSCWFGEFGNRGLGADQTKRATWRGIKE-LT  540

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + A  FT G F+  D +W+  + +P+  G +
Sbjct  541   AQHAADFTAGRFVFGD-RWIQPSGVPYVAGMM  571



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 379/569 (67%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG--GGEISTASKSVKEICAPTDYKE  3048
             ++ ++ AV  ++S+ L++ +VA T+S+ ++  + D    GE++ + K+VK++CAPTDYK+
Sbjct  10    KKKRRYAVILISSVLLISMIVAVTISLNKNEANGDSKSNGELAASVKAVKDVCAPTDYKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L     +T DP EL+K AF VT++ ITDA  KS+ + +  KDPRT  ALD CKEL
Sbjct  70    TCEDTLLKNGHNTTDPMELVKTAFSVTMKQITDAAKKSQTMMDLQKDPRTRMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ F+ T G  GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGTQGKAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  + IP +N  RRLL+ +          P +VD   
Sbjct  190   KALKTAIELTHNGLAIISEMSSFVGQMGIPELN-SRRLLSQD---------IPSWVDQRG  239

Query  2510  RRLLTTDP--ASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             R LL      +  K DIVVA+DGSGQY ++ +A++ VP K + T V+ IKAGVY E V+V
Sbjct  240   RSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTTFVVHIKAGVYKEYVQV  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI GD FIA+NIGF N+AGA KH
Sbjct  300   NKSMTHLVFIGDGPDKTIISGSKNYKDGITTYRTATVAIIGDYFIAKNIGFVNTAGAIKH  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R +   V Q C I  EP   A    +K +LGRPWKE+SR
Sbjct  420   LVRKPLPNQACPITAHGRKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D + P+GW  W G   LDT +Y+E QN GPGA+   RV W G K  +S E 
Sbjct  480   TIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNIGPGAALAGRVTWPGIK-TLSDEE  538

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                FTP  ++  D  W+    +P++PG L
Sbjct  539   ILSFTPDQYIQGD-VWVPGKGVPYTPGLL  566



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/523 (50%), Positives = 364/523 (70%), Gaps = 7/523 (1%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEA  2919
             + K+++ IC PT YKETC+ SL   A DT DPKEL+K  F+V  + + + I  S+ LK+ 
Sbjct  45    SKKAIEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDL  104

Query  2918  DKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETC  2739
              KDP  S ALD CKELL+ +++DL  +  K+  F+++ + +Y  DLKVWLS A+  Q TC
Sbjct  105   AKDPMASQALDICKELLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATC  164

Query  2738  IDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK  2559
             +DAF++T G+ G+KMK  LKTA EL+SNGLAM T  + LL SL +   N  RRLL+AE K
Sbjct  165   VDAFKDTKGEAGDKMKGFLKTAQELTSNGLAMATQISSLLGSLNL---NSHRRLLSAE-K  220

Query  2558  GeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVV  2379
              +   +  P ++ A   +LLT  P ++K ++VVA+DG+G+YK++ EAL+ VP K++ET V
Sbjct  221   SKRNYQAVPSWMGARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFV  280

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             I+IK GVY E++ + R+M  +  +G+GPTKT+I+G+++  DG  T HTAT A  GD F+A
Sbjct  281   IYIKEGVYKEQIIIDRQMTNVFMIGDGPTKTKISGNKNKADGTATMHTATFAAVGDYFVA  340

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             ++I FEN+AG  KHQAVALRV +D +IF+NCH+DAYQDTLYT +YRQ+YRDCTI+GTVDF
Sbjct  341   KDIRFENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDF  400

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+   +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    
Sbjct  401   IFGDGVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDK  460

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK+F+R ++M + ID+ + PEGW  W G+M+ +TC+  EY N+GP A   +R
Sbjct  461   NKAYLGRPWKDFARVVVMQSQIDEAIQPEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQR  520

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKW   K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  521   VKWPSLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  561



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   556 bits (1433),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 271/565 (48%), Positives = 373/565 (66%), Gaps = 14/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ ++ A+  ++S+ LV+ VVA T+ V  +        EI+ + K++KE+CAPTDYK+TC
Sbjct  11    KRKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTC  70

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   AKDT DP EL++ AF VT++ IT+   KS+ + E  KDPRT  ALD CKEL+ 
Sbjct  71    EDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMD  130

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L  SF ++  F+   + E    +KVWLS  IT ++TCID F+ T GD GE +K  
Sbjct  131   YAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITHEQTCIDGFKGTKGDAGETIKKA  190

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ N LAM+T  +  L  ++   ++  RRLL  E          P +VD   RR
Sbjct  191   LKTAVQLTHNALAMVTEMSNYLGQMQFTELS-SRRLLAQE----------PSWVDGRVRR  239

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LLT   + +K D+VVA+DGSGQYK++ EA++ VP   + T V++IK GVY E V+V R M
Sbjct  240   LLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQVDRTM  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             + +VF+G+GP KT ITG +S +DGI TY TATVAI GD FIA+N+GF+N+AGAAKHQAV 
Sbjct  300   SDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAGAAKHQAVG  359

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRK
Sbjct  360   IRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRK  419

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GR+D +     VLQ C I  E    A    +K +LGRPWK +S+T+IM
Sbjct  420   PLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIM  479

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D +  EGW  W+G   +DT +Y+E +N GPGA    RV W G K+ +S E    +
Sbjct  480   DTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSDEDILGY  538

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  DE W+    +P++PG  
Sbjct  539   TPAKYIQGDE-WIPSKGVPYTPGLF  562



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   551 bits (1420),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/519 (50%), Positives = 359/519 (69%), Gaps = 8/519 (2%)
 Frame = -1

Query  3083  VKEICAPTDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDP  2907
             ++ IC PT YKETC+ SL   A DT DPKEL+K  F+V  + + + I  S+ LK+  KDP
Sbjct  51    IEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKDP  110

Query  2906  RTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAF  2727
               S ALD CKE+L+ +++DL  +  K+  F+++ + +Y  DLKVWLS A+  Q TC+DAF
Sbjct  111   MASQALDVCKEMLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATCVDAF  170

Query  2726  ENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             ++T G+ G+KMK  LKTA EL+SNGLAM+T  + LL SL +   N  RRLL+A +K    
Sbjct  171   KDTKGEAGDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNL---NSHRRLLSAHSK--RN  225

Query  2546  eeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
              +  P ++ A   +LLT  P S+K ++VVA+DGSG+YK++ EAL+ VP K++ET VI+IK
Sbjct  226   YQAVPSWMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIK  285

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVY E + + R+M  +  +G+GPTKT+I+GS++  DG  T HTAT A  GD F+A++I 
Sbjct  286   EGVYKEEIIIDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGDYFVAKDIR  345

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FEN+AG  KHQAVALRV +D +IF+NCH+DAYQDTLYT +YRQ+YRDCTI+GTVDFIFG+
Sbjct  346   FENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGD  405

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
                +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK +
Sbjct  406   GVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAY  465

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+F+R ++M + ID+ + PEGW  W G+ + +TC+  EY NRGP A   +RVKW 
Sbjct  466   LGRPWKDFARVVVMNSQIDEAIQPEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWP  525

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  526   SLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  562



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   552 bits (1422),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 290/581 (50%), Positives = 383/581 (66%), Gaps = 32/581 (6%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVG------------RSGESADGGGEISTASKSVKEIC  3069
             +++A+  V+  FLV+ VVA TV  G            + G S D     S ++K++K IC
Sbjct  13    RRIAIIAVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSTDK----SASTKAIKAIC  68

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PTDYK+ C  SL + A +T DP +LIK+ F+  ++ I +A  KS LL++ +KD RTS A
Sbjct  69    QPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQKLEKDHRTSMA  128

Query  2891  LDTCKELLHNSIDDLKRSFQKV---ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFEN  2721
             LDTCKEL+  ++D+L +SF ++   ENF     K +  DLKVWLS +IT QE+C+DAFEN
Sbjct  129   LDTCKELMELAVDELNQSFNRLGDTENF--YKYKTFIMDLKVWLSASITYQESCLDAFEN  186

Query  2720  TTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             TT   D GE+MK LLKT+  LSSNGLAM+      L  L  P  + +RRLL+ +      
Sbjct  187   TTSSNDAGEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRRLLSFDGLPILG  246

Query  2546  e--eEFPGFVDAATRRLLT--TDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                 E P + +A  R+LLT  T PA   H  D VV+KDGSG YK++ EAL  VP   +ET
Sbjct  247   HGDLELPEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALEHVPKYGNET  306

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI+IK GVYNE V V R M  ++ +G+G  KTRITG+ +  DG  TY TA VAI GD F
Sbjct  307   FVIYIKEGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTPTYRTAAVAIHGDHF  366

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +A +IGFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH++RQFYRDCTISGT+
Sbjct  367   MAMDIGFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQFYRDCTISGTI  426

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DF+FG+A  +FQNC  +V KP+ +Q C+VTAQGRK+ R  +AIV+Q+  I A+P      
Sbjct  427   DFVFGDAAAIFQNCTFVVHKPLPDQSCIVTAQGRKEGRQPSAIVIQNSTITADPDYFLVK  486

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
               NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y E++N GP A+  
Sbjct  487   NVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLRTCFYTEFRNTGPAANKA  546

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             +RV W+G K+ I+   A QFTPG F   DE W+  + +P+S
Sbjct  547   RRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPYS  585



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   551 bits (1419),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 278/575 (48%), Positives = 381/575 (66%), Gaps = 15/575 (3%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S      GGE  ST++K+++ IC PTDY
Sbjct  4     GEVQNKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  3053  KETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V +  + + I  S  LKE  KD R + AL  CK
Sbjct  64    KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKELAKDSRANQALQNCK  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL  +IDDL  SF K+  FD   +  Y  DLKVWLS A+T ++TC+D F+NTTGD G K
Sbjct  124   ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-----TAETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L ++L I      RRLL       +    ++ +  P
Sbjct  184   MRQFLKTSQELTSNGLAMVSEVSTLFKALNIKT---GRRLLQDAATATDENRFQRAKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  241   AWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA+++GFEN+
Sbjct  301   DEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGFENT  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  361   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LGRP
Sbjct  421   FQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRP  478

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             W   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W G K+
Sbjct  479   WTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK  538

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  539   -LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   550 bits (1417),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 377/563 (67%), Gaps = 16/563 (3%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             N KVA   V++I LVA V    V++    +S     + S++ K++K+ C PTDY+ETCE 
Sbjct  3     NMKVAALSVSAIVLVAIVATVAVTISNL-DSEPAKTQFSSSQKNIKDFCNPTDYQETCES  61

Query  3035  SL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNS  2859
             +L A A ++ DPKEL+ LAF++T++ I +A + S +L EA K+PRTSDAL+ C+ELL  +
Sbjct  62    TLSAAAGNSTDPKELVNLAFQITIDQIKEAFNHSTVLSEAAKNPRTSDALENCRELLDYA  121

Query  2858  IDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             IDDL+ S  ++E F +  + ++ +DLKVW+S +IT QETC+D FENTT +  E M+  L 
Sbjct  122   IDDLRSSIDQLEGFSLIKLDKFLDDLKVWISASITYQETCLDGFENTTTNAAESMRKALN  181

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             ++ E++SN LA++ +    L SL +      R+LL  E         +P +V    RRLL
Sbjct  182   SSAEMTSNILAIVINLDNTLDSLNL---GISRKLLAEE---------YPSWVSLGKRRLL  229

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                PA +K ++ VA+DG+G  K++ +AL  VP K++ T VI+IK GVY E+V+V R +  
Sbjct  230   QLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKEKVQVNRSLTN  289

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             ++ VG+G  KT+ITGS +  DG  T+ TATVA+ GDGFI +++  ENSAGAAKHQAVALR
Sbjct  290   VIMVGDGTNKTKITGSLNYIDGTATFKTATVAVIGDGFIGKDLWIENSAGAAKHQAVALR  349

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V +D ++F+N  ID YQDTLY H+ RQFYRDC ISGT+DFIFG+   V QNC ++ RKPM
Sbjct  350   VQSDKSVFYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQNCLILARKPM  409

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ+ +VTAQGRKDRR A AIVL +C I A+PA          FLGRPWKEFSRT ++ +
Sbjct  410   DNQQNIVTAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQS  469

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              +DD++ P+GW  W     L+TC+Y E  NRGPGA+T +RVKWKG K  I    A++FT 
Sbjct  470   QLDDLIDPKGWLPWFENFGLNTCFYTELDNRGPGANTSQRVKWKGVK-TIGYAHAQKFTV  528

Query  1598  GPFLMADEQWLGRAQIPFSPGFL  1530
               F+  +  WL ++ +P+ PG L
Sbjct  529   EHFIQGN-TWLPKSGVPYIPGLL  550



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   555 bits (1430),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 271/565 (48%), Positives = 373/565 (66%), Gaps = 14/565 (2%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ ++ A+  ++S+ LV+ VVA T+ V  +        EI+ + K++KE+CAPTDYK+TC
Sbjct  11    KRKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTC  70

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E +L   AKDT DP EL++ AF VT++ IT+   KS+ + E  KDPRT  ALD CKEL+ 
Sbjct  71    EDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMD  130

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +I +L  SF ++  F+   + E    +KVWLS  IT ++TCID F+ T GD GE +K  
Sbjct  131   YAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITHEQTCIDGFKGTKGDAGETIKKA  190

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LKTA +L+ N LAM+T  +  L  ++   ++  RRLL  E          P +VD   RR
Sbjct  191   LKTAVQLTHNALAMVTEMSNYLGQMQFTELS-SRRLLAQE----------PSWVDGRVRR  239

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LLT   + +K D+VVA+DGSGQYK++ EA++ VP   + T V++IK GVY E V+V R M
Sbjct  240   LLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQVDRTM  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             + +VF+G+GP KT ITG +S +DGI TY TATVAI GD FIA+N+GF+N+AGAAKHQAV 
Sbjct  300   SDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRFIAKNMGFQNTAGAAKHQAVG  359

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRK
Sbjct  360   IRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRK  419

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ C +TA GR+D +     VLQ C I  E    A    +K +LGRPWK +S+T+IM
Sbjct  420   PLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKAYSKTIIM  479

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              TFI D +  EGW  W+G   +DT +Y+E +N GPGA    RV W G K+ +S E    +
Sbjct  480   DTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSDEDILGY  538

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             TP  ++  DE W+    +P++PG  
Sbjct  539   TPAKYIQGDE-WIPSKGVPYTPGLF  562



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   548 bits (1413),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 277/575 (48%), Positives = 380/575 (66%), Gaps = 15/575 (3%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S      GGE  ST++K+++ IC PTDY
Sbjct  7     GEAQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHQGKSGGEQTSTSTKAIQSICQPTDY  66

Query  3053  KETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V +  + + I  S  LK   KD R + AL  CK
Sbjct  67    KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKALAKDSRANQALQNCK  126

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL  +IDDL  SF K+  FD   +  Y  DLKVWLS A+T ++TC+D F+NTTGD G K
Sbjct  127   ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  186

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-----TAETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L ++L I      RRLL       +    ++ +  P
Sbjct  187   MRQFLKTSQELTSNGLAMVSEVSTLFKALNIKT---GRRLLQDAATATDENRFQRAKIIP  243

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  244   AWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  303

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA+++GFEN+
Sbjct  304   DEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGFENT  363

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  364   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  423

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LGRP
Sbjct  424   FQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRP  481

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             W   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W G K+
Sbjct  482   WTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK  541

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  542   -LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  574



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   549 bits (1414),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 276/571 (48%), Positives = 382/571 (67%), Gaps = 17/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGG----GEISTASKSVKEICAPTDY  3054
             ++ K++A+ GV+SI LVA VVA  V V     S          +  + K++K IC PTDY
Sbjct  19    QKKKRLAIIGVSSIILVAMVVAVAVGVSHHSGSGSSESGSDNHVQDSMKAIKTICQPTDY  78

Query  3053  KETCERSL--AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             KE C  SL      +T DPKEL+KL+F V +E +     +S LLKE +KDP T  AL  C
Sbjct  79    KEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKEVEKDPGTRQALSIC  138

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
              E++  +ID+LK S  +V  FD+++++E   +++ WLS AIT QETC+DAFENTT   GE
Sbjct  139   DEIMDYAIDELKNSIDQVGGFDLSNMEEIIENIRSWLSAAITYQETCVDAFENTTSKAGE  198

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVD  2520
             +MK ++KTA +L+SN LA++T  +++  S +IP  NF RRLL+   +G      FP +V 
Sbjct  199   QMKKVMKTATKLTSNTLAIVTELSDVFASFKIP--NFNRRLLSTSNEG------FPEWVS  250

Query  2519  AATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
              + RRL T D PA    D+VVA+DGSG   +V EAL  VP    +  VI++K G+Y E V
Sbjct  251   QSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYKENV  310

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              + + M  +  +G+GPTK+ IT   +  DG+ T++TATV + G+GF+A+N+GFENSAGA 
Sbjct  311   NIEKNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNGFVAKNMGFENSAGAE  370

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV +D +IF+NC +D YQDTLY H++RQFYR+CTISGT+DFIFGN+ VVFQNC
Sbjct  371   KHQAVALRVESDFSIFYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVFQNC  430

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             +++VRKP+ NQ+  +TAQGR DRR   A++L +C I+A+P           +LGRPWKE+
Sbjct  431   QIVVRKPLDNQQNTITAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLPTYLGRPWKEY  490

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SR  I+ + IDD+V P GW  W G   L+T +Y+EY NRGPGA+T +RVKW+G K +I+ 
Sbjct  491   SRAFILQSEIDDLVQPAGWLPWAGDFALNTLFYSEYDNRGPGAATAERVKWRGLK-SITA  549

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E A++FT   FL   E W+  A +PF PG +
Sbjct  550   EHAEKFTVARFLGGTE-WIKNASVPFIPGLI  579



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   554 bits (1427),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 274/569 (48%), Positives = 376/569 (66%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  +  ++S+ L++ VVA TV  S+ ++  + D   +I+++ K+VK++CAPTD+K+
Sbjct  10    KRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE SL     +T DP EL+K AF  T++ IT A  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ FE T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+ E          P +VD   
Sbjct  190   KALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLSQE---------IPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             RRLL    A    K DIVVA+DGSGQYK++ EAL+ VP K + T V++IKAG+Y E V++
Sbjct  240   RRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQI  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N+AG AK 
Sbjct  300   NKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPAKF  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSR
Sbjct  420   LVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    RV W G K+  + E+
Sbjct  480   TIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEI  539

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K FTP  F+     W+    +P++PG L
Sbjct  540   LK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   550 bits (1418),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 277/581 (48%), Positives = 384/581 (66%), Gaps = 28/581 (5%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESA----------DGGGEISTASKSV  3081
             G  ++  ++A+ GV+++ LVA VVA T+S+ ++              +    +++  K+V
Sbjct  4     GDAQKGSRIAIIGVSTLLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNYVASTLKAV  63

Query  3080  KEICAPTDYKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKD  2910
             + IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++E+ +E +KD
Sbjct  64    QTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFREIEKD  123

Query  2909  PRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDA  2730
             PR+ DALDTCK+L+H SI +  RS   +  FD+ H+ +   +LKVWL+GA+T  +TC+D 
Sbjct  124   PRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDG  183

Query  2729  FENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee  2550
             FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F RRLL        
Sbjct  184   FENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRRLL--------  234

Query  2549  qeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIF  2373
             Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP + DET  VI+
Sbjct  235   QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIY  294

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQGD F A N
Sbjct  295   IKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAIN  354

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +GFENSAG  KHQAVALRV  D  IF NC +D YQDTLY H+ RQFYRDCTISGT+DF+F
Sbjct  355   MGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K
Sbjct  415   GNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHK  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDK  1662
              +L RPWK FSRT+IM TFIDD++ P+G+  W   +G + +DTC+Y EY N GPG+   K
Sbjct  475   SYLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSK  534

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             RVKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  535   RVKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  573



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   548 bits (1413),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 280/582 (48%), Positives = 384/582 (66%), Gaps = 26/582 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG-RSGESADGGGEISTAS--KSVKEICAPTDYK  3051
             ++ +++ + GV++  LVA VVA TV V   + +S D  G    AS  K+VK  C PTDYK
Sbjct  7     QKRRRIVIIGVSTFLLVAMVVAVTVGVNFGANDSKDNNGNTHMASTVKAVKSFCHPTDYK  66

Query  3050  ETCERS-LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             + CE + +A A +T D +ELIK+AF VTV  I+D I K+ LL E +K+PR   ALDTCK+
Sbjct  67    KECEENVIANAGNTTDSRELIKIAFNVTVTKISDGIKKTNLLHEVEKEPRAKMALDTCKQ  126

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L+  SI +  RS + ++NFD+ +++    +LKVWLSGAIT QETC+D FENTT D  +KM
Sbjct  127   LMDLSIGEFDRSIEGIKNFDLNNLENILVNLKVWLSGAITYQETCLDGFENTTSDASKKM  186

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT--------AETKGeeqeeE  2538
             K++L T+  +SSN LA+I+   +    L++      RRL+          +   ++   +
Sbjct  187   KNILTTSMHMSSNALAVISDLAD--NVLDLNATTDGRRLIDDYKGEYVGEQVVAKDDVND  244

Query  2537  FPGFV----DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
              P +V        RRLL  +   +K ++VVAKDGSG++K + +AL+ VP KN +  VI I
Sbjct  245   VPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKINDALKQVPKKNQKPFVIHI  304

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  2190
             K GVY+E VEV +KM  +VF+G+G  KTRITG+++  DGI TY T TVAI+GD F+A NI
Sbjct  305   KEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGINTYQTPTVAIEGDNFVAINI  364

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             GFENSAG  KHQAVA+RV AD  IF+ C +D YQDTLY H+ RQFYRDCTISGT+DFIFG
Sbjct  365   GFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYVHTMRQFYRDCTISGTIDFIFG  424

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNC  +V+KP+ NQ+C+VTAQGRK+R   + IV+Q+C I+A+         NK 
Sbjct  425   DAISVFQNCTFLVKKPLENQQCIVTAQGRKERHQPSGIVIQNCHIVADT--HNVKFDNKA  482

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQG----TMYLDTCWYAEYQNRGPGASTDK  1662
             +L RPWK FSRT+ M T+I D++ P+G+  WQG       +DTC+YAEY N+GPG+   K
Sbjct  483   YLARPWKNFSRTVFMKTYIGDLIQPDGFMPWQGPNGTVSGIDTCFYAEYNNKGPGSDKSK  542

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             RVKW G K  ++ + A  F P  F   D+ W+   +IP+S G
Sbjct  543   RVKWPGIK-TLTSQSASHFLPSMFFHGDD-WIKVTKIPYSSG  582



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   553 bits (1424),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 274/569 (48%), Positives = 377/569 (66%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  +  ++S+ L++ VVA TV  S+ ++  + D   +I+++ K+VK++CAPTD+K+
Sbjct  10    KRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE SL     +T DP EL+K AF  T++ IT A  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ FE T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+ E         FP +VD   
Sbjct  190   KALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLSQE---------FPSWVDQRG  239

Query  2510  RRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             RRLL      +  K DIVVA+DGSGQYK++ EAL+ VP K + T V++IKAG+Y E V++
Sbjct  240   RRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQI  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N+AG AK 
Sbjct  300   NKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPAKF  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSR
Sbjct  420   LVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    RV W G K+  + E+
Sbjct  480   TIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEI  539

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K FTP  F+     W+    +P++PG L
Sbjct  540   LK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   554 bits (1427),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 274/569 (48%), Positives = 376/569 (66%), Gaps = 17/569 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATV--SVGRSGESADGGGEISTASKSVKEICAPTDYKE  3048
             ++ ++  +  ++S+ L++ VVA TV  S+ ++  + D   +I+++ K+VK++CAPTD+K+
Sbjct  10    KRKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKK  69

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE SL     +T DP EL+K AF  T++ IT A  KS+ + E  KDPRT  ALD CKEL
Sbjct  70    TCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             +  ++ +L  SF+++  F+   + E   +L++WLS AI+ +ETC++ FE T G+ GE MK
Sbjct  130   MDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFEGTQGNAGETMK  189

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
               LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+ E          P +VD   
Sbjct  190   KALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLSQE---------IPSWVDQRG  239

Query  2510  RRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
             RRLL    A    K DIVVA+DGSGQYK++ EAL+ VP K + T V++IKAG+Y E V++
Sbjct  240   RRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKKNTTFVVYIKAGIYQEYVQI  299

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI GD FIA+NIGF N+AG AK 
Sbjct  300   NKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIGDSFIAKNIGFVNTAGPAKF  359

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  360   QAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  419

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GR D R A   V Q C I  EP   A    +K +LGRPW+EFSR
Sbjct  420   LVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSR  479

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM +F+ D V P+GW  W G   LDT +Y+E QN GPGA    RV W G K+  + E+
Sbjct  480   TIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKKLSNEEI  539

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              K FTP  F+     W+    +P++PG L
Sbjct  540   LK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   552 bits (1422),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 271/569 (48%), Positives = 379/569 (67%), Gaps = 20/569 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG--EISTASKSVKEICAPTDYKE  3048
             ++ +   +  ++S  L++ +VA TVSV ++    D GG  EI+T+ K++K++CAPTDYK+
Sbjct  11    KRKRSYVIISISSAVLISMIVAVTVSVNKN----DNGGNEEITTSVKAIKDVCAPTDYKK  66

Query  3047  TCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TCE +L   AK+  DP EL+K AF  T++ I++   KS+ + +  KDPRT  ALD CKEL
Sbjct  67    TCEDTLRKDAKNISDPLELVKTAFNATMKQISNVAKKSQTMIDLQKDPRTKMALDQCKEL  126

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT--GEK  2697
             +  +I +L +SF ++ +F++  + E    LK+WLS  I+ ++TC+D F+ T G+   GE 
Sbjct  127   MDYAIVELTKSFDEIGSFELHKMDEALIKLKIWLSATISHEQTCLDGFQGTQGNNNAGET  186

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK  LKTA +L+ NGLAM++  +  L  ++ P +N  RRLL+ +        +FP ++D 
Sbjct  187   MKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPELN-SRRLLSQD--------QFPSWLDV  237

Query  2516  ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
               R LL    +  K D+VVA+DGSGQYK++ EAL+ VP K + T V+ IK G+Y E V+V
Sbjct  238   RARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKKRNATFVVHIKEGIYKEYVQV  297

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
              R M  +VF+G+GP KT ++G +S KDGI TY TATV I GD FIA+N+GFEN+AGA KH
Sbjct  298   NRSMPDLVFIGDGPDKTVLSGDKSFKDGITTYRTATVGIIGDHFIAKNMGFENTAGAIKH  357

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC +
Sbjct  358   QAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTL  417

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ C +TA GRKD R +   VLQ C I  E    A    +K +LGRPWKE+S+
Sbjct  418   LVRKPLPNQACPITAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEYSK  477

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM TFI D V  +GW  WQG   LDT +Y+E +N GPGA    RV W G K+ +S E 
Sbjct  478   TIIMNTFIPDFVPAQGWQPWQGNFGLDTLFYSEVRNTGPGAPVTNRVTWPGIKK-LSEEE  536

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +FTP  ++  D  W+    +P++PG  
Sbjct  537   VLEFTPSRYIQGDA-WIPGKGVPYTPGLF  564



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   546 bits (1407),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 280/564 (50%), Positives = 385/564 (68%), Gaps = 18/564 (3%)
 Frame = -1

Query  3215  NKKVAVTGVASIFLVACVVAATVSV-GRSGESADGGGEISTASKSVKEICAPTDYKETCE  3039
             N KVAV  +++I LVA V    V+V  R  +SAD   ++ST+ K+V++ C PTDYKETCE
Sbjct  3     NNKVAVLSISAIVLVAVVATVAVTVSNRRSQSADP--QLSTSVKNVQDFCRPTDYKETCE  60

Query  3038  RSLAGAKDTD-DPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
              +L+     D DPKEL+ LAF +TV++I DAI  S +L EA KDP TS+AL+ C+ELL  
Sbjct  61    NTLSSVAGPDADPKELLNLAFNITVKHINDAIDHSTVLSEAAKDPSTSEALENCRELLDY  120

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             +IDDL+RS  ++ +F +A++ ++ +DLK+WLS  IT QETC+D FE TT + GE M+ +L
Sbjct  121   AIDDLRRSVDRLGDFSVANLDKFLDDLKIWLSATITYQETCVDGFEGTTTNAGESMRKML  180

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
              +++EL+SN LA++ +F + L SL +P     R+LL          E +P +V    RRL
Sbjct  181   NSSSELTSNILAIVNNFDDTLSSLNLP---INRKLLA---------EGYPSYVTPGKRRL  228

Query  2501  LTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMN  2322
             L T  A +K ++VVA+DGSG  K++ EA+  VP K  +  +I IK G Y E+V V +   
Sbjct  229   LATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKEKVHVNKSAT  288

Query  2321  KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
              ++ +G+GPTKT+ITGS +  DG  T+ TATVA+ GDGF+A+++  ENSAGA KHQAVAL
Sbjct  289   NVMLIGDGPTKTKITGSLNYVDGTRTFDTATVAVVGDGFVAKDLWIENSAGAEKHQAVAL  348

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             RV +DM++F+NC ID YQDTLY H++RQFYRDCTISGT+DFIFG++  +FQNC ++ RKP
Sbjct  349   RVQSDMSVFYNCRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCLILARKP  408

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
             + NQ+ +VTAQGRK R+ A+AI+L +C I A+PA          FLGRPWK +SRT I+ 
Sbjct  409   LDNQQNIVTAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQ  468

Query  1781  TFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFT  1602
             + IDD++ P+GW  W G   L+TC+Y E  NRGPGA   KRV WKG K NI    AK+F+
Sbjct  469   SQIDDLIHPDGWLPWFGDFGLNTCFYTEVDNRGPGADKSKRVTWKGVK-NIDYAHAKKFS  527

Query  1601  PGPFLMADEQWLGRAQIPFSPGFL  1530
                FL    +WL R  +PF+   L
Sbjct  528   VQQFLHGG-KWLPRTGVPFTAELL  550



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   546 bits (1407),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 264/527 (50%), Positives = 366/527 (69%), Gaps = 15/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSEL  2931
             E+ST++K++K+ C PTDY+ TCE SL+  A +T DPKEL+ LAF+VT++++ +A + S +
Sbjct  38    ELSTSNKNIKDFCRPTDYQATCESSLSAVAGNTTDPKELVNLAFQVTIDHMKEAFNHSTV  97

Query  2930  LKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQ  2751
             L EA KD RTSDAL+ C+ELL  +I DLK S  +++ F +  + ++ +DLKVW+S +IT 
Sbjct  98    LSEAAKDSRTSDALENCRELLDYAIYDLKSSIDRLDGFSLTKLDKFLDDLKVWISASITY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT D  E M+  L ++ EL+SN LA++T+F   L SL +    F R+LL 
Sbjct  158   QETCLDGFENTTTDAAESMRKALNSSAELTSNILAIVTNFDSALDSLNL---GFNRKLLA  214

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         +P ++    RRLL   PA +K +I VAKDGSG  K++ EA+  VP K++
Sbjct  215   EE---------YPSWISPGNRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSN  265

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T VI+IK GVY E+V+V R +  ++ +G+G +KT+ITG  +  DG  T+ TATVAI GD
Sbjct  266   YTFVIYIKEGVYEEQVQVNRSLTNVMMIGDGTSKTKITGKLNYIDGTATFKTATVAIVGD  325

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GFI +++  ENSAGAAKHQAVALRV +D ++F+N  +D YQDTLY H+ RQFYR+CTISG
Sbjct  326   GFIGKDLWIENSAGAAKHQAVALRVQSDKSVFYNVRMDGYQDTLYVHTKRQFYRECTISG  385

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG++P VFQNC +  RKP+ NQ+ +VTAQGRKDRR A+AI+L +C I A+PA   
Sbjct  386   TIDFIFGDSPTVFQNCLIQARKPLDNQQNIVTAQGRKDRRQASAIILHNCTISADPAYFP  445

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
             A      FLGRPWKEFSRT ++ + +DD++ P+GW  W G   L++C+Y E  NRGPGA 
Sbjct  446   ARKKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWSGDFGLNSCFYTELDNRGPGAD  505

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +RV WKG K +I    A++FT   F+  +  WL +  +PF PG L
Sbjct  506   MSQRVNWKGVK-SIDYAHAQKFTVEHFIQGNA-WLPKTGVPFIPGLL  550



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   546 bits (1406),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 267/580 (46%), Positives = 386/580 (67%), Gaps = 20/580 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSG-------ESADGGGEISTASKSVKEICAPT  3060
             + ++VAV GV S+ L+A VVA TV +  +G       E  D  G ++T+SK+V+ IC   
Sbjct  13    KKERVAVLGVFSVMLLAMVVAVTVGIKGTGHTDTSYEEEEDDDG-LATSSKAVRSICQMV  71

Query  3059  DYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             +Y+  CER+LA A  T+ PK+L++  F   +E +  A++ S  +K A  D R + AL+TC
Sbjct  72    EYQRACERTLAHAHTTN-PKKLVQTTFNAAMEKLEGALTNSSTIKAAKDDRRNAGALETC  130

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             K+++  +I DLKRS  ++++FDM   +E+  ++++WLSGA+T QETCI+AF+NTTGD GE
Sbjct  131   KQVVEYAITDLKRSIDQMDHFDMHKKEEHVENMRIWLSGAMTSQETCIEAFQNTTGDAGE  190

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFK-RRLLTAETKGeeqeeEFPGFV  2523
             KMK  L  + EL+SNGL + T  +   +SL I   N K +R+L  E    + +EE P +V
Sbjct  191   KMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLEEQGEAKNKEEIPHWV  250

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN--------DETVVIFIK  2367
             D   ++LL     ++K D+VVAKDGSG +K++ EAL+  P  +        ++T VI+IK
Sbjct  251   DTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDATKVEKGTNKTFVIYIK  310

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVY E V+V   M  ++ +G+GPTKT+ITG ++  DG   + TATV+I G  FIA++IG
Sbjct  311   EGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFVLFKTATVSIFGHNFIAKDIG  370

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAGA KHQA+AL V +D ++F+NCHI+ YQDTLY HSYRQFYR CT+SGT+DFIFGN
Sbjct  371   FENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYAHSYRQFYRHCTVSGTIDFIFGN  430

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK+++RKP+ ++ C++TAQ R+  R     +LQ+C I+A+P        +K F
Sbjct  431   AAAVFQNCKLVIRKPLEDEGCVITAQARQHVREPTGFILQNCTIMADPLYYPLRLKSKAF  490

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LG PWK+FSRT+IM +F+ D + PEGW  W GT    +C+++EY+NRGPGA+   RVKW 
Sbjct  491   LGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQSSCFFSEYENRGPGAALLGRVKWH  550

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             G K+ I+P+ A  FTP  F   +  W+    +P+ PG + 
Sbjct  551   GIKK-ITPQQADGFTPSKFYQGN-HWIIPTGVPYEPGMMH  588



