BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g1_i6 len=1784 path=[2304:0-288 2593:289-335 2640:336-425
2730:426-582 2887:583-606 49619:607-608 49621:609-622 18702:623-624
18704:625-653 18733:654-666 18746:667-704 18784:705-735
18815:736-959 19039:960-1043 19123:1044-1079 19159:1080-1155
19235:1156-1391 19471:1392-1502 19582:1503-1526 46126:1527-1572
19652:1573-1598 19677:1599-1783]

Length=1784
                                                                      Score     E

ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        750   0.0      Vitis vinifera
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   743   0.0      
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        739   0.0      
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   729   0.0      
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   729   0.0      
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   729   0.0      
emb|CDP20872.1|  unnamed protein product                                723   0.0      
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        723   0.0      
ref|XP_007052106.1|  Pectinesterase 2                                   721   0.0      
gb|AFW03484.1|  pectin methylesterase 5                                 720   0.0      
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   719   0.0      
gb|AFW03479.1|  pectin methylesterase 5                                 719   0.0      
emb|CAN83663.1|  hypothetical protein VITISV_017689                     718   0.0      Vitis vinifera
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        718   0.0      Vitis vinifera
gb|KHG19575.1|  Uncharacterized protein F383_07269                      718   0.0      
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    717   0.0      Populus trichocarpa [western balsam poplar]
gb|AER38244.1|  PME5                                                    716   0.0      
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        715   0.0      
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   715   0.0      Vitis vinifera
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   714   0.0      
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        713   0.0      Vitis vinifera
emb|CAN78759.1|  hypothetical protein VITISV_000562                     712   0.0      Vitis vinifera
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     709   0.0      
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        709   0.0      
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    707   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   707   0.0      
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   705   0.0      
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         703   0.0      
gb|KHN35617.1|  Pectinesterase 2                                        702   0.0      
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             700   0.0      
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        700   0.0      
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        696   0.0      
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   693   0.0      
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   691   0.0      
emb|CDP08022.1|  unnamed protein product                                691   0.0      
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               690   0.0      Ricinus communis
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   689   0.0      
ref|XP_010098938.1|  Pectinesterase 2                                   689   0.0      
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        685   0.0      
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   682   0.0      
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    681   0.0      
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   681   0.0      
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   679   0.0      
emb|CAN76835.1|  hypothetical protein VITISV_043176                     677   0.0      Vitis vinifera
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    677   0.0      
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    675   0.0      Citrus sinensis [apfelsine]
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   674   0.0      
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             674   0.0      
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 673   0.0      
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   672   0.0      
ref|NP_001275775.1|  pectinesterase 2 precursor                         672   0.0      
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    671   0.0      
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 669   0.0      
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             668   0.0      
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    667   0.0      
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             665   0.0      
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    665   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   664   0.0      
ref|XP_002882002.1|  predicted protein                                  663   0.0      
emb|CDO97716.1|  unnamed protein product                                663   0.0      
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   663   0.0      
gb|KHN47892.1|  Pectinesterase 2                                        662   0.0      
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    662   0.0      
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             662   0.0      
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    660   0.0      
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    658   0.0      
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    657   0.0      
gb|KHN47891.1|  Pectinesterase 2                                        657   0.0      
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    657   0.0      
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   662   0.0      
emb|CBI24285.3|  unnamed protein product                                650   0.0      
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg                647   0.0      
emb|CDY27388.1|  BnaC04g50170D                                          645   0.0      
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   645   0.0      
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   644   0.0      
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   644   0.0      
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             644   0.0      
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        643   0.0      
emb|CDP20891.1|  unnamed protein product                                643   0.0      
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        642   0.0      
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   642   0.0      
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    641   0.0      
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         640   0.0      
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    640   0.0      
ref|XP_002322401.1|  putative pectin methylesterase family protein      639   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   637   0.0      
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   636   0.0      
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   635   0.0      
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   635   0.0      
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   634   0.0      
ref|XP_007038413.1|  Pectinesterase                                     632   0.0      
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             630   0.0      
gb|KCW73024.1|  hypothetical protein EUGRSUZ_E01466                     631   0.0      
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   631   0.0      
ref|XP_002318285.1|  putative pectin methylesterase family protein      631   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   630   0.0      
ref|XP_010058469.1|  PREDICTED: pectinesterase 2-like                   628   0.0      