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   545 bits (1403),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 265/532 (50%), Positives = 361/532 (68%), Gaps = 18/532 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
             +I T +K+V+ +C+PTD+K+TC  SL  A  ++ +P +LIKL+F VT+ +I D I +S  
Sbjct  42    KIKTTTKAVQAVCSPTDFKDTCVNSLMEASPNSTEPLDLIKLSFDVTIRSIKDGIKRSST  101

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             EL  +A KD  T  AL+ C+ L++++ DDLK+ F   + F +  I+++  DL+VWLSG+I
Sbjct  102   ELKAKAAKDEETKGALELCENLMNDATDDLKKCFDNFDGFSITQIEDFVEDLRVWLSGSI  161

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + MK++ KT+ EL+SN LAMIT  + LL  + I  V     N
Sbjct  162   AYQQTCMDTFEEVKSNLAQDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDLGN  221

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       E  P +V   TRRL+      +K ++VVA+DGSGQYKS+ EAL+
Sbjct  222   YARKLLSTE-------EGIPSWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALK  274

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             AVP  N    VI+IK G+Y E V+V +KM  + F+G+GPT+T+ITG+ + + G + TY T
Sbjct  275   AVPQNNRWPFVIYIKQGIYKENVDVTKKMTHVTFIGDGPTRTKITGNLNFRIGKVKTYQT  334

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC +D YQDTLY H++RQF
Sbjct  335   ATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQMDGYQDTLYVHAHRQF  394

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+A  +FQNC ++VRKPM  Q C+VTAQGR D R +  IVL +C I
Sbjct  395   YRDCTISGTVDFIFGDAKSLFQNCNIVVRKPMGGQSCIVTAQGRTDVRESTGIVLHNCRI  454

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EPA       NK +LGRPWK FSRT++M T ID+++ P GW  W G   L+T +YAEY
Sbjct  455   TGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALNTLYYAEY  514

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             QN GPG++  +RV W G K NISP  A +FTP  FL  +  W+ +  +P++P
Sbjct  515   QNSGPGSNQAQRVNWAGIK-NISPRQALKFTPARFLRGN-LWIPQTHVPYTP  564



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   545 bits (1403),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 277/577 (48%), Positives = 386/577 (67%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G+  + KK+A+ GV+++ LVA VVA T+ V  +   ++   E      ++++ K+V+ +C
Sbjct  4     GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  + + +K   ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP+ PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPYFPG  567



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   545 bits (1403),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 279/577 (48%), Positives = 385/577 (67%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G+  + KK+A+ GV+++ LVA VVA T+ V  +   ++   E      ++++ K+V+ +C
Sbjct  4     GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   548 bits (1411),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 269/545 (49%), Positives = 362/545 (66%), Gaps = 16/545 (3%)
 Frame = -1

Query  3155  ATVSVGRSGESADGGG--EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKL  2985
             A +S+G +  + D G   EI+ + K++KE+CAPTDYK+TCE +L   AKDT DP EL++ 
Sbjct  17    AMISIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRA  76

Query  2984  AFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAH  2805
              F VT++ IT+   KS+ + E  KDPRT  ALD CKEL+  +I +L  SF ++  F+   
Sbjct  77    GFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFHK  136

Query  2804  IKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTE  2625
             + E    +KVWLS  I+ Q+TCID F+ T GD GE +K  LKTA +L+ NGLAM+T  + 
Sbjct  137   VDEVLIKVKVWLSATISHQQTCIDGFKGTKGDAGETIKKALKTAVQLTHNGLAMVTEMSN  196

Query  2624  LLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGS  2445
              L  ++   +N  RRLL  E          P +VD   RRLLT   + +K D+VVA+DGS
Sbjct  197   YLGQMQFTELN-SRRLLAQE----------PSWVDGRVRRLLTAPLSEVKPDMVVAQDGS  245

Query  2444  GQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRS  2265
             GQYK++ EA++ VP   + T V++IK GVY E V+V R M+ +VF+G+GP KT ITG +S
Sbjct  246   GQYKTISEAMQNVPKNKNVTFVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKS  305

Query  2264  NKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQD  2085
              +DGI TY TATVAI GD FIA+N+GFEN+AGAAKHQAV +RV +D +IF+NC  D YQD
Sbjct  306   FQDGITTYRTATVAIIGDRFIAKNMGFENTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQD  365

Query  2084  TLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGA  1905
             TLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +  
Sbjct  366   TLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKET  425

Query  1904  AAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTM  1725
                VLQ C I  E    A    +K +LGRPWK +S+T+IM TFI D +  EGW  W+G  
Sbjct  426   TGFVLQGCTIAGEADYLAVKESSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNF  485

Query  1724  YLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              +DT +Y+E +N GPGA    RV W G K+ +S E    +TP  ++  DE W+    +P+
Sbjct  486   GIDTLFYSEARNTGPGAGVTGRVTWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPY  543

Query  1544  SPGFL  1530
             +PG  
Sbjct  544   TPGLF  548



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   544 bits (1402),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 286/574 (50%), Positives = 388/574 (68%), Gaps = 15/574 (3%)
 Frame = -1

Query  3227  SPEQNKK-VAVTGVASIFLVACVVAATVSVGR------SGESADGGGEISTASKSVKEIC  3069
             +PEQ KK +A+ G +++ L+  VV A V V         G S  GGG + T SK++K IC
Sbjct  15    NPEQKKKKLAIIGGSAVILLCMVVGAVVGVSHHNSSSDGGSSNSGGGRLVTTSKAIKSIC  74

Query  3068  APTDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PTDYK+ CE SL   A +T DPK L++ AF VT++ I DA + S +L+ A KDPRTSDA
Sbjct  75    QPTDYKDICESSLTHAAGNTSDPKALVEAAFNVTIDYIRDAFNHSSVLQAAAKDPRTSDA  134

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LD CKELL  ++D+L+ SF K    +++ I E  +DLK+WLS A+T QETC+D FEN +G
Sbjct  135   LDDCKELLDYAVDELRNSFTKFGQLEISKIDEIIDDLKIWLSAAVTYQETCLDGFENISG  194

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D  E MK  L  +  L+SN LA+I   + +L + +IP ++  RRLL+ E   E  + E+P
Sbjct  195   DAAESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLS--RRLLSEE---EADDGEYP  249

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
              +V    RRLL      +K DIVVA+DGSG Y+++ EAL A+P  ++ T VI+IK GVY 
Sbjct  250   SWVTNGKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIYIKEGVYK  309

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E+V + + M  ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ G+GFIA+++GFENSA
Sbjct  310   EQVWLDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGEGFIAKDLGFENSA  369

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  KHQAVALRV +D +IF+NC +D YQDTLY H+ RQFYRDCTI+GT+DFIFG++  +F
Sbjct  370   GPEKHQAVALRVQSDRSIFYNCQMDGYQDTLYCHTKRQFYRDCTITGTIDFIFGDSASIF  429

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNC + VRKP+ANQ+C+VTA GRKDRR A AI+L +C I A+      +  N  +LGRPW
Sbjct  430   QNCLIKVRKPLANQQCIVTASGRKDRREATAIILHNCTISADSEYLPFHIQNPSYLGRPW  489

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             K +SRT+IM + ID+ + PEGW  W G + L TC+YAE  N G GA+  KRV W+GYK+ 
Sbjct  490   KPYSRTIIMQSQIDEFIHPEGWLPWLGDVGLHTCFYAEVDNHGLGANVTKRVTWRGYKK-  548

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             I    A+QFT   F+  +  WL    +P+ PG L
Sbjct  549   IDSSHAQQFTVQRFIQGNS-WLRPTGVPYIPGLL  581



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   543 bits (1399),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 278/577 (48%), Positives = 385/577 (67%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +   ++   E      ++++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDYELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGPEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   541 bits (1393),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 267/534 (50%), Positives = 359/534 (67%), Gaps = 27/534 (5%)
 Frame = -1

Query  3116  GGGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKS  2937
             G    ST++K+V+ +C+PT Y+ETCE++LA A +T DPKELI+  F V V+ I +A+ KS
Sbjct  26    GAPATSTSNKAVQAVCSPTSYRETCEQTLAKA-NTSDPKELIRYGFGVAVDGIGEALKKS  84

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
              LLK+A  D  T DA   C+++L  ++ DL++S  ++  F+   + +Y  DL+ WLSG +
Sbjct  85    ALLKQAAADQSTKDAFYVCEDVLDLAVYDLQKSIDRIGEFNPQKLNDYVEDLRTWLSGVV  144

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF---K  2586
             T Q TCIDAFENTTGDTGEKMK LLKT  EL+SNGL M+T  T +L  L+I   N    +
Sbjct  145   TTQTTCIDAFENTTGDTGEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQIGIGNVSAGR  204

Query  2585  RRLLT--AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             RRLL+  AE K                 R+L      I+ + VVA DGSGQYKS+  A+ 
Sbjct  205   RRLLSDWAEPK----------------MRMLA---GGIRANAVVALDGSGQYKSINAAIN  245

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
             A P KN    VI +KAG+Y E VEVP+    IV +G+G T+TRITG ++   G+ T+ TA
Sbjct  246   AAPSKNARPFVIHVKAGLYREYVEVPKHKTNIVILGDGATRTRITGRKNLAGGVKTFATA  305

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             T A+  D F A++IG EN+AG   HQAVALRV+ D  + +N +ID +QDTLY H++RQFY
Sbjct  306   TFAVNADDFTAKDIGIENTAGPEGHQAVALRVTGDRAVLYNLNIDGFQDTLYAHAHRQFY  365

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             R+C ISGT+DF+FGNA  +FQNC+ IVRKPMANQ CMVTAQGR  R    AIV+Q+ EI 
Sbjct  366   RNCRISGTIDFVFGNALSIFQNCQFIVRKPMANQACMVTAQGRDQRNSNGAIVIQNGEIR  425

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
             AE A   A P  + +LGRPWK+FS T+IM ++I   + P+GW+ W G+  LDTC+YAEY+
Sbjct  426   AEQAFINAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQGWAPWAGSFALDTCYYAEYR  485

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPG++T +RVKWKG K +I P+ A ++ PG     D+QW+ RA +P+  G +
Sbjct  486   NRGPGSNTSQRVKWKGIK-HIDPQTAARYAPGK-AYGDDQWIRRAGVPYVSGMM  537



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   542 bits (1396),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 264/539 (49%), Positives = 359/539 (67%), Gaps = 18/539 (3%)
 Frame = -1

Query  3134  SGESADGGGEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENI  2958
             SG    G  +I T +K+V+ +C PTDYKETC  SL A + ++  P +LI+L F +T+ +I
Sbjct  37    SGPIKHGDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSI  96

Query  2957  TDAISKS--ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTND  2784
                I K+  EL   A+KDP T  ALD C+EL+ ++IDDLK+ F K + F++   +E+  D
Sbjct  97    HQGIKKAAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVED  156

Query  2783  LKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI  2604
             L+VWLSG+I  Q+TC+D FE    D  ++M  + KT+ EL+SNGLAM++  + LL    I
Sbjct  157   LRVWLSGSIAFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNI  216

Query  2603  PGV-----NFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQ  2439
              GV     ++ R+LL+ E       + FP ++    R+L+      +K + VVA DGSGQ
Sbjct  217   TGVRGDLGSYARKLLSTE-------DGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQ  269

Query  2438  YKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK  2259
             +KS+  AL+ VP KN    VI+IK G+Y E+V+V + M+ + F+G+GPTKTRITG+ +  
Sbjct  270   FKSINAALKTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFG  329

Query  2258  DG-IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              G + TY TATVA+ G+ F A++IGFEN+AG   HQAVALRVSAD  +FHNC ID YQDT
Sbjct  330   MGKVKTYQTATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYQDT  389

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LY HS+RQFYRDCTISGT+D+IFG+A   FQNC M+VRKPM  Q CMVTAQGR D+R   
Sbjct  390   LYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETT  449

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
              IVL +C I  +PA       NK +LGRPWK+FSRT+IM T I+DI+ P+GW  W G   
Sbjct  450   GIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFA  509

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             LDT  YAE++N+GPG++   RVKW G K+  +P  A +FT G FL     W+ + Q+P+
Sbjct  510   LDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGGT-WIPQTQVPY  566



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   542 bits (1396),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 272/567 (48%), Positives = 389/567 (69%), Gaps = 12/567 (2%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCE  3039
             + KK+A+  V+++ LVA VVA  V V +S +  +   + +T SK+++ +C PTDYKETC+
Sbjct  9     KKKKIAIISVSALILVAMVVAVAVGVTKSHKGGNDEKKPATTSKAIETVCQPTDYKETCQ  68

Query  3038  RSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
              +L+  A +  DPKEL+K+ F++ +E + + I+ S+ LKE  KD   + AL  C+EL+  
Sbjct  69    NALSEKAGNVTDPKELVKIGFQIAIEKLQEVINNSDTLKEIAKDNLGNQALQNCRELIEY  128

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             SIDDLKRS  K+  F++  +KEY  DLKVWLS ++  ++TC+D F+NT G+ G KMK+ L
Sbjct  129   SIDDLKRSADKIGPFEVTKLKEYVEDLKVWLSASLQYEQTCLDGFDNTPGEAGAKMKNFL  188

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT-AETKGeeqeeEFPGFVDAATRR  2505
             KT+ EL+ N LAM T    L ++  +     +RRLL       ++  +  P +++     
Sbjct  189   KTSQELTKNALAMATEIGNLFRTSSLKS---QRRLLADTPMDPKKAPKIIPSWIEGRKLD  245

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND-ETVVIFIKAGVYNERVEVPRK  2328
             + T +P S+K D++VAKDGSG+YK+V EAL+ +P  N  +T VI+IK GVY+E+V + + 
Sbjct  246   IATANPISLKPDVIVAKDGSGKYKTVNEALKDIPKDNVLKTFVIYIKEGVYSEQVVLDKH  305

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
             M  ++F+G+GPTKT+ITG+++  DG+ T+ TATVA+ GD FIA++IGFEN+AGA  HQAV
Sbjct  306   MTNVMFIGDGPTKTKITGNKNYADGVQTFKTATVAVIGDYFIAKDIGFENTAGARGHQAV  365

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRV +D++IF+NC ID YQDTLYT ++RQFYRDC ISGT+DFIFG+A  VFQNCKMIVR
Sbjct  366   ALRVQSDLSIFYNCQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDAAAVFQNCKMIVR  425

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP  NQ CMVTAQGR D+R    IVLQ+C I  E    AA      +LGRPWK +SRT++
Sbjct  426   KPGPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFDAAT--TMAYLGRPWKMYSRTIV  483

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + ID+++ P GW  W GT   +T W+ E+ NRG GA+T++RVKW  YK   +PE A  
Sbjct  484   MQSQIDNVINPLGWMEWTGTTNHETSWFGEFSNRGLGAATNQRVKW--YKL-ATPEEAGA  540

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             F PG  L+ D +W+  + +P+  G ++
Sbjct  541   FAPGSILLGD-KWIMPSGVPYVAGMMR  566



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   542 bits (1397),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 278/577 (48%), Positives = 386/577 (67%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSV-----GRSGESADGG-GEISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA TV V     G + ++ D     + ++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSALLLVAMVVAITVGVNLNENGSNNDTEDNKKNHVVSSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+YK+ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYKKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             L+TCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LETCKQLMDLSIGELTRSLDGIGEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  + + +K   ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPLENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   541 bits (1394),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 265/530 (50%), Positives = 354/530 (67%), Gaps = 20/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
              I   +K+++ +CAPTDYKETC  SL  A  D+  P ELIKL F +T+++I D++ K+  
Sbjct  47    HIQATTKAIRAVCAPTDYKETCVDSLMHASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  ALD C++L+ ++ DDL++       F + HI+++  DL+VWLSG+I
Sbjct  107   ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + M  + +T+ EL+SN LAMIT  +  L    I G+     N
Sbjct  167   AYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGN  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+ E       +  P +V   TRRL+  +   +K D+VVA+DGSGQYK++ EAL 
Sbjct  226   HARKLLSTE-------DGIPSWVGPNTRRLMA-EQGVVKPDVVVAQDGSGQYKTINEALS  277

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N +  VI+IK GVYNE+V+VP+KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  278   VVPKANQKPFVIYIKQGVYNEKVDVPKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHT  337

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  338   ATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQF  397

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+  VV Q C ++VRKPM  Q CM+TAQGR D R +  +VL +C I
Sbjct  398   YRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTDERESTGLVLDNCHI  457

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EP        NK +LGRPWK+FSRT+IM T IDD+V P GW  W G+  L+T +YAEY
Sbjct  458   TGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALNTLYYAEY  517

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +N GPG+   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  518   ENNGPGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   541 bits (1395),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 273/584 (47%), Positives = 380/584 (65%), Gaps = 20/584 (3%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVG--RSGESADGGGE----ISTASKSVKEI  3072
             MG   Q K++A+ GV++  LVA VVA TVS+     G S D   E    ++++ K+VK +
Sbjct  1     MGGDAQKKRIAIIGVSTFLLVAMVVAVTVSINLNNKGSSYDSKEESKSSVASSIKAVKTL  60

Query  3071  CAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             CAPTDYK+ CE SL   + +  DP+ELIK+AF VT+  I + + K+EL+ + + DPRT +
Sbjct  61    CAPTDYKKECEDSLIEHSNNITDPRELIKIAFHVTISKIGEGLEKTELMHQVENDPRTKE  120

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALDTCK+L++ SI +  RS  +   FD+ ++      LKVWLSGAIT QETC+DAFENTT
Sbjct  121   ALDTCKQLMNLSIGEFTRSLDRFTKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTT  180

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRLLTAETKGeeqee  2541
              D   KM+ LL++A  +SSNGL++IT  ++ L  + I  PG   +RRLL     G +  +
Sbjct  181   TDASLKMQRLLQSAMHMSSNGLSIITELSKTLSEMHIGKPG---RRRLLNNNVLGHDYFD  237

Query  2540  EFPGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
               P +VD     R+LL          +VVAKDGSG + ++ EAL+ VP KN    VI++K
Sbjct  238   -LPEWVDDQVGVRKLLHMTGRKRMAHVVVAKDGSGNFTTINEALKHVPKKNLRPFVIYVK  296

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVYNE VEV + M  +V +G+G  K+RITG+++  DG+GT+ TA+ AI GD F+   +G
Sbjct  297   EGVYNEYVEVSKNMTHVVMIGDGGKKSRITGNKNFVDGVGTFRTASAAILGDFFVGIGMG  356

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+FG+
Sbjct  357   FENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVFGD  416

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  V QNC  +VRKP+ NQ+C+VTAQGRK+    + +++Q   I+A+P        NK +
Sbjct  417   AVAVLQNCTFVVRKPLENQQCIVTAQGRKEMNQPSGLIIQGGSIVADPMYYPVRFDNKAY  476

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+Y+E+ NRGPG+   KRV
Sbjct  477   LARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGLRGMDTCFYSEFNNRGPGSDKAKRV  536

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW+G K   S  ++  F P  F   D+ W+   ++P+  G   P
Sbjct  537   KWEGIKALDSDGIS-NFLPAKFFHGDD-WIRVTRVPYYSGQPSP  578



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   542 bits (1397),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 280/583 (48%), Positives = 375/583 (64%), Gaps = 30/583 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSV------------GRSGESADGGGEISTASKSVKEIC  3069
             K+V +  V++  LVA VVA TV              G  G S D    +    K++K IC
Sbjct  13    KRVVIISVSAFLLVAMVVAVTVGFAMEKSFYNSPYSGNKGRSHDKPASM----KAIKAIC  68

Query  3068  APTDYKETCERSL--AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
              PTDYK+ C  SL  A    T DP +LI   F+V ++ + DA  KS+ L++ +KDPRTS+
Sbjct  69    QPTDYKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLRKLEKDPRTSN  128

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFD-MAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALDTC+EL+  ++ +L++S  ++   D +    +   DLKVWLS  IT QE+C+DAFENT
Sbjct  129   ALDTCEELMELALGELRQSLVRLGFIDDLTKFNDMLMDLKVWLSATITYQESCLDAFENT  188

Query  2717  TG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqe  2544
             T   D  E+MK++LKT+  LSSN LAM++        L  P  +  RRLL  +       
Sbjct  189   TSSTDAAEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPS-HRRLLQFDAFPVIGH  247

Query  2543  eEF--PGFVDAATRRLLTTD----PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV  2382
              EF  P +     R+LLTT     P   K DI+VAKDGSG YK++ EAL+ VP   +ET 
Sbjct  248   SEFEDPKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVPKYGNETF  307

Query  2381  VIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFI  2202
             +I+IK G+YNE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVAIQGD F+
Sbjct  308   IIYIKEGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDGTTTYHTATVAIQGDHFM  367

Query  2201  ARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVD  2022
               +IGFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH+ RQFYRDCTISGT+D
Sbjct  368   VMDIGFENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLYTHAQRQFYRDCTISGTID  427

Query  2021  FIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANP  1842
             F+FG+A  +FQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I A+P       
Sbjct  428   FVFGDATAIFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITADPDYFPVKD  487

Query  1841  PNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDK  1662
              NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N GP A+  +
Sbjct  488   ENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAELGNTGPAANKAR  547

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             RV W+G K+ I+   A  FTPG F   D +W+  + +P+ PG 
Sbjct  548   RVTWRGIKK-ITENHAADFTPGRFFRGD-KWIRLSGVPYIPGL  588



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   541 bits (1395),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 276/589 (47%), Positives = 388/589 (66%), Gaps = 33/589 (6%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVG---RSGESADGGGEISTAS--KSVKEICAPTD  3057
             ++  ++ + G+++  LVA VVA TVSV    R+ +S +   +   AS  KSVK  C PTD
Sbjct  7     QKRTRIVIIGMSTFLLVAMVVAVTVSVDINTRNDDSTNNNDKTRIASTIKSVKSFCQPTD  66

Query  3056  YKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             YK+ CE +L   A +T +P+ELIKLAF VT++ I D I K+ LL E +K+PR   ALDTC
Sbjct  67    YKKECEENLIEIAGNTTEPRELIKLAFNVTIKKIGDGIKKTNLLHEVEKEPRAKLALDTC  126

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             K+L+  SI + +RS + ++ FD+ +++     LKVWLSGAIT QETC+D F+NTT D  +
Sbjct  127   KQLMDLSIGEFERSLEGIKTFDLNNLENILVSLKVWLSGAITYQETCLDGFQNTTSDASK  186

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-------------TAETK  2559
             KM+++L T+  +SSN LA+I+   + +  L +   N +RRL+               E  
Sbjct  187   KMQNILTTSMHMSSNALAIISDLAKSVLDLNL--TNNERRLIDNNNNNNNNNNNDVGEQV  244

Query  2558  GeeqeeEFPGFV----DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
                 + E P +         RRLL  +   +K +++VAKDGSG++K + +AL+ VP KN 
Sbjct  245   FGHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGKFKKINDALKHVPKKNK  304

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY T TVAI GD
Sbjct  305   KIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFIDGVNTYKTPTVAIAGD  364

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A NIGFENSAG  KHQAVA+RV AD +IF+ C ID YQDTLY H+ RQFYRDCTISG
Sbjct  365   YFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTLYAHTMRQFYRDCTISG  424

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  +FQNC  +VRKP+ NQ+C+VTAQGRKD+   + IV+Q C I+++     
Sbjct  425   TIDFVFGDAVAIFQNCTFVVRKPLENQQCIVTAQGRKDKHQPSGIVIQGCSIVSDT--HN  482

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMY-LDTCWYAEYQNRG  1683
                 NK +L RPWK +SRT+ M T+I D++ P+G+  WQ   GT+  +DTC+Y EY+N+G
Sbjct  483   VKFDNKAYLARPWKNYSRTIFMKTYIGDLIEPDGYMPWQLPNGTLTGMDTCFYVEYKNKG  542

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             PG++  KRVKW+G K N++   A  F P  F   D+ W+   ++P+S G
Sbjct  543   PGSNKSKRVKWRGIK-NLTSHTASVFLPYKFFHGDD-WIKVTRVPYSSG  589



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   539 bits (1389),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 276/577 (48%), Positives = 384/577 (67%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +   ++   E      ++++ K+V+ +C
Sbjct  9     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  68

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKEL+K+ F +T+  I D + ++ +L E +++PR   A
Sbjct  69    HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  128

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGAIT Q+TC+D FENTT 
Sbjct  129   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAITYQDTCLDGFENTTS  188

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  189   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  239

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  240   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  297

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  298   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  357

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  358   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  417

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  418   VFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  477

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  478   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  537

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  538   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  572



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   546 bits (1408),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 267/565 (47%), Positives = 374/565 (66%), Gaps = 6/565 (1%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             E  KK+ +  V S  LVA VVA  ++VG   E  +   ++S++ K++  +C  TDY+E C
Sbjct  3     ESKKKITIVAVCSCLLVAMVVA-LIAVGLQDEDKEVQ-DVSSSKKAITSLCETTDYQEAC  60

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
               SL A   ++ +PK+LI   F+  ++ I +A   S +L E   DPR   AL+ C+EL  
Sbjct  61    VESLNASGTNSTNPKDLIDAIFQSAIDYIKEASKNSTVLLELQTDPRAKAALENCQELAD  120

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              ++ DL+RSFQ   NFD+ ++ +   +LK+WLSGAIT QETC+D FE   G+ GEKM+  
Sbjct  121   RAVHDLERSFQSFNNFDITNMDDLLLELKIWLSGAITHQETCLDGFEGVPGEAGEKMRVS  180

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             L  A +++SN LAM+   +  ++SL I   +  RRLL+        ++E P ++D   RR
Sbjct  181   LTKAMQMTSNALAMMAELSTYIKSLGIES-STSRRLLSENEAVVGHDDELPNWMDLNKRR  239

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL+  P  I+  +VVAKDGSG+++++ EAL+ +P K DE  V++IK GVY ERV+V   +
Sbjct  240   LLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYEERVQVNSSL  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               ++F+G+GPTKTRITG  +  DG  TY TATVA+QGD F+A NIGFENSAG  KHQAVA
Sbjct  300   THLLFIGDGPTKTRITGKLNFIDGTNTYRTATVAVQGDNFMAVNIGFENSAGPQKHQAVA  359

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRVSAD  IF+NCH+D YQDTLYTH+YRQFYRDC ISGT+DFIFG++  VFQ C ++VRK
Sbjct  360   LRVSADKAIFYNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQGCTLLVRK  419

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P+ NQ+C+VTAQGRKD R    +V+Q+C I A+ A        K +LGRPWK++SRT+IM
Sbjct  420   PLDNQQCIVTAQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWKQYSRTIIM  479

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              +F+DD++ P+GW  W  T  L T +Y E+ NRGP A   +RVKW G  R +     ++F
Sbjct  480   ESFLDDLIQPQGWLPWNETFALQTLFYTEFNNRGPAAPKSERVKWAGI-RELPSNRIRRF  538

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             T   FL    +W+ + ++P + GF+
Sbjct  539   TLEEFLDG-HRWIPQTKVPHASGFI  562



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   538 bits (1387),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 274/576 (48%), Positives = 380/576 (66%), Gaps = 27/576 (5%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G  ++ +++A+ GV+S+ LVA V+A TV   R+    D   E      +S+  ++V+ IC
Sbjct  5     GDAQKGRRIAIIGVSSLLLVAMVIAVTVGANRNQNGFDDDIENNRKNHVSSTMRAVQTIC  64

Query  3068  APTDYKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTS  2898
              PTDYK+ C  +L   A A +  DPKELIK+AF VT++ I + I  ++L+ E +KDPR+ 
Sbjct  65    QPTDYKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKATDLMHEVEKDPRSK  124

Query  2897  DALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DA+DTCK+L+  SI +  R+   ++ FD+  I     +LKVWL+GA+T  +TC+D F+NT
Sbjct  125   DAIDTCKQLMDLSIGEFARAMDGIDQFDLKDIDRILMNLKVWLNGAVTYMDTCVDGFQNT  184

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             T D G+KMK +L ++  +SSN LA+I+ F + + S  +  + F RRLL  +T        
Sbjct  185   TTDAGKKMKDILTSSMHMSSNALAIISDFADTVTSWNVTKI-FGRRLLDTDT--------  235

Query  2537  FPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
              P +V +  R LL    +S  +K ++ VA DG+G  K++ EAL  VP K+++   I+IK 
Sbjct  236   -PSWV-SEHRMLLDAKTSSFKLKPNVTVALDGTGDVKTINEALLKVPEKSEKPFFIYIKE  293

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             GVYNE VEV + M  +VF+G+G  K+RITGS++  DG+ TY TA+VAIQGD F A N+GF
Sbjct  294   GVYNEYVEVGKHMTYVVFLGDGGQKSRITGSKNFIDGVNTYKTASVAIQGDHFTAINMGF  353

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAGA KHQAVALRV  D +IF NC +D YQDTLY H+ RQFYRDCTISGT+DFIFGNA
Sbjct  354   ENSAGAHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFIFGNA  413

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK +VRKPMANQ+C+VTAQGRK+R   +AIV+Q   I+A+P        +K +L
Sbjct  414   LSVFQNCKFVVRKPMANQQCIVTAQGRKERFQPSAIVIQGGSIVADPEFYPVRFDHKAYL  473

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              RPWK FSRT+ M TFIDD++ P+G+  WQ   G   +DTC+YAEY N GPG+   KRV 
Sbjct  474   ARPWKNFSRTIFMDTFIDDLIHPDGYMPWQTPEGFSGMDTCFYAEYHNYGPGSDKSKRVH  533

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             W G   +++ + A+ F P  F    + W+    +PF
Sbjct  534   WAGI-WSLNSKAARWFAPSKFFHGSD-WIEETGVPF  567



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   536 bits (1382),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 270/572 (47%), Positives = 377/572 (66%), Gaps = 27/572 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADG-----GGEISTASKSVKEICAPTDYKE  3048
             ++ A+ GV+++ LVA ++   V         D         +++  K+++ IC PTDYK+
Sbjct  10    RRSAIIGVSTLLLVAMIIVVMVGARNKYSFKDDIEDNKKNHVASTMKAIRTICQPTDYKK  69

Query  3047  TCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
              CE SL   A A +  DPKELIK+AF VT++ I + + ++++L E +KDPR+ DALDTCK
Sbjct  70    ECEESLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKETDMLCELEKDPRSKDALDTCK  129

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SID+  RS   +   ++ +I+    +LKVWL+GA+T  +TC+D FENTT + G+K
Sbjct  130   QLMDLSIDEFTRSLDGIGKLNIQNIENILMNLKVWLNGAVTYMDTCLDGFENTTSEAGKK  189

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LL ++  +SSN LA+IT F + +  + +  +  +R L   +T         P +V+ 
Sbjct  190   MKELLTSSMHMSSNALAIITDFADTISDMNVTKIVGRRLLQDYKT---------PSWVEH  240

Query  2516  ATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIFIKAGVYNER  2346
               R+LL     + KH  ++ VA DGSG +KS+ EAL+ VP +  +T  VI+IKAGVY E 
Sbjct  241   --RKLLDAKTNAFKHTPNVTVALDGSGDFKSINEALKKVPHEESKTPFVIYIKAGVYREY  298

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             VEV   M  IVFVG+G  K+ ITG+++  DG+ TYHTATVAIQGD F A N+GFENSAG 
Sbjct  299   VEVLTNMTHIVFVGDGGKKSIITGNKNFMDGVTTYHTATVAIQGDHFTAINMGFENSAGP  358

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV  D  IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VFQN
Sbjct  359   QKHQAVALRVQGDKAIFYNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQN  418

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CK +VRKPM++Q+C+VTAQGRK+R   +AIV++   I+A+P        +K +L RPWK 
Sbjct  419   CKFVVRKPMSDQQCIVTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKSYLARPWKN  478

Query  1805  FSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             FSRT+IM TFIDD++ P+G+  W   +G + +DTC+YAEY N GPG+   KRVKW G   
Sbjct  479   FSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYAEYHNYGPGSDKSKRVKWAGI-Y  537

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             NI+ + A++F P  F    + W+    IP+ P
Sbjct  538   NINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  568



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   535 bits (1379),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 269/567 (47%), Positives = 369/567 (65%), Gaps = 22/567 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESAD--GGGEISTASKSVKEICAPTDYKETCE  3039
             KK  + G+ +  LVA V+   +   ++  + D      I+  +K+++ +CAPTDYKETC 
Sbjct  10    KKSIIAGILTALLVAMVIVVAIIKTQNSSNPDKTTTVHITATTKAIRAVCAPTDYKETCV  69

Query  3038  RSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKELL  2868
              SL  A  D+  P ELIKL F +T+++I D++ K+  EL  +A  D  T  ALD C++L+
Sbjct  70    NSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGELKAKAANDNETKGALDLCEKLM  129

Query  2867  HNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
              ++ DDL++       F + HI+++  DL+VWLSG+I  Q+TC+D FE    +  + M  
Sbjct  130   TDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSIAYQQTCMDTFEEINSNLSQDMHK  189

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqeeEFPGFV  2523
             + +T+ EL+SN LAMIT  +  L    I G+     N  R+LL+ E       +  P +V
Sbjct  190   IFETSKELTSNALAMITSISTFLGE-HITGLIGDHGNHGRKLLSTE-------DGIPSWV  241

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                TRRL+  +   +K D+VVA+DGSGQYK++ EAL  VP  N +  VI+IK GVYNE+V
Sbjct  242   GPNTRRLMA-EQGVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVIYIKQGVYNEKV  300

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             +V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI GD F A+NIGFEN+AG 
Sbjct  301   DVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTAKNIGFENTAGP  360

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
               HQAVALRVSAD  +FHNC ID YQDTLY HS+RQFYRDCTISGTVDFIFG+  VV Q 
Sbjct  361   EGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQK  420

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C ++VRKPM  Q CM+TAQGR + R +  +VL +C I  EP        NK +LGRPWK+
Sbjct  421   CNIVVRKPMKGQSCMITAQGRTNERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQ  480

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             FSRT+IM T I+D+V P GW  W G+  L+T +YAEY+N G G+   +RVKW G K+ +S
Sbjct  481   FSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIKK-LS  539

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             P+ A +FTP  FL  +  W+   ++P+
Sbjct  540   PKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   539 bits (1389),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 267/585 (46%), Positives = 374/585 (64%), Gaps = 33/585 (6%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             M    + + VA+  V S+ LVA +VA  +++ +  +S + G + +T+ K+++ IC  T Y
Sbjct  1     MAGNNRKRNVAIISVCSLILVAMIVAVAITM-KGKDSDNNGQDATTSQKTIESICQTTRY  59

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             + TC  SL + A+ + DPK+LI+ +F+V ++ I +AI  S +L++ +KDPR   AL+ C+
Sbjct  60    QHTCVESLESSAEGSSDPKDLIQKSFQVAIKKIKEAIENSTMLQKLEKDPRAKLALENCQ  119

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT QETC+D FE TTG+T EK
Sbjct  120   KLAWQAVNDLNRTHTKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEKTTGETEEK  179

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSL--------------EIPGVNFKRRLLTAETK  2559
             MK  L ++ EL+SN L MIT  + +  SL              E P +     LL     
Sbjct  180   MKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILGHGNELL-----  234