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    623   0.0      
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     624   0.0      
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               620   0.0      Ricinus communis
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   622   0.0      
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   623   0.0      
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    621   0.0      
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   620   0.0      
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   619   0.0      
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   612   0.0      
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       612   0.0      
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   607   0.0      
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   617   0.0      
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    607   0.0      
emb|CDX74715.1|  BnaA05g04610D                                          603   0.0      
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   605   0.0      
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   604   0.0      
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     605   0.0      
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   602   0.0      
emb|CDX83392.1|  BnaA03g21140D                                          597   0.0      
emb|CDX95641.1|  BnaC03g25220D                                          597   0.0      
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   598   0.0      
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    593   0.0      
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   594   0.0      
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                591   0.0      
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   587   0.0      
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   585   0.0      
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     581   0.0      
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   568   0.0      
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    563   0.0      
gb|KHN35620.1|  Pectinesterase 2                                        552   0.0      
emb|CBI24286.3|  unnamed protein product                                553   0.0      
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     555   0.0      
ref|XP_010662407.1|  PREDICTED: probable pectinesterase/pectinest...    551   0.0      
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     551   0.0      
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               550   0.0      Ricinus communis
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          549   0.0      
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   544   0.0      
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          543   0.0      
ref|XP_010271283.1|  PREDICTED: pectinesterase                          543   0.0      
gb|KHN42767.1|  Pectinesterase 2                                        540   0.0      
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     541   0.0      
ref|XP_002322399.1|  putative pectin methylesterase family protein      540   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   537   0.0      
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     538   0.0      
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     536   0.0      
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     536   0.0      
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     535   0.0      
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     535   0.0      
ref|XP_007038414.1|  Plant invertase/pectin methylesterase inhibi...    534   0.0      
ref|XP_010654104.1|  PREDICTED: pectinesterase                          533   3e-180   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     531   4e-180   
gb|KHN25547.1|  Pectinesterase 2                                        525   6e-180   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             529   9e-179   Populus trichocarpa [western balsam poplar]
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         529   9e-179   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     528   1e-178   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    528   2e-178   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     527   3e-178   
gb|KHN35618.1|  Pectinesterase 2                                        519   1e-177   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          525   2e-177   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          524   4e-177   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    523   9e-177   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               521   6e-176   Ricinus communis
ref|XP_006490218.1|  PREDICTED: probable pectinesterase/pectinest...    520   2e-175   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     519   7e-175   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                517   2e-174   
ref|XP_006421696.1|  hypothetical protein CICLE_v10004719mg             516   6e-174   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     515   2e-173   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    515   3e-173   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     514   3e-173   
ref|XP_008234390.1|  PREDICTED: probable pectinesterase/pectinest...    514   4e-173   
gb|KHN35616.1|  Pectinesterase 2                                        507   6e-173   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    513   1e-172   
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         512   3e-172   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          511   3e-172   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     512   3e-172   
emb|CDP00815.1|  unnamed protein product                                512   3e-172   
ref|XP_010035022.1|  PREDICTED: probable pectinesterase/pectinest...    511   6e-172   
ref|XP_008376203.1|  PREDICTED: probable pectinesterase/pectinest...    511   6e-172   
ref|XP_009799202.1|  PREDICTED: probable pectinesterase/pectinest...    511   2e-171   
ref|XP_009609130.1|  PREDICTED: probable pectinesterase/pectinest...    509   4e-171   
emb|CDY18944.1|  BnaC04g04060D                                          504   2e-170   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    507   2e-170   
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      507   2e-170   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      507   2e-170   
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    506   4e-170   
ref|XP_010062172.1|  PREDICTED: probable pectinesterase/pectinest...    507   4e-170   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          507   5e-170   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 506   5e-170   
ref|XP_004240801.1|  PREDICTED: probable pectinesterase/pectinest...    504   2e-169   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    503   5e-169   
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    503   6e-169   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      503   7e-169   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                501   1e-168   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     503   1e-168   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             502   1e-168   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     502   3e-168   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             501   4e-168   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     500   5e-168   Vitis vinifera
ref|XP_009400700.1|  PREDICTED: pectinesterase-like                     501   7e-168   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     498   1e-167   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   499   2e-167   
ref|XP_008354203.1|  PREDICTED: probable pectinesterase/pectinest...    499   2e-167   