Query  2558  GeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVV  2379
                     P +VD   RRLL      IK DIVVAKDGS +YK++ EAL+ +P   ++T V
Sbjct  235   --------PDWVDMRRRRLLAA--KEIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYV  284

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             ++IK GVYNE+VE    M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ GD F+A
Sbjct  285   LYIKQGVYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFVA  344

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             ++IGFENSAG  KHQAVALRV+AD +IF+NCHID YQDTL  H+YRQFYRDC I GT+DF
Sbjct  345   KDIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDF  404

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+   VFQNC + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +       
Sbjct  405   VFGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYDEVKGE  464

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWKE+SRT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+S  +R
Sbjct  465   VKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKTER  524

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              KW+G K  +     ++FT   FL  D  W+    IP++PGF  P
Sbjct  525   AKWQGVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLP  567



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   535 bits (1378),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 274/577 (47%), Positives = 383/577 (66%), Gaps = 25/577 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +   ++   E      ++++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKEL+K+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA D SG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   535 bits (1378),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 273/592 (46%), Positives = 393/592 (66%), Gaps = 27/592 (5%)
 Frame = -1

Query  3233  MGSPEQNKK-VAVTGVASIFLVACVVAA-------TVSVGRSGESADGGGEISTASKSVK  3078
             MG   Q+K+ +A+ GV++IFLVA VVA         ++ G + ++ D   +I+++ K+VK
Sbjct  1     MGEDGQSKRRIAIIGVSTIFLVAMVVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVK  60

Query  3077  EICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRT  2901
              +C PTDY++ CE+SL A A +T DP+ELIK+AF++T++ + + + K++ + E + DPR+
Sbjct  61    TLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPRS  120

Query  2900  SDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFEN  2721
               AL+TCK+L++ SID+ KRS +++  FD+ ++    N L+VWLSGAIT QETC+D F+N
Sbjct  121   KMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQETCLDGFKN  180

Query  2720  TTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee---  2550
             TT   G KMK+LLK+   +SSN LA+I+   + +  + +   +   R L  ++  E    
Sbjct  181   TTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFG  240

Query  2549  qeeEFPGFVD-------AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             Q +  P +V+          RRLL      IK ++VVAKDGSG+YKS+ +AL+ VP KN 
Sbjct  241   QHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQ  300

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY TA+VA++GD
Sbjct  301   KPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGD  360

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A NIGFENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFYRDCTISG
Sbjct  361   YFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISG  420

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDF+FG+A  VFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++      
Sbjct  421   TVDFVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HT  477

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGP  1680
              N  NK +L RPWK  SRT+ M T+I+ ++ PEG+  WQG   L   D C+YAEY N GP
Sbjct  478   ENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNNTGP  537

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             G++  KRVKW+G    ++ E   +++P  F   D+ W+   +IP+      P
Sbjct  538   GSNKSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVTAP  587



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   534 bits (1376),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 276/579 (48%), Positives = 371/579 (64%), Gaps = 27/579 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSV------------GRSGESADGGGEISTASKSVKEIC  3069
             K++ +  +++  L+A V+A                 G  G S D     S + K++K IC
Sbjct  13    KRIVIISLSAFLLMAMVMAVAAGFIMEKGFYNSPVSGSKGSSHDK----SASMKAIKTIC  68

Query  3068  APTDYKETCERSL--AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
              PTDYK+ C  SL  A    T DP ELI+  F+V ++ +TDA  KS+ L++ +KDPRTS+
Sbjct  69    QPTDYKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFLRKLEKDPRTSN  128

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFD-MAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALD C+EL+  ++ +L++S  ++   D      E   DLKVWLS  IT QE+C+DAFENT
Sbjct  129   ALDACEELMDLALSELRQSLVRLGYIDDFTKFNEMLVDLKVWLSATITYQESCLDAFENT  188

Query  2717  TG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqe  2544
             T   D  E+MK +L T+  LSSN LAM++        L  P  +  RRLL  +       
Sbjct  189   TSSTDAAEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSS-HRRLLQFDAFPVIGH  247

Query  2543  eEF--PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
              EF  P + +   R+L ++ P   K DI+VAKDGSG YK++ EAL  VP   +ET +I+I
Sbjct  248   SEFEDPKWYEGGVRKL-SSAPKINKPDIIVAKDGSGSYKTITEALDHVPKYGNETFIIYI  306

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  2190
             K GVYNE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVAIQGD F+AR+I
Sbjct  307   KEGVYNEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTPTYHTATVAIQGDHFMARDI  366

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             GFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH+ RQFY DCTISGT+DF+FG
Sbjct  367   GFENSAGPEKHQAVALRVSADEAIFYRCSMDGYQDTLYTHAQRQFYCDCTISGTIDFVFG  426

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  VFQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I AEP        NK 
Sbjct  427   DATAVFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENKA  486

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N GP A+  +RV W
Sbjct  487   YLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAESGNTGPAANKARRVTW  546

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +G K+ I+      FTPG F   D +W+  + +P+ PG 
Sbjct  547   RGIKQ-ITENHTADFTPGRFFRGD-KWIRLSGVPYIPGL  583



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   533 bits (1373),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 274/577 (47%), Positives = 376/577 (65%), Gaps = 29/577 (5%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEIC  3069
             G   + +++A+ GV+++ LVA VVA TV   R+    D   E      I++  K+V+ IC
Sbjct  4     GDANKGRRIAIIGVSTLLLVAMVVAVTVGANRNQNGYDDDIEDNQRNHIASTMKAVQTIC  63

Query  3068  APTDYKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTS  2898
              PT+YK+ CE +L   A A +  DPKELIK+AF VT+  I++ I +++L+ E +KDPR+ 
Sbjct  64    HPTEYKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKETDLMHEVEKDPRSK  123

Query  2897  DALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALDTCK+L+  SI +  RS      FD+  + +   +LKVWL+GA+T  +TC+D F+NT
Sbjct  124   DALDTCKQLMDLSIGEFTRSLDGFSQFDLQDMDKILMNLKVWLNGAVTYMDTCVDGFDNT  183

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-TAETKGeeqee  2541
             T + G KMK LL ++  + SN LA+I+ F + L       V F RRLL  +ET       
Sbjct  184   TTEAGAKMKELLTSSMHMGSNALAIISDFADTLADWNATKV-FGRRLLHDSET-------  235

Query  2540  EFPGFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
               P +VD   R+L+ T   + +H  ++ VA DG+G +K++ EAL  VP K  +  +I+IK
Sbjct  236   --PSWVDH--RQLIDTKTNTFRHKPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIK  291

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVY+E VEV ++M  +VFVG+G  K+ ITG+++  DG+ TY TA+VAIQGD F A N+G
Sbjct  292   EGVYSEYVEVTKRMTHVVFVGDGGKKSVITGNKNFIDGVNTYRTASVAIQGDHFTAINMG  351

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAG  KHQAVALRV  D +IF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGN
Sbjct  352   FENSAGPHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGN  411

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +
Sbjct  412   ALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAY  471

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+IM  FIDD++ P+G+  WQ   G   +DTC+YAEY N GPG+   KRV
Sbjct  472   LARPWKNFSRTIIMDAFIDDLIHPDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRV  531

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
              W G   N++ + A  F P  F    + W+    IPF
Sbjct  532   HWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPF  566



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   533 bits (1372),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 264/552 (48%), Positives = 359/552 (65%), Gaps = 31/552 (6%)
 Frame = -1

Query  3134  SGESADGGGEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENI  2958
             SG    G  +I T +K+V+ +C PTDYKETC  SL A + ++  P +LI+L F +T+ +I
Sbjct  37    SGPIKHGDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSI  96

Query  2957  TDAISKS--ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTND  2784
                I K+  EL   A+KDP T  ALD C+EL+ ++IDDLK+ F K + F++   +E+  D
Sbjct  97    HQGIKKAAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVED  156

Query  2783  LKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI  2604
             L+VWLSG+I  Q+TC+D FE    D  ++M  + KT+ EL+SNGLAM++  + LL    I
Sbjct  157   LRVWLSGSIAFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNI  216

Query  2603  PGV-----NFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQ  2439
              GV     ++ R+LL+ E       + FP ++    R+L+      +K + VVA DGSGQ
Sbjct  217   TGVRGDLGSYARKLLSTE-------DGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQ  269

Query  2438  YKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK  2259
             +KS+  AL+ VP KN    VI+IK G+Y E+V+V + M+ + F+G+GPTKTRITG+ +  
Sbjct  270   FKSINAALKTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFG  329

Query  2258  DG-IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAY---  2091
              G + TY TATVA+ G+ F A++IGFEN+AG   HQAVALRVSAD  +FHNC ID Y   
Sbjct  330   MGKVKTYQTATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYVDS  389

Query  2090  ----------QDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECM  1941
                       QDTLY HS+RQFYRDCTISGT+D+IFG+A   FQNC M+VRKPM  Q CM
Sbjct  390   FYANCQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCM  449

Query  1940  VTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIV  1761
             VTAQGR D+R    IVL +C I  +PA       NK +LGRPWK+FSRT+IM T I+DI+
Sbjct  450   VTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDII  509

Query  1760  VPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
              P+GW  W G   LDT  YAE++N+GPG++   RVKW G K+  +P  A +FT G FL  
Sbjct  510   DPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQG  568

Query  1580  DEQWLGRAQIPF  1545
                W+ + Q+P+
Sbjct  569   GT-WIPQTQVPY  579



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   532 bits (1371),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 272/583 (47%), Positives = 390/583 (67%), Gaps = 24/583 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAA------TVSVGRSGESADGGGEISTASKSVKEICAPT  3060
             ++ +++ + GV++IFLVA VVA        +  G + ++ D    ++++ K+VK +C PT
Sbjct  7     QKKRRIVIIGVSAIFLVAVVVAVAVGVNLNIKGGSNDDAQDNKSHVASSVKAVKTLCKPT  66

Query  3059  DYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DY + CE+SL A A +T DP+ELIK+AF +T++ I + + K++++ + + DP +  ALDT
Sbjct  67    DYPKECEKSLSAEAGNTTDPRELIKIAFNITIKKIGNGLKKTDIMHKVENDPISKMALDT  126

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CK+L+  SID+ KRS +++  FD+ ++    N L+VWLSGAIT Q+TC+D F+NTT + G
Sbjct  127   CKQLMDLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQDTCLDGFKNTTNEAG  186

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq----eeEF  2535
              KMK+LL ++  +SSN LA+I+   +++  + +       R L  +++G E     EE  
Sbjct  187   NKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDG--HRELVEDSRGGEHVFGHEEVI  244

Query  2534  PGFVD---AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
             P +V+      RRLL   P  +K ++VVAKDGSG+YKS+ +AL+ VP +N +  VI+IK 
Sbjct  245   PSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYIKE  304

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA+VAI GD FIA NIGF
Sbjct  305   GVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINIGF  364

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFYRDCTISGT+DF+FG+A
Sbjct  365   ENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDFVFGDA  424

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
              VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++    K     NKV+L
Sbjct  425   VVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKF---DNKVYL  481

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGPGASTDKRVK  1653
              RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YAEY N GPG++  KRVK
Sbjct  482   ARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYAEYNNTGPGSNKSKRVK  541

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             W+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  542   WRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  582



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   531 bits (1367),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 273/568 (48%), Positives = 382/568 (67%), Gaps = 20/568 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG-GGEISTASKSVKEICAPTDY  3054
             G+ E+ K++A+ GV+++ LVA VVA TV V  S   ++    +I+++ K+V+ +C PT+Y
Sbjct  4     GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+ CE SL A A +T DPKELIK+ F +T+  I D + K+ LL E ++DPR   ALDTCK
Sbjct  64    KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SI++L RS   +  FD+ +I +   +LKVWLSGA+T Q+TC+D FENTT D G+K
Sbjct  124   QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LL     +SSN LA++T+  + +    +      RR L  ++K        P +VD 
Sbjct  184   MKDLLTAGMHMSSNALAIVTNLADTVDDWNV--TELSRRRLLQDSK-------LPVWVDQ  234

Query  2516  ATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RLL  + + ++H  ++ VA DGSG +KS+ EAL+ VP +N +  VI+IK GVY E V
Sbjct  235   --HRLLNENESLLRHKPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVYQEYV  292

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENSAG  
Sbjct  293   EVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQ  352

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  +FQNC
Sbjct  353   KHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAIFQNC  412

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L RPWK +
Sbjct  413   TFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNY  472

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW G   N
Sbjct  473   SRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKWAGI-WN  531

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
             ++ + A+ F+   F    + W+    IP
Sbjct  532   LNSKAARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   531 bits (1369),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 270/588 (46%), Positives = 390/588 (66%), Gaps = 9/588 (2%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             M    + +   + GV S+ LVA VVA  V++  + + A+   ++++  K+++ IC  T Y
Sbjct  1     MAGNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAQ-DVTSTKKAIESICQTTQY  59

Query  3053  KETCERSLAGAKD-TDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             + TC  SL    + + DPKELI+ +F+VT++ I +AI  S  +++ +KDPR   AL+ C+
Sbjct  60    QTTCVESLESTGECSSDPKELIQKSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCE  119

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT QE+C+D FE+TTG+ GEK
Sbjct  120   KLALQAVNDLNRTHLKFESFEFNDLSHWIADLKIWLSGAITYQESCLDGFEDTTGEAGEK  179

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq-eeEFPGFVD  2520
             MK  L  + +L+SN L+MIT  +++  SL   G N +RRLL  +T       E  P ++D
Sbjct  180   MKKALNVSMQLTSNALSMITEISDVFTSLN-AGSN-RRRLLFDDTPVLGHGIELLPDWID  237

Query  2519  AATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RRLL  + ++ IK D+VVAKDGSG+YK + +AL+ +P   ++T V++IK GVY+E+V
Sbjct  238   VGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVYDEKV  297

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             E+   M+ +V +G+GPTKTRITG++S K G+ TY T+TVAI GD F+A++IGFEN+AG  
Sbjct  298   EILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAIMGDYFVAKDIGFENTAGPD  357

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQA+ALRV+AD +IF+NCH+D YQDTL  H+YRQFYRDCTI GT+DF+FG+A  VFQNC
Sbjct  358   KHQALALRVAADKSIFYNCHMDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNC  417

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              + VRKPM  Q C+VTAQGR D R  + IVLQ+C I+A+ +        K +LGRPWK++
Sbjct  418   TLAVRKPMKEQHCIVTAQGRTDLRQPSGIVLQNCSIVADESYNEVKGEAKTYLGRPWKQY  477

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM + IDD++ PEGW  W  T   DT +Y E+ N+G G+S   RV W G K  +  
Sbjct  478   SRTIIMESKIDDLIQPEGWLEWNKTFAFDTLFYTEFNNKGLGSSKADRVTWSGVKE-LPI  536

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGF-LQP*NKQAKLSSHPTKD  1482
             E  ++FT   FL AD  W+    +P++ GF L P    + +   P  D
Sbjct  537   ERVQRFTASNFLDAD-LWIPSTGVPYTSGFLLSPPQSDSSIVYSPVND  583



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   534 bits (1376),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 270/588 (46%), Positives = 391/588 (66%), Gaps = 9/588 (2%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDY  3054
             M    + +   + GV S+ LVA VVA  V++  + + A+   ++++  K+++ IC  T Y
Sbjct  1     MAGNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAK-DVTSTKKAIESICQTTQY  59

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             + TC  SL A  + + DPK+LI+++F+VT++ I +AI  S  +++ +KDPR   AL+ C+
Sbjct  60    QTTCVESLEATGECSSDPKDLIQMSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCE  119

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
              L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT QETC+D FE+TTG+ GEK
Sbjct  120   MLALQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEDTTGEAGEK  179

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq-eeEFPGFVD  2520
             MK  L  + +L+SN L+MIT  +++  SL   G N +RRLL  +T       E  P ++D
Sbjct  180   MKKALNVSMQLTSNALSMITEISDVFTSLN-AGSN-RRRLLFDDTPVLGHGIELLPDWID  237

Query  2519  AATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RRLL  + ++ IK D+VVAKDGSG+YK + +AL+ +P   ++T V++IK GVYNE+V
Sbjct  238   VGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEHRNQTYVLYIKEGVYNEKV  297

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             E+   M+ +V +G+GPTKTRITG++S KDGI TY T+TVAI GD F+A++IGFEN+AG  
Sbjct  298   EILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVAIMGDYFVAKDIGFENTAGPD  357

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQA+ALRV+AD +IF+NCH+D YQDTL  H+YRQFYRDCTI GT+DF+FG+A  VFQNC
Sbjct  358   KHQALALRVAADKSIFYNCHVDGYQDTLCAHTYRQFYRDCTIRGTIDFVFGDAAAVFQNC  417

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              + VRKPM  Q C+VTAQGR D R    +V Q+C I+A+ +        K +LGRPWK++
Sbjct  418   TLAVRKPMKEQHCIVTAQGRTDARQPTGLVFQNCSIVADESYNEVKGEVKTYLGRPWKQY  477

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM + IDD++ PEGW  W  T   +T +Y E+ N+G G+S   RV+W G K  +  
Sbjct  478   SRTIIMESNIDDLIQPEGWLEWNKTFAFETLFYTEFNNKGSGSSKTDRVRWSGVKE-LPI  536

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSSHPTKD  1482
             E  ++FT   F+ AD  W+    +P++ G FL P    + +   P  D
Sbjct  537   ERVQRFTTSSFIDAD-LWIPSTGVPYTSGFFLSPPQSDSSIVYSPVDD  583



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   530 bits (1365),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 374/582 (64%), Gaps = 22/582 (4%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG------EISTASKSVKEI  3072
             MG   Q + V + GV++  LVA VVA TV+V  + + +           ++++ K+VK +
Sbjct  1     MGGDAQKRNV-IIGVSTFLLVAMVVAVTVNVNFNNKGSSSDSKEESKSHVASSMKAVKTL  59

Query  3071  CAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD  2895
             CAPTDYK+ CE +L   A +  DP+ELIK+AF VT+  I + + K++L+ E + DP T +
Sbjct  60    CAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQLMHEVENDPITKE  119

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALDTCK+L++ SI +  RS  K   FD+ ++      LKVWLSGAIT QETC+DAFENTT
Sbjct  120   ALDTCKQLMNLSIGEFTRSLDKFAKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTT  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRLLTAETKGeeqee  2541
              D G+KM+ LL+TA  +SSNGL++I   ++ L  + +  PG   +RRLL           
Sbjct  180   TDAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG---RRRLLNNVDDLPVLGH  236

Query  2540  EF--PGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
             +F  P +VD     R+LL          +VVAKDGSG + ++ EAL+ VP KN    VI+
Sbjct  237   DFDLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYVPKKNLRPFVIY  296

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             +K GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+   
Sbjct  297   VKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASAAILGDFFVGIG  356

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +GFENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+F
Sbjct  357   MGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVF  416

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  V QNC  +VRKP+ NQ+C+VTAQGRK+R   + +V+    I+++P        NK
Sbjct  417   GDAVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVSDPTYYPVRFDNK  476

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDK  1662
              +L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+YAE+ NRGPG+   K
Sbjct  477   AYLARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGFSGMDTCFYAEFNNRGPGSDKTK  536

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             RVKW+G K  +  +    F P  F   D+ W+   +IP+  G
Sbjct  537   RVKWEGVK-TLDSDGITNFLPSMFFHGDD-WIRVTRIPYYSG  576



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   529 bits (1363),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 272/568 (48%), Positives = 382/568 (67%), Gaps = 20/568 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADG-GGEISTASKSVKEICAPTDY  3054
             G+ E+ K++A+ GV+++ LVA VVA TV V  S   ++    +I+++ K+V+ +C PT+Y
Sbjct  4     GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+ CE SL A A +T DPKELIK+ F +T+  I D + K+ LL E ++DPR   ALDTCK
Sbjct  64    KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SI++L RS   +  FD+ +I +   +LKVWLSGA+T Q+TC+D FENTT D G+K
Sbjct  124   QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LL     +SSN LA++T+  + +    +      RR L  ++K        P +VD 
Sbjct  184   MKDLLTAGMHMSSNALAIVTNLADTVDDWNV--TELSRRRLLQDSK-------LPVWVDQ  234

Query  2516  ATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RLL  + + ++H  ++ VA DGSG ++S+ EAL+ VP +N +  VI+IK GVY E V
Sbjct  235   --HRLLNENESLLRHKPNVTVAIDGSGDFESINEALKQVPKENRKPFVIYIKEGVYQEYV  292

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENSAG  
Sbjct  293   EVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQ  352

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  +FQNC
Sbjct  353   KHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAIFQNC  412

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L RPWK +
Sbjct  413   TFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNY  472

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW G   N
Sbjct  473   SRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKWAGI-WN  531

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
             ++ + A+ F+   F    + W+    IP
Sbjct  532   LNSKAARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   529 bits (1362),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 259/530 (49%), Positives = 353/530 (67%), Gaps = 20/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
             +I   +K+++ +CAPTDYKETC  SL  A  D+  P ELIKL F +T+++I D++ K+  
Sbjct  47    QIKATTKAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  ALD C++L+ ++ DDL++       F + HI+++  DL+VWLSG+I
Sbjct  107   ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + M  + +T+ EL+SN LAMIT  +  L    I G+     N
Sbjct  167   AYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGN  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+ E       +  P +V   TRRL+  +   +K ++VVA+DGSG+YK++ EAL 
Sbjct  226   HARKLLSTE-------DGIPSWVGPNTRRLMA-EQGVVKPNVVVAQDGSGEYKTINEALS  277

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N +  VI+IK GVYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  278   VVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHT  337

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD   A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  338   ATVAINGDNLTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQF  397

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+  VV Q C ++VRKPM +Q CM+TAQGR D R +  +VL +C I
Sbjct  398   YRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKSQSCMITAQGRTDERESTGLVLDNCHI  457

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EP        NK +LGRPWK+FSRT+IM T I+D+V P GW  W G+  L+T +YAEY
Sbjct  458   TGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEY  517

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +N G G+   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  518   ENNGLGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   530 bits (1365),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 268/597 (45%), Positives = 369/597 (62%), Gaps = 37/597 (6%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTAS-------KSVKEICAP  3063
             ++ K++A+  V S  LVA VVA TV V  +  S+D G   S+ S       K++K +C P
Sbjct  8     QRKKRIAIIAVCSFLLVAMVVAVTVGVSINDTSSDDGTSNSSKSSQVSASVKAIKSVCQP  67

Query  3062  TDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TD+++TCE  L A A DT D KEL++ AF+  +++ + A+  S  L++ +KDPRT  ALD
Sbjct  68    TDFRKTCEEQLRAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEKDPRTKKALD  127

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              CK+L+  SI +LK+S  +++  D+        DLK+WLS  IT Q+TC+D F+NTT   
Sbjct  128   VCKQLMTYSIKELKKSLDQIDKLDINKFDRMLADLKIWLSATITNQQTCLDGFKNTTSKA  187

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFK--------------------  2586
             GEKMK  L  + ELS NGLA+ T  + +L+ LEI GV+ +                    
Sbjct  188   GEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQENLPVLGHGDWSTYLDI  247

Query  2585  -----RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVE  2421
                  RRLL           +F   +    RRL+   P+ IK DIVVAKDGSG + ++  
Sbjct  248   PMTRRRRLLQDNEPPVLGHGQFE--IQPGVRRLMAAPPSRIKADIVVAKDGSGNFTTINA  305

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             A+ ++P    +  VI+IK GVY E +E   KM  +  +G+G  KTRITG  +N DG+ T+
Sbjct  306   AMSSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITGHLNNADGVPTF  365

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
              TATVA+ GD F A+NIGFENSAGAAK QAVAL V +D ++F+NC +D YQDTLY HS R
Sbjct  366   RTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDGYQDTLYVHSKR  425

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYRDCTI+GT+DF+FG+A  VFQNC  +VR P+  Q+C+VTAQGR D R   AIV+Q+ 
Sbjct  426   QFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPLNGQQCIVTAQGRTDARQPTAIVIQNS  485

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
                A P L         +LGRPW  FSRT+IM +++DD++ PEGW+IW G   L+T +Y+
Sbjct  486   TFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGWAIWDGPWGLNTSFYS  545

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E+ N GPG++   RV W+G KR IS   A  FTPG F+     W+   ++P++PGF 
Sbjct  546   EFNNYGPGSNKTGRVTWRGIKR-ISQATAFGFTPGKFING-AAWIKPRRVPYTPGFF  600



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   528 bits (1359),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 263/568 (46%), Positives = 375/568 (66%), Gaps = 26/568 (5%)
 Frame = -1

Query  3164  VVAATVSV-------GRSGESADGGGEISTASKSVKEICAPTDYKETCERSL-AGAKDTD  3009
             VVA  V V       G + ++ D   +I+++ K+VK +C PTDY++ CE+SL A A +T 
Sbjct  2     VVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVKTLCKPTDYQKECEKSLRAEAGNTT  61

Query  3008  DPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQK  2829
             DP+ELIK+AF++T++ + + + K++ + E + DPR+  AL+TCK+L++ SID+ KRS ++
Sbjct  62    DPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPRSKMALETCKQLMNLSIDEFKRSLER  121

Query  2828  VENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGL  2649
             +  FD+ ++    N L+VWLSGAIT QETC+D F+NTT   G KMK+LLK+   +SSN L
Sbjct  122   MGKFDLNNLDNILNSLRVWLSGAITYQETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNAL  181

Query  2648  AMITHFTELLQSLEIPGVNFKRRLLTAETKGee---qeeEFPGFVD-------AATRRLL  2499
             A+I+   + +  + +   +   R L  ++  E    Q +  P +V+          RRLL
Sbjct  182   AIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLL  241

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                   IK ++VVAKDGSG+YKS+ +AL+ VP KN +  VI+IK GVY+E VEV +KM  
Sbjct  242   HESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTH  301

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +VFVG+G  KTRITG+++  DG+ TY TA+VA++GD F+A NIGFENSAG  KHQAVA+R
Sbjct  302   VVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGDYFVAVNIGFENSAGPEKHQAVAIR  361

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V AD +IF+ C +D YQDTLY H+ RQFYRDCTISGTVDF+FG+A  VFQNC  +VRK +
Sbjct  362   VQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTVDFVFGDAVAVFQNCTFVVRKAL  421

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ+C+VTAQGRK+R   +  V+Q   I++       N  NK +L RPWK  SRT+ M T
Sbjct  422   ENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HTENLDNKAYLARPWKNHSRTIFMNT  478

Query  1778  FIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             +I+ ++ PEG+  WQG   L   D C+YAEY N GPG++  KRVKW+G    ++ E   +
Sbjct  479   YIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNNTGPGSNKSKRVKWRGI-ITLTSESVSR  537

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             ++P  F   D+ W+   +IP+      P
Sbjct  538   YSPYKFFHGDD-WIKVTRIPYYSAVTAP  564



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   528 bits (1359),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 261/572 (46%), Positives = 377/572 (66%), Gaps = 17/572 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTAS-------KSVKEICAPT  3060
             +  KVA+  ++ + L+A +VA  V+V     +A       T S       K+++ +C PT
Sbjct  2     EKNKVALVSLSFVILLAGLVAVAVTVSHLNSNASSINNPPTESPRPNTSIKAIQTVCQPT  61

Query  3059  DYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+ CE++L+  + +T D  EL+ +AF  +++ +TD   +SELLKE  KDP +++AL T
Sbjct  62    DYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLKEVSKDPASTEALQT  121

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C+ELL  ++DDLK+S  ++ N      ++   DLKVWLS AIT Q+TC+D FE       
Sbjct  122   CRELLEYAMDDLKKSIVQLGNVHKNLYEQAVEDLKVWLSAAITYQDTCVDGFEGINTSAA  181

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             E M+  ++ + +++SN LAM+     L++SL I  +  +R+LL+     +    EFP ++
Sbjct  182   ETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSL-LRRKLLS-----DAGANEFPSWM  235

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
              AA RRLL   PA I  ++ VA+DG+G ++++ EAL  VP  N+ T VI++KAGVY ER 
Sbjct  236   PAAQRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFVIYVKAGVYKERF  295

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAGA  2166
              V + M K+  +G+GPTKT+ITG+ S   G I T+ TATVA+ G+ F+   +GFEN+AG 
Sbjct  296   LVDKHMTKVTMIGDGPTKTKITGNVSVIAGEISTFKTATVAVAGEWFVGIGLGFENTAGP  355

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV+AD ++F+NC +D YQDTLY HS RQFYRDCTI+GT+DFIFG++  +FQN
Sbjct  356   EKHQAVALRVNADRSVFYNCRMDGYQDTLYAHSERQFYRDCTITGTIDFIFGDSATIFQN  415

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             C +I RKPM NQ+ +VTAQGRK+R+G  AIVLQ+C I ++PA          +LGRPWK 
Sbjct  416   CMIIARKPMDNQQNIVTAQGRKERQGNGAIVLQNCTITSDPAYYPHRKVLPTYLGRPWKP  475

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRTLI+ + +DD++ P+GW  W G + LDTC+YAE  NRGPGA   KRV W G K N++
Sbjct  476   YSRTLILQSQLDDLIHPDGWLPWTGDVGLDTCFYAELDNRGPGADLTKRVTWPGIK-NLT  534

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                A+++T   +L   + W+ RA +PF PG L
Sbjct  535   YVEAQEYTIENYLYG-QTWISRAGVPFIPGLL  565



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   528 bits (1360),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 276/575 (48%), Positives = 369/575 (64%), Gaps = 26/575 (5%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEICAPTD  3057
             + +++A+ GV+++ LVA VVA TV         D   E      I++  K+V+ IC PTD
Sbjct  8     KGRRIAIIGVSTLLLVAMVVAVTVGTYGDQNGYDDNIEDTRKNHIASTMKAVQTICHPTD  67

Query  3056  YKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             YK+ CE +L   A A +  DPKELIK+AF VT++ I D I +++LL E +KDPR+ DALD
Sbjct  68    YKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKETDLLHEVEKDPRSKDALD  127

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
             TCK+L+  SI++  RS   +  FD+  I +   +LKVWL+GA+T  +TC+D FENTT + 
Sbjct  128   TCKQLMDLSIEEFTRSLDGINEFDLKDIDKILMNLKVWLNGAVTYIDTCLDGFENTTSEA  187

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             G KMK LL ++  +SSN LA+I+ F + +       +  +R L  +ET         P  
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRRLLHDSET---------PSS  238

Query  2525  VDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
             VD   ++         KH  ++ VA DGSG +KS+ EAL  VP K+ +  VI+IK GVY 
Sbjct  239   VDHHHKQH-NAKKNVFKHKPNVTVALDGSGDFKSINEALTQVPKKSKKPFVIYIKEGVYP  297

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VAIQGD F+A N+GFENSA
Sbjct  298   EYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENSA  357

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VF
Sbjct  358   GPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVF  417

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +L RPW
Sbjct  418   QNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPW  477

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             K FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV W G 
Sbjct  478   KNFSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRVNWAGI  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
               N++ + A  F P  F    + W+    IPF  G
Sbjct  538   -WNLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  570



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   527 bits (1358),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 240/546 (44%), Positives = 354/546 (65%), Gaps = 14/546 (3%)
 Frame = -1

Query  3134  SGESADGGGEISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENI  2958
             SG+   G  +I+  +K+++ IC PT YK+ CE +L  +  +T+DPKEL+K AFRV  E +
Sbjct  35    SGDKGAGENKIAAGTKAIQSICQPTRYKQACESTLTNSGGNTNDPKELVKTAFRVAKEEV  94

Query  2957  TDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLK  2778
               A+ KS+ ++ A  DPR ++ ++ C+E++  +I+DL+R+ + V  F M +I ++  DL+
Sbjct  95    AKALEKSKTIQAAKDDPRAAEGIEICREVVGYAINDLERTVESVGAFSMDNIDDFLEDLR  154

Query  2777  VWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG  2598
             VW+ GAIT QE C + FEN+T D G KM++    + ELSSN L +IT    +LQ L+IPG
Sbjct  155   VWIGGAITYQEVCFEGFENSTSDAGTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIPG  214

Query  2597  VNFK------------RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAK  2454
             ++              RRLL    KG     E P +V    R+++    + +K D  V++
Sbjct  215   LDLSALNGGGDGGAAHRRLLGKAPKGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQ  274

Query  2453  DGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG  2274
              G GQYK++ EA+  VP  N    +I+IKAG Y E + + +K   ++ VG+GPTKT ITG
Sbjct  275   SGGGQYKTISEAIAKVPMNNASPFIIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITG  334

Query  2273  SRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDA  2094
             S++   GI T+ TATV + GDGF+AR++  ENS+G   HQAVAL+V +D+ + +NC    
Sbjct  335   SKNFAAGINTFKTATVGVLGDGFMARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTG  394

Query  2093  YQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDR  1914
              QDTLY    RQFYRDCT+SGT+DFIFG+A  VFQNCK++VRKP  NQ+CMVTAQGR + 
Sbjct  395   NQDTLYALRGRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEE  454

Query  1913  RGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ  1734
             +G  A + + C + +EP  KA    N  +LGRPWKE+S+T+ M++ IDD + P+GW+ WQ
Sbjct  455   KGPGAFIFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQ  514

Query  1733  GTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQ  1554
             G   LDT +YAE++N+G GA   +RVKWKG K  +S + A  FTP    ++ ++W+  + 
Sbjct  515   GNFALDTLYYAEFENKGAGADKSQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIPESG  573

Query  1553  IPFSPG  1536
             +P++PG
Sbjct  574   VPYAPG  579



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   526 bits (1355),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 267/580 (46%), Positives = 377/580 (65%), Gaps = 30/580 (5%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGG-----EISTASKSVKEICA  3066
             GS ++ K +   GV+++     +V        + ++ADG       +I T +K+VK +CA
Sbjct  4     GSDDKKKCIIAGGVSALL----IVMVVSVAVVTSKNADGPNKLADIQIKTTTKAVKAVCA  59

Query  3065  PTDYKETCERS-LAGAKDTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSD  2895
              TDYKETC  S ++ + ++  P +LI+L F +T+++I + I K+  EL ++A KDP    
Sbjct  60    ITDYKETCINSFMSASPNSTQPLDLIRLGFDLTIKSIHEGIKKAADELKEKAAKDPEAKR  119

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALD C EL+ +S DDL + F K + F+++ I+E+  DL+VWLSG++  Q+TCID F+   
Sbjct  120   ALDLCHELMIDSTDDLSKCFDKFDGFNLSEIEEFVEDLRVWLSGSMAFQQTCIDTFDEVK  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGee  2550
              D  + M  + KT+ EL+SNGLAM++  +  L    I  +N     + R+LL+ E     
Sbjct  180   SDLAQDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDLGSYARKLLSTE-----  234

Query  2549  qeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
               + FP ++   TR+L+   T P  +K + VVA DGSGQ+KS+ +AL+ VP  N    VI
Sbjct  235   --DGFPTWMRPETRKLMAAVTGP-KVKPNAVVALDGSGQFKSINDALKTVPKNNKFPFVI  291