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    498   1e-166   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          497   2e-166   
ref|XP_006357927.1|  PREDICTED: probable pectinesterase/pectinest...    497   2e-166   
ref|XP_007131333.1|  hypothetical protein PHAVU_011G005000g             496   3e-166   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     494   9e-166   
ref|XP_003599460.1|  Pectinesterase                                     495   1e-165   
gb|AES69711.2|  pectinesterase/pectinesterase inhibitor                 494   2e-165   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     491   3e-165   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     493   3e-165   
ref|XP_007148706.1|  hypothetical protein PHAVU_005G007800g             494   5e-165   
ref|XP_003533518.1|  PREDICTED: probable pectinesterase/pectinest...    493   8e-165   
ref|XP_004234933.2|  PREDICTED: probable pectinesterase/pectinest...    493   8e-165   
ref|XP_003523880.1|  PREDICTED: probable pectinesterase/pectinest...    493   9e-165   
ref|XP_011010932.1|  PREDICTED: probable pectinesterase/pectinest...    492   2e-164   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     491   3e-164   
ref|XP_002872964.1|  predicted protein                                  488   7e-164   
ref|XP_006367817.1|  PREDICTED: probable pectinesterase/pectinest...    490   9e-164   
ref|XP_008812365.1|  PREDICTED: pectinesterase                          490   9e-164   
ref|XP_003540571.1|  PREDICTED: probable pectinesterase/pectinest...    490   1e-163   
ref|XP_011029954.1|  PREDICTED: probable pectinesterase/pectinest...    490   1e-163   
ref|XP_007220716.1|  hypothetical protein PRUPE_ppa022308mg             488   2e-163   
ref|XP_003598225.1|  Pectinesterase                                     489   2e-163   
ref|XP_003598230.1|  Pectinesterase                                     489   2e-163   
ref|XP_003537030.1|  PREDICTED: probable pectinesterase/pectinest...    489   3e-163   
ref|XP_009340595.1|  PREDICTED: probable pectinesterase/pectinest...    486   6e-163   
ref|XP_004516727.1|  PREDICTED: probable pectinesterase/pectinest...    488   7e-163   
gb|KEH22545.1|  pectinesterase/pectinesterase inhibitor                 488   8e-163   
ref|XP_006289025.1|  hypothetical protein CARUB_v10002406mg             486   9e-163   
ref|XP_004499656.1|  PREDICTED: probable pectinesterase/pectinest...    487   2e-162   
ref|XP_003598229.1|  Pectinesterase                                     486   5e-162   
emb|CDP05321.1|  unnamed protein product                                483   5e-162   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   484   1e-161   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             482   2e-161   
ref|NP_191930.1|  pectin methylesterase 38                              481   3e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    481   4e-161   
ref|XP_009627971.1|  PREDICTED: probable pectinesterase/pectinest...    483   4e-161   
ref|XP_010672014.1|  PREDICTED: probable pectinesterase/pectinest...    483   5e-161   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     484   2e-160   
ref|XP_009374496.1|  PREDICTED: probable pectinesterase/pectinest...    479   3e-160   
ref|XP_009149919.1|  PREDICTED: probable pectinesterase/pectinest...    483   4e-160   
gb|KEH29375.1|  pectinesterase/pectinesterase inhibitor                 481   4e-160   
emb|CDX99055.1|  BnaA06g17460D                                          483   5e-160   
emb|CDY55029.1|  BnaC03g75510D                                          482   9e-160   
ref|XP_002318284.2|  pectinesterase family protein                      479   2e-159   Populus trichocarpa [western balsam poplar]
ref|XP_010426712.1|  PREDICTED: putative pectinesterase/pectinest...    477   2e-159   
ref|XP_009773841.1|  PREDICTED: probable pectinesterase/pectinest...    479   2e-159   
gb|KFK34037.1|  hypothetical protein AALP_AA5G093700                    481   3e-159   
ref|XP_002875838.1|  pectinesterase family protein                      481   3e-159   
ref|XP_009773839.1|  PREDICTED: probable pectinesterase/pectinest...    478   6e-159   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             479   1e-158   
ref|XP_009374495.1|  PREDICTED: probable pectinesterase/pectinest...    475   2e-158   
ref|XP_009150639.1|  PREDICTED: probable pectinesterase/pectinest...    479   2e-158   
ref|XP_006290793.1|  hypothetical protein CARUB_v10016896mg             478   4e-158   
ref|XP_010503340.1|  PREDICTED: probable pectinesterase/pectinest...    478   4e-158   
ref|XP_006404388.1|  hypothetical protein EUTSA_v10010228mg             478   5e-158   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    476   5e-158   
emb|CDX83016.1|  BnaA01g20160D                                          478   5e-158   
ref|XP_010426182.1|  PREDICTED: probable pectinesterase/pectinest...    477   9e-158   
ref|NP_190324.1|  Probable pectinesterase/pectinesterase inhibito...    477   1e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322402.2|  putative pectin methylesterase family protein      472   2e-157   Populus trichocarpa [western balsam poplar]
ref|XP_006281620.1|  hypothetical protein CARUB_v10027747mg             474   3e-157   
gb|ABQ42392.1|  pectin methylesterase-like protein                      476   3e-157   Taiwania cryptomerioides
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    473   5e-157   
ref|XP_010550793.1|  PREDICTED: probable pectinesterase/pectinest...    473   6e-157   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     473   8e-157   
ref|XP_006401970.1|  hypothetical protein EUTSA_v10013190mg             472   1e-156   
ref|XP_010933723.1|  PREDICTED: pectinesterase-like                     471   1e-156   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          471   2e-156   
ref|XP_010523198.1|  PREDICTED: putative pectinesterase/pectinest...    470   2e-156   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     471   4e-156   
ref|XP_009107418.1|  PREDICTED: probable pectinesterase/pectinest...    470   9e-156   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     470   2e-155   
ref|XP_010442652.1|  PREDICTED: probable pectinesterase/pectinest...    469   2e-155   
ref|XP_002865863.1|  pectinesterase family protein                      469   3e-155   
ref|XP_006401969.1|  hypothetical protein EUTSA_v10013189mg             469   3e-155   
ref|XP_010443361.1|  PREDICTED: probable pectinesterase/pectinest...    468   4e-155   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     469   4e-155   
ref|XP_010442655.1|  PREDICTED: probable pectinesterase/pectinest...    468   6e-155   
emb|CDY00480.1|  BnaA10g07930D                                          468   6e-155   
ref|XP_009107408.1|  PREDICTED: probable pectinesterase/pectinest...    468   7e-155   
gb|KHN16553.1|  Pectinesterase 2                                        463   7e-155   
ref|XP_009132604.1|  PREDICTED: probable pectinesterase/pectinest...    467   1e-154   
ref|XP_010443373.1|  PREDICTED: probable pectinesterase/pectinest...    467   2e-154   
ref|XP_010443353.1|  PREDICTED: probable pectinesterase/pectinest...    466   2e-154   
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    466   3e-154   
ref|XP_010482487.1|  PREDICTED: probable pectinesterase/pectinest...    466   4e-154   
ref|XP_010482485.1|  PREDICTED: probable pectinesterase/pectinest...    466   4e-154   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     466   5e-154   
emb|CDX99914.1|  BnaC09g27910D                                          465   8e-154   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             466   1e-153   
ref|NP_199962.1|  putative pectinesterase/pectinesterase inhibito...    464   1e-153   
ref|XP_008452338.1|  PREDICTED: probable pectinesterase/pectinest...    464   1e-153   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     465   2e-153   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     464   3e-153   
ref|XP_010532250.1|  PREDICTED: probable pectinesterase/pectinest...    464   3e-153   