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIA  2199
             +IK G+Y E+V+V + M  + F+G+GPTKT +TG+ +   G + TY TATVA+ G+ F A
Sbjct  292   YIKQGIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNFGIGNVKTYQTATVAVNGENFTA  351

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             ++IGFEN+AG   HQAVALRVSAD  +F+NC ID YQDTLY HS+RQFYRDCTISGT+D+
Sbjct  352   KDIGFENTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTLYAHSHRQFYRDCTISGTIDY  411

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A   FQNCKM+VRKPM  Q CMVTAQGR D+R +  I+L +C I+ +PA       
Sbjct  412   IFGDAKSFFQNCKMVVRKPMGGQSCMVTAQGRTDKRESTGIILHNCRIMGDPAYIPVKST  471

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDDI+ P+GW  W G   LDT  Y EY+N G G+  + R
Sbjct  472   NKAYLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWNGNFALDTLEYGEYENNGSGSGQEMR  531

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             VKW G K+ +S   A QFT G FL  +  W+ R ++P++P
Sbjct  532   VKWPGIKK-LSARQALQFTAGRFLRGN-TWIPRRRVPYTP  569



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   524 bits (1350),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 269/555 (48%), Positives = 369/555 (66%), Gaps = 25/555 (5%)
 Frame = -1

Query  3164  VVAATVSVGRSGESADGGGE------ISTASKSVKEICAPTDYKETCERSL-AGAKDTDD  3006
             VVA T+ V  +   ++   E      ++++ K+V+ +C PT+Y++ CE SL AGA +T D
Sbjct  2     VVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTD  61

Query  3005  PKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKV  2826
             PKEL+K+ F +T+  I D + ++ +L E +++PR   ALDTCK+L+  SI +L RS   +
Sbjct  62    PKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGI  121

Query  2825  ENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLA  2646
               F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT D G+KMK LL     +SSN LA
Sbjct  122   NEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALA  181

Query  2645  MITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD--PASIKH  2472
             ++T   + +    I   +F RRLL        Q+ E P +VD    RLL  +  P   K 
Sbjct  182   IVTDLADTVNDWNITK-SFGRRLL--------QDSELPSWVDQ--HRLLNENASPFKRKP  230

Query  2471  DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPT  2292
             ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GVY E VEV +KM  +VF+GEG  
Sbjct  231   NVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGK  290

Query  2291  KTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFH  2112
             KTRI+G+++  DG  TY TATVAIQGD F+A N+GFENSAG  KHQAVALRV AD +IF+
Sbjct  291   KTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFENSAGPHKHQAVALRVQADKSIFY  350

Query  2111  NCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTA  1932
             NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VFQNC  +VRKPM NQ+C+VTA
Sbjct  351   NCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMENQQCIVTA  410

Query  1931  QGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPE  1752
             QGRK+R+  + IV+Q   I+++P   +    NK +L RPWK +SRT+IM T+IDD++  +
Sbjct  411   QGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLIDAD  470

Query  1751  GWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
             G+  WQG      +DTC+YAEY N GPG+   KRVKW G   N++ + A+ F+P  F   
Sbjct  471   GYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFFHG  529

Query  1580  DEQWLGRAQIPFSPG  1536
              + W+    IP  PG
Sbjct  530   TD-WIEVTGIPCFPG  543



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   524 bits (1349),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 268/565 (47%), Positives = 367/565 (65%), Gaps = 28/565 (5%)
 Frame = -1

Query  3182  IFLVACVVAATVSVGRSGESA----------DGGGEISTASKSVKEICAPTDYKETCERS  3033
             + LVA VVA T+S+ ++              +    +++  K+V+ IC PT YK+ C  S
Sbjct  2     LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  3032  L---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
             L   A A +  DPKELIK+AF VT+  I + + ++E+  E +KD R+ DALDTCK+L+H 
Sbjct  62    LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             SI +  RS   +  FD+ H+ +   +LKVWL+GA+T  +TC+D FENTTGD  +KMKHLL
Sbjct  122   SIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDGFENTTGDASKKMKHLL  181

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
              ++  +SSN LA++++F + +  + +  + F R LL        Q+ E P +V+      
Sbjct  182   TSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRCLL--------QDSEIPSWVEHRILLD  232

Query  2501  LTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIFIKAGVYNERVEVPRKM  2325
               T+ +  K ++ VA DGSG +KS+ EAL+ VP + DET  VI+IK GVY E VEV + M
Sbjct  233   AMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYREYVEVLKNM  292

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQ D F A N+GFENSAG  KHQAVA
Sbjct  293   THIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSAGPQKHQAVA  352

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRV  D  IF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VFQNCK +VRK
Sbjct  353   LRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRK  412

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K +L  PWK FSRT+IM
Sbjct  413   PMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPWKNFSRTIIM  472

Query  1784  FTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
              TFIDD++ P+G+  W   +G + +DTC+Y EY N GPG+   KRVKW G   NI+ + A
Sbjct  473   DTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGI-YNINTKAA  531

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSP  1539
             ++F P  F    + W+    IP+ P
Sbjct  532   QKFAPSKFFHGGD-WIKDTGIPYYP  555



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   523 bits (1346),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 266/566 (47%), Positives = 380/566 (67%), Gaps = 21/566 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KKV + G+AS+ +VACVVAA V++ +        G ++T++KSV+ +C PT YK+TCE++
Sbjct  3     KKVVIGGIASVLVVACVVAACVTLTKHDSDTSSNG-VATSTKSVESMCQPTPYKQTCEKT  61

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+  DPK+ IK+AF  TV +I +AI  +E +K+A  DP T DAL  C+E+   +++
Sbjct  62    LSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVKKAASDPYTKDALLACEEVFDLAVE  121

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT-GDTGEKMKHLLKT  2676
             +L+ S  ++ENFD + +K+  +DLK WLS  +  +ETC+D F  +    T ++M  L+ T
Sbjct  122   ELRGSIARIENFDFSKMKDIVDDLKSWLSAVVAYEETCLDGFTKSEYSATRDEMMKLMST  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELSSN L+M+ +F E++           R+LL+              FV+A+ R+LL 
Sbjct  182   TRELSSNALSMVNNFGEMITQ----NTGLTRKLLSNSD----------SFVEASNRKLLQ  227

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                ++ K + VV+  G GQYK++ EAL+AVP  +    VI IKAG Y E +E+ + M  +
Sbjct  228   I--SASKPNAVVSTSGGGQYKTIQEALQAVPRSSPTPFVILIKAGTYKEHIEIEKNMLNV  285

Query  2315  VFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             V +GEGPTKT ITG ++   + I T+HTAT+ + GDGF+ +++G EN+AG  K QAVALR
Sbjct  286   VLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVMKDMGIENTAGPTKEQAVALR  345

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             ++AD  + +NC+ID YQDTLY HS RQFYRDCTI+GT+DF+FG+A  VFQNCK+IVRKP 
Sbjct  346   INADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPG  405

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ CM+TAQGR  +      V+Q+C+I A+ AL +ANPP KV+LGRPWKEFS+T+IM +
Sbjct  406   PNQACMITAQGRMRKDSLGGFVIQNCDIKADQALTSANPPVKVYLGRPWKEFSKTIIMQS  465

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
              ID  V P GWS W  T + + TC+YAEYQNRGPGA+ DKRV  W+GY+++IS +V   F
Sbjct  466   NIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSF  525

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             T G F+   + WL    IP+  G ++
Sbjct  526   TAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   523 bits (1346),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 275/573 (48%), Positives = 370/573 (65%), Gaps = 23/573 (4%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE------ISTASKSVKEICAPTD  3057
             + +++A+ GV+++ LVA VVA TV   R+    D   E      +++  K+V+ IC PTD
Sbjct  8     KGRRIAIIGVSTVLLVAMVVAVTVGTYRNQNGYDDNIEDTKKNHVASTMKAVQTICHPTD  67

Query  3056  YKETCERSL---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALD  2886
             YK+ CE +L   A A +  DPKELIK+AF VT++ I D I +++LL E +KDPR+ DALD
Sbjct  68    YKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKETDLLHEVEKDPRSKDALD  127

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
             TCK+L+  SID+  RS   +  FD+ +I +   +LKVWL+GA+T  +TC+D FENTT + 
Sbjct  128   TCKQLMDLSIDEFTRSLDGINEFDLQNIDKILMNLKVWLNGAVTYMDTCLDGFENTTSEA  187

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             G KMK LL ++  +SSN LA+I+ F + +       +  +  L  +ET         P  
Sbjct  188   GTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRHLLHDSET---------PSS  238

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             VD   +     +    K ++ VA DGSG +KS+ EAL  VP K+ +  VI+IK GVY E 
Sbjct  239   VDHHKQHNAMKNVFKHKPNVTVALDGSGDFKSINEALTRVPEKSKKPFVIYIKEGVYPEY  298

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VAIQGD F+A N+GFENSAG 
Sbjct  299   VEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAINMGFENSAGP  358

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VFQN
Sbjct  359   HKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQN  418

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +L RPWK 
Sbjct  419   CKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYLARPWKN  478

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV W G   
Sbjct  479   FSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKSKRVNWAGI-W  537

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             N++ + A  F P  F    + W+    IPF  G
Sbjct  538   NLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  569



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   523 bits (1347),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 268/565 (47%), Positives = 367/565 (65%), Gaps = 28/565 (5%)
 Frame = -1

Query  3182  IFLVACVVAATVSVGRSGESA----------DGGGEISTASKSVKEICAPTDYKETCERS  3033
             + LVA VVA T+S+ ++              +    +++  K+V+ IC PT YK+ C  S
Sbjct  2     LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  3032  L---AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
             L   A A +  DPKELIK+AF VT+  I + + ++E+  E +KD R+ DALDTCK+L+H 
Sbjct  62    LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             SI +  RS   +  FD+ H+ +   +LKVWL+GA+T  +TC+D FENTTGD  +KMKHLL
Sbjct  122   SIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDGFENTTGDASKKMKHLL  181

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
              ++  +SSN LA++++F + +  + +  + F R LL        Q+ E P +V+      
Sbjct  182   TSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRCLL--------QDSEIPSWVEHRILLD  232

Query  2501  LTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIFIKAGVYNERVEVPRKM  2325
               T+ +  K ++ VA DGSG +KS+ EAL+ VP + DET  VI+IK GVY E VEV + M
Sbjct  233   AMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIYIKEGVYREYVEVLKNM  292

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQ D F A N+GFENSAG  KHQAVA
Sbjct  293   THIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQEDHFTAINMGFENSAGPQKHQAVA  352

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRV  D  IF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  VFQNCK +VRK
Sbjct  353   LRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRK  412

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P        +K +L  PWK FSRT+IM
Sbjct  413   PMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPWKNFSRTIIM  472

Query  1784  FTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
              TFIDD++ P+G+  W   +G + +DTC+Y EY N GPG+   KRVKW G   NI+ + A
Sbjct  473   DTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGI-YNINTKAA  531

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSP  1539
             ++F P  F    + W+    IP+ P
Sbjct  532   QKFAPSKFFHGGD-WIKDTGIPYYP  555



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   520 bits (1340),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 265/566 (47%), Positives = 378/566 (67%), Gaps = 21/566 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KKV + G+AS+ +VACVVAA V++ +        G ++T++KSV+ +C PT YK+TCE++
Sbjct  3     KKVVIGGIASVLVVACVVAACVTLTKHDSDTSSNG-VATSTKSVESMCQPTPYKQTCEKT  61

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+  DPK+ IK+AF  TV +I +AI  +E +K+A  DP T DAL  C+E+   +++
Sbjct  62    LSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVKKAASDPYTKDALLACEEVFDLAVE  121

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT-GDTGEKMKHLLKT  2676
             +L+ S  ++ENFD + +K+  +DLK WLS  +  +ETC+D F  +    T ++M  L+ T
Sbjct  122   ELRGSIARIENFDFSKMKDIVDDLKSWLSAVVAYEETCLDGFTKSEYSATRDEMMKLMST  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELSSN L+M+  F E++           R+LL+              FV+A+ R+LL 
Sbjct  182   TRELSSNALSMVNSFGEMITQ----NTGLTRKLLSNSD----------SFVEASNRKLLQ  227

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                +  K + VV+  G GQYK++ EAL+AVP  +    VI IKAG Y E +++ + M  +
Sbjct  228   ISAS--KPNAVVSASGGGQYKTIQEALQAVPKSSPTPFVILIKAGTYKEHIQIEKNMLNV  285

Query  2315  VFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             V +GEGPTKT ITG ++   + I T+HTAT+ + GDGF+ +++G EN+AG  K QAVALR
Sbjct  286   VLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVMKDMGIENTAGPTKEQAVALR  345

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             ++AD  + +NC+ID YQDTLY HS RQFYRDCTI+GT+DF+FG+A  VFQNCK+IVRKP 
Sbjct  346   INADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITGTIDFLFGDASAVFQNCKLIVRKPG  405

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ CM+TAQGR  +      V+Q+C+I A+ AL +ANPP KV+LGRPWKEFS+T+IM +
Sbjct  406   PNQACMITAQGRMRKDSLGGFVIQNCDIKADKALTSANPPVKVYLGRPWKEFSKTIIMQS  465

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
              ID  V P GWS W  T + + TC+YAEYQNRGPGA+ DKRV  W+GY+++IS +V   F
Sbjct  466   NIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQKDISGDVINSF  525

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             T G F+   + WL    IP+  G ++
Sbjct  526   TAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   521 bits (1343),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 268/573 (47%), Positives = 368/573 (64%), Gaps = 15/573 (3%)
 Frame = -1

Query  3227  SPEQNKKVAV-TGVASIFLVACVVAATVSVGRSG--ESADGGGEISTASKSVKEICAPTD  3057
             S ++ KK AV  GV+S  +V   +   V    SG  E A   G       +V  IC+ TD
Sbjct  15    SEKRKKKYAVIVGVSSFLVVTMFIGTAVMSSGSGGHERAIKAGNKLVVKTAVNVICSSTD  74

Query  3056  YKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDT  2883
             YKETC  SL   + + DP+ LIK AF   +++I   I+++  +L   A  D RT +AL+ 
Sbjct  75    YKETCVASLETVR-SPDPRNLIKSAFEFAIKSIQKGINQAAIDLRMRAKSDRRTREALEN  133

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C EL+ NS++DL++S +K   F    +++   DL VWLSGAIT Q+TCID FE    D  
Sbjct  134   CVELMENSVEDLRKSNEKFAGFAFTRLRDIAEDLGVWLSGAITYQQTCIDGFEGIDSDAA  193

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF--KRRLLTAETK---GeeqeeE  2538
             E M+ + KTA +L+SNGLA+ T+   LL+   IP + F    R  T E        Q  E
Sbjct  194   EIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIP-IPFLTTSRDSTDEDSIEPVGRQLTE  252

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
             FP +V   +RRLL      I+ + VVAKDGSGQY+++ EAL AVP  N+   VI+IK+GV
Sbjct  253   FPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNERRFVIYIKSGV  312

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             Y E VE+ +KM  ++F+G+GPTKT +TG+ S + + I TY T+TVA+ GD F+A+++ FE
Sbjct  313   YAENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRISTYRTSTVAVNGDWFMAKDMAFE  372

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AG   HQAVALRVSAD  +F+NC +D YQDTLY H++RQFYRDC ISGT+DF+FG+A 
Sbjct  373   NTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAK  432

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC+ +VR+PM NQ+C+VTAQGRKDRR    IV+    I+ +P        N+ +LG
Sbjct  433   AVFQNCQFVVRRPMENQQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYLPVKTKNRAYLG  492

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWKE+SRT+IM + IDDI+ PEGW  W  T  LDT +YAEYQN GPG+    RV+W G 
Sbjct  493   RPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALDTLYYAEYQNTGPGSDQAGRVRWNGI  552

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + ++S   A Q+TP  FL  +  W+ + ++P++
Sbjct  553   Q-HLSDSAATQYTPDNFLRGN-TWIPKTRVPYA  583



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   521 bits (1343),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 261/579 (45%), Positives = 373/579 (64%), Gaps = 24/579 (4%)
 Frame = -1

Query  3233  MGSPEQNK-KVAVTGVASIFLVACVVAATVSVGRSGESADGGGE--------ISTASKSV  3081
             M    +NK K  + GV+++F +A V      +      ++G  E        +++  K+V
Sbjct  1     MSERNENKGKRIIIGVSALFFMAIVGVVIFGINLIDNGSNGDKENIDNKKNHVASTVKAV  60

Query  3080  KEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPR  2904
             + +C PT+Y++ CE SL AGA +T DP+EL+K+AF +T+  I D + ++ LL + +K+PR
Sbjct  61    QSLCHPTNYEKECEESLIAGAGNTTDPRELVKIAFNITITKIGDKLKETNLLHDVEKEPR  120

Query  2903  TSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFE  2724
                ALDTCK+L+  SI +L RS   +  F++ +I++   ++KVWLSGAIT Q+TC+D F+
Sbjct  121   AKMALDTCKQLMDLSIGELSRSIDGISEFELINIEKILMNIKVWLSGAITYQDTCLDGFD  180

Query  2723  NTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqe  2544
             NTT + G+KMK  L T+  +SSN LA++T   + + +L +  +  +R L  +E+      
Sbjct  181   NTTSEAGQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLLQDSES------  234

Query  2543  eEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
                P +VD        T   + K ++ VA+DG+G +KS+ EAL+ VP KN +  VI+IK 
Sbjct  235   ---PSWVDHQGLPNANTSLFNHKLNVTVAQDGNGDFKSINEALKQVPEKNKKPFVIYIKE  291

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             G Y E VEV + M  +VF+G+G  KTRI G+++  DGI TY TATVAIQGD F+A N+GF
Sbjct  292   GTYQEYVEVTKDMTHVVFIGDGGKKTRIIGNKNFIDGINTYRTATVAIQGDYFVAINMGF  351

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN AG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA
Sbjct  352   ENFAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNA  411

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNC  +VRKPM NQ+C+VTAQGRK+++  + IV+Q   I+++P   +    NK +L
Sbjct  412   LAVFQNCTFVVRKPMKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAYL  471

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              RPWK +SRT+IM T IDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRV 
Sbjct  472   ARPWKNYSRTIIMDTNIDDLIHADGYLPWQGPEGPTGMDTCFYAEYHNTGPGSDKSKRVN  531

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             W G   N++ + A  F+P  F      W+    IP+ PG
Sbjct  532   WSGI-WNLNSKAAHSFSPSKFFHG-TNWIQVTGIPYFPG  568



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   537 bits (1384),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 380/571 (67%), Gaps = 17/571 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ +K+ +   +S+ LVA  V   V+   +G + +   ++S + +++  IC  TDY++TC
Sbjct  3     DRKRKMGIIAASSVVLVAMAVILVVAC--TGGNDEKPPDVSASQRAIMSICDTTDYQQTC  60

Query  3041  ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
               SLAG  ++ DPK LI++A + ++ +I +A+  S  + +A+K PR   AL+TC+EL + 
Sbjct  61    LDSLAG-HNSSDPKALIEVAIQSSINHIEEAVKNSTAIHDAEKTPRGRLALETCRELANR  119

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             ++DDL RSF   ++FD+  + +   +LK+WLSGAITQ ETC+D+FE+  GD G +M+ +L
Sbjct  120   AVDDLDRSFGTFDDFDITSVADVPLELKIWLSGAITQLETCLDSFEDVPGDAGNRMRQVL  179

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPG----VNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             + + E++SN L M+   +  L S+   G        RRLL+ +       E  P +VDA 
Sbjct  180   RESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAVTSRRLLSTD-------EFLPEWVDAG  232

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK-NDETVVIFIKAGVYNERVEV  2337
              R+LL   P  +  D++VAKDG+G Y ++ EAL+ +P    ++T+V++I+ GVY E+++ 
Sbjct  233   KRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPKSGKNKTIVLYIREGVYEEKLQF  292

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKH  2157
                M  +  +G+GPTKTRITG  +  DG  TY TATVA+QGD FIAR+IGFEN+AG  KH
Sbjct  293   NSSMKNLFVIGDGPTKTRITGKSNFIDGTNTYQTATVAVQGDDFIARDIGFENTAGPEKH  352

Query  2156  QAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKM  1977
             QAVALRVSAD  IF+NCH+DAYQDTLY H+YRQFYR+C ISGT+DFIFG++  VFQNC +
Sbjct  353   QAVALRVSADKAIFYNCHMDAYQDTLYAHAYRQFYRNCRISGTIDFIFGDSAAVFQNCTL  412

Query  1976  IVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSR  1797
             +VRKP+ NQ+C+VTAQGRK+ R     +LQ+C I  +  L A     K +LGRPWK++SR
Sbjct  413   LVRKPLENQQCVVTAQGRKEIRQPTGFILQNCSIRPDRDLYAIRKNIKTYLGRPWKQYSR  472

Query  1796  TLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEV  1617
             T+IM +F+DD++ P GW  W GT  LDT +Y E+ NRGP A   +R +W G K   S  +
Sbjct  473   TVIMESFLDDLICPTGWLPWNGTFALDTLFYTEFNNRGPAAPKKQRARWPGVKELPSSRI  532

Query  1616  AKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
              ++FT   FL  +  W+ R Q+P++PGF+ P
Sbjct  533   -QRFTAVEFLDGN-GWIPRTQVPYTPGFVFP  561



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   516 bits (1328),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 255/534 (48%), Positives = 351/534 (66%), Gaps = 15/534 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSEL  2931
              ++++ K+VK +CAPTDYK+ CE +L   A +  DP+ELIK+AF VT+  I + + K++L
Sbjct  27    HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  86

Query  2930  LKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQ  2751
             + E + DP T +ALDTCK+L++ SI +  RS  K   FD+ ++      LKVWLSGAIT 
Sbjct  87    MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKFAKFDLNNLDNILTSLKVWLSGAITY  146

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRL  2577
             QETC+DAFENTT D G+KM+ LL+TA  +SSNGL++I   ++ L  + +  PG   +RRL
Sbjct  147   QETCLDAFENTTTDAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG---RRRL  203

Query  2576  LTAETKGeeqeeEF--PGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
             L           +F  P +VD     R+LL          +VVAKDGSG + ++ EAL+ 
Sbjct  204   LNNVDDLPVLGHDFDLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKY  263

Query  2408  VPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTAT  2229
             VP KN    VI++K GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+
Sbjct  264   VPKKNLRPFVIYVKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTAS  323

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
              AI GD F+   +GFENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYR
Sbjct  324   AAILGDFFVGIGMGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYR  383

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             DC ISGT+DF+FG+A  V QNC  +VRKP+ NQ+C+VTAQGRK+R   + +V+    I++
Sbjct  384   DCIISGTIDFVFGDAVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVS  443

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAE  1698
             +P        NK +L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+YAE
Sbjct  444   DPTYYPVRFDNKAYLARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGFSGMDTCFYAE  503

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + NRGPG+   KRVKW+G K  +  +    F P  F   D+ W+   +IP+  G
Sbjct  504   FNNRGPGSDKTKRVKWEGVK-TLDSDGITNFLPSMFFHGDD-WIRVTRIPYYSG  555



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   516 bits (1329),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 250/529 (47%), Positives = 356/529 (67%), Gaps = 10/529 (2%)
 Frame = -1

Query  3110  GEISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G+ +T+ K++K +C PTDYK+ CE++L+  + +T DP EL+ +AF  +++ +TDA  KSE
Sbjct  43    GQPNTSIKAIKAVCEPTDYKDACEKTLSSMSHNTSDPMELVNVAFNASMKYVTDAFDKSE  102

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             LLK+  KDP +++AL TC ELL  + DDLK+S +++ +      ++   DLKVWLS AIT
Sbjct  103   LLKDVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQTNRYEQAVEDLKVWLSAAIT  162

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
              Q+TC+D FE       E M   +K + +++SN LAMI  F  L+ S  I   +  R+LL
Sbjct  163   YQDTCVDGFEGINTSAAEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISS-HAGRKLL  221

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             +       +  EFP ++ AA  R L   PA IK ++ VA+DG+G +K++ EAL+ VP +N
Sbjct  222   SG-----TRANEFPWWMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQN  276

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQ  2217
             ++T VI++KAGVY E V V + M  +  +G+GPTKT+ITG      G I T+ TATVA+ 
Sbjct  277   NDTFVIYVKAGVYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVA  336

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+ F    +GFEN+AG   HQAVALRV+AD ++F+NC +D YQDTLY HS RQFYRDCTI
Sbjct  337   GEWFTGMGLGFENTAGPQNHQAVALRVNADRSVFYNCRMDGYQDTLYAHSGRQFYRDCTI  396

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFG++  + QNC +IVRKPM NQ+ +VTA GR DR+G  A+V+Q+C I ++PA 
Sbjct  397   TGTIDFIFGDSATMLQNCMIIVRKPMDNQQNIVTAHGRIDRQGNGALVIQNCTITSDPAY  456

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
               +      +LGRPWK +SRTLI+ + +DD+V P+GW  W G + LDTC+YAE  NRGPG
Sbjct  457   YPSRKKLPTYLGRPWKPYSRTLILQSQLDDLVHPDGWMPWNGNIGLDTCFYAELDNRGPG  516

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+  KRV W G K+ +S + A++FT   +L   + W+ R  +PF PG L
Sbjct  517   ANLTKRVTWPGIKK-LSYDEAQRFTVEHYLFG-QTWIPRTGVPFIPGLL  563



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   518 bits (1333),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 254/511 (50%), Positives = 334/511 (65%), Gaps = 27/511 (5%)
 Frame = -1

Query  3017  DTDDPKELIKLAFRVTVENITDAISKSEL---------------LKEADKDPRTSDALDT  2883
             +T DP EL+K AF  T++ IT    KS+                L++  KDPRT  ALD 
Sbjct  4     NTSDPLELVKTAFNATMKQITGVAKKSQXSPPNLIKQKLTLLKRLRKXQKDPRTKMALDQ  63

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +I +L +SF+++  F+   + E    L+VWLS  I+ +ETC+D F+ T GD G
Sbjct  64    CKELMDYAIGELSKSFEELGRFEFHKVDEALVKLRVWLSATISHEETCLDGFQGTQGDAG  123

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             E +K  LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+ E         FP ++
Sbjct  124   ETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLSQE---------FPSWM  173

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
             D  TRRLL +  + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IK G+Y E V
Sbjct  174   DGRTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYV  233

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             +V R M  +VF+G+GP KT I+G ++ KDGI TY TATVAI GD FIA+N+GFEN+AGA 
Sbjct  234   QVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYRTATVAIVGDHFIAKNMGFENTAGAI  293

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC
Sbjct  294   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  353

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ C +TA GRKD R +   VLQ C I  EP        +K +LGRPWKE+
Sbjct  354   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEY  413

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M TFI D + PEGW  W G   LDT +Y+E +N GPGA   KRV W G K+ +S 
Sbjct  414   SRTIFMNTFIPDFIPPEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIKK-LSE  472

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P+ PG  
Sbjct  473   EEILKFTPAEYIQGDA-WIPGKGVPYIPGLF  502



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   513 bits (1322),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 252/546 (46%), Positives = 355/546 (65%), Gaps = 23/546 (4%)
 Frame = -1

Query  3152  TVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRV  2973
             T++   S  S++G   ++T++KSV+ +C PT YK+TCE++L+ AK+  DPK+ IK+AF  
Sbjct  25    TLTKHDSDTSSNG---VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEA  81

Query  2972  TVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEY  2793
             TV +I +A+  +E +K+A  DP T DAL  C+EL   +++DL+ S  K+ENFD + IK+ 
Sbjct  82    TVADIKNALKNTEPIKKAASDPYTKDALLACEELFDLAVEDLRGSVAKIENFDFSKIKDI  141

Query  2792  TNDLKVWLSGAITQQETCIDAFENTT-GDTGEKMKHLLKTANELSSNGLAMITHFTELLQ  2616
              +DLK WLS  +  +ETC+D F  +    T  +M  L+ T  ELS N L+M+  F E++ 
Sbjct  142   VDDLKSWLSAVVAYEETCLDGFTKSEYSATRNQMVKLMNTTRELSINALSMVNSFGEMIT  201

Query  2615  SLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQY  2436
                       R+LL+              FV+A+ R+L+    ++ K + VV+  G GQY
Sbjct  202   QT----TGLTRKLLSDSD----------SFVEASNRKLVQI--SASKPNAVVSASGGGQY  245

Query  2435  KSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK-  2259
             K++ EA+ AVP  N    VI IKAG Y E +E+ +    +VF+GEGPTKT ITG R  K 
Sbjct  246   KTIQEAVNAVPKNNPTPFVILIKAGTYKEHIEIDKNKPNVVFIGEGPTKTIITGDRGVKH  305

Query  2258  DGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTL  2079
             DG  T+HT  + + G+GF+ ++IG EN+AG AK QAVALR++AD  + HNC ID YQDTL
Sbjct  306   DGYATWHTCALGVAGEGFVIKDIGIENTAGPAKEQAVALRINADKAVVHNCKIDGYQDTL  365

Query  2078  YTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAA  1899
             Y HS+RQFYRDCTI+GTVDFIFG+A  VFQNCK+IVRKP   Q CM+TAQGR        
Sbjct  366   YAHSFRQFYRDCTITGTVDFIFGDASAVFQNCKLIVRKPGNAQACMITAQGRTVPTSFGG  425

Query  1898  IVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-  1722
              V+Q+C+I A+PA  +  PP K +LGRPWKE+S+T+IM + ID  + P GW+ W  T + 
Sbjct  426   FVIQNCDIKADPAFTSTTPPIKAYLGRPWKEYSKTIIMQSNIDAFIDPTGWAPWNSTDFG  485

Query  1721  LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             L TC+YAEYQNRGPGA+  KRV  W+GY++ IS +   ++T G F+   + WL +  IP+
Sbjct  486   LHTCFYAEYQNRGPGAALGKRVSTWRGYQKGISGDAINKYTAGKFINTQQPWLPKFDIPY  545

Query  1544  SPGFLQ  1527
               G ++
Sbjct  546   DAGMMK  551



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   512 bits (1319),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 264/573 (46%), Positives = 370/573 (65%), Gaps = 17/573 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE-ISTASKSVKEICAPTDYKET  3045
             E+ KK+AV  V+SI LVA VVAA V +    E  + GG+ I+ + ++ + IC   +YKET
Sbjct  10    EKKKKIAVLSVSSILLVAMVVAAAVGIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKET  69

Query  3044  CERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             C +SLA A  T D KELI  AF  T E I + I  S L  E   D  T  A D CKE+L 
Sbjct  70    CHKSLAKASGTSDLKELIITAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVLG  129

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              ++DD++RS   +E FD+  + +Y  DLKVW++G +  Q+TC+D FENT+ + G+ M  +
Sbjct  130   YAVDDIRRSVHTLEKFDLNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTSSEAGKTMAKV  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPG--VNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
             L  + ELS+N L ++   + L + L +    VN  R+LL+ ET      + FP +V    
Sbjct  190   LNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEET---ALVDGFPTWVSEGQ  246

Query  2510  RRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
             RRLL   DP   K D+VVA+DGSGQ K++ EAL+ VP KN +  VI+IKAG+YNE + + 
Sbjct  247   RRLLQAVDP---KPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIYNEYIIMN  303

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + +  +  +G+GPTKTRITGS++  DG+ TY+TAT  +    F+A+NIGFEN+AGA KHQ
Sbjct  304   KHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENTAGAEKHQ  363

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV+AD  +F+NC++D +QDTLYT S RQFYRDCT++GT+DF+FG+A  VFQNCK I
Sbjct  364   AVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFI  423

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR P+ NQ+C+VTA GR      +A+V QSC    EP + A   P   +LGRPW+ +++ 
Sbjct  424   VRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALT-PKIAYLGRPWRLYAKV  482

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + IDDI VPEG+  W G+ + DT  Y E+ NRGPGA+T  R+ W G+K  ++P  A
Sbjct  483   VIMDSQIDDIFVPEGYMAWMGSAFKDTSTYYEFNNRGPGANTIGRITWPGFKV-LNPIEA  541

Query  1613  KQFTPGPFLM-----ADEQWLGRAQIPFSPGFL  1530
              ++ PG F         + W+  + +P+S G L
Sbjct  542   VEYYPGKFFQIANSTERDSWILGSGVPYSLGPL  574



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   510 bits (1313),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 251/531 (47%), Positives = 344/531 (65%), Gaps = 16/531 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELL  2928
             I   SK+V+ +CAPTD+KETC  S   A  ++ +P +LIKL+F +T++ I D + KS + 
Sbjct  48    IKMTSKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSVE  107

Query  2927  KEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQ  2748
              +A  D  T  +L+ C+ L++++IDDL + F     F +  I+++  DL+VWLSG+I+ Q
Sbjct  108   LKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISYQ  167

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKR  2583
             +TC+DAFE       + MK + K + EL+SN LAMIT  + +     I        N  R
Sbjct  168   QTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNAR  227

Query  2582  RLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
             +LL AE       + FP +V   TRRL+      +K ++VVAKDGSGQYKS+ EAL+AVP
Sbjct  228   KLLNAE-------DGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVP  280

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATV  2226
               N    VI+IK GVY E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T+++
Sbjct  281   INNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSL  340

Query  2225  AIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRD  2046
              ++GD F+A+N+G EN+AG    QAVALRVSAD  +  NC ID YQDTLY HS+RQFYRD
Sbjct  341   TVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRD  400

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
              TISGTVDFIFG++  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ E
Sbjct  401   STISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGE  460

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
             PA       NK +LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N 
Sbjct  461   PAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENS  520

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GPG++  +RVKW G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  521   GPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   509 bits (1310),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 250/531 (47%), Positives = 344/531 (65%), Gaps = 16/531 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKSELL  2928
             I   +K+V+ +CAPTD+KETC  S   A  ++ +P +LIKL+F +T++ I D + KS + 
Sbjct  48    IKMTNKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSVE  107

Query  2927  KEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQ  2748
              +A  D  T  +L+ C+ L++++IDDL + F     F +  I+++  DL+VWLSG+I+ Q
Sbjct  108   LKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISYQ  167

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKR  2583
             +TC+DAFE       + MK + K + EL+SN LAMIT  + +     I        N  R
Sbjct  168   QTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNAR  227

Query  2582  RLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
             +LL AE       + FP +V   TRRL+      +K ++VVAKDGSGQYKS+ EAL+AVP
Sbjct  228   KLLNAE-------DGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVP  280

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATV  2226
               N    VI+IK GVY E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T+++
Sbjct  281   INNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSL  340

Query  2225  AIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRD  2046
              ++GD F+A+N+G EN+AG    QAVALRVSAD  +  NC ID YQDTLY HS+RQFYRD
Sbjct  341   TVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYRD  400

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
              TISGTVDFIFG++  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ E
Sbjct  401   STISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIGE  460

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
             PA       NK +LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N 
Sbjct  461   PAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYENS  520

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GPG++  +RVKW G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  521   GPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   508 bits (1309),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 250/535 (47%), Positives = 360/535 (67%), Gaps = 14/535 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLK  2925
             I+ + K++ ++C  T Y++TC  SL+ A  + D K+LI+ +FR  +E + + I +S  L+
Sbjct  38    INPSQKAIVDLCQNTYYQQTCINSLSKATISSDTKDLIRTSFRTAMEELGNVIKQSATLQ  97

Query  2924  EADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQE  2745
             EA K+P T++A  TC++LL++SI DL+++ ++ E+ D++++    +D+K WL+GA+T QE
Sbjct  98    EASKNPETAEAYRTCQKLLNDSILDLQKTLERTESVDISNLNLLIDDIKTWLTGALTYQE  157

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-FKRRLLTA  2568
             TC+D FE+  GD  EKM   +K   EL+ NGLA+   F++LL    +P  +   RRLL  
Sbjct  158   TCLDCFEDAEGDAAEKMMEFMKLGKELTINGLALANGFSDLL----LPNDHGAGRRLLAD  213

Query  2567  ETK-GeeqeeEFPG--FVDAATR--RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
               K G   + ++ G  +++ ATR  RLL   P  IK  + VAKDGSG + ++ EAL++VP
Sbjct  214   SNKMGLINKADYIGEHWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVP  273

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
                ++T +I+IKAGVY E + V   M  ++F+G+GP  T+ITG++S   G  T+ TATV 
Sbjct  274   LSCNDTYIIYIKAGVYQENIIVGTSMWSVMFIGDGPNATKITGNKSKVGGTETFWTATVG  333

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             + GD FIA++IGFENSAGA+ HQAVALR S D +IF NC ID YQDT++ H++RQF+RDC
Sbjct  334   VDGDNFIAKDIGFENSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFAHNHRQFFRDC  393

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQE-CMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             TISGT+DFIFGNA  VFQNC ++VRKP+ NQ+ C+VTA+GR      +AIVLQ+C IL  
Sbjct  394   TISGTIDFIFGNARAVFQNCTLLVRKPLENQKACLVTAEGRTTINETSAIVLQNCRILPA  453

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT-MYLDTCWYAEYQN  1689
             P     +P  K +LGRPWK +SRT+IM + +D +V PEGW+ W  T  +LDTCWYAE  N
Sbjct  454   PEYPVNDPTYKTYLGRPWKPYSRTVIMDSHLDSLVDPEGWAPWNVTSAHLDTCWYAELNN  513

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             +GPGA   +RV W G K+ I+   A  FTPG F++ D  W+    IP+  G + P
Sbjct  514   KGPGADLSRRVAWPGIKK-ITVNEADDFTPGQFMVGD-SWIAGKGIPYDSGLILP  566



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   506 bits (1304),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 365/567 (64%), Gaps = 25/567 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KKV + G+AS+ +VACVVAA +++ +  +S     E++T++KSV+ +C PT YK+TCE++
Sbjct  3     KKVVIGGIASVLVVACVVAACLTLTKH-DSDTSSNEVATSTKSVESMCQPTPYKQTCEKT  61

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+  DPK+ IK+AF  TV +I +AI   E +K+A  DP T DAL  C+EL   +++
Sbjct  62    LSAAKNVSDPKDYIKVAFEATVTDIKNAIMNIEPIKKAASDPYTKDALHACEELFDLAVE  121

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT-GDTGEKMKHLLKT  2676
             DL+ S  K+ENFD + IK+  +DLK WLS  +  +ETC+D F  +    T ++M  L+ T
Sbjct  122   DLRGSVAKIENFDFSKIKDVVDDLKTWLSAVVAYEETCLDGFTKSEYSATRDEMVKLMNT  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               ELS N L+M+  F E++           R+LL+              FV+A+ R+LL 
Sbjct  182   TRELSINALSMVNSFGEMITQT----TGLTRKLLSNSDS----------FVEASNRKLLQ  227

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                A  K + VV+  G GQYK++ EA+ AVP  N    +I IKAG Y E +E+ +    +
Sbjct  228   ISAA--KPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFIILIKAGTYKEHIEIEKSKPNV  285

Query  2315  VFVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
             VF+GEG TKT ITG R  K+G G  T+HT  + + G+GF+ R+IG EN+AG  K QAVAL
Sbjct  286   VFIGEGATKTIITGDRGVKNGGGYATWHTCALGVAGEGFVIRDIGLENTAGPEKEQAVAL  345

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             R++AD  I +NC ID +QDTLY HS+RQFYRDC I+GT+DF+FG+A  VFQNC++IVRKP
Sbjct  346   RINADKAIVYNCKIDGFQDTLYAHSFRQFYRDCIITGTIDFMFGDASAVFQNCQIIVRKP  405

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
                Q CMVTAQGR         V+Q+C+I  EP   +     K +LGRPWKEFS+T+IM 
Sbjct  406   GNTQACMVTAQGRTVPTSVGGFVIQNCDIKPEPGFPST---TKAYLGRPWKEFSKTIIMQ  462

Query  1781  TFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQ  1608
             + ID  + P GW+ W  T + + TC+YAEYQNRGPGA+ DKRV  W+GY+R IS +   Q
Sbjct  463   SNIDAFIDPSGWAPWNTTDFGIHTCFYAEYQNRGPGAALDKRVSTWRGYQRGISGDAINQ  522

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             FT G F+  +  WL +  IP+  G ++
Sbjct  523   FTAGKFINTESPWLPKGDIPYDAGMMK  549



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   506 bits (1303),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 264/575 (46%), Positives = 369/575 (64%), Gaps = 20/575 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSV---GRSGESADGGGEISTASKS-VKEICAPTDY  3054
             EQ ++ AV G++SI LVA V A  V++   G  GE  D    + TA ++ V+ IC  T+Y
Sbjct  8     EQKRRFAVLGISSILLVAMVAAVAVTINRGGNKGEEGDDESRVQTAQRNNVEMICNSTEY  67

Query  3053  KETCERSL--AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             KETC++SL  A + +  D KELIK AF  +   + + I  S L KE  KD  T  A+D C
Sbjct  68    KETCKKSLEKASSDENADTKELIKAAFNASAVELLNHIKNSTLYKELAKDNMTRQAMDIC  127

Query  2879  KELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             KE+   +ID +++S + ++ F+   + EY  DLKVWL+G+++ Q+TC+D FENT    GE
Sbjct  128   KEVFDYAIDGVQKSIETLDKFEFIKLSEYVYDLKVWLTGSLSHQQTCLDGFENTNTKAGE  187

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-VNFKRRLLTAETKGeeqeeEFPGFV  2523
             KM   +  + ELSSN L MI   + L++ L I   V   RRLL+  +K E   + +P +V
Sbjct  188   KMAKAMNASLELSSNALDMINFISGLIKDLNISSLVGNNRRLLS--SKEEALVDGYPSWV  245

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL    +SIK +  VAKDGSGQ+ ++ +AL+ VP KN +  VI++KAGVY E V
Sbjct  246   SEGQRRLLGL--SSIKPNATVAKDGSGQFATLTDALKTVPPKNAQAFVIYVKAGVYKENV  303

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              V   M  +  +G+GP KTR +GS + KDG+ T+++AT A+    F+A+++GFEN+AGA 
Sbjct  304   NVGMDMTHVTVIGDGPKKTRFSGSLNYKDGVQTFNSATFAVNAANFMAKDVGFENTAGAE  363

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV+AD  +F+NC +DA+QDTLY  S RQFYRDCTI+GT+DFIFG+A  VFQNC
Sbjct  364   KHQAVALRVTADQAVFYNCQMDAFQDTLYVQSQRQFYRDCTITGTIDFIFGDAFGVFQNC  423

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV-FLGRPWKE  1806
             K+IVR P+ NQ+CMVTA GR     A+ +V QSC    EP  + A    K+ +LGRPW+ 
Sbjct  424   KLIVRPPLPNQQCMVTAGGRNKVDSASGLVFQSCHFSGEP--QVAQLTRKIAYLGRPWRP  481

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +S+ +IM + ID+I +PEG+  W G+ + +TC Y EY N+GPGA T +RVKW G K   S
Sbjct  482   YSKVVIMDSQIDNIFLPEGYMAWMGSQFKETCIYYEYNNKGPGADTSQRVKWPGVKTITS  541

Query  1625  PEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              E  K + PG F         + W+  A++P+S G
Sbjct  542   VEATKYY-PGRFFELVNSTERDSWIVDARVPYSLG  575



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   505 bits (1300),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 253/554 (46%), Positives = 356/554 (64%), Gaps = 17/554 (3%)
 Frame = -1

Query  3164  VVAATVSVGRSGESADGGGE-ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIK  2988
             VVAA V +    E  + GG+ I+ + ++ + IC   +YKETC +SLA A  T D KELI 
Sbjct  2     VVAAAVRIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELII  61

Query  2987  LAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMA  2808
              AF  T E I + I  S L  E   D  T  A D CKE+L  ++DD++RS   +E FD+ 
Sbjct  62    TAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVLGYAVDDIRRSVHTLEKFDLN  121

Query  2807  HIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFT  2628
              + +Y  DLKVW++G +  Q+TC+D FENT+ + G+ M  +L  + ELS+N L ++   +
Sbjct  122   KLNDYAYDLKVWIAGTLAHQQTCLDGFENTSSEAGKTMAKVLNASLELSNNALDIVNGVS  181

Query  2627  ELLQSLEIPG--VNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL-TTDPASIKHDIVVA  2457
              L + L +    VN  R+LL+ ET      + FP +V    RRLL   DP   K D+VVA
Sbjct  182   SLFKGLNLSSFSVNSNRKLLSEET---ALVDGFPTWVSEGQRRLLQAVDP---KPDVVVA  235

Query  2456  KDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRIT  2277
             +DGSGQ K++ EAL+ VP KN +  VI+IKAG+YNE + + + +  +  +G+GPTKTRIT
Sbjct  236   QDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIYNEYIIMNKHLTYVTMIGDGPTKTRIT  295

Query  2276  GSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHID  2097
             GS++  DG+ TY+TAT  +    F+A+NIGFEN+AGA KHQAVALRV+AD  +F+NC++D
Sbjct  296   GSKNYVDGVQTYNTATFGVNAANFMAKNIGFENTAGAEKHQAVALRVTADKAVFYNCNMD  355

Query  2096  AYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKD  1917
              +QDTLYT S RQFYRDCT++GT+DF+FG+A  VFQNCK IVR P+ NQ+C+VTA GR  
Sbjct  356   GFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFIVRMPLENQQCLVTAGGRSK  415

Query  1916  RRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW  1737
                 +A+V QSC    EP + A   P   +LGRPW+ +++ +IM + IDDI VPEG+  W
Sbjct  416   IDSPSALVFQSCVFTGEPNVLALT-PKIAYLGRPWRLYAKVVIMDSQIDDIFVPEGYMAW  474

Query  1736  QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLM-----ADEQ  1572
              G+ + DT  Y E+ NRGPGA+T  R+ W G+K  ++P  A ++ PG F         + 
Sbjct  475   MGSAFKDTSTYYEFNNRGPGANTIGRITWPGFKV-LNPIEAVEYYPGKFFQIANSTERDS  533

Query  1571  WLGRAQIPFSPGFL  1530
             W+  + +P+S G L
Sbjct  534   WILGSGVPYSLGPL  547



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   504 bits (1298),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 260/540 (48%), Positives = 344/540 (64%), Gaps = 15/540 (3%)
 Frame = -1

Query  3110  GEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             GE+ST+ KS+K  C P DYKETCER+L A A +   P +L K+ F+VT + I  A  +S 
Sbjct  35    GEMSTSVKSIKSFCQPVDYKETCERALEATAGNATSPTDLAKVIFKVTSDRIEKAARESA  94

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             +L +   DPRTS AL  CKELL  +IDDLK +F ++  F+M + K   +DLK WLS A+T
Sbjct  95    VLNDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMTNFKAAVDDLKTWLSSALT  154

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
              QETC+D FENTT D   KM+  L T+ EL+ N LA++  F+E L SL +P  +F RRLL
Sbjct  155   YQETCLDGFENTTTDAAAKMRRALNTSQELTENILALVDEFSETLASLGLP--SFHRRLL  212

Query  2573  TAETKGeeqeeEFPGFV-DAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVP  2403
                          P ++ D A RR+L   P S   K D+ VA DGSG +K++  AL  VP
Sbjct  213   AGNGGA-------PSWMTDDAKRRVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVP  265

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
              K+    V+++KAG Y E V VPR +  +V VG+G TKT +TGS+S    I T  TAT+ 
Sbjct  266   TKSATAYVMYVKAGTYKEYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNITTKDTATME  325

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             + G+GF  R +G EN+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+ RQ+YRDC
Sbjct  326   VIGNGFQMRGVGVENTAGARNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDC  385

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
              ++GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C +   P
Sbjct  386   VVTGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTVEPHP  445

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
               +++    K +LGRPWKE SRTL + + I   V P+GW  W G   L TC+YAE +N G
Sbjct  446   EFESSAGRLKTYLGRPWKEHSRTLYIQSEIGGFVDPQGWLPWLGDFGLSTCYYAEVENHG  505

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
             PGA T KR KWKG K NI+ + A+Q       +  + WL +  +PF PG L P N+  ++
Sbjct  506   PGADTSKRAKWKGVK-NITYQQAQQKYTVERFIQGQTWLPKLGVPFIPGLL-PQNQTGRI  563



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   501 bits (1290),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 256/569 (45%), Positives = 371/569 (65%), Gaps = 21/569 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             E+ KK  + G  S  LV  VV+  V   +     D   EI   +K+V+ +CAPTDYKETC
Sbjct  6     EKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKGDEN-EIRKTTKAVQAVCAPTDYKETC  64

Query  3041  -ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
              +R +    ++ +P +LIKL+F VT+++I +++ K+  ++   A K+P    A   C+ +
Sbjct  65    FDRMMNAEPESTEPLDLIKLSFNVTIQSIHESLQKASEDVKARASKNPAAKGAFQLCEHV  124

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             + ++IDDL++SF +   F +A I+ Y  DL+VWLSG+I  Q+TCID+FE    +  ++M 
Sbjct  125   MLDAIDDLRKSFDR--GFSLARIEGYVEDLRVWLSGSIAFQQTCIDSFEEIKSNLLQEMI  182

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqeeEFPGF  2526
             ++ KT+ EL+SN LAM+T  + LL +  I G+     ++ R+LL+ E       +  P +
Sbjct  183   NIFKTSRELTSNSLAMVTGMSTLLPNSNITGLTGVLASYARKLLSTE-------DGIPTW  235

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             V    RRL+      +K + VVA+DGSGQ+K++ +AL AVP  +    +I IK G+Y E+
Sbjct  236   VGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNAVPKGDTLPFIIHIKEGIYKEK  295

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAG  2169
             V V +KM  + F+G+GPTKT ITGS + + G + T+ TAT+ IQG+ F A++IG EN++G
Sbjct  296   VIVTKKMPHVTFIGDGPTKTVITGSLNFRIGKVKTFLTATITIQGNHFTAKSIGIENTSG  355

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
                 QAVALRVSAD  +F+NC ID YQ+TLY HS+RQFYRDCT+SGTVDFIFG+A  + Q
Sbjct  356   PKGGQAVALRVSADYAVFYNCQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQ  415

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP  +Q CMVTAQGR D R    IVL +C I+ +PA       NK +LGRPW+
Sbjct  416   NCKIVVRKPKRSQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYLGRPWR  475

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             +FSRT+IM T IDD++ P GW +WQG   L T +YAE+ N GPG++  +RVKW G K+ +
Sbjct  476   QFSRTIIMKTTIDDVIDPAGWLLWQGESALKTLFYAEHLNIGPGSNQAQRVKWPGLKK-L  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             SPE A  FT   FL+ D  W+ +  +P++
Sbjct  535   SPEEALMFTGNRFLLGD-TWIPQTHVPYT  562



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   501 bits (1289),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 255/541 (47%), Positives = 341/541 (63%), Gaps = 15/541 (3%)
 Frame = -1

Query  3110  GEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             GE+ST+ KS+K  C P DY+ETCE++L A A +   P +L K  F+VT + I  A+ +S 
Sbjct  37    GEMSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESA  96

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             +L E   DPRT  ALD C+ELL  +IDDLK +F ++  F+M + K   +DL+ WLS A+T
Sbjct  97    VLNELKNDPRTKGALDNCRELLDYAIDDLKTTFDRLGGFEMTNFKSAVDDLRTWLSSALT  156

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
              QETC+D FENTT     KM+  L ++ EL+ N LA++  F+E L +L IP  +F RRLL
Sbjct  157   YQETCLDGFENTTTAAAGKMRRALNSSQELTENILALVDEFSETLANLGIP--SFHRRLL  214

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPF  2400
                  G       P ++  A RRL    P     K D+ VAKDGSG ++++  AL  VP 
Sbjct  215   ADHAGG------VPSWMPDAKRRLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPV  268

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             K+  T V+++KAG Y E V VPR +  +V VG+G TKT ITG +S    I T  TAT+  
Sbjct  269   KSAATYVMYVKAGTYREYVSVPRNVTNLVMVGDGATKTVITGDKSFMMNITTKDTATMEA  328

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              G+GF+ R IG EN+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+ RQ+YR+C 
Sbjct  329   LGNGFLMRGIGVENTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRECV  388

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             I+GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C I   P 
Sbjct  389   ITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTIEPHPE  448

Query  1859  LK--AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
              +  A +   + FLGRPWKE SRTL + + I   + P+GW  W G   L TC+YAE +NR
Sbjct  449   FEKSAGDGKLRTFLGRPWKEHSRTLYIQSEIGGFIDPKGWLPWLGDFGLSTCYYAEVENR  508

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAK  1506
             G GA T KRVKW+G K        +++T   F+   + WL +  +PF PG L P N+  +
Sbjct  509   GAGADTSKRVKWRGVKNITYQHALQKYTVESFIQG-QHWLPQLGVPFIPGLL-PQNQSGR  566

Query  1505  L  1503
             +
Sbjct  567   I  567



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   501 bits (1291),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 260/576 (45%), Positives = 357/576 (62%), Gaps = 23/576 (4%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGE--SADG-GGEISTASKSVKEICAPT  3060
             G  +Q K+  + GV+S+ LVA V A  V +   G+  S  G  G+IS+  ++V+ IC  T
Sbjct  11    GGGDQRKRFTLLGVSSVLLVAMVGAVAVGLTSKGDTNSEQGQNGQISSTQRNVEIICEST  70

Query  3059  DYKETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
              Y+ETC +SL  A  +T D KELIK AF  T E +   I  + L  E  KD  T  A++ 
Sbjct  71    QYQETCHKSLDKASNETSDMKELIKAAFNATAEELIKQIHNTTLYDELAKDNMTKQAMNI  130

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C E+L  ++D + RS   ++ +D   + EY  DLKVWL+G ++ Q+TC+D FENTT   G
Sbjct  131   CNEVLDYAVDGIHRSIDTMDKYDFNKLSEYAYDLKVWLTGTLSHQQTCLDGFENTTTKAG  190

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSL--EIPGVNFKRRLLTAETKGeeqeeEFPG  2529
             E M   L T+ ELSSN L +I   + LL+        VN  R+LL+ +         FP 
Sbjct  191   EIMAKALNTSLELSSNSLDIINAVSSLLKDAGENNVNVNLNRKLLSND--------GFPS  242

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +V    R +L     + K + VVA+DGSGQ+K++ EAL  VP  N E  VI++KAG+YNE
Sbjct  243   WVSEGQRHILM--EGNFKPNAVVAQDGSGQFKTLSEALLTVPSYNAEPFVIYVKAGIYNE  300

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              V V ++M  +  +G+GPTKTR T S +  DG+ TY+TAT  + G  F+A+++GFEN+AG
Sbjct  301   NVNVLKEMTHVTIIGDGPTKTRFTASLNYVDGVQTYNTATFGVNGANFMAKDVGFENTAG  360

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRV+AD  +F+NC +D +QDTLYT S RQFYRDC++SGT+DFIFG+A  VFQ
Sbjct  361   AEKHQAVALRVTADQAVFYNCQMDGFQDTLYTQSQRQFYRDCSVSGTIDFIFGDAFGVFQ  420

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK+IVRKP  +Q+C+VTA GR     A+ ++ Q+C    E  L A   P   +LGRPWK
Sbjct  421   NCKLIVRKPSEDQQCLVTAGGRIKADSASGLIFQNCHFTGEAEL-AVMRPKISYLGRPWK  479

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
              +S+ +IM + IDDI VPEG+  W G+ + +TC Y EY N+GPGA T  RVKW G K  I
Sbjct  480   PYSKVVIMDSQIDDIFVPEGYMPWAGSAFEETCIYYEYNNKGPGADTSSRVKWVGVK-TI  538

Query  1628  SPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             S + A  + PG F         + W+  + IP+S G
Sbjct  539   SSDEAVDYYPGRFFEIVNSTQRDSWIVDSGIPYSLG  574



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   500 bits (1287),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 259/578 (45%), Positives = 363/578 (63%), Gaps = 22/578 (4%)
 Frame = -1

Query  3239  IKMGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGE-SADGGGEISTASKSVKEICAP  3063
             I+  S    KK A+ GV+SI L+A V A  V V  +G+  ++G  +I+ + K+VK +C  
Sbjct  6     IETQSHASKKKFAILGVSSILLIAMVAAVAVGVNDAGQVESEGDNQITKSQKNVKVLCGT  65

Query  3062  TDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             T+YK+TCE+SLA   +  D KELIK AF  T E +   I  S L KE   +  T  A+D 
Sbjct  66    TEYKQTCEKSLAKTGN-KDMKELIKQAFNATAEELVKQIHNSTLYKELATNDMTKQAMDI  124

Query  2882  CKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKE+L  ++DD+ +S   ++ FD+  I E   DLKVWLSG +  Q+TC+D FENTT   G
Sbjct  125   CKEVLGYAVDDVHQSIHSLDKFDLNKIDEIAYDLKVWLSGTLANQQTCLDGFENTTTHAG  184

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGeeqeeEF  2535
             + M  +L  + ELS+N L +I   +  ++ L +      +N  R+LL+ +          
Sbjct  185   QTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASALNNNRKLLSED--------GL  236

Query  2534  PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
             P +V  + R+LL   P ++K ++VVA+DGSGQ+K++ EAL  VP KN    VI +KAG+Y
Sbjct  237   PSWVSQSQRKLLAA-PQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAGIY  295

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
              E V +    + +  +G+GP KT  TGS+S  DG+ TY+TAT ++    F A N+GFENS
Sbjct  296   KEYVALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQTYNTATFSVNSAHFTAFNVGFENS  355

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGAAKHQAVALRV+AD  +F+NC ++ YQDTLYT S RQFYRDCTI+GT+DF+FG+A  V
Sbjct  356   AGAAKHQAVALRVTADKALFYNCEMNGYQDTLYTQSKRQFYRDCTITGTIDFVFGDAVGV  415

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCK+IVRKPMA Q+CMVTA GR      +A+V Q+C    EP +     P   +LGRP
Sbjct  416   FQNCKLIVRKPMATQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYLGRP  474

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             W+ FS+ +I+ + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW G K 
Sbjct  475   WRNFSKVVIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-  533

Query  1634  NISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              IS   A ++ PG F       A + W+  + IP++ G
Sbjct  534   TISAGEAAKYYPGKFYEIANATARDDWITESGIPYAMG  571



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   499 bits (1284),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 253/541 (47%), Positives = 344/541 (64%), Gaps = 16/541 (3%)
 Frame = -1

Query  3137  RSGESAD-GGGEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVE  2964
             +SG   D G GE+ST+ KS+K  C P DY+ETCE +L A A +  +P +L K  F+ T E
Sbjct  27    KSGSGNDKGDGELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSE  86

Query  2963  NITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTND  2784
              I  A+ +S +L +   D RTS AL  CKELL  +IDDLK +F K+  F+M++ K   +D
Sbjct  87    KIEQAVRESTVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDD  146

Query  2783  LKVWLSGAITQQETCIDAFEN-TTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLE  2607
             LK WLS A+T QETC+D FEN T+ D  EKMK+ LK++ EL+ N LA++  F + L +L+
Sbjct  147   LKTWLSSALTYQETCLDGFENATSTDASEKMKNALKSSQELTENILALVDQFGDTLANLD  206

Query  2606  IPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYK  2433
             +P  +F RRLL  +          PG++  A RRLL   P +   K D+ VA DGSG +K
Sbjct  207   LP--SFSRRLLGDD--------GLPGWISDAKRRLLQASPGAPEFKPDVTVAADGSGDFK  256

Query  2432  SVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG  2253
             ++ EAL  VP K   T V+++KAG Y E V V R +  +V +G+G TKT ITG++S    
Sbjct  257   TINEALAKVPIKATATYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLN  316

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             I T  TAT+   G+GF  R IG EN+AGA  HQAVALRV +D ++F+ C  D YQDTLYT
Sbjct  317   ITTKDTATMEAIGNGFFMRGIGVENTAGAKNHQAVALRVQSDQSVFYQCQFDGYQDTLYT  376

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             H+ RQ+YR+CTI+GT+DFIFGNA VVFQNC +  R+ M NQ+ +VTAQGRK++  A   V
Sbjct  377   HTSRQYYRECTITGTIDFIFGNAQVVFQNCLIQARRCMDNQQNIVTAQGRKEKHSAGGTV  436

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             + +C I      KA     + FLGRPWKE+SRTL + + I   + P+GW  W G   L+T
Sbjct  437   IHNCTIEPHADFKADAAKFRTFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNT  496

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             C+YAE +NRG GA   KR KW+G K     +  +++T   F+   +QW+ +  +PF PG 
Sbjct  497   CYYAEVENRGAGADMSKRAKWRGVKTVTYQQAQQKYTVERFIQG-QQWIPKYGVPFIPGL  555

Query  1532  L  1530
             L
Sbjct  556   L  556



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   497 bits (1279),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 365/566 (64%), Gaps = 22/566 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KKV + GVASI +VACVVAA V++ +        G ++T++KSV+ +C PT YK+TCE++
Sbjct  3     KKVIIGGVASILVVACVVAACVTLTKHDAETSSKG-LATSTKSVQSMCQPTPYKQTCEKT  61

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L+ AK+  DPK+ IK+AF  TV  + + I   E +K+A  DP T DAL  C++L   + +
Sbjct  62    LSIAKNVSDPKDYIKVAFEATVTELKNIIKSIEPIKKAASDPYTKDALLACEQLFDLAAE  121

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAF-ENTTGDTGEKMKHLLKT  2676
             DL+ S  K++NFD++ IK+  +DLK WLS  +  ++TC+D F +    +T EKM  L+ T
Sbjct  122   DLRTSITKIQNFDISMIKDVVDDLKTWLSAVLAYEDTCLDGFTKKEYSETREKMAKLMNT  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
               EL+ N L M+  F +++           R+LL+               ++A+ R+LL 
Sbjct  182   TQELTLNVLYMVDSFGQMITQT----TGLTRKLLSNS----------DSIIEASNRKLLQ  227

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
                +S + + VV+ DGSGQYK++ +A+ AVP KN +  VI IK G+Y E +E+ +    +
Sbjct  228   I--SSAQPNAVVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEGIYKENIEIEKDKLNV  285

Query  2315  VFVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
             V +GEGPTKT ITG  + K+G G  T+HT+T+ + G GF+ ++IG +N+AG  K QAVAL
Sbjct  286   VLIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIGIQNTAGPEKEQAVAL  345

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             RV+AD    +NC ID YQDTLY HS RQFYRDC I+GT+DF+FG A  VFQNCK+IVRKP
Sbjct  346   RVNADKAAVYNCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVFQNCKLIVRKP  405

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
                Q CM+TAQG  D +     V+Q+C+I AEP   A NP  K +LGRPWK +SRT+IM 
Sbjct  406   GDTQNCMMTAQGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPWKMYSRTIIMQ  465

Query  1781  TFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQ  1608
             + ID  +  EGW+ W  T + + TC+YAEYQNRGPGA+ DKRV  W+GY+++IS +   +
Sbjct  466   SNIDAFINSEGWAPWNTTDFGIHTCFYAEYQNRGPGATLDKRVSHWRGYQKDISGDTINK  525

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFL  1530
             FT   F+  + QWL  A IP+    +
Sbjct  526   FTADKFINTNPQWLPVADIPYEADMM  551



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   496 bits (1278),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 253/566 (45%), Positives = 367/566 (65%), Gaps = 20/566 (4%)
 Frame = -1

Query  3203  AVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSLAG  3024
             A+ G+ ++FL+A VVA  V V       DG  EIS+++K+V+ +C PT+YKETC++SLA 
Sbjct  5     AIIGICAVFLLAMVVAVVVGVTHIKNKNDGE-EISSSNKAVQALCQPTNYKETCQKSLA-  62

Query  3023  AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLK  2844
             + ++ D KELI+  F+  +  I + +  S  ++E  KD     AL  C+E+L  +IDD +
Sbjct  63    SSNSSDVKELIRTGFQAGLVEIKNVLGHSVTVQELTKDENNKAALGVCQEVLDLAIDDFQ  122

Query  2843  RSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANEL  2664
             +SF  +  +DM+ I +Y  +LK WLSGA T Q+TCID+F  ++ ++ +KM+ +LKT+ E+
Sbjct  123   KSFDMLGEYDMSKIGKYLLELKTWLSGAFTSQQTCIDSFAQSSNESSQKMQSILKTSMEI  182

Query  2663  SSNGLAMITHFTELLQSLEIPGVN------FKRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
             +SN LAM+   + +++ L IP V       F R+LL+ E        +   ++  A R+L
Sbjct  183   TSNALAMLNGLSTIVKELNIPNVGNIDSTGFNRKLLSTE--------DMLEWISQADRKL  234

Query  2501  LTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMN  2322
             L   P  +K ++VVAKDGSG+Y ++ +AL  VP K+ +  VI IKAG Y E++ V ++M 
Sbjct  235   LQAKPMDLKPNVVVAKDGSGKYDTINKALAEVPVKSPDRFVIHIKAGTYKEKINVTKQMT  294

Query  2321  KIVFVGEGPTKTRITG--SRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
              +VF+G+GPTKT IT   S +    + TY TATV + G GF+A++IGF+NSAG   HQAV
Sbjct  295   NVVFIGDGPTKTIITNDISVAKNPPVRTYRTATVGVDGAGFMAKDIGFDNSAGPEGHQAV  354

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             A R +AD  I  NCH   YQDTLY H  RQ Y +C I+GTVDFIFG+A  +FQNC +IVR
Sbjct  355   AFRATADRVIMFNCHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAASIFQNCMLIVR  414

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KP   Q CMVTAQGR D    +AIVLQ+C I   P   +    NK +LGRPWK+F+R++I
Sbjct  415   KPGPGQNCMVTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAYLGRPWKQFARSII  474

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + IDDI+ PEG++   GT+ +DT + AE+ NRGPGA T++RV WKG K+ I    A +
Sbjct  475   MQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGIKK-IDINEANK  533

Query  1607  FTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +TP  +L + E W+  + +P+SP  +
Sbjct  534   WTPRVYLES-ETWISSSDVPYSPDMV  558



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   496 bits (1278),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 259/569 (46%), Positives = 358/569 (63%), Gaps = 22/569 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGE-SADGGGEISTASKSVKEICAPTDYKETCER  3036
             KK A+ GV+SI L+A V A  V V   G+  ++GG +I  + K V+ +C  T YK+TCE+
Sbjct  15    KKFAILGVSSILLIAMVAAVAVGVKDGGQVESEGGNQIVKSQKIVQVLCGTTGYKQTCEK  74

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             SLA    TD  KELIK  F+ T E ++  I  S+L KE   +  T  A+D CKE+L  ++
Sbjct  75    SLAKTGKTD-MKELIKAVFKATAEELSKQIHNSKLYKELATNDMTKQAMDICKEVLGYAV  133

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             DD+ +S   ++ FD+  I E   DLKVWLSG +  Q+TC+  FENTT    + M  +LK 
Sbjct  134   DDVHQSIHSLDKFDIRKIDEIAYDLKVWLSGTLANQQTCLYGFENTTTHAEQTMAKVLKA  193

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGV----NFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
             + EL++N L +I   +  ++ L +  +    N  R+ L+ +          P +V  + R
Sbjct  194   SLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSED--------GLPSWVSQSQR  245

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             +LL   P ++K + VVA+DGSGQ+K++ EAL  VP KN    VI +KAG+Y E V V + 
Sbjct  246   KLLAA-PENVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGIYKEYVSVDKD  304

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
              + +  +G+GPTKT  TGS+S  DG+ TY+TAT  +    F A N+GFENSAGAAKHQAV
Sbjct  305   RDHVTIIGDGPTKTIFTGSKSYADGVQTYNTATFGVNSAHFTALNVGFENSAGAAKHQAV  364

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRV+AD  +F+NC +D YQDTLYT S RQFYRDCTISGT+DF+FG+A  VFQNCK++VR
Sbjct  365   ALRVTADKALFYNCQMDGYQDTLYTQSKRQFYRDCTISGTIDFVFGDAVGVFQNCKLVVR  424

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KPMANQ+CMVTA GR      +A+V Q+C    EP +     P   +LGRPW+ FS+ +I
Sbjct  425   KPMANQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYLGRPWRNFSKVVI  483

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             + + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW G K  IS   A +
Sbjct  484   VDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-TISAGEAAK  542

Query  1607  FTPGPFL-----MADEQWLGRAQIPFSPG  1536
             + PG F       A + W+  + IP+S G
Sbjct  543   YYPGKFYEIANGTARDDWITESGIPYSIG  571



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   497 bits (1279),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 269/594 (45%), Positives = 376/594 (63%), Gaps = 27/594 (5%)
 Frame = -1

Query  3233  MGSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVK  3078
             M    +  ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K
Sbjct  1     MLRKSEKTRIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIK  60

Query  3077  EICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRT  2901
              +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR 
Sbjct  61    TVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRA  120

Query  2900  SDALDTCKELLHNSIDDLKRSFQKVENFDMA---HIKEYTNDLKVWLSGAITQQETCIDA  2730
             S AL+ C EL+  +I+DL+RSF+++   D      +    N+LK WLS  IT QETC+D 
Sbjct  121   SLALEDCNELMDEAIEDLQRSFEELGKSDRQARYKMGPMINNLKTWLSSTITYQETCLDG  180

Query  2729  FENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAE  2565
             FENTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+   
Sbjct  181   FENTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENN  240

Query  2564  TKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
              K          E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL 
Sbjct  241   AKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALN  300

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
              +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTA
Sbjct  301   FIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTA  360

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV++ G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+Y
Sbjct  361   TVSVLGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYY  420

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+
Sbjct  421   RDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSII  480

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
             A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY 
Sbjct  481   ADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYG  540

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             N GPGA+   RV W+G K     E A +FT G F   D+ W+    +P+  GF+
Sbjct  541   NYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYVSGFV  593



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   496 bits (1277),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 254/569 (45%), Positives = 371/569 (65%), Gaps = 21/569 (4%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGES---ADGGGEISTASKSVKEICAPTDYKETC  3042
             +++AV GV++IFLVA VVA   SV  + +S   +     + ++ K+V+ +C PT Y++ C
Sbjct  10    RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E+SL   A +T D +ELIK+ F +T++ I     K + +  A+++PR   AL TCK+L++
Sbjct  70    EKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLMN  129