gb|ABK24761.1|  unknown                                                 464   6e-153   
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                459   2e-152   
gb|KGN56178.1|  hypothetical protein Csa_3G088980                       460   5e-152   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     461   5e-152   
ref|XP_009107426.1|  PREDICTED: probable pectinesterase/pectinest...    459   1e-151   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          461   1e-151   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             459   2e-151   
gb|AGG23325.1|  pectin methylesterase 1                                 459   4e-151   
gb|ACQ85264.1|  pectin methylesterase                                   459   4e-151   
ref|XP_006282103.1|  hypothetical protein CARUB_v10028350mg             458   5e-151   
ref|XP_011076510.1|  PREDICTED: pectinesterase-like                     457   5e-151   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    458   9e-151   
ref|XP_010424032.1|  PREDICTED: putative pectinesterase/pectinest...    455   9e-151   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     458   1e-150   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    458   1e-150   
gb|EEC70505.1|  hypothetical protein OsI_01594                          457   2e-150   
dbj|BAJ96804.1|  predicted protein                                      457   2e-150   
ref|XP_011076834.1|  PREDICTED: probable pectinesterase/pectinest...    455   3e-150   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   446   9e-150   
emb|CDO97717.1|  unnamed protein product                                444   1e-149   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          455   1e-149   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             456   1e-149   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 454   2e-149   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          454   4e-149   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          454   5e-149   
emb|CBI38888.3|  unnamed protein product                                442   6e-149   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               453   9e-149   
ref|NP_199963.1|  putative pectinesterase/pectinesterase inhibito...    452   1e-148   
ref|XP_008796891.1|  PREDICTED: pectinesterase-like                     448   3e-148   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     452   3e-148   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   446   4e-148   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         446   5e-148   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     452   5e-148   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     448   5e-148   
ref|XP_004160315.1|  PREDICTED: probable pectinesterase/pectinest...    447   1e-147   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 449   1e-147   
ref|XP_006307093.1|  hypothetical protein CARUB_v10008680mg             451   1e-147   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          451   1e-147   
ref|NP_001042866.1|  Os01g0312500                                       445   2e-147   
gb|EYU24971.1|  hypothetical protein MIMGU_mgv1a004327mg                449   2e-147   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     446   2e-147   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     450   2e-147   
gb|ABZ89800.1|  pectin methylesterase-like protein                      449   4e-147   
ref|XP_010932336.1|  PREDICTED: pectinesterase-like                     449   7e-147   
emb|CDY04739.1|  BnaC05g18500D                                          447   7e-147   
emb|CDY21422.1|  BnaA09g30050D                                          447   8e-147   
emb|CDY38867.1|  BnaA03g13120D                                          444   9e-147   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          447   1e-146   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     447   1e-146   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    447   1e-146   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     447   1e-146   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     444   2e-146   
ref|XP_002304257.2|  pectinesterase family protein                      447   4e-146   
gb|KHN11656.1|  Putative pectinesterase/pectinesterase inhibitor 33     442   5e-146   
gb|AHB84678.1|  pectin methylesterase                                   446   6e-146   
ref|NP_001274969.1|  pectin methyl esterase                             446   6e-146   
emb|CBI24284.3|  unnamed protein product                                434   6e-146   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     446   7e-146   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    446   8e-146   
ref|XP_009417531.1|  PREDICTED: probable pectinesterase/pectinest...    447   1e-145   
gb|AFB77929.1|  pectin methylesterase                                   446   1e-145   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    445   1e-145   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    446   2e-145   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            444   2e-145   
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     445   2e-145   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          446   2e-145   
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         445   2e-145   
emb|CDP15270.1|  unnamed protein product                                445   2e-145   
gb|AFW03475.1|  pectin methylesterase 1                                 445   3e-145   
ref|XP_010477609.1|  PREDICTED: probable pectinesterase/pectinest...    443   3e-145   
ref|XP_002890570.1|  predicted protein                                  443   4e-145   
gb|KGN44975.1|  Pectinesterase                                          446   4e-145   
emb|CDY64024.1|  BnaCnng43010D                                          440   4e-145   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    445   4e-145   
ref|XP_009409661.1|  PREDICTED: pectinesterase-like                     442   4e-145   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    444   5e-145   
ref|XP_010460102.1|  PREDICTED: probable pectinesterase/pectinest...    443   5e-145   
emb|CAB95025.1|  pectin methylesterase                                  444   5e-145   
gb|AFW03480.1|  pectin methylesterase 1                                 444   5e-145   
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             443   6e-145   
gb|KFK26750.1|  hypothetical protein AALP_AA8G288600                    440   6e-145   
gb|KEH21378.1|  pectinesterase                                          436   6e-145   
gb|KHG08631.1|  Pectinesterase 3                                        443   9e-145   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 439   9e-145   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    444   1e-144   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    443   1e-144   
ref|XP_003630890.1|  Pectinesterase                                     440   1e-144   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    443   2e-144   
gb|ACN40984.1|  unknown                                                 442   3e-144   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    441   3e-144   
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    442   3e-144   
gb|EPS62329.1|  pectinesterase                                          441   4e-144   
ref|XP_010498826.1|  PREDICTED: probable pectinesterase/pectinest...    441   4e-144   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     441   1e-143   
dbj|BAJ34238.1|  unnamed protein product                                439   2e-143   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    440   2e-143   
ref|XP_010058445.1|  PREDICTED: pectinesterase 2-like                   435   2e-143   
ref|XP_010917466.1|  PREDICTED: pectinesterase-like                     441   3e-143   
ref|XP_009625343.1|  PREDICTED: pectinesterase-like                     436   6e-143   
gb|AAO85706.1|  pectin methyl-esterase                                  439   6e-143   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    438   7e-143   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     437   1e-142   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    437   2e-142   
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    436   3e-142   
ref|XP_007012502.1|  Pectin methylesterase 3                            436   4e-142   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  436   5e-142   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     436   8e-142   
ref|XP_009782456.1|  PREDICTED: pectinesterase-like                     434   8e-142   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     435   8e-142   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             436   8e-142   
ref|XP_009115554.1|  PREDICTED: probable pectinesterase/pectinest...    435   1e-141   
ref|XP_003627458.1|  Pectinesterase                                     435   3e-141   
emb|CAC01624.1|  putative pectin methylesterase                         434   3e-141   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   434   4e-141   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     434   4e-141   
ref|XP_011076333.1|  PREDICTED: probable pectinesterase/pectinest...    430   8e-141   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    433   8e-141   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         432   9e-141   
gb|EEC82670.1|  hypothetical protein OsI_27314                          433   9e-141   
gb|AFQ23194.1|  pectin methylesterase                                   433   9e-141   
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    433   1e-140   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    433   1e-140   
ref|NP_001060620.1|  Os07g0675100                                       433   1e-140   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   433   1e-140   
emb|CDY35644.1|  BnaC09g29660D                                          428   1e-140   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     432   1e-140   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             433   2e-140   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            431   2e-140   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     431   2e-140   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             432   3e-140   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     431   3e-140   
ref|NP_001275859.1|  pectinesterase 1 precursor                         432   3e-140   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     431   4e-140   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    430   5e-140   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 430   6e-140   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     431   6e-140   
gb|AHC69829.1|  pectin methylesterase PME2.1                            430   7e-140   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     429   7e-140   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     431   8e-140   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     429   9e-140   
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       431   1e-139   
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    431   1e-139   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    431   1e-139   
emb|CDX96216.1|  BnaC02g14350D                                          426   1e-139   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    427   1e-139   
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    431   1e-139   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     429   1e-139   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     429   2e-139   
ref|NP_001146685.1|  pectinesterase precursor                           429   2e-139   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    429   2e-139   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     429   2e-139   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             429   2e-139   
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    429   2e-139   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    429   3e-139   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              429   3e-139   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          428   4e-139   
gb|AFB77928.1|  pectin methylesterase                                   428   4e-139   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             429   4e-139   
gb|AFI23411.1|  pectin methylesterase                                   429   5e-139   
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    428   5e-139   
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                427   6e-139   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             427   6e-139   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    427   8e-139   
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    428   8e-139   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         428   8e-139   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     427   9e-139   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     427   1e-138   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          427   1e-138   
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    427   1e-138   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     427   1e-138   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    427   1e-138   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             427   2e-138   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    427   2e-138   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    427   2e-138   
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         427   2e-138   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    427   3e-138   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     426   3e-138   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         426   4e-138   
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    427   4e-138   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   420   4e-138   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     426   4e-138   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     425   5e-138   
ref|XP_003632058.1|  PREDICTED: probable pectinesterase/pectinest...    425   6e-138   
ref|XP_002317208.1|  pectin methylesterase family protein               424   9e-138   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     425   1e-137   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     424   1e-137   
emb|CDX98441.1|  BnaC05g39340D                                          424   1e-137   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             426   1e-137   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   424   1e-137   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          424   2e-137   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    425   2e-137   
emb|CDY49170.1|  BnaA02g10290D                                          420   2e-137   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   424   2e-137   
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             423   2e-137   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        424   2e-137   
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          425   3e-137   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             423   3e-137   
ref|XP_009611830.1|  PREDICTED: probable pectinesterase/pectinest...    422   3e-137   
ref|XP_002865971.1|  pectinesterase family protein                      424   4e-137   
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     423   4e-137   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    422   5e-137   
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    424   5e-137   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   424   6e-137   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          422   7e-137   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    424   7e-137   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                424   9e-137   