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              S+ + KR+ +K+  FD+ ++      LKVWLSGAIT QETC+D F NTT   G +M++L
Sbjct  130   LSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGNRMRNL  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV------  2523
             L T   +SSN LA+IT     +   E+  VN KR+L+  +     Q+E     +      
Sbjct  190   LTTTMHMSSNALAIITALANTVS--ELSDVN-KRQLVEDDEHVFGQDEVISSLIFDDDDD  246

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL  +P  +K + +VAKDGS ++KS+ +AL+ VP KN +  VI+I+ GVYNE +
Sbjct  247   GGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVYNEYI  306

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV + M ++VFVG+G  KTRITG+R+  DG+ TY TA+VAI GD F+A NIGFENSAG  
Sbjct  307   EVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASVAIHGDYFVAINIGFENSAGPH  366

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV AD +IF+ C +D Y+DTLY H+ RQFYRDCTISGT DF+FG+A  VFQNC
Sbjct  367   KHQAVAIRVQADRSIFYRCSMDGYEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNC  426

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ  +VTAQGRK++   + IV+Q   I++   +K      K +L RP K +
Sbjct  427   TFVVRKPLENQPLIVTAQGRKEKHQPSGIVIQGSSIVSNHRMKF---DKKAYLARPLKNY  483

Query  1802  SRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+ M T+++  + P+G+  W   QG   ++TC+YAEY N GPG++  KRVKW G K+ 
Sbjct  484   SRTIFMNTYMEGFIEPDGYVPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIKK-  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++ + A +++P  F   D+ W+   +IP+
Sbjct  543   LNSKSASEYSPLNFFHGDD-WVKITRIPY  570



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   494 bits (1272),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 243/536 (45%), Positives = 353/536 (66%), Gaps = 19/536 (4%)
 Frame = -1

Query  3113  GGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G EIS+++K+V+ +C PT+YKETC++SLA + ++ D KELI+  F+  +  I + ++ S 
Sbjct  18    GEEISSSNKAVQALCQPTNYKETCQKSLASS-NSSDVKELIRTGFQAGLVEIKNVLAHSV  76

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
              ++E  KD     AL  C+E+L  +IDD ++SF  +  +DM+ I +Y  +LK WLSGA T
Sbjct  77    TVQELIKDKNNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKTWLSGAFT  136

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN------  2592
              Q+TCID+F  ++ ++ +KM+ +LKT+ E++SN LAM+   + +++ L IP V       
Sbjct  137   SQQTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDTTG  196

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+AE        + P ++  A R+LL   P  +K ++VVAKDGSG+Y ++ +AL 
Sbjct  197   VNRKLLSAE--------DMPEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALA  248

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYH  2238
              VP K+ +  VI IKAG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY 
Sbjct  249   EVPVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYR  308

Query  2237  TATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQ  2058
             TATV + G GF+A++IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ
Sbjct  309   TATVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQ  368

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
              Y +C I+GTVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C 
Sbjct  369   LYSNCLITGTVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCT  428

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             I   P   +    NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE
Sbjct  429   ISGAPDYISVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAE  488

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + NRGPGA T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  489   FGNRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  542



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   495 bits (1274),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 250/539 (46%), Positives = 337/539 (63%), Gaps = 16/539 (3%)
 Frame = -1

Query  3125  SADGG----GEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVEN  2961
             S DGG    GE+ST+ KS+K  C P DY+ETCE++L A A +   P EL K  F+VT + 
Sbjct  28    SGDGGRAEEGEMSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPTELAKAIFKVTSDR  87

Query  2960  ITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDL  2781
             I  A+ +S LL E   D RTS AL  C ELL  +IDDL+ +F ++  F+M + K   +DL
Sbjct  88    IAKAVRESALLNELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFEMTNFKSAVDDL  147

Query  2780  KVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP  2601
             + WLS A+T QETC+D FENTT     KM+  L ++ EL+ N LA++  F+E L +L +P
Sbjct  148   RTWLSSALTYQETCLDGFENTTTPAAGKMRKALNSSQELTENILALVDEFSETLANLGLP  207

Query  2600  GVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSV  2427
               +F RRLL    +G       P ++  A RRLL   P     + D+ VAKDGSG ++++
Sbjct  208   --SFHRRLLAEHARGA------PSWMPDAKRRLLLVSPGEKGFRPDVTVAKDGSGDFRTI  259

Query  2426  VEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG  2247
               AL  VP K+  T V+++KAG Y E V V R +  +V VG+G TKT ITG +S    I 
Sbjct  260   NAALAKVPLKSATTYVMYVKAGKYREYVSVARNVTNLVMVGDGATKTVITGHKSFMMNIT  319

Query  2246  TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHS  2067
             T  TAT+   G+GF+ R IG +N+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+
Sbjct  320   TKDTATMEAIGNGFLMRGIGVKNTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTLYTHT  379

Query  2066  YRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQ  1887
              RQ+YRDC I+GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR     V+ 
Sbjct  380   SRQYYRDCVITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSVGGTVIH  439

Query  1886  SCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCW  1707
             +C +   P  + +    + FLGRPWKE SRTL + + I   + P+GW  W G   L TC+
Sbjct  440   NCTVAPHPEFEKSVGRFRTFLGRPWKEHSRTLYIQSEIGGFIDPQGWLPWLGDFGLSTCY  499

Query  1706  YAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             YAE +N GPGA+  +RVKW+G K        +++T   F+   + WL +  +PF PG L
Sbjct  500   YAEVENHGPGANMTRRVKWRGIKNITYQHALQKYTVESFIQG-QHWLPQLGVPFIPGLL  557



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   496 bits (1277),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 270/588 (46%), Positives = 374/588 (64%), Gaps = 31/588 (5%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAPTDY  3054
             ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K +C PTDY
Sbjct  13    RIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIKTVCQPTDY  72

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR S AL+ C 
Sbjct  73    QKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRASLALEDCN  132

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEY-----TNDLKVWLSGAITQQETCIDAFENTTG  2712
             EL+  +I+DL+RSF+++   D  H   Y      N+LK WLS  IT QETC+D F NTTG
Sbjct  133   ELMDEAIEDLQRSFEELGKSD--HQARYKMGPMINNLKTWLSSTITYQETCLDGFANTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAETKGe--  2553
             + G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+    K    
Sbjct  191   EAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGH  250

Query  2552  ------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                   E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL  +P K+
Sbjct  251   GGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKS  310

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G
Sbjct  311   NKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILG  370

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   RV W+G K     E A +FT G F   D+ W+    +P+  GF+
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYVSGFV  597



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   494 bits (1271),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 259/577 (45%), Positives = 367/577 (64%), Gaps = 25/577 (4%)
 Frame = -1

Query  3233  MGSP-EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTD  3057
             MGS  ++ KK  V G  S FLV  VV+  V   +     D    I   +K+V+ +CAPTD
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKH-SPKDDENHIRKTTKAVQAVCAPTD  59

Query  3056  YKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALD  2886
             +K+TC  SL GA  D+DDP +LIKL F+VT+++I +++ K+  ++  EADK+P    A +
Sbjct  60    FKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAEADKNPEAKGAFE  119

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C++L+ ++IDDLK+       F +  I+ +  DL+VWLSG+I  Q+TC+D+F     + 
Sbjct  120   LCEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNL  177

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGeeqee  2541
              + M  + KT+ ELSSN LAM+T  + L+ +  + G+      + R+LL+ E       +
Sbjct  178   MQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTE-------D  230

Query  2540  EFPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
               P +V    RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I I
Sbjct  231   SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARN  2193
             K G+Y E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+N
Sbjct  291   KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKN  350

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IG EN+AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIF
Sbjct  351   IGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIF  410

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK
Sbjct  411   GDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNK  470

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVK
Sbjct  471   AYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVK  530

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             W G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  531   WPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   492 bits (1267),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 258/577 (45%), Positives = 367/577 (64%), Gaps = 25/577 (4%)
 Frame = -1

Query  3233  MGSP-EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTD  3057
             MGS  ++ KK  V G  S FLV  VV+  V   +     D    I   +K+V+ +CAPTD
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKH-SPKDDENHIRKTTKAVQAVCAPTD  59

Query  3056  YKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALD  2886
             +K+TC  SL GA  D+DDP +LIKL F+VT+++I +++ K+  ++  +ADK+P    A +
Sbjct  60    FKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFE  119

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C++L+ ++IDDLK+       F +  I+ +  DL+VWLSG+I  Q+TC+D+F     + 
Sbjct  120   LCEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNL  177

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGeeqee  2541
              + M  + KT+ ELSSN LAM+T  + L+ +  + G+      + R+LL+ E       +
Sbjct  178   MQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTE-------D  230

Query  2540  EFPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
               P +V    RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I I
Sbjct  231   SIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHI  290

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARN  2193
             K G+Y E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+N
Sbjct  291   KEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKN  350

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IG EN+AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIF
Sbjct  351   IGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIF  410

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK
Sbjct  411   GDAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNK  470

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVK
Sbjct  471   AYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVK  530

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             W G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  531   WPGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   492 bits (1266),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 246/534 (46%), Positives = 342/534 (64%), Gaps = 16/534 (3%)
 Frame = -1

Query  3119  DGGGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISK  2940
             +GG  I  + ++V+ IC   +YKETC +SLA A +T D KELI  AF  T E I   I  
Sbjct  46    EGGDSIVKSQRNVQVICESAEYKETCHKSLAKASETSDLKELIITAFNATAEEIAKQIKN  105

Query  2939  SELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGA  2760
             S L  E   D     A+D CKE+L  ++DD+ +S +K+E F++  + +Y  DLKVW++G 
Sbjct  106   STLYHELATDDMNKQAMDICKEVLGYAVDDMHQSVRKLEEFELNKLNDYAYDLKVWIAGT  165

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKR-  2583
             +  Q+TC+D FENTT + G+ M  +L T+ ELS+N L ++   + L + L +   +    
Sbjct  166   LAHQQTCLDGFENTTNEAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNN  225

Query  2582  RLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
             R L +E  G      FP +V    RRLL    A  K D+VVA+DGSGQ K++ EAL+ VP
Sbjct  226   RKLLSEVDG------FPTWVSEGQRRLL--QAADAKADVVVAQDGSGQVKTIHEALKLVP  277

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
              KN +  VI++KAGVY E + + + +  +  +G+GPTKTRITGS++  DGI TY+TAT  
Sbjct  278   KKNKKPFVIYVKAGVYQEYIMINKHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFG  337

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             +    F+A NIGFEN+AGA KHQAVALRV+AD  +F+NC++D +QDTLYT S RQFYRDC
Sbjct  338   VNAANFMAMNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDC  397

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             T++GT+DF+FG+A  VFQNCK IVRKPM NQ+CMVTA GR      +A+V QSC    EP
Sbjct  398   TVTGTIDFVFGDAVAVFQNCKFIVRKPMENQQCMVTAGGRTKIDSPSALVFQSCIFTGEP  457

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
              + A + P   +LGRPW+ +++ +IM + IDDI VPEG+  W G+ + DT  Y E+ NRG
Sbjct  458   DVFALS-PKIAYLGRPWRVYAKVVIMDSQIDDIFVPEGYMPWMGSAFKDTSTYYEFNNRG  516

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              GA+T  R+ W G+K  I+P  A  + PG F         + W+  + +P+S G
Sbjct  517   FGANTQGRITWPGFKV-ITPIEATDYYPGKFFEIANSTERDSWIVGSGVPYSLG  569



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   491 bits (1264),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 257/572 (45%), Positives = 365/572 (64%), Gaps = 21/572 (4%)
 Frame = -1

Query  3233  MGSP-EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTD  3057
             MGS  ++ KK  V G  S FLV  VV+  V   +     D    I   +K+V+ +CAPTD
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKH-SPKDDENHIRKTTKAVQAVCAPTD  59

Query  3056  YKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALD  2886
             +K+TC  SL GA  D+DDP +LIKL F+VT+++I +++ K+  ++  +ADK+P    A +
Sbjct  60    FKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFE  119

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C++L+ ++IDDLK+       F +  I+ +  DL+VWLSG+I  Q+TC+D+F     + 
Sbjct  120   LCEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNL  177

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
              + M  + KT+ ELSSN LAM+T  + L+ +  +    + R+LL+ E       +  P +
Sbjct  178   MQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTA-KYARKLLSTE-------DSIPTW  229

Query  2525  VDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
             V    RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I IK G+Y
Sbjct  230   VGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIY  289

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFEN  2178
              E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+NIG EN
Sbjct  290   KEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNIGIEN  349

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             +AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIFG+A  
Sbjct  350   TAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKC  409

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK +LGR
Sbjct  410   ILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGR  469

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW G K
Sbjct  470   PWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIK  529

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  530   K-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  559



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   491 bits (1265),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 260/578 (45%), Positives = 369/578 (64%), Gaps = 23/578 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGE--ISTASKSVKEICAPTDYKE  3048
             E+ K++A+  V+S+ LVA V A  V +  + E A+ GG+  I    ++VK IC   +YKE
Sbjct  11    EKKKRLAILTVSSVLLVAMVAAVAVGIRDNEEMAEEGGDSGIVKNQRNVKVICQSAEYKE  70

Query  3047  TCERSLAGAKDTD-DPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             TC++SL  A D + D K+LI  AF  T E I   I  S L +E   D  T  A++ C+E+
Sbjct  71    TCQKSLEKASDENSDLKQLIITAFNATAEEIHSKIKNSTLFQELATDNMTKQAMEICQEV  130

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             L  ++DD+ +S   +E FD++ + EY  DLKVW++G +  Q+TC+D F +TT + G+ M 
Sbjct  131   LGYAVDDINKSSATLEKFDLSMLNEYAYDLKVWIAGTLAHQQTCLDGFNHTTTEAGKTMT  190

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGVNF------KRRLLTAETKGeeqeeEFPG  2529
              +L  + E+S N L ++   + L +     G+NF       R+LL+ E   +   + FP 
Sbjct  191   RVLNASLEMSHNALDIVNGASALFK-----GLNFTSFAASNRKLLSEEPLVDGLVDGFPS  245

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +V    R++L  + A+ K D+VVA DGSGQ   + EAL+ VP  N +  VI+IKAG+Y E
Sbjct  246   WVTEGQRKIL--EDANPKPDVVVALDGSGQVTKIHEALKLVPKNNKKPFVIYIKAGIYQE  303

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              V + + M+ +  +G+GPT+TRITG+++  DG  TY+TAT       F+A+NIGFENSAG
Sbjct  304   YVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQTYNTATFGANAANFMAKNIGFENSAG  363

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRV+AD  +F+NCH+D YQDTLYT S RQFYRDCT+SGT+DF+FG+A  VFQ
Sbjct  364   AEKHQAVALRVTADKAVFYNCHMDGYQDTLYTQSQRQFYRDCTVSGTIDFVFGDAVAVFQ  423

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK +VRKPM NQ+CMVTA GR      +A+V QSC    EP L A  P    +LGRPW+
Sbjct  424   NCKFVVRKPMENQQCMVTAGGRSKIDSPSALVFQSCTFTGEPDLVAVTPKIS-YLGRPWR  482

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
              +S+ +I+ + IDDI VPEG+  W G+ + DTC Y E+ NRGPGA+T  RV W G+K  I
Sbjct  483   IYSKVVIIDSQIDDIFVPEGYMPWMGSAFRDTCTYYEFNNRGPGANTAGRVTWPGFKV-I  541

Query  1628  SPEVAKQFTPGPFL-MAD----EQWLGRAQIPFSPGFL  1530
             +P  A ++ PG F  +A+    + W+  + +P+S G L
Sbjct  542   NPTEAAEYYPGKFFEIANSTDRDAWILESGVPYSLGSL  579



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   490 bits (1262),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 242/536 (45%), Positives = 351/536 (65%), Gaps = 19/536 (4%)
 Frame = -1

Query  3113  GGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             G EIS+++K+V+ +C PT+YKETC++SLA + ++ D KELI+  F+  +  I + ++ S 
Sbjct  34    GEEISSSNKAVQALCQPTNYKETCQKSLA-SSNSSDVKELIRTGFQAGLVEIKNVLAHSV  92

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
              ++E  KD     AL  C+E+L  +IDD ++SF  +  +DM+ I +Y  +LK WLSGA T
Sbjct  93    TVQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKTWLSGAFT  152

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN------  2592
              Q+TCID+F  ++ ++ +KM+ +LKT+ E++SN LAM+   + +++ L IP V       
Sbjct  153   SQQTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTG  212

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             F R+LL+ E        +   ++  A R+LL   P  +K ++VVAKDGSG+Y ++ +AL 
Sbjct  213   FNRKLLSTE--------DMLEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALA  264

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYH  2238
              VP K+ +  VI IKAG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY 
Sbjct  265   EVPVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYR  324

Query  2237  TATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQ  2058
             TATV + G GF+A++IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ
Sbjct  325   TATVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQ  384

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
              Y +C I+GTVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C 
Sbjct  385   LYSNCLITGTVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCT  444

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             I   P        NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE
Sbjct  445   ISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAE  504

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + NRGPGA T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  505   FGNRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=559

 Score =   488 bits (1256),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 246/566 (43%), Positives = 370/566 (65%), Gaps = 18/566 (3%)
 Frame = -1

Query  3218  QNKKVAVTGVASIFLVACVVAATVSVGRS-GESADGGGEISTASKSVKEICAPTDYKETC  3042
             + KK+A+ GV++I LVA VVA  V V +S G   D     +T+SK+++ +C PTD+K+TC
Sbjct  9     KKKKIAIIGVSAIILVAMVVAVAVGVTKSKGHKEDN--TPATSSKAIEAVCQPTDFKDTC  66

Query  3041  ERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             + +LA  A +  DPKELIK+A ++  + + + +  S+ + E  KDP    AL  CKEL+ 
Sbjct  67    KTTLAANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHEVVKDPLGDQALQNCKELIQ  126

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              SI+D+K++F  +  FD++ +K Y  +L+ WLS +++ ++TC+D F +  GD G+KMK+ 
Sbjct  127   YSINDIKKAFGNMGPFDVSKVKNYVKELENWLSASVSYEQTCLDGFNSVKGDAGDKMKNF  186

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LK + EL+ NGLAMI+  ++L+       +  +RRLL      +      P ++D     
Sbjct  187   LKQSQELTKNGLAMISEISKLMGGA--IDIKPQRRLLADGDSSKTS----PSWIDGRKLD  240

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             L T   +S+K D+VVA+DGSG+YK+V EAL+ +P ++ +T VI+IK G Y E V + ++M
Sbjct  241   LATASASSLKPDVVVAQDGSGKYKTVGEALKDIPKESPKTFVIYIKEGEYKEHVVLEKEM  300

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               ++F+G+GPTKT+ITG ++  DG   + TATV + GD FIA+++GFENSAGA  HQA+A
Sbjct  301   KNVMFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDYFIAKDMGFENSAGAKGHQAMA  360

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRV +D +IF+NC +D YQ+TL+T +YRQFYRDCTISG VD IFG+A VVFQNCKMI+RK
Sbjct  361   LRVQSDQSIFYNCQMDGYQNTLFTQTYRQFYRDCTISGAVDIIFGDAAVVFQNCKMIIRK  420

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             P  + +  VTAQ R D+R   AIV Q+  I A+   K        FLGRP   +SRT++M
Sbjct  421   PEGDDKATVTAQERSDKRQPTAIVFQNSTISADKEYK----DKTAFLGRPAHTYSRTVVM  476

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + IDD++ PEGW+ W G    + CW+ E+ NRG G++T+KRV W    + ++ + A +F
Sbjct  477   QSQIDDVISPEGWTPWTGQSNTEECWFGEFSNRGSGSATNKRVSW---FKMVTRDQADEF  533

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +    L   E W+  + +P+  G ++
Sbjct  534   SASSLLFG-ENWIKPSGVPYEAGLMR  558



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   488 bits (1256),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 251/570 (44%), Positives = 359/570 (63%), Gaps = 21/570 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + G  S  LV  VV+  V   R    AD   +I   +K+V+ +CAPTD+KETC
Sbjct  6     DKKKKCIIAGSVSGLLVIMVVSVAVVTSRHSPKADEN-QIKKTTKAVQAVCAPTDFKETC  64

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
               SL  A   + +P +LIKL+F VT+++I + + K+  ++  +A KDP    A + C+++
Sbjct  65    VNSLMNASPKSTEPMDLIKLSFDVTIKSINEGLKKASGDVKAKASKDPEAKGAFELCEKV  124

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             + ++I+DLK+       F +  I  +  DL+VWLSG+I  Q+TC+D+FE    +  ++M+
Sbjct  125   MVDAIEDLKKCMD--HGFSVDKIDAFVEDLRVWLSGSIAFQQTCMDSFEEIKSNLMQEMQ  182

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPG-----VNFKRRLLTAETKGeeqeeEFPGF  2526
             H+ KT  ELSSN LAM+T  + LL +    G      N+ R+LLT E       +  P +
Sbjct  183   HIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTE-------DGIPTW  235

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             V    RRL+   P  +K + VVA+DGSGQ+K++ +AL A+P  N    VI IK G+Y E+
Sbjct  236   VGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGNTVPFVIHIKQGIYKEK  295

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAG  2169
             V V RKM  + F+G+G TKT ITG+++   G + T+ TA + ++GD F  +NIG EN+AG
Sbjct  296   VMVTRKMPYVTFIGDGQTKTVITGNQNYGIGKVKTFQTAPLIVEGDHFTMKNIGVENTAG  355

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
                 QAVALRVSAD  +FH+C  D YQDTLY HS+R F+RDCT+SGTVDFIFG+A  + Q
Sbjct  356   PEGGQAVALRVSADYAVFHSCQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQ  415

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP   Q CMVTAQGR D R +  +VL +C I  +PA       +K +LGRPWK
Sbjct  416   NCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWK  475

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             +FSRT++M T IDD++ P GW  W G   L T +YAEY N GPG++  +RVKW G  R I
Sbjct  476   QFSRTIVMKTLIDDVIDPAGWLEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWPGI-RKI  534

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             +P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  535   TPQDALSYTGDRFLGGNT-WIPQTQVPYTP  563



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   486 bits (1252),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 252/576 (44%), Positives = 365/576 (63%), Gaps = 39/576 (7%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASK---SVKEICAPTDYKETCE  3039
             KVAV  V+S+ LVA VVA   + GR  ++  GG +++ + K   ++  +C+ TDYK+ C 
Sbjct  1     KVAVAAVSSLLLVAMVVALMYN-GRGDDAGGGGVDVAASQKAMVTIDTLCSSTDYKKACV  59

Query  3038  RSLAGAKD-TDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
              +L  + + T DPKEL+++AFR T++ I  A   S +L+E  +DPR  +A+D C EL   
Sbjct  60    DTLRDSGNSTSDPKELMEIAFRATMDRIAAAGRNSSVLREVQRDPRGREAVDACAELAER  119

Query  2861  SIDDLKRSFQKVEN----FDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             ++ DL R+F+K       FD+ +  E   DLK+WLSGA+T QETC+D FE  +GD G++M
Sbjct  120   AVADLNRTFEKFSKEFSEFDLTNADEVVGDLKIWLSGAVTYQETCLDGFEGVSGDAGDRM  179

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF------KRRLLTAETKGeeqeeEFP  2532
             + LL  + ++SSN LAM+T    +L S      +       +RRLL+ +          P
Sbjct  180   RDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSRRRRLLSEKDD-------LP  232

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
                              +K D++VAKDGSG +K++ EAL  VP  +++T V++IK G+Y 
Sbjct  233   KL-------------NIMKPDLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIKEGIYE  279

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E+V++      ++ VG+GP KTRITG  +  +G  TY +ATVA+ GD F A ++GFEN+A
Sbjct  280   EQVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTTTYQSATVAVHGDRFTAMDVGFENAA  339

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G   HQAVALRVSAD+ +F+NCH+D YQDTLY H+YRQFYRDCTISGT+D+IFG+A  +F
Sbjct  340   GPEGHQAVALRVSADLAVFYNCHMDGYQDTLYAHTYRQFYRDCTISGTIDYIFGDAAALF  399

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             Q C M+VRKP+ANQ C+VTAQGRKD      +VLQ+C ++ +PA       NK +L RPW
Sbjct  400   QGCTMVVRKPLANQYCIVTAQGRKDVHQPTGLVLQNCSVVGDPAYYPVMDVNKAYLARPW  459

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             K +SR +IM ++ID I+ P+G+  W GT  LDT +Y E+ NRGPGA   +R+KW G K  
Sbjct  460   KLYSRAVIMESYIDRIIQPDGYLEWNGTFALDTLFYTEFNNRGPGADKSRRLKWTGIK-E  518

Query  1631  ISPEVAKQFTPGPFLMADEQWL--GRAQIPFSPGFL  1530
             ++ +  K+FT   F+    +W    + +IP+  GF+
Sbjct  519   LTGKRMKRFTGDDFIDG-SRWTKHNKMKIPYKGGFV  553



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   486 bits (1252),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 257/572 (45%), Positives = 359/572 (63%), Gaps = 26/572 (5%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + GV S  LV  VV+  +   ++  + +   EI   +K+VK +CAPTDYKETC
Sbjct  6     DKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNEN---EIRQNTKAVKTVCAPTDYKETC  62

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
              +SL  A   + +P  LIKL+F VT+++I + + K+  ++  +ADK P   DA + C+++
Sbjct  63    LKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKV  122

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             ++++I DLK+      + D   I+ +  DL+VW+SG+I  Q+TCID FE         M 
Sbjct  123   MNDAIADLKKCVDHKVSVD--EIERFIKDLRVWISGSIAFQQTCIDTFEEIKSTLKHDMI  180

Query  2690  HLLKTANELSSNGLAMITHF----TELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             ++ K + +LSSN LAM+T      TEL  + E    N  R+LL+ E  G       P +V
Sbjct  181   NIFKRSRQLSSNSLAMVTDLNSNATELTGAFE----NNARKLLSTEEDG------VPTWV  230

Query  2522  DAATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
                 RRL+       +K + VVA+DGSGQ+K++ +AL AVP +N    VI IK GVY E+
Sbjct  231   GPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEK  290

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAG  2169
             V V RKM  + F+G+GPTKT ITGS +   G + TY TA + ++G+ F A+ IG EN+AG
Sbjct  291   VVVTRKMPYVTFIGDGPTKTVITGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAG  350

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
                 QAVALRVS D  +F +C ID YQDTLY HS RQFYRDCT+SGTVDFIFG++  + Q
Sbjct  351   PEGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQ  410

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKPMA Q CMVTAQGR D R    IVL +C I+ +PA       +K +LGRPWK
Sbjct  411   NCKIVVRKPMAGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWK  470

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT++M T +DD++ P GW  W G   L T +YAE+ N GPGA+  +RVKW G K+ +
Sbjct  471   EFSRTIVMKTIVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-L  529

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +PE A  +T   FL  +  W+ R Q+P++ G 
Sbjct  530   TPEQALSYTGDRFLSGN-TWIPRTQVPYTAGM  560



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   486 bits (1252),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 254/563 (45%), Positives = 358/563 (64%), Gaps = 33/563 (6%)
 Frame = -1

Query  3167  CVVAATVS----------VGRSGESADGGGEISTASKSVKEICAPTDYKETCERSLAGAK  3018
             C++A +VS             + +++    EI   +K+VK +CAPTD+KETC  SL  A 
Sbjct  11    CIIAGSVSSLLVIMVVSVAVVTSKNSPNENEIRKNTKAVKAVCAPTDFKETCVNSLMNAS  70

Query  3017  -DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKELLHNSIDDL  2847
               + +P +LIKL F VT+++I +A+ K+  ++  +ADK P    A + C++L+ ++IDDL
Sbjct  71    PKSTEPLDLIKLGFNVTIKSINEALQKASRDVKAKADKAPEAKGAFELCEKLMTDAIDDL  130

Query  2846  KRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANE  2667
             ++       F +A I  +  DL+VWLSG+I  QETC+D+FE    +  + M  + KT+ E
Sbjct  131   QKCVD--HGFSVAKIDGFVEDLRVWLSGSIAFQETCMDSFEEIKSNLLQDMLKIFKTSRE  188

Query  2666  LSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
             LSSN LAM+T  + +L +  I G+     N+ R+LL+ +       +  P +V    RRL
Sbjct  189   LSSNSLAMVTDLSTILPNSNITGLTGTLANYARKLLSTK-------DGIPTWVGPEARRL  241

Query  2501  LTTDPAS---IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPR  2331
             +         +K + VVA+DGSGQ+K++ +AL AVP  N    VI IK G+Y E+V V +
Sbjct  242   MAAPQGGGPPVKANAVVAQDGSGQFKTIADALNAVPKDNRLPFVIHIKQGIYKEKVIVTK  301

Query  2330  KMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             KM  + F+G+GPTKT+ITGS +   G + T+ TATV I G+ F A+NI  EN+AG    Q
Sbjct  302   KMPYVTFIGDGPTKTKITGSLNFGLGKVKTFLTATVTIDGEHFTAKNIWIENTAGPEGGQ  361

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRVSAD  +F++C ID YQDTLY HS RQFYRDCT+SGTVDFIFG+A  + QNCK++
Sbjct  362   AVALRVSADYAVFYSCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIV  421

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP   Q CMVTAQGR D R +  +VL +C I+ EPA       NK +LGRPWK+FSRT
Sbjct  422   VRKPKGGQSCMVTAQGRTDVRESTGLVLHNCHIVGEPAYIPVKSVNKAYLGRPWKKFSRT  481

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM T IDD++ P GW  W+G   L+T +YAE+ N GPG++  +RV W G K+ +SPE A
Sbjct  482   IIMKTTIDDVIDPAGWLPWRGDFALETLYYAEHLNIGPGSNQAQRVNWPGIKK-LSPEEA  540

Query  1613  KQFTPGPFLMADEQWLGRAQIPF  1545
               +T G FL  D  W+ + Q+P+
Sbjct  541   LLYTGGRFLHGD-TWIPQTQVPY  562



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   486 bits (1250),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 250/561 (45%), Positives = 344/561 (61%), Gaps = 14/561 (2%)
 Frame = -1

Query  3203  AVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSLAG  3024
             A+ G ++I +VA V A  V   + G       E+ST+ KS+K  C P DYKE CE +L  
Sbjct  6     AIIGASTILVVAVVAAVCVVSFKGGSDDKSDQELSTSVKSIKSFCEPVDYKEACESTLEK  65

Query  3023  -AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDL  2847
              A +     EL K  F+ T E I  A+ +S +L E   D RT+ AL+ CKELL+ ++DDL
Sbjct  66    TAGNATSTTELAKAIFKATSERIEQAVRESSVLNELKHDQRTAGALNNCKELLNYAMDDL  125

Query  2846  KRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANE  2667
             K +F+++  F+M + K   +DLK WLS A+T QETC+D FENTT D   KMK  L  + E
Sbjct  126   KTTFEQLGGFEMTNFKHALDDLKTWLSSALTYQETCVDGFENTTTDAAAKMKKALNASQE  185

Query  2666  LSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP  2487
             L+ N L+++  F + L +LE+P  N  RRLL  +          PG++    RRLL   P
Sbjct  186   LTENILSIVDEFGDTLANLELP--NLSRRLLGDD--------GVPGWMSDTKRRLLQAKP  235

Query  2486  AS--IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
             +    K DI VA DGSG YK++ EAL  VP K+ +T V++IKAG Y E V V R +  +V
Sbjct  236   SEPEFKPDITVASDGSGDYKTINEALAKVPLKSADTFVMYIKAGTYKEYVSVARNVTNLV  295

Query  2312  FVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVS  2133
              +G+G +KT ITG +S    I T  T+T+   G+GF  R IG EN+AGA  HQAVALRV 
Sbjct  296   MIGDGASKTIITGDKSFMLNITTKDTSTMEAIGNGFFMRGIGVENTAGAKNHQAVALRVQ  355

Query  2132  ADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMAN  1953
             +D ++F+ C  D YQDTLYTH+ RQ+YRDCT++GT+DFIFGNA VVFQNC + VR+ M N
Sbjct  356   SDQSVFYECQFDGYQDTLYTHTSRQYYRDCTVTGTIDFIFGNAQVVFQNCLIQVRRCMDN  415

Query  1952  QECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFI  1773
             Q+ ++TAQGRK++  A   V+ +C I   P  K      + FLGRPWKE+SRTL + + I
Sbjct  416   QQNIITAQGRKEKHSAGGTVILNCTIEPHPEFKEHAGRLRTFLGRPWKEYSRTLYIQSEI  475

Query  1772  DDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGP  1593
                + P+GW  W G   L+TC+YAE  N GPG+   KR KW+G K     +  +++T   
Sbjct  476   GGFIDPQGWLPWLGDFGLNTCYYAEVDNHGPGSDMSKRAKWRGVKTVTYQQAQQKYTIEK  535

Query  1592  FLMADEQWLGRAQIPFSPGFL  1530
             F+   + W+ +  +P+ PG L
Sbjct  536   FIQG-QTWIPKYGVPYIPGLL  555



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   490 bits (1261),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 272/596 (46%), Positives = 373/596 (63%), Gaps = 38/596 (6%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAPTDY  3054
             ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K +C PTDY
Sbjct  13    RIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIKTVCQPTDY  72

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR S AL+ C 
Sbjct  73    QKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRASLALEDCN  132

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEY-----TNDLKVWLSGAITQQETCIDAFENTTG  2712
             EL+  +I+DL+RSF+++   D  H   Y      N+LK WLS  IT QETC+D F NTTG
Sbjct  133   ELMDEAIEDLQRSFEELGKSD--HQARYKMGPMINNLKTWLSSTITYQETCLDGFANTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAETKGe--  2553
             + G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+    K    
Sbjct  191   EAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGH  250

Query  2552  ------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                   E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL  +P K+
Sbjct  251   GGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKS  310

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G
Sbjct  311   NKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILG  370

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------RAQIPFSPGFLQ  1527
             +   RV W+G K     E A +FT G F   D+ W+        R   P  P  LQ
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRWRLHRPLCPRTLQ  605



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   485 bits (1248),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 256/579 (44%), Positives = 364/579 (63%), Gaps = 27/579 (5%)
 Frame = -1

Query  3233  MGS-PEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTD  3057
             MGS  ++ KK  + G  S FLV  VV+  V   +    AD    I   +K+V+ +CAPTD
Sbjct  1     MGSIGDKKKKFIIAGSVSGFLVIMVVSVAVVTSKHSPKADEN-HIKKTTKAVQAVCAPTD  59

Query  3056  YKETCERSLAGAKDTD-DPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALD  2886
             +K+TC  SL GA  +  +P +LIKL F +T+++I +++ K+  ++  +ADK+P    A +
Sbjct  60    FKDTCVNSLMGASPSSAEPLDLIKLGFNITIKSINESLKKASGDVKAKADKNPEAKGAFE  119

Query  2885  TCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C++L+ ++IDDLK+       F +  I+ +  DL+VWLSG+I  Q+TC+D+F     + 
Sbjct  120   LCEKLMIDAIDDLKKCMD--HGFSVDRIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNL  177

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqee  2541
              + M  + +T+ ELSSN LAM+T  + LL +  I G+     N+ R+LL+ E       +
Sbjct  178   MQDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGALANYARKLLSTE-------D  230

Query  2540  EFPGFVDAATRRLLTTDPAS-----IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
               P +V    RRL+           +K + VVA+DGSGQ+K++ +AL  VP  N    VI
Sbjct  231   GIPNWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALNGVPKGNTVPFVI  290

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIA  2199
              IK G+Y E+V V RKM  + F+G+GP KT ITGS +   G + T+ TAT+ ++GD F A
Sbjct  291   HIKQGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTATITVEGDHFTA  350

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +NIG EN+AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDF
Sbjct  351   KNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDF  410

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       
Sbjct  411   IFGDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPVKSV  470

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +R
Sbjct  471   NKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQR  530

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             VKW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  531   VKWPGIKK-LTPQDALLYTGDRFLRGDT-WIPQTQVPYT  567



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   485 bits (1248),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 251/573 (44%), Positives = 362/573 (63%), Gaps = 22/573 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGE-SADGGG--EISTASKSVKEICAPTDYK  3051
             E+ KK AV G++SI LVA V A  V V  + E S + GG  +++T+ K+VK IC   +YK
Sbjct  10    EKKKKYAVVGLSSILLVAMVAAVAVGVSTTDEISGESGGDNQLATSQKNVKVICDSAEYK  69

Query  3050  ETCERSLAG-AKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             +TCE+SLA  + +T D K L+  AF  T E +   I  S L  E   D  T  A+D CKE
Sbjct  70    QTCEKSLANVSSETTDMKTLVIAAFNATAEELLSKIHNSTLYNELATDNMTKQAMDICKE  129

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L  ++DD+ +S   ++ F+++ I EY  D+K+W++G ++ Q TC+D FENTT + G+ M
Sbjct  130   VLGYAVDDIHQSIHTLDRFELSKIDEYAYDIKIWIAGTLSHQRTCLDGFENTTTEAGQTM  189

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVN--FKRRLLTAETKGeeqeeEFPGFVD  2520
               +L  + ELS+N + ++      ++ L +  +     R+LL+ +          P +V 
Sbjct  190   AKVLNASLELSNNAMDIVNGVAGFVKGLNLSSLTSAMSRKLLSED--------GIPSWVG  241

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
              + RRLL   P  +  +++VA+DGSGQ+K++ EAL  VP KN    VI++KAGVYNE V 
Sbjct  242   QSQRRLLEA-PHDVTPNVIVAQDGSGQFKTLNEALELVPKKNKIPFVIYVKAGVYNEYVA  300

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             + +  + +  +G+GPTKT  TG+++  DG+ TY+TAT +I    F+A N+GFENSAGA K
Sbjct  301   LDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQTYNTATFSINAADFMAINVGFENSAGAEK  360

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV+AD  +F+NC +D +QDTLYT S RQFYRDCT+SGT+DFIFG+A  VFQNCK
Sbjct  361   HQAVALRVTADKAVFYNCQMDGFQDTLYTQSKRQFYRDCTVSGTIDFIFGDAAGVFQNCK  420

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             +IV+KPM NQ+CMVTA GR       A+V Q+C    EP + A  P    +LGRPW+E+S
Sbjct  421   LIVKKPMENQQCMVTAGGRTKVDSPTALVFQNCHFTGEPDVVALKPKIS-YLGRPWREYS  479

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             + +IM + IDDI +PEG+  W G+   +TC Y EY N+G GA+T+ RVKW   K  I+  
Sbjct  480   KVVIMDSVIDDIFLPEGYMAWMGSANKETCTYYEYNNKGLGANTEHRVKWPNVK-TIAAN  538

Query  1619  VAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              A  + P  F         + W+ ++ +P+S G
Sbjct  539   EAVNYYPEKFFELVNSTQRDAWIVQSGVPYSIG  571



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   490 bits (1262),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 272/596 (46%), Positives = 373/596 (63%), Gaps = 38/596 (6%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAPTDY  3054
             ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K +C PTDY
Sbjct  13    RIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIKTVCQPTDY  72

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR S AL+ C 
Sbjct  73    QKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRASLALEDCN  132

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEY-----TNDLKVWLSGAITQQETCIDAFENTTG  2712
             EL+  +I+DL+RSF+++   D  H   Y      N+LK WLS  IT QETC+D F NTTG
Sbjct  133   ELMDEAIEDLQRSFEELGKSD--HQARYKMGPMINNLKTWLSSTITYQETCLDGFANTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAETKGe--  2553
             + G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+    K    
Sbjct  191   EAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGH  250

Query  2552  ------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                   E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL  +P K+
Sbjct  251   GGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKS  310

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G
Sbjct  311   NKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILG  370

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------RAQIPFSPGFLQ  1527
             +   RV W+G K     E A +FT G F   D+ W+        R   P  P  LQ
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRWRLHRPLCPRTLQ  605



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   489 bits (1260),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 272/596 (46%), Positives = 373/596 (63%), Gaps = 38/596 (6%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAPTDY  3054
             ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K +C PTDY
Sbjct  13    RIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIKTVCQPTDY  72

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR S AL+ C 
Sbjct  73    QKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRASLALEDCN  132

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEY-----TNDLKVWLSGAITQQETCIDAFENTTG  2712
             EL+  +I+DL+RSF+++   D  H   Y      N+LK WLS  IT QETC+D F NTTG
Sbjct  133   ELMDEAIEDLQRSFEELGKSD--HQARYKMGPMINNLKTWLSSTITYQETCLDGFANTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAETKGe--  2553
             + G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+    K    
Sbjct  191   EAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGH  250

Query  2552  ------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                   E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL  +P K+
Sbjct  251   GGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKS  310

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G
Sbjct  311   NKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILG  370

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------RAQIPFSPGFLQ  1527
             +   RV W+G K     E A +FT G F   D+ W+        R   P  P  LQ
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRWRLHRPLCPRTLQ  605



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   489 bits (1260),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 272/596 (46%), Positives = 373/596 (63%), Gaps = 38/596 (6%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGE--------SADGGGEISTASKSVKEICAPTDY  3054
             ++A    ASIFLV  VV ATVS+GR           S+    ++S + K++K +C PTDY
Sbjct  13    RIAFVMFASIFLVVMVVVATVSIGRRPNNGKSEVDVSSQSHDQVSASMKAIKTVCQPTDY  72

Query  3053  KETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  LK+ +KDPR S AL+ C 
Sbjct  73    QKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTLKQLEKDPRASLALEDCN  132

Query  2876  ELLHNSIDDLKRSFQKVENFDMAHIKEY-----TNDLKVWLSGAITQQETCIDAFENTTG  2712
             EL+  +I+DL+RSF+++   D  H   Y      N+LK WLS  IT QETC+D F NTTG
Sbjct  133   ELMDEAIEDLQRSFEELGKSD--HQARYKMGPMINNLKTWLSSTITYQETCLDGFANTTG  190

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GVNFKRRLLTAETKGe--  2553
             + G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G +  R L+    K    
Sbjct  191   EAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSSHHRGLIENNAKVLGH  250

Query  2552  ------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                   E  + +P ++    R+LL   D A  K D+VVAKDGSG   ++ EAL  +P K+
Sbjct  251   GGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGNCTTINEALNFIPKKS  310

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ +  DG  T HTATV+I G
Sbjct  311   NKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYVDGTPTMHTATVSILG  370

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDTLYTH+ RQ+YRDCTI+
Sbjct  371   EFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTLYTHAKRQYYRDCTIT  430

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       AIV+Q+  I+A+    
Sbjct  431   GTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPTAIVIQNSSIIADHVYW  490

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   + TC+YAEY N GPGA
Sbjct  491   PVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFGIHTCFYAEYGNYGPGA  550

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------RAQIPFSPGFLQ  1527
             +   RV W+G K     E A +FT G F   D+ W+        R   P  P  LQ
Sbjct  551   NKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRWRLHRPLCPRTLQ  605



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   484 bits (1246),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/537 (46%), Positives = 345/537 (64%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIKL+F  T+++I D   K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNFKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDLK+   +   F +  I+ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ K++ ELSSN LAM T    +L +  I G+      
Sbjct  159   AFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP------ASIKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K ++ VA+DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ EPA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  512   LYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   498 bits (1281),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/564 (44%), Positives = 349/564 (62%), Gaps = 41/564 (7%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELL  2928
             +++ +SK+V+ IC PTDYK+ C +SLA  K TDDPKEL++ AF   +  + +  S S +L
Sbjct  36    KLAASSKAVQAICNPTDYKDACVKSLATVK-TDDPKELVRAAFASAMAELKEIASNSTIL  94

Query  2927  KEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQ  2748
             K  + DP+T+ A+  CKEL  ++IDD +RSF ++   D   +     +LK+W+S   T Q
Sbjct  95    KVLEMDPKTAQAVKDCKELFQDAIDDFQRSFDEIGKLDWNQVNSVLENLKIWISATRTYQ  154

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKR-----  2583
             ETC+D FENTTGD   K++ +L+T+ E+SSNGLA++   + L  +L+I     +R     
Sbjct  155   ETCLDGFENTTGDATVKVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATY  214

Query  2582  ---RLLTAETKGeeqeeE--------------------------FPGFVDAATRRLLT--  2496
                R L  +  G                                 P +VD   R+LL   
Sbjct  215   KVHRRLFGDDDGNNVLLSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASP  274

Query  2495  --TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMN  2322
               TD    K ++VVA+DGSG++K++ EA++ +P    ET +I+IK GVYNE + + + M 
Sbjct  275   MLTDDLKAKANVVVAQDGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMT  334

Query  2321  KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
              +VFVG+GPTKTRIT +++  DG  T+ TAT+++ GD F+A++IG ENSAGA KHQAVA 
Sbjct  335   NVVFVGDGPTKTRITNNKNYADGTKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAF  394

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             R  +D +IF NCH D YQDTLYTH+YRQFYRDC I+GT+DFIFG+A V FQNC  +VRKP
Sbjct  395   RAQSDKSIFFNCHFDGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKP  454

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
             + NQ C+VTAQGR +R     I++ + +  A+P        NK +LGRPWKE+S+T+IM 
Sbjct  455   LENQNCIVTAQGRMERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIME  514

Query  1781  TFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFT  1602
             + I D++ PEGW  W+G   LDT +Y EY N G GA    RVKW+G K  I    A++F 
Sbjct  515   SEIGDLIQPEGWLPWEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFM  573

Query  1601  PGPFLMADEQWLGRAQIPFSPGFL  1530
             P P L  ++ W+  + IP+ P  +
Sbjct  574   P-PILYENDDWIRDSGIPYDPALI  596



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   484 bits (1245),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/537 (45%), Positives = 346/537 (64%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIKL+F  T+++I D + K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDLK+   +   F +  I+ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ K++ ELSSN LAM T    +L +  I G+      
Sbjct  159   AFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP------ASIKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K ++ VA+DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ +PA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  512   LYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   482 bits (1241),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 246/531 (46%), Positives = 335/531 (63%), Gaps = 15/531 (3%)
 Frame = -1

Query  3110  GEISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSE  2934
             GE+ST+ KS+K  C P DY+ETCE +L   A +  +P +L K  F+ T E I  A+ +S 
Sbjct  37    GELSTSVKSIKSFCQPVDYRETCETTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESA  96

Query  2933  LLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAIT  2754
             +L +   DPRTSDAL  C+ELL  +IDDLK +F K+  F  ++ K   +D+K WLS A+T
Sbjct  97    VLNDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAVDDVKTWLSSALT  156

Query  2753  QQETCIDAFENTTG-DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
              QETC+D FEN+T  +  EKM+  LK++ EL+ N LA++  F + L +L+I G  F RRL
Sbjct  157   YQETCLDGFENSTSTEASEKMRKALKSSQELTENILAIVDQFADTLANLDITG--FSRRL  214

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVP  2403
             L  +          P ++  A RRLL   P S   K D+ VA DGSG +K++ EAL  VP
Sbjct  215   LGDD--------GVPVWMSNAKRRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVP  266

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
              K+  T V+++KAG Y E V V R +  +V +G+G TKT ITG++S    I T  TAT+ 
Sbjct  267   VKSTGTYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATME  326

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
               G+GF  R IG EN+AG+  HQAVALRV +D + F+ C  D +QDTLYTH+ RQ+YRDC
Sbjct  327   AIGNGFFMRGIGVENTAGSKNHQAVALRVQSDQSAFYECQFDGHQDTLYTHTSRQYYRDC  386

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             TI+GT+DFIFGNA VV QNC++ VR+ M NQ+ +VTAQGRK++  A   V+ +C I    
Sbjct  387   TITGTIDFIFGNAQVVLQNCRIQVRRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHE  446

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
               KA     K FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE +NRG
Sbjct  447   DFKADAAKFKTFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRG  506

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              GA   KR KW+G K     +  +++T   F+   + WL +  +PF PG L
Sbjct  507   DGADMSKRAKWRGVKTVTYQQAQQKYTVERFIQG-QTWLPKFGVPFIPGLL  556



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   481 bits (1239),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 250/532 (47%), Positives = 343/532 (64%), Gaps = 13/532 (2%)
 Frame = -1

Query  3125  SADGGGEISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAI  2946
             + D    IST+ K+++++C  T Y++TC  +L+ A ++ DP+ LI+  F + + ++ + I
Sbjct  36    TKDQTNNISTSQKAIQDLCQSTYYQQTCTETLSNATNSSDPQTLIQTIFEIAISHLNNTI  95

Query  2945  SKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLS  2766
              +S  L++   DP+TS A  TC ++L +SI DL+++  + E FD      + +D+K WL+
Sbjct  96    QQSGPLQQISNDPKTSQAYKTCTKVLDDSIQDLRKTIHRTETFDFFDFSIFIDDIKTWLT  155

Query  2765  GAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTEL-LQSLEIPGVNF  2589
             GA+T QETC+D+FE+T GD  E M+ LLK + EL++NGLA+      L L +L  P V  
Sbjct  156   GALTYQETCLDSFEDTKGDHAETMRQLLKLSRELTTNGLAIANQIHRLFLPNLLAPPVAP  215

Query  2588  KRRLLTAETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEAL  2415
              +  L A+ K        P       R+LL   +D      ++VVAKDGSG+YK+V EAL
Sbjct  216   TKHQL-ADRKPLS-----PRGDSNYYRKLLQMASDRRYDTPNVVVAKDGSGKYKTVTEAL  269

Query  2414  RAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYH  2238
             + VP +++ET VI +K GVY E VE+   M  +V VG+GPTKTRITG +S   DG+GTY 
Sbjct  270   KEVPERSNETFVIHVKEGVYEEYVEITSGMWSVVLVGDGPTKTRITGKKSYGGDGLGTYF  329

Query  2237  TATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQ  2058
             TATV I GD FI ++IGFEN+AGA  +QAVALRVSAD  IF+NCHID YQDTLY H++RQ
Sbjct  330   TATVGIDGDNFIGKDIGFENTAGAIGYQAVALRVSADKAIFYNCHIDGYQDTLYAHNHRQ  389

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
             +YRDCTISGT+DFIFGNA  + QNC ++VRKP+ NQ C+VTA GR      +A V+    
Sbjct  390   YYRDCTISGTIDFIFGNARALIQNCTLLVRKPLDNQACVVTANGRTLSNETSAFVIHGSR  449

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTM-YLDTCWYA  1701
             ++A P     +   + FLGRPWKE+S+T+ M + I+  + PEGWS W  T  +LDTCWYA
Sbjct  450   VVAAPEYPVDDKRIQSFLGRPWKEYSKTIFMASEIEGFISPEGWSPWDNTADHLDTCWYA  509

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             E  NRGPGA    RVKW G K NI+   A QF P  + M    W+    IPF
Sbjct  510   EVGNRGPGADLTNRVKWPGIK-NITMAEAAQFAPTMY-MDSGHWIEGKGIPF  559



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score =   481 bits (1239),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 249/569 (44%), Positives = 354/569 (62%), Gaps = 39/569 (7%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYK  3051
             G  +Q+K+ A+ GV+SI LVA V  ATV+  + G+             +V+ +C  T Y+
Sbjct  8     GGHDQSKRFALVGVSSILLVAMV--ATVADAQQGQ------------PNVQILCESTQYQ  53

Query  3050  ETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             +TC +SLA A  +T   K+LIK AF  T E +   I+ S L++E  +D  T  A++ C E
Sbjct  54    QTCHQSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNE  113

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L  ++D + +S   V+ FD+  I EY+ DLKVWL+G ++ Q+TC+D F NTT   GE M
Sbjct  114   VLDYAVDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETM  173

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
                L T+ +LSSN + M+    +L         N KRRLL+ +         +P +V   
Sbjct  174   ARALNTSIQLSSNAIDMVDAVYDL--------TNAKRRLLSLDN-------GYPLWVSEG  218

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              RRLL    A++K ++VVA+DGSGQ+K++ +A++ VP  N +  VI++K GVYNE V VP
Sbjct  219   QRRLLAE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVP  276

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + M  +  +G+GP KT+ TGS +  DG+  Y+TAT  + G+ F+A++I  EN+AG  KHQ
Sbjct  277   KDMAFVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQ  336

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV+AD  IF+NC ID YQ TL+  S RQFYRDC+ISGT+D I+G+A  VFQNCK+I
Sbjct  337   AVALRVTADKAIFYNCQIDGYQATLFAESQRQFYRDCSISGTIDMIYGDAFAVFQNCKLI  396

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+  Q+C V A GR     ++  V QSC    EP + A   P   +LGRPWK +S+ 
Sbjct  397   VRKPLEEQQCFVAADGRTKSDSSSGFVFQSCHFTGEPEV-AKIDPKIAYLGRPWKSYSKV  455

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + IDDI  PEG+  W G+ + DTC + EY N+GPGA T KRVKW G K +IS   A
Sbjct  456   VIMDSNIDDIFDPEGYMPWMGSAFKDTCTFYEYNNKGPGADTSKRVKWPGVK-SISSTEA  514

Query  1613  KQFTPGPFL-MAD----EQWLGRAQIPFS  1542
               F PG F  +A+    + W+ ++ +P+S
Sbjct  515   AAFYPGKFFEIANATDRDTWIVKSGVPYS  543



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score =   481 bits (1239),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 249/569 (44%), Positives = 354/569 (62%), Gaps = 39/569 (7%)
 Frame = -1

Query  3230  GSPEQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYK  3051
             G  +Q+K+ A+ GV+SI LVA V  ATV+  + G+             +V+ +C  T Y+
Sbjct  8     GGHDQSKRFALVGVSSILLVAMV--ATVADAQQGQ------------PNVQILCESTQYQ  53

Query  3050  ETCERSLAGA-KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             +TC +SLA A  +T   K+LIK AF  T E +   I+ S L++E  +D  T  A++ C E
Sbjct  54    QTCHQSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNE  113

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L  ++D + +S   V+ FD+  I EY+ DLKVWL+G ++ Q+TC+D F NTT   GE M
Sbjct  114   VLDYAVDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETM  173

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
                L T+ +LSSN + M+    +L         N KRRLL+ +         +P +V   
Sbjct  174   ARALNTSIQLSSNAIDMVDAVYDL--------TNAKRRLLSLDN-------GYPLWVSEG  218

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              RRLL    A++K ++VVA+DGSGQ+K++ +A++ VP  N +  VI++K GVYNE V VP
Sbjct  219   QRRLLAE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVP  276

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + M  +  +G+GP KT+ TGS +  DG+  Y+TAT  + G+ F+A++I  EN+AG  KHQ
Sbjct  277   KDMAFVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQ  336

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV+AD  IF+NC ID YQ TL+  S RQFYRDC+ISGT+D I+G+A  VFQNCK+I
Sbjct  337   AVALRVTADKAIFYNCQIDGYQATLFAESQRQFYRDCSISGTIDMIYGDAFAVFQNCKLI  396

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+  Q+C V A GR     ++  V QSC    EP + A   P   +LGRPWK +S+ 
Sbjct  397   VRKPLEEQQCFVAADGRTKSDSSSGFVFQSCHFTGEPEV-AKIDPKIAYLGRPWKSYSKV  455

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + IDDI  PEG+  W G+ + DTC + EY N+GPGA T KRVKW G K +IS   A
Sbjct  456   VIMDSNIDDIFDPEGYMPWMGSAFKDTCTFYEYNNKGPGADTSKRVKWPGVK-SISSTEA  514

Query  1613  KQFTPGPFL-MAD----EQWLGRAQIPFS  1542
               F PG F  +A+    + W+ ++ +P+S
Sbjct  515   AAFYPGKFFEIANATDRDTWIVKSGVPYS  543



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   477 bits (1228),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 251/573 (44%), Positives = 357/573 (62%), Gaps = 24/573 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + G  S  LV  VV+  V   +    AD   +I   +K+V+ +CAPTD+KETC
Sbjct  6     DKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKADEN-QIKKTTKAVQAVCAPTDFKETC  64

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
               SL  A   + +P +LIKL F VT+++I + + K+  ++  +A KDP    A + C+++
Sbjct  65    VNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKAKASKDPEAKGAFELCEKV  124

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             + ++I+DLK+       F +  I  +  DL VWLSG+I  Q+TC+D+FE    D  ++M+
Sbjct  125   MVDAIEDLKKCMD--HGFSVDKIDSFVEDLLVWLSGSIAFQQTCMDSFEEIKSDLMQEMR  182

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPG-----VNFKRRLLTAETKGeeqeeEFPGF  2526
             H+ KT  ELSSN LAM+T  + LL +    G      N+ R+LL+AE       +  P +
Sbjct  183   HIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLSAE-------DGIPTW  235

Query  2525  VDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
             V    RRL+      P  +K + VVA+DGSGQ+K++ EAL AVP  N    VI IK G+Y
Sbjct  236   VGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVPKGNTVPYVIHIKQGIY  295

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFEN  2178
              E+V V RKM  + F+G+G TKT ITG+ +   G + T+ TA + I+GD F  +NIG EN
Sbjct  296   KEKVMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPLTIEGDHFTMKNIGVEN  355

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             +AG    QAVALRVSAD  +FH+C  D +QDTLY HS+R F+R+CT+SGTVDFIFG+A  
Sbjct  356   TAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRECTVSGTVDFIFGDAKC  415

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I  +PA       +K +LGR
Sbjct  416   ILQNCKIVVRKPKKGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGR  475

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK+FSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW G  
Sbjct  476   PWKQFSRTIIMKTMIDDVIDPAGWLAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWPGI-  534

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             R ++P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  535   RKLTPQDALLYTGDRFLGGN-TWIPQTQVPYTP  566



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   476 bits (1225),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/529 (45%), Positives = 326/529 (62%), Gaps = 14/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKLAFRVTVENITDAISKSEL  2931
             E++T+ KS+K  C P DYK  CE++L   A +     EL K  F+ T E I  A+ +S L
Sbjct  37    ELTTSLKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVRESSL  96

Query  2930  LKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQ  2751
             L +   DPRTS AL  CKELLH +IDDLK +F ++  F+M + K   +DLK WLS A+T 
Sbjct  97    LNDLKHDPRTSGALKNCKELLHYAIDDLKTTFDQLGGFEMTNFKHAMDDLKTWLSSALTY  156

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QE+C+D F+NTT +   KM+  L  + EL+ N L+++  F + + +L++    F RRLL 
Sbjct  157   QESCLDGFDNTTTNAAAKMRKALNVSQELTENILSIVDEFGDTIANLDLS--IFSRRLLG  214

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +          P ++  A RRLL   P+    K D+ VA DGSG + ++ EAL  VP K
Sbjct  215   HDGA--------PRWMSDAKRRLLEVSPSEPDFKPDVTVAADGSGDFTTINEALAKVPLK  266

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T V+++K G Y E V VPR ++ +V +G+G  KT ITG +S    I T  TAT+   
Sbjct  267   REDTYVMYVKEGTYKEYVSVPRNVSNLVMIGDGADKTVITGEKSFMMNITTKDTATMEAI  326

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF  R I  EN+AGA  HQAVALRV +D ++F+ C    YQDTLYTH+ RQ+YRDCT+
Sbjct  327   GNGFFMRGITVENTAGAKNHQAVALRVQSDQSVFYECQFHGYQDTLYTHTSRQYYRDCTV  386

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DFIFGNA VVFQNC + VRK M NQ+ ++TAQGRK+R  A  IV+ +C I   P  
Sbjct  387   SGTIDFIFGNAQVVFQNCLIQVRKCMENQQNIITAQGRKERHSAGGIVIHNCTIEPHPEF  446

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
             K      + FLGRPWKE SRTL + + I D V PEGW  W G   L+TC+YAE +NRGPG
Sbjct  447   KDHMGRLRTFLGRPWKEHSRTLYIQSEIGDFVDPEGWLPWLGEFGLNTCYYAEVENRGPG  506

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    R  WKG K     +  +++T   F+   + W+ +  +PF PG L
Sbjct  507   ADMSNRATWKGVKHITYQQAEEKYTVERFIQG-QLWISKYGVPFIPGLL  554



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   476 bits (1225),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/537 (45%), Positives = 343/537 (64%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIKL+F  T+++I D + K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDLK+   +   F +  I+ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ KT+ ELSSN LAM T    +L +    G+      
Sbjct  159   AFQQTCIDTFEEIKSNLMRDMLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS------IKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K + VV +DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGPKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNCK++VRK    Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKAKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ EPA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N G G++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P++
Sbjct  512   LYYAEHLNAGAGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYT  566



>ref|XP_007138937.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
 gb|ESW10931.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
Length=573

 Score =   476 bits (1224),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 245/570 (43%), Positives = 363/570 (64%), Gaps = 17/570 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASK-SVKEICAPTDYKET  3045
             +Q ++ A+ GV+SI LVA V A  V++ +  E AD    I+++ + SV+ +C  T+Y +T
Sbjct  9     DQQRRFAILGVSSILLVAVVAAVAVTLNQGEEPADDAAHITSSQRTSVEILCHSTEYAKT  68

Query  3044  CERSLAGAKDTD-DPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
             C++SLA   D + D + L+K A   T   +   I  S L ++  KD  T  A++ CKE+ 
Sbjct  69    CKKSLAKVPDRNADTRALVKAAINATAVELLSHIKNSTLYRDLGKDNMTRQAVEICKEVF  128

Query  2867  HNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               +I  +++S   ++ F+   + EY  DLKVW+SG++T Q TC+  FE+T    G KM  
Sbjct  129   EYAIHGIQKSVDTIDKFEYGKLSEYIYDLKVWISGSLTHQYTCLYGFEHTDTKAGAKMNK  188

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
             +L T+ EL+SN L MI   + +L+ L +      RRLL+ +   +   +++P +V    R
Sbjct  189   VLNTSLELTSNALDMIDVISGILKDLNMTSFG-NRRLLSQD---KVPLDDYPSWVSEGKR  244

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             RLL+    S K  +VVA+DGSGQ+K++ EAL+ VP  N E  VI++KAGVY E V++   
Sbjct  245   RLLSQGTESAK--VVVAQDGSGQFKTIKEALKTVPPNNAEPYVIYVKAGVYKENVDMSML  302

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
             M  +  +G+GPTKTR +GS +  DG+ TY TAT A+    F+A+N+GFEN+AG+ KHQAV
Sbjct  303   MTHVTIIGDGPTKTRFSGSLNYDDGVQTYKTATFAVNAANFMAKNVGFENTAGSKKHQAV  362

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRV+AD  +F NCH+D +QDTLY  S RQFYRDC ++GTVDF+FG+A  +FQ CK+IVR
Sbjct  363   ALRVTADQAVFVNCHMDGFQDTLYAQSQRQFYRDCIVTGTVDFVFGDAVGMFQKCKLIVR  422

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV-FLGRPWKEFSRTL  1791
             KP+  Q+CMVTA GR      +A+V Q C    +P L++    +KV +LGRPW+ FS+ +
Sbjct  423   KPLNKQKCMVTAGGRVKSDSPSALVFQGCHFTGDPELRSL--ADKVAYLGRPWRAFSKVI  480

Query  1790  IMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM + ID+I +PEG+  W G  ++DTC Y EY N+GP A T  RVKW G+K  ++ + A 
Sbjct  481   IMESQIDNIFLPEGYMGWMGISFMDTCTYYEYNNKGPDADTSSRVKWPGFKV-LTAQEAS  539

Query  1610  QFTPGPFL---MADEQ--WLGRAQIPFSPG  1536
              + P  F     +DE+  W+ R+++P+S G
Sbjct  540   DYYPSKFFELANSDERDDWIVRSKVPYSLG  569



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   474 bits (1220),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 252/572 (44%), Positives = 358/572 (63%), Gaps = 27/572 (5%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + GV S  LV  VV+  +   ++  + +   EI   +K+VK +CAPTDYKETC
Sbjct  6     DKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNEN---EIRQNTKAVKTVCAPTDYKETC  62

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
              +SL  A   + +P  LIKL+F VT+++I + + K+  ++  +ADK P   DA + C+++
Sbjct  63    LKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKV  122

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             ++++I DLK+      + D   I+ +  DL+VW+SG+I  Q+TCID FE         M 
Sbjct  123   MNDAIADLKKCVDHKVSVD--EIERFIKDLRVWISGSIAFQQTCIDTFEEIKSTLKHDMI  180

Query  2690  HLLKTANELSSNGLAMITHF----TELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             ++ K + +LSSN LAM+T      TEL  + E    N  R+LL+ E       +  P +V
Sbjct  181   NIFKRSRQLSSNSLAMVTDLNSNATELTGAFE----NNARKLLSTE-------DGVPTWV  229

Query  2522  DAATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
                 RRL+       +K + VVA+DGSGQ+K++ +AL AVP +N    VI IK GVY E+
Sbjct  230   GPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEK  289

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAG  2169
             V V RKM  + F+G+GPTKT I+GS +   G + TY TA + ++G+ F A+ IG EN+AG
Sbjct  290   VVVTRKMPYVTFIGDGPTKTVISGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAG  349

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
                 QAVALRVS D  +F +C ID YQDTLY HS RQFYRDCT+SGTVDFIFG++  + Q
Sbjct  350   PEGGQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQ  409

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKPMA Q CMVTAQGR D R    IV+ +C I+ +PA       +K +LGRPWK
Sbjct  410   NCKIVVRKPMAGQSCMVTAQGRSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWK  469

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+++ T +DD++ P GW  W G   L T +YAE+ N GPGA+  +RVKW G K+ +
Sbjct  470   EFSRTIVIKTTVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-L  528

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             + E A  +T   FL  +  W+ R Q+P++ G 
Sbjct  529   THEQALSYTCDRFLSGN-TWIPRTQVPYTAGM  559



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   474 bits (1220),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 248/570 (44%), Positives = 354/570 (62%), Gaps = 22/570 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + G  S  LV  VV+  V   +    AD   +I   +K+V+ +C PTD+KETC
Sbjct  6     DKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKADEN-QIKKTTKAVQAVCEPTDFKETC  64

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
               SL  A   + +P +LIKL F VT+++I + + K+  ++  +A KDP    A + C+++
Sbjct  65    VNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASEDVKAKASKDPEAKGAFELCEKV  124

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             + ++I+DLK+       F +  I  +  DL+VWLSG+I  Q+TC+D+FE    D  ++M+
Sbjct  125   MVDAIEDLKKCMD--HGFSVDKIDAFVEDLRVWLSGSIAFQQTCMDSFEEIKSDLMQEMR  182

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPG-----VNFKRRLLTAETKGeeqeeEFPGF  2526
             H+ KT  ELSSN LAM+T  + LL +    G      N+ R+LLT E       +  P +
Sbjct  183   HIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFANYARKLLTTE-------DGIPTW  235

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             V    RRL+   P  +K + VVA+DGSGQ+K++ +AL AVP  N    VI IK G+Y E+
Sbjct  236   VGREARRLMAA-PGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIYKEK  294

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAG  2169
             + V RKM  + F+G+G TKT ITG+ +   G + T+ TA + I+GD F  +NIG EN+AG
Sbjct  295   IMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPLTIEGDHFTMKNIGVENTAG  354

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
                 QAVALRVSAD  +FH+C  D +QDTLY HS+R F+RDCT+SGTVDFIFG+A  + Q
Sbjct  355   PEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQ  414

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP   Q CMVTAQGR D R +  +VL +C I  +PA       +K +LGRPWK
Sbjct  415   NCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWK  474

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             +FSRT++M T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW G  R +
Sbjct  475   QFSRTIVMKTMIDDVIDPAGWLAWSGDFALKTLYYAEHLNTGPGSNQAQRVKWPGI-RKL  533

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             +P+ A  +T   FL     W+   Q+P++P
Sbjct  534   TPQDALLYTGDRFL-GGNTWIPPTQVPYTP  562



>gb|KHN03341.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=554

 Score =   473 bits (1217),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/568 (43%), Positives = 347/568 (61%), Gaps = 40/568 (7%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ +K+A+  V+S+ L                  +GG  I  + ++V+ IC   +YKETC
Sbjct  11    KKKRKLAILSVSSLLL------------------EGGDSIVKSQRNVQVICESAEYKETC  52

Query  3041  ERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHN  2862
              +SLA A +T D KELI  AF  T E I   I  S L  E   D     A+D CKE+L  
Sbjct  53    HKSLAKASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMNKQAMDICKEVLGY  112

Query  2861  SIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             ++DD+ +S +K+E F++  + +Y  DLKVW++G +  Q+TC+D FENTT + G+ M  +L
Sbjct  113   AVDDMHQSVRKLEEFELNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTTNEAGKTMARVL  172

Query  2681  KTANELSSNGLAMITHFTELLQSLEIPGVNFKR-RLLTAETKGeeqeeEFPGFVDAATRR  2505
              T+ ELS+N L ++   + L + L +   +    R L +E  G      FP +V    RR
Sbjct  173   NTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLSEVDG------FPTWVSEGQRR  226

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             LL    A  K D+VVA+DGSGQ K++ EAL+ VP KN +  VI++KAGVY E + + + +
Sbjct  227   LL--QAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYVKAGVYQEYIMINKHL  284

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
               +  +G+GPTKTRITGS++  +G          +    F+A NIGFEN+AGA KHQAVA
Sbjct  285   THVTMIGDGPTKTRITGSKNYING------GLAGVNAANFMAMNIGFENTAGAEKHQAVA  338

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRV+AD  +F+NC++D +QDTLYT S RQFYRDCT++GT+DF+FG+A  VFQNCK IVRK
Sbjct  339   LRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFIVRK  398

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM NQ+CMVTA GR      +A+V QSC    EP + A + P   +LGRPW+ +++ +IM
Sbjct  399   PMENQQCMVTAGGRTKIDSPSALVFQSCIFTGEPDVFALS-PKIAYLGRPWRVYAKVVIM  457

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + IDDI VPEG+  W G+ + DT  Y E+ NRG GA+T  R+ W G+K  I+P  A  +
Sbjct  458   DSQIDDIFVPEGYMPWMGSAFKDTSTYYEFNNRGFGANTQGRITWPGFKV-ITPIEATDY  516