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/521 (74%), Positives = 439/521 (84%), Gaps = 15/521 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             ++F+ +   L+  V   V GY   ++KSWCSQTPYPQPCEY+LS    +   IK KSDFL
Sbjct  3     VEFLLVSLLLSPIV---VSGYKSEDVKSWCSQTPYPQPCEYFLSHK-PDHSPIKQKSDFL  58

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  A+ NTYSLG+KCR+  EK AW DCL+LYE  + +++ TVDPN KCS 
Sbjct  59    KISMQLALERALRAESNTYSLGSKCRNELEKTAWSDCLKLYEYTILRLNKTVDPNTKCSQ  118

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D+QTWLSTALTNLETC AGFV+LGV+  +LP + SNNVS LISNTL++NK         
Sbjct  119   VDSQTWLSTALTNLETCRAGFVELGVSDYLLP-LMSNNVSKLISNTLSLNK-----VPYT  172

Query  1131  ttgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                Y EGFP WV+PGDRKLLQSS+ AS+A+IVVA+DGSG+Y T+T AV+AA+KRSG+GRY
Sbjct  173   EPSYKEGFPTWVKPGDRKLLQSSSPASQANIVVAKDGSGDYTTITAAVSAASKRSGTGRY  232

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVKAG Y EN+EIG+KLKNIML+GDGIGKTIITGS+SVGGG+TTF SATVA VGDGFI
Sbjct  233   VIYVKAGTYNENIEIGAKLKNIMLLGDGIGKTIITGSKSVGGGSTTFNSATVAAVGDGFI  292

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
             G+G+T RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGTVD
Sbjct  293   GRGLTIRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVD  352

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             FIFGNAAVV QNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNCKVTAASDLK     
Sbjct  353   FIFGNAAVVLQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSS  412

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             VKTYLGRPWKEYSRTVFMK+ LDSLI+PAGW+ W GNFAL TLYYGEY NTG G+ST+NR
Sbjct  413   VKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNR  472

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W GYHVITS++EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  473   VNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  513



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/524 (73%), Positives = 430/524 (82%), Gaps = 9/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M+N+  IF   F++ F   +  GYS   IKSWC QTP+PQPCEY+L+++      I  KS
Sbjct  6     MSNIYLIFPLLFVSSFFFPSTNGYSMAAIKSWCIQTPHPQPCEYFLTQNPKYSTPINKKS  65

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLKV+  LAL  A  A+ N YSLG+KCR+  EKAAW DCLELYE+ + KI +TVDPN K
Sbjct  66    DFLKVSLELALDRALRAQTNAYSLGSKCRNEREKAAWADCLELYEHTIHKIKSTVDPNTK  125

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+ ADAQ+WLSTALTNLETC AGF +LGVT  ++P + SNNVS LISNTL++N G+ T  
Sbjct  126   CTAADAQSWLSTALTNLETCRAGFEELGVTDYVMP-LMSNNVSSLISNTLSLNHGYYTEP  184

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                       FP WV PGDRKLLQSS+ AS+A+IVVA+DGSGN+KTV EAV AA KR GS
Sbjct  185   TATQVDG---FPTWVAPGDRKLLQSSSPASQANIVVAKDGSGNFKTVKEAVAAAGKRKGS  241

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VIYVKAG+Y ENVE+GSKLKNIM VGDGIGKTIITGS+SVGGG+TTFKSATVAVVGD
Sbjct  242   ARFVIYVKAGIYSENVELGSKLKNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGD  301

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GIT RNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+SDRQFYRECD+YG
Sbjct  302   GFICRGITIRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDVYG  361

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG-  427
             TVDFIFGNAAVV QNCNI+AR+PPNKTNT+TAQGR+DPNQNTGISIHNC++TAASDLK  
Sbjct  362   TVDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRTDPNQNTGISIHNCRITAASDLKAS  421

Query  426   ---VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTV MK+ LDSLI P GW+PW G FAL TLYYGEY NTG G+ST
Sbjct  422   KNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGSST  481

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ANRVKWGGY VITSA EASKFT  NFIAG SWLPATNVPFTSGL
Sbjct  482   ANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  525



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/524 (73%), Positives = 428/524 (82%), Gaps = 9/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M+N+  IF   F++ F   +  GYS   IK WC QTP+PQPCEY+L+++      I  KS
Sbjct  30    MSNIYLIFPLLFVSSFFFPSTNGYSQAAIKFWCIQTPHPQPCEYFLTQNPKYSTPINKKS  89

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLKV+  LAL  A  A+ N YSLG+KCR+  EKAAW DCLELYEN + KI +TV PN K
Sbjct  90    DFLKVSLELALDRALRAQTNAYSLGSKCRNEREKAAWADCLELYENTIHKIKSTVGPNTK  149

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+ ADAQ+WLSTALTNLETC AGF +LGVT  ++P + SNNVS LISNTL++N G+ T  
Sbjct  150   CTAADAQSWLSTALTNLETCRAGFEELGVTDYVMP-LMSNNVSSLISNTLSLNHGYYTEP  208

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                       FP WV  GDRKLLQSS+ AS+A+IVVA+DGSGN+KTV EAV AA KR GS
Sbjct  209   TATQVDG---FPTWVALGDRKLLQSSSPASQANIVVAKDGSGNFKTVKEAVAAAGKRKGS  265

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VIYVKAG+Y ENV++GSKLKNIMLVGDGIGKTIITGS+SVGGG+TTFKSATVAVVGD
Sbjct  266   ARFVIYVKAGIYSENVDLGSKLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGD  325

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GIT RNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+SDRQFYRECDIYG
Sbjct  326   GFICRGITIRNTAGPTNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDIYG  385

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG-  427
             TVDFIFGNAAVV QNCNI+AR+PPNKTNT+TAQGRSDPNQNTGISIHNC+VTAASDLK  
Sbjct  386   TVDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRSDPNQNTGISIHNCRVTAASDLKAS  445

Query  426   ---VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTV MK+ LDSLI P GW+PW G FAL TLYYGEY NTG G+ST
Sbjct  446   KNSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGSST  505

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ANRVKWGGY VITSA EASKFT  NFIAG SWLPATNVPFTSGL
Sbjct  506   ANRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  549



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/507 (74%), Positives = 430/507 (85%), Gaps = 14/507 (3%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA  1450
             S  + GYS +++K+WCS+ PYPQPCEY+L+        IK KSDFLKV+  LAL+ A+ A
Sbjct  18    SPTISGYSSSDVKAWCSKMPYPQPCEYFLTHD-PKQASIKQKSDFLKVSMQLALERAQMA  76

Query  1449  KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNL  1270
               NT+SLG+KC +  EKAAW DCL+LYE  + +++ T+  +  C+  +AQTWLSTALTNL
Sbjct  77    HSNTHSLGSKCSNEHEKAAWADCLQLYEYTILRLNRTIVHD--CTQDEAQTWLSTALTNL  134

Query  1269  ETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRP  1090
             ETC AGFV+LGV+GN+LP + SNNVS LISNTLA+N          T  YT+ FP WVRP
Sbjct  135   ETCQAGFVELGVSGNVLP-LMSNNVSKLISNTLALN-----YAPYTTPNYTKKFPTWVRP  188

Query  1089  GDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVE  913
             GDRKLLQSS+A SKA+I+VAQDGSGNYKT++EA+ AA+KRSG+ RY+IY+KAG Y ENVE
Sbjct  189   GDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVE  248