Query  1604  TPGPFL-----MADEQWLGRAQIPFSPG  1536
              PG F         + W+  + +P+S G
Sbjct  517   YPGKFFEIANSTERDSWIVGSGVPYSLG  544



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   473 bits (1216),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 246/569 (43%), Positives = 362/569 (64%), Gaps = 33/569 (6%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGES---ADGGGEISTASKSVKEICAPTDYKETC  3042
             +++AV GV++IFLVA VVA   SV  + +S   +     + ++ K+V+ +C PT Y++ C
Sbjct  10    RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  3041  ERSL-AGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLH  2865
             E+SL   A +T D +ELIK+ F +T++ I     K + +  A+++PR   AL TCK+L++
Sbjct  70    EKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLMN  129

Query  2864  NSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              S+ + KR+ +K+  FD+ ++      LKVWLSGAIT QETC+D F NTT   G +M++L
Sbjct  130   LSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGNRMRNL  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV------  2523
             L T   +SSN LA+IT     +   E+  VN KR+L+  +     Q+E     +      
Sbjct  190   LTTTMHMSSNALAIITALANTVS--ELSDVN-KRQLVEDDEHVFGQDEVISSLIFDDDDD  246

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL  +P  +K + +VAKDGS ++KS+ +AL+ VP KN +  VI+I+ GVYNE +
Sbjct  247   GGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVYNEYI  306

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV + M ++VFVG+G  KTRITG+R+  DG+ TY TA+V            GFENSAG  
Sbjct  307   EVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASV------------GFENSAGPH  354

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV AD +IF+ C +D Y+DTLY H+ RQFYRDCTISGT DF+FG+A  VFQNC
Sbjct  355   KHQAVAIRVQADRSIFYRCSMDGYEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNC  414

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ  +VTAQGRK++   + IV+Q   I++   +K      K +L RP K +
Sbjct  415   TFVVRKPLENQPLIVTAQGRKEKHQPSGIVIQGSSIVSNHRMKF---DKKAYLARPLKNY  471

Query  1802  SRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+ M T+++  + P+G+  W   QG   ++TC+YAEY N GPG++  KRVKW G K+ 
Sbjct  472   SRTIFMNTYMEGFIEPDGYVPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIKK-  530

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++ + A +++P  F   D+ W+   +IP+
Sbjct  531   LNSKSASEYSPLNFFHGDD-WVKITRIPY  558



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   470 bits (1209),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 248/572 (43%), Positives = 358/572 (63%), Gaps = 24/572 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             ++ KK  + G  S  LV  VV+  V   +    A+   +I   +K+V+ +CAPTD+KETC
Sbjct  6     DKKKKCIIAGSVSGLLVIMVVSVAVVTSKHSPKAEEN-QIKKTTKAVQAVCAPTDFKETC  64

Query  3041  ERSLAGAK-DTDDPKELIKLAFRVTVENITDAISKS--ELLKEADKDPRTSDALDTCKEL  2871
               SL  A   + +P +LIKL F VT+++I + + K+  ++  +A KDP    A + C++L
Sbjct  65    VNSLMSASPKSAEPLDLIKLGFDVTIKSINEGLKKASGDIKAKAGKDPDAKGAFELCEKL  124

Query  2870  LHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             + ++I+DLK+       F +  ++ +  DL+VWLSG+I  Q+TC+D+FE    +  + M+
Sbjct  125   MVDAIEDLKKCMD--HGFSVDRVEVFVEDLRVWLSGSIAFQQTCMDSFEEIKSNLMQDMQ  182

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLLTAETKGeeqeeEFPGF  2526
             ++ +T+ ELSSN LAM++  + L  S    G+     N+ R+LL+AE       +  P +
Sbjct  183   NIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTLTNYARKLLSAE-------DGIPTW  235

Query  2525  VDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
             V    RRLL      P  +K + VVA+DGSGQ+K++ +AL AVP  N    VI IK G+Y
Sbjct  236   VRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVPKGNTVPFVIHIKQGIY  295

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFEN  2178
              E+V V RKM  + F+G+GP KT ITGS +   G + T+ T ++ I+GD F A+NIG EN
Sbjct  296   KEKVIVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTGSITIEGDHFTAKNIGIEN  355

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             +AG    QAVALRVSAD   F +C ID +QDTLY HS+RQFYRDCT+SGTVDFIFG+A  
Sbjct  356   TAGPEGGQAVALRVSADYAAFQSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKC  415

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             + QNCK++VRKP   Q CMVTAQGR + R +  +VL +C I  + A       +K +LGR
Sbjct  416   ILQNCKIVVRKPKKGQSCMVTAQGRSNVRESTGLVLHNCHITGDSAYIPVKSESKAYLGR  475

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWKEFSRT++M T IDD++ P GW  W G   L T +YAE+ N GPG++   RVKW G K
Sbjct  476   PWKEFSRTIVMKTAIDDVIDPAGWLPWSGDFALKTLYYAEHLNTGPGSNQAHRVKWPGIK  535

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + ++P+ A  +T   FL   E W+ + Q+P++
Sbjct  536   K-LTPQDALLYTGDKFL-GGETWIPQTQVPYT  565



>ref|XP_002528621.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33779.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=568

 Score =   469 bits (1207),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 241/536 (45%), Positives = 336/536 (63%), Gaps = 21/536 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKLAFRVTVENITDAISKSELL  2928
             ++ST++KSV +IC PTDYKE CE+SL   KDT DPKE +K A   TVE  T + + S  L
Sbjct  41    QVSTSTKSVAQICQPTDYKEACEKSLNSVKDTKDPKEYVKAAILATVEAATKSFNLSSNL  100

Query  2927  ----KEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGA  2760
                 K AD D R S  L+ CK+LL +++ +L+ SF  V    +  + +   +L+ WLS  
Sbjct  101   IVDAKNADNDTRMS--LEDCKDLLQDAVQELQASFSTVGESTVNTMDQRIAELQNWLSAV  158

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI-------P  2601
             ++ Q+TC++ F +   +   +M+  +  A +L+SN LA+I   +++L + ++        
Sbjct  159   VSYQDTCLEQFGDPNSNYKSQMQDGMVDATQLTSNALAIINALSQMLSTFDLKFDLTSES  218

Query  2600  GVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVE  2421
             G N  R+LL+ +  G       P + D A RRL+  D ++IK +I VA+DGSG  K+V E
Sbjct  219   GDN-SRKLLSVDETG------VPIWFDGAKRRLMAADTSAIKPNITVAQDGSGDVKTVTE  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             A+  +P K++   +I++KAG Y E   V +KM  +   G+GP KT ITGS SN  G  T 
Sbjct  272   AIAKIPLKSENPFIIYVKAGTYKEYPIVEKKMLNVFMYGDGPKKTIITGSHSNHTGWKTM  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
              +AT A  G GF+A+++GFEN+AG   HQAVALRV AD   F +C+ID YQDTLYT ++R
Sbjct  332   RSATFAALGPGFMAKSMGFENTAGPEGHQAVALRVQADRAAFFDCNIDGYQDTLYTQAHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFY  C+ISGT+DFIFG+A VV QN K++VRKPM NQ   VTA GR  +     ++LQ+C
Sbjct  392   QFYYGCSISGTIDFIFGDASVVIQNSKIVVRKPMKNQGNTVTAHGRTMKHETTGLILQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
             +I+AE  L       K +LGRPWK +SRT++M + I D++ PEGW  W G +YLDT  YA
Sbjct  452   QIIAEDLLFPERTVVKSYLGRPWKAYSRTIVMESEITDVIQPEGWLPWNGDLYLDTLDYA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY N G  ++TDKRVKWKG+    S + A+QFT GPF+   E WL    IPF  GF
Sbjct  512   EYANTGAASATDKRVKWKGFHVITSKKEAEQFTVGPFIQGGE-WLNGTGIPFKLGF  566



>gb|KHN20255.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=475

 Score =   464 bits (1195),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 233/479 (49%), Positives = 320/479 (67%), Gaps = 17/479 (4%)
 Frame = -1

Query  2930  LKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQ  2751
             + + + DP +  ALDTCK+L+  SID+ KRS +++  FD+ ++    N L+VWLSGAIT 
Sbjct  1     MHKVENDPISKMALDTCKQLMDLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITY  60

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NTT + G KMK+LL ++  +SSN LA+I+   +++  + +       R L 
Sbjct  61    QDTCLDGFKNTTNEAGNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDG--HRELV  118

Query  2570  AETKGeeqe----eEFPGFVD---AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
              +++G E      E  P +V+      RRLL   P  +K ++VVAKDGSG+YKS+ +AL+
Sbjct  119   EDSRGGEHVFGHEEVIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALK  178

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
              VP +N +  VI+IK GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA
Sbjct  179   KVPARNQKPFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTA  238

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             +VAI GD FIA NIGFENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFY
Sbjct  239   SVAILGDYFIAINIGFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFY  298

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCTISGT+DF+FG+A VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I+
Sbjct  299   RDCTISGTIDFVFGDAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIV  358

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYA  1701
             +    K     NKV+L RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YA
Sbjct  359   SNHTEKF---DNKVYLARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYA  415

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             EY N GPG++  KRVKW+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  416   EYNNTGPGSNKSKRVKWRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  472



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score =   459 bits (1182),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 302/434 (70%), Gaps = 22/434 (5%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVS-VGRSGESADGGGEISTASKSVKEICAPTDYKETCER  3036
             KK+ + G+ASI LVACVV   V+   ++ +S   GGEIS++SKSV+ +C PT YKE CE+
Sbjct  7     KKIVIAGIASILLVACVVGVAVTFTKKNDDSTSNGGEISSSSKSVQAMCQPTQYKEACEK  66

Query  3035  SLAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             SL  AK+T DPKELIK AF  T+  I+++I  S   KEA  DPRT +AL  C E+L  SI
Sbjct  67    SLGSAKNTSDPKELIKTAFDNTMTEISNSIKNSAPFKEAANDPRTKNALKVCDEVLDRSI  126

Query  2855  DDLKRSFQKVENFDMAH-IKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             ++ KRSF ++++ D+   IKEY  D++ WLS A+T +ETCIDAF NTTGDTGEKMK +LK
Sbjct  127   EEFKRSFSQIDSNDLNKLIKEYIYDVRSWLSSAVTFEETCIDAFANTTGDTGEKMKSILK  186

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             TA+ELSS  L +++ F E +  L+  G+   RRLL AE               A  RRLL
Sbjct  187   TASELSSVALDIVSSFEEQMAGLQGLGIA-NRRLLVAE---------------AGNRRLL  230

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 A++K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VIFIKAG+YNE VEV   M  
Sbjct  231   QI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENVEVANTMTN  288

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +VF+GEG  KT+ITG+++  DG+  + TATV+I G GF+A++IGFENSAG  K +AVALR
Sbjct  289   VVFIGEGSNKTKITGNKNYLDGLPIFLTATVSISGQGFMAKDIGFENSAGPLKKEAVALR  348

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP-  1962
             VSA+M +F NC ID YQ TL  H  RQFYRDCTISGT+DFIFG+A  VFQNCK+I RKP 
Sbjct  349   VSAEMIVFQNCQIDGYQSTLMAHVGRQFYRDCTISGTIDFIFGDAVAVFQNCKIIARKPE  408

Query  1961  -MANQECMVTAQGR  1923
              M  Q   + AQGR
Sbjct  409   EMQTQAITIAAQGR  422



>gb|KEH37213.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=565

 Score =   464 bits (1194),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 240/564 (43%), Positives = 342/564 (61%), Gaps = 19/564 (3%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KK A+ GV+ I LVA V    VS+ + G+  +    IS + K+V  +C  T +KETC ++
Sbjct  14    KKHALLGVSCILLVAMVGVVAVSLTKGGD-GEQKAHISNSQKNVDMLCQSTKFKETCHKT  72

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L  A  ++  K  IK A   T E +   I+ S L +E   D  T  A++ C E+L  ++D
Sbjct  73    LEKASFSN-MKNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAVD  131

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
              + +S   ++ FD   + EY  D+KVWL+G ++ Q+TC+D F NT    GE M  +LKT+
Sbjct  132   GIHKSVGTLDQFDFHKLSEYAFDIKVWLTGTLSHQQTCLDGFVNTKTKAGETMTKVLKTS  191

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              ELSSN + M+   + +++          RRLL+ +          P +V    R LL  
Sbjct  192   MELSSNAIDMMDVVSHIIKGFNPSQYGVSRRLLSDD--------GIPSWVSDGHRHLLA-  242

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
                ++K + VVA+DGSGQ+K++ +AL+ VP  N    VI++KAGVY E V V ++MN + 
Sbjct  243   -GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAKEMNYVT  301

Query  2312  FVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVS  2133
              +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG  K+QAVALRV+
Sbjct  302   VIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTNKNQAVALRVT  361

Query  2132  ADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMAN  1953
             AD  IFHNC +D +QDTLY  S RQFYRDC ISGT+DF+FG+A  VFQNCK+I R P   
Sbjct  362   ADQAIFHNCQMDGFQDTLYVQSQRQFYRDCAISGTIDFVFGDAFGVFQNCKLICRVPAKG  421

Query  1952  QECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFI  1773
             Q+C+VTA GR  +  A+A+V  S     EPAL +  P    +LGRPWK +S+ +IM + I
Sbjct  422   QKCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWKLYSKVVIMDSTI  480

Query  1772  DDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGP  1593
             D +  PEG+    G  + DTC + EY N+GPGA T+ RVKW G K  ++  VA ++ PG 
Sbjct  481   DAMFAPEGYMPMVGGAFKDTCTFYEYNNKGPGADTNLRVKWHGVKV-LTSNVAAEYYPGK  539

Query  1592  FL-----MADEQWLGRAQIPFSPG  1536
             F       A + W+ ++ +P+S G
Sbjct  540   FFEIVNATARDTWIVKSGVPYSLG  563



>emb|CAB65291.1| pectin methyl-esterase PEF1 [Medicago truncatula]
Length=565

 Score =   463 bits (1191),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 240/564 (43%), Positives = 342/564 (61%), Gaps = 19/564 (3%)
 Frame = -1

Query  3212  KKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERS  3033
             KK A+ GV+ I LVA V    VS+ + G+  +    IS + K+V  +C  T +KETC ++
Sbjct  14    KKHALLGVSCILLVAMVGVVAVSLTKGGD-GEQKAHISNSQKNVDMLCQSTKFKETCHKT  72

Query  3032  LAGAKDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSID  2853
             L  A  ++  K  IK A   T E +   I+ S L +E   D  T  A++ C E+L  ++D
Sbjct  73    LEKASFSN-MKNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAVD  131

Query  2852  DLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
              + +S   ++ FD   + EY  D+KVWL+G ++ Q+TC+D F NT    GE M  +LKT+
Sbjct  132   GIHKSVGTLDQFDFHKLSEYAFDIKVWLTGTLSHQQTCLDGFVNTKTHAGETMAKVLKTS  191

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              ELSSN + M+   + +L+          RRLL+ +          P +V    R LL  
Sbjct  192   MELSSNAIDMMDVVSRILKGFHPSQYGVSRRLLSDD--------GIPSWVSDGHRHLLA-  242

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
                ++K + VVA+DGSGQ+K++ +AL+ VP  N    VI++KAGVY E V V ++MN + 
Sbjct  243   -GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAKEMNYVT  301

Query  2312  FVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVS  2133
              +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG +K QAVALRV+
Sbjct  302   VIGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTSKFQAVALRVT  361

Query  2132  ADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMAN  1953
             AD  IFHNC +D +QDTL+  S RQFYRDC ISGT+DF+FG+A  VFQNCK+I R P   
Sbjct  362   ADQAIFHNCQMDGFQDTLFVESQRQFYRDCAISGTIDFVFGDAFGVFQNCKLICRVPAKG  421

Query  1952  QECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFI  1773
             Q+C+VTA GR  +  A+A+V  S     EPAL +  P    +LGRPWK +S+ +IM + I
Sbjct  422   QKCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWKLYSKVVIMDSTI  480

Query  1772  DDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGP  1593
             D +  PEG+    G  + DTC + EY N+GPGA T+ RVKW G K  ++  VA ++ PG 
Sbjct  481   DAMFAPEGYMPMVGGAFKDTCTFYEYNNKGPGADTNLRVKWHGVKV-LTSNVAAEYYPGK  539

Query  1592  FL-----MADEQWLGRAQIPFSPG  1536
             F       A + W+ ++ +P+S G
Sbjct  540   FFEIVNATARDTWIVKSGVPYSLG  563



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   458 bits (1179),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 309/458 (67%), Gaps = 18/458 (4%)
 Frame = -1

Query  2894  ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             AL+TCK+L+  SI +L RS   +  F++ ++ +   +LKVWLSGA+T Q+TC+D FENTT
Sbjct  2     ALETCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTT  61

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEF  2535
              D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E 
Sbjct  62    SDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSEL  112

Query  2534  PGFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAG  2361
             P +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK G
Sbjct  113   PSWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEG  170

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFE
Sbjct  171   VYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFE  230

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  231   NSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNAL  290

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L 
Sbjct  291   AVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLA  350

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKW  1650
             RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW
Sbjct  351   RPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKW  410

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  411   AGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  446



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   462 bits (1189),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 251/574 (44%), Positives = 354/574 (62%), Gaps = 21/574 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             E+  K+ V GV+ I +V  V+     V     + D   ++ST+SK+V  IC PTDYKE C
Sbjct  2     EKRGKLVVGGVSIILIVGVVIGLVAVVCTKKSNKD---QLSTSSKAVAAICDPTDYKEAC  58

Query  3041  ERSLAGA--KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD--ALDTCKE  2874
               SL      D+  PK+LI+ A   T++ +  AI  S  + ++ K   ++   A+D CK+
Sbjct  59    IDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSSSIAKSFKAINSTGKMAMDDCKD  118

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL ++I DL+ SF  V + +M  + +   +L+ W S  I+ Q++C+D       +  + M
Sbjct  119   LLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVISFQQSCLDGLPQE--ELQKLM  176

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIP------GVNFKRRLLTAETKGeeqeeEFP  2532
             K  L  A +L+SN LA+ +   ++L++  I         +  RRLL  E  G +Q   +P
Sbjct  177   KDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQENDGHDQ---YP  233

Query  2531  GFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
              +  AA RRLL   D   +K + VVAKDGSGQ+K++  AL A P       +I++KAGVY
Sbjct  234   SWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVY  293

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V V +    +   G+GP  T +TGS+S  DGI T +TAT A  G+GF+A+ +GF+N+
Sbjct  294   NEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQNTATFAAIGNGFLAKGMGFQNT  353

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++RQFYR+C ISGTVDFIFG++P +
Sbjct  354   AGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTL  413

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
              QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E  L         +LGRP
Sbjct  414   IQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRP  473

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK ++RT+IM + + D + P GW  W G   LDT +YAEY NRGPGA+T++RV+WKGY  
Sbjct  474   WKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV  533

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  534   -INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   461 bits (1185),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 250/574 (44%), Positives = 354/574 (62%), Gaps = 21/574 (4%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             E+  K+ V GV+ I +V  V+     V     + D   ++ST+SK+V  IC PTDYKE C
Sbjct  2     EKRGKLVVGGVSIILIVGVVIGLVAVVCTKKSNKD---QLSTSSKAVAAICDPTDYKEAC  58

Query  3041  ERSLAGA--KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD--ALDTCKE  2874
               SL      D+  PK+LI+ A   T++ +  AI  S  + ++ K   ++   A+D CK+
Sbjct  59    IDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSSSIAKSFKAINSTGKMAMDDCKD  118

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL ++I DL+ SF  V + +M  + +   +L+ W S  I+ Q++C+D       +  + M
Sbjct  119   LLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVISFQQSCLDGIPQE--ELQKLM  176

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIP------GVNFKRRLLTAETKGeeqeeEFP  2532
             K  L  A +L+SN LA+ +   ++L++  I         +  RRLL  E  G +Q   +P
Sbjct  177   KDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTSSSRRLLEQENDGHDQ---YP  233

Query  2531  GFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
              +  AA RRLL   D   +K + VVAKDGSGQ+K++  AL A P       +I++KAGVY
Sbjct  234   SWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVY  293

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V V +    +   G+GP  T +TGS+S  DGI T +TAT +  G+GF+A+ +GF+N+
Sbjct  294   NEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQNTATFSAIGNGFLAKGMGFQNT  353

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++RQFYR+C ISGTVDFIFG++P +
Sbjct  354   AGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTL  413

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
              QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E  L         +LGRP
Sbjct  414   IQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRP  473

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK ++RT+IM + + D + P GW  W G   LDT +YAEY NRGPGA+T++RV+WKGY  
Sbjct  474   WKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV  533

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  534   -INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   460 bits (1184),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 252/573 (44%), Positives = 352/573 (61%), Gaps = 20/573 (3%)
 Frame = -1

Query  3221  EQNKKVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETC  3042
             E+  K+ V GV+ I +V  V+     V     + D   ++ST+SK+V  IC PTDYKE C
Sbjct  2     EKRGKLVVGGVSIILIVGVVIGLVAVVCTKKSNKD---QLSTSSKAVAAICDPTDYKEAC  58

Query  3041  ERSLAGA--KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSD--ALDTCKE  2874
               SL      D+  PK+LI+ A   T++ +  AI  S  + ++ K   ++   A+D CK+
Sbjct  59    IDSLGSVAKNDSATPKDLIQAAIDSTIKTVKSAIENSNSIAKSFKAINSTGKMAMDDCKD  118

Query  2873  LLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL ++I DL+ SF  V + +M  + +   +L+ W S  I+ Q++C+D       +  + M
Sbjct  119   LLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVISFQQSCLDGIPQE--ELQKLM  176

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKR-----RLLTAETKGeeqeeEFPG  2529
             K  L  A +L+SN LA+ T   ++L++  I      R     R+L  E  G  Q   +P 
Sbjct  177   KDSLLNATQLTSNALAIATSIAQILENFNITLNKDLRPTSSSRILEQENDGHGQ---YPS  233

Query  2528  FVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
             +  AA RRLL   D   +K + VVAKDGSGQ+K++  AL A P       +I++KAGVYN
Sbjct  234   WFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYPKGLQGRYIIYVKAGVYN  293

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E V V +    +   G+GP KT +TGS+S  DGI T +TAT A  G+GF+A+ +GF+N+A
Sbjct  294   EYVTVTKNQVNVFMYGDGPRKTMVTGSKSFADGITTQNTATFAAIGNGFLAKGMGFQNTA  353

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             GA KHQAVALRV ++M+ F NC +DAYQDTLY  ++RQFYR+C ISGTVDFIFG++P + 
Sbjct  354   GAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQFYRNCVISGTVDFIFGDSPTLI  413

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C I+ E  L         +LGRPW
Sbjct  414   QNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCRIVPEEVLFPLRFKIPSYLGRPW  473

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             K ++RT+IM + + D + P GW  W G   LDT +YAEY NRGPGA+T++RV+WKGY   
Sbjct  474   KTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAEYGNRGPGAATNQRVRWKGYHV-  532

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             I+   A QFT GPFL+AD +WL    IP+  G 
Sbjct  533   INRNDAVQFTAGPFLLAD-RWLKTTGIPYFAGL  564



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score =   460 bits (1183),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 241/553 (44%), Positives = 326/553 (59%), Gaps = 22/553 (4%)
 Frame = -1

Query  3137  RSGESADGGGEISTASKSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKLAFRVTVE  2964
             ++G      GE+ST+ KSVK  C PTDY++TCE  L  A       P +L K  F VT E
Sbjct  27    KNGGGGKEDGELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSE  86

Query  2963  NITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTND  2784
              I+ AIS+S  L+E   D RTS AL  CKELL  ++DDLK SF+K+  F+M +  +  +D
Sbjct  87    KISKAISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAVDD  146

Query  2783  LKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI  2604
             L+ WLS A+T Q TC+D F NTT D  +KMK  L ++ EL+ + LA++  F+  L SL I
Sbjct  147   LRTWLSAALTYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNI  206

Query  2603  PGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL------TTDPASIKHDIVVAKDGSG  2442
                  +RRLL  +          P ++    RR L         P   K D+ VA DGSG
Sbjct  207   G----RRRLLADD--------GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSG  254

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
               K++ EA+  VP KN E   I++KAG YNE V V R    +  +G+G  KT ITG+++ 
Sbjct  255   DVKTIGEAVAKVPPKNKERYTIYVKAGTYNEYVSVGRPATNVNMIGDGIGKTIITGNKNF  314

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
             K  + T  TAT+   G+GF  R I  EN+AG   HQAVALR  +DM +F+ C  D YQDT
Sbjct  315   KMNLTTKDTATMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDT  374

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LY H+ RQF+RDCT+SGT+DFIFGN+ VV QNC +  RKPM NQ  ++TAQGR+++R A 
Sbjct  375   LYPHAQRQFFRDCTVSGTIDFIFGNSQVVLQNCLLQPRKPMDNQVNIITAQGRREKRSAG  434

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
               V+ +C +   P L+      K +L RPWKE+SRT+ +   I  +V P GW  W G   
Sbjct  435   GTVIHNCTVAPHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIGAVVDPVGWLEWNGNFA  494

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             LDT +YAE  N GPGA   KR KWKG +     +V K+FT   F+   E ++ +  +P+ 
Sbjct  495   LDTLYYAEVDNHGPGADMSKRAKWKGVQSLTYQDVQKEFTVEAFIQGQE-FIPKFGVPYI  553

Query  1541  PGFLQP*NKQAKL  1503
             PG L P  +Q ++
Sbjct  554   PGLL-PQTQQGRM  565



>ref|XP_004298254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=577

 Score =   455 bits (1170),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 245/546 (45%), Positives = 331/546 (61%), Gaps = 22/546 (4%)
 Frame = -1

Query  3116  GGGEISTASKSVKEICAPTDYKETCERSLAGA--KDTDDPKELIKLAFRVTVENITDAIS  2943
             G  ++S++SK+V  +C PTDYKE C  SLAGA    +  PK+LI+ A   TV+ +  AI 
Sbjct  34    GKDKLSSSSKAVIAMCEPTDYKEACVDSLAGAAKNQSASPKDLIRSAVEYTVQQVKAAIE  93

Query  2942  KSELLKEADKDPRTSD--ALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTNDLKVWL  2769
             KS ++ +  KD  ++   A D C ELL ++I+ L+ S   + + DM  I E   DLK W 
Sbjct  94    KSGIIIKEAKDVNSTGKMAFDDCNELLESAIESLQYSLLTLVDADMPKINEKEADLKNWF  153

Query  2768  SGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----  2601
             S A++ QE+CID       D  ++M   ++ A +L+SN LA+++  + +L +  IP    
Sbjct  154   SAAMSFQESCIDGIPYE--DLKKQMSEAMQNAEQLTSNALAIVSSLSNILGNFNIPLKPN  211

Query  2600  -GVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPA---------SIKHDIVVAKD  2451
                +  RRLL  E +  ++   FP +  AA R+L+              ++K + VVAKD
Sbjct  212   NNPSTARRLLDVEME-TDEHGTFPTWFSAADRKLIAKQNKKNNNAGNGQAVKPNAVVAKD  270

Query  2450  GSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGS  2271
             GSGQYK++  AL A P       VI++KAG+YNE V V +  N +   G+GP +T +TG 
Sbjct  271   GSGQYKTIGAALAAYPKGFQGRYVIYVKAGIYNEYVTVAKNQNNVFMYGDGPRETMVTGR  330

Query  2270  RSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAY  2091
             +S  DGI T  TAT  + G GFIAR +GF+N+AG  KHQAVALRV +DM+ F NC +D Y
Sbjct  331   KSFADGITTQDTATFIVVGHGFIARGMGFQNTAGPEKHQAVALRVQSDMSAFFNCRMDGY  390

Query  2090  QDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRR  1911
             QDTLY  +YRQFYR+C ISGTVDFIFG++  V QN  +IVRKP+ANQ+  VTA GRKD+R
Sbjct  391   QDTLYVQAYRQFYRNCVISGTVDFIFGDSTTVIQNSLIIVRKPLANQKNTVTANGRKDQR  450

Query  1910  GAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQG  1731
              +  +V+Q+C I+ E AL         +LGRPWK +SRT+IM +   D + P GW  WQG
Sbjct  451   ESTGLVIQNCRIVPEEALFPLRFQIMSYLGRPWKMYSRTVIMESEFGDFIQPAGWLEWQG  510

Query  1730  TMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQI  1551
                LDT +YAEY NRGPGA T  RVKWKG+       VA QFTPG FL A   WL     
Sbjct  511   NFALDTLYYAEYANRGPGAVTTGRVKWKGFHVITDRNVALQFTPGNFL-AGGLWLKGTGA  569

Query  1550  PFSPGF  1533
             P+  G 
Sbjct  570   PYFLGL  575



>gb|EAZ41174.1| hypothetical protein OsJ_25671 [Oryza sativa Japonica Group]
Length=570

 Score =   454 bits (1169),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 241/557 (43%), Positives = 326/557 (59%), Gaps = 26/557 (5%)
 Frame = -1

Query  3137  RSGESADGGGEISTASKSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKLAFRVTVE  2964
             ++G      GE+ST+ KSVK  C PTDY++TCE  L  A       P +L K  F VT E
Sbjct  27    KNGGGGKEDGELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSE  86

Query  2963  NITDAISKSELLKEADKDPRTSDALDTCKELLHNSIDDLKRSFQKVENFDMAHIKEYTND  2784
              I+ AIS+S  L+E   D RTS AL  CKELL  ++DDLK SF+K+  F+M +  +  +D
Sbjct  87    KISKAISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAVDD  146

Query  2783  LKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI  2604
             L+ WLS A+T Q TC+D F NTT D  +KMK  L ++ EL+ + LA++  F+  L SL I
Sbjct  147   LRTWLSAALTYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNI  206

Query  2603  PGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL------TTDPASIKHDIVVAKDGSG  2442
                  +RRLL  +          P ++    RR L         P   K D+ VA DGSG
Sbjct  207   G----RRRLLADD--------GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSG  254

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
               K++ EA+  VP KN E   I++KAG YNE V V R    +  +G+G  KT ITG+++ 
Sbjct  255   DVKTIGEAVAKVPPKNKERYTIYVKAGTYNEYVSVGRPATNVNMIGDGIGKTIITGNKNF  314

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
             K  + T  TAT+   G+GF  R I  EN+AG   HQAVALR  +DM +F+ C  D YQDT
Sbjct  315   KMNLTTKDTATMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDT  374

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAP----VVFQNCKMIVRKPMANQECMVTAQGRKDR  1914
             LY H+ RQF+RDCT+SGT+DFIFGN+     VV QNC +  RKPM NQ  ++TAQGR+++
Sbjct  375   LYPHAQRQFFRDCTVSGTIDFIFGNSQASKIVVLQNCLLQPRKPMDNQVNIITAQGRREK  434

Query  1913  RGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ  1734
             R A   V+ +C +   P L+      K +L RPWKE+SRT+ +   I  +V P GW  W 
Sbjct  435   RSAGGTVIHNCTVAPHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIGAVVDPVGWLEWN  494

Query  1733  GTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQ  1554
             G   LDT +YAE  N GPGA   KR KWKG +     +V K+FT   F+   E ++ +  
Sbjct  495   GNFALDTLYYAEVDNHGPGADMSKRAKWKGVQSLTYQDVQKEFTVEAFIQGQE-FIPKFG  553

Query  1553  IPFSPGFLQP*NKQAKL  1503
             +P+ PG L P  +Q ++
Sbjct  554   VPYIPGLL-PQTQQGRM  569



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   453 bits (1166),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 236/566 (42%), Positives = 345/566 (61%), Gaps = 13/566 (2%)
 Frame = -1

Query  3209  KVAVTGVASIFLVACVVAATVSVGRSGESADGGGEISTASKSVKEICAPTDYKETCERSL  3030
             K+  T V+ + +V   +   VSV   G S +G  ++S+ SKSV  ICAP DYK+ C  SL
Sbjct  5     KIVATTVSVLLVVGVCIGVLVSVKGKGGSGNGD-QVSSTSKSVAAICAPADYKQACVSSL  63

Query  3029  AGA--KDTDDPKELIKLAFRVTVENITDAISKSELLKEADKDPRTSDALDTCKELLHNSI  2856
             +     ++  PKELI+ A   T+E +  A++KS  + ++  +     A++ C++LL  ++
Sbjct  64    SAVAKNESASPKELIQAAIAATLEEVKAALNKSGSIGKSATNSSQKMAVEDCQDLLKFAV  123

Query  2855  DDLKRSFQKVENFDMAHIKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             D+L+ SF  V + D+  + +  ++L+ WLS  I+ Q+TC+D    T  D  ++M + +  
Sbjct  124   DELQSSFSMVGDSDLHTVNDRVSELQNWLSAVISYQQTCLDGV--TQPDLQKQMSNGMLN  181

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNF--KRRLLTAETKGeeqeeEFPGFVDAATRRL  2502
             A EL+SN LA+++  + +L S +IP  N    RRLL  E    E  +  P +     R+L
Sbjct  182   ATELTSNALAIVSAISGILTSFKIPFNNTASSRRLL--EEADAEDADGHPSWWSREDRKL  239

Query  2501  LTTDP-ASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             +       +  + VVAKDGSG Y ++  AL A P  N    VI++KAGVYNE + V +  
Sbjct  240   MARQAKGQVTPNAVVAKDGSGHYSTIAAALAAYPKNNKGRYVIYVKAGVYNEYITVTKDQ  299

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTAT--VAIQGDGFIARNIGFENSAGAAKHQA  2151
               I+  G+GP KT ITG + N+DG+ T+ +A+   A+ G+GFI +++GF+N+AG   HQA
Sbjct  300   VNILMYGDGPRKTMITGKKCNRDGVSTFRSASFFAAVIGNGFIGKSMGFQNTAGPEGHQA  359

Query  2150  VALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIV  1971
             VALRV +DM  F NC +D YQDTLY  ++RQFYR+C +SGTVDFIFG+A  V QN  ++V
Sbjct  360   VALRVQSDMAAFFNCRMDGYQDTLYVQAHRQFYRNCVVSGTVDFIFGDAAAVIQNSLIVV  419

Query  1970  RKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTL  1791
             RKPM NQ+  VTA GR D+     +V+Q+C I+ E  L         +LGRPWK++SRT+
Sbjct  420   RKPMDNQQNTVTAHGRTDKHETTGLVIQNCRIVPEQKLYPVRLQIPSYLGRPWKQYSRTV  479

Query  1790  IMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM + I D++ P G+  W G   LDT +YAEY NRGPGA+TDKRVKWKG+    +   A 
Sbjct  480   IMESTIGDLIQPAGYMPWSGNFALDTLYYAEYANRGPGAATDKRVKWKGFHVIKNRNEAL  539

Query  1610  QFTPGPFLMADEQWLGRAQIPFSPGF  1533
             QFT  PF+  + QWL    +P+  GF
Sbjct  540   QFTASPFIQGN-QWLKPTGMPYLLGF  564



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10737389917540