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +GSKL+NIM VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDGFI Q ITFRNTAGAAN
Sbjct  249   VGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAAN  308

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
             HQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNAAVV QNCN
Sbjct  309   HQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCN  368

Query  552   IYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSR  385
             IYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK     VKTYLGRPW+EYSR
Sbjct  369   IYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSR  428

Query  384   TVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATE  205
             TVFMK+ LDSLI+ AGW+ WDGNFAL+TLYYGEY NTG G+STA+RV W GYHVITSATE
Sbjct  429   TVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWAGYHVITSATE  488

Query  204   ASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ASKFTVG+FIAGGSWLPAT VP+TSGL
Sbjct  489   ASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/524 (72%), Positives = 438/524 (84%), Gaps = 14/524 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M + Q   I  FL + +S  + GYS +++K+WCS+ PYPQPCEY+L+        IK KS
Sbjct  1     MGSHQKFMILLFLPLLLSPTISGYSSSDVKAWCSKMPYPQPCEYFLTHD-PKQASIKQKS  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLKV+  LAL+ A+ A  NT+SLG+KC +  EKA W DCL+LYE+ + +++ T+  +  
Sbjct  60    DFLKVSMQLALERAQMAHSNTHSLGSKCSNEREKAVWADCLQLYEHTILRLNRTIVHD--  117

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  +AQTWLSTALTNLETC AGFV+LGV+GN+LP + SNNVS LISNTLA+N       
Sbjct  118   CTHDEAQTWLSTALTNLETCRAGFVELGVSGNVLP-LMSNNVSKLISNTLALN-----YA  171

Query  1140  neattgyteGFPDWVRPGDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                T  YT+ FP WVRPGDRKLLQSS+A SKA+I+VAQDGSGNYKT++EA+ AA+KRSG+
Sbjct  172   PYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGT  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              RY+IY+KAG Y ENVE+GSKL+NIM VGDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  232   ARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  291

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYG
Sbjct  292   GFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYG  351

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVV QNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK  
Sbjct  352   TVDFIFGNAAVVLQNCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSV  411

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPW+EYSRTVFMK+ LDSLI+ AGW+ WDGNFAL+TLYYGEY NTG G+ST
Sbjct  412   QSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSST  471

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             A+RV W GYHVITSATEASKFTVG+FIAGGSWLPAT VP+TSGL
Sbjct  472   ASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/524 (72%), Positives = 433/524 (83%), Gaps = 14/524 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  LQ      FL++ +S +  G+S  + KSWCS+ PYPQPCEY+L+ +  N   IK KS
Sbjct  1     MDLLQKFITFVFLSLVISPSTSGFSTGDAKSWCSKMPYPQPCEYFLTHNPKNI-PIKQKS  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLKV+K L L+ A  A  N YSLG+KCR+  EKA W DCLELYE  + +++ TVD  +K
Sbjct  60    DFLKVSKQLVLERALRAHSNAYSLGSKCRNEREKAVWADCLELYEQTILRLNRTVD--LK  117

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  D QTWLSTALTNLETC  GFV+LGV+  +LP + SNNV+ LISNTLA+N       
Sbjct  118   CTQEDVQTWLSTALTNLETCRTGFVELGVSDYVLP-LMSNNVTKLISNTLALNH-----V  171

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   YT G+P+WVRPGDRKLLQSS+ +SKA+IVVA+DGSG YKT+ EA+ AA+KR G+
Sbjct  172   PYKPPSYTNGYPNWVRPGDRKLLQSSSPSSKANIVVAKDGSGKYKTIKEAITAASKRFGT  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              RYVIYVKAG YKEN+E+GSKLKNIM VGDGIGKTIITGSRSVGGG+TTFKSATVAVVGD
Sbjct  232   ARYVIYVKAGTYKENIEVGSKLKNIMFVGDGIGKTIITGSRSVGGGSTTFKSATVAVVGD  291

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI + ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYG
Sbjct  292   GFIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYG  351

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVVFQNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNC+VTAAS+LK  
Sbjct  352   TVDFIFGNAAVVFQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRV  411

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWKEYSRTVFMK+ LDSLI+PAGW+ W+GNFAL TLYYGEY NTG G+ST
Sbjct  412   QSSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSST  471

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NRVKWGGY VITSA+EASKFTVG+ IAG SWLPAT VPFTSGL
Sbjct  472   KNRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  515



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/527 (73%), Positives = 439/527 (83%), Gaps = 17/527 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGY--SPTEIKSWCSQTPYPQPCEYYLSRS--YSNGGQI  1513
             MT    IF+  F+ +FVS A+      P  +KSWC+QTPYPQPCEY+LS++  Y  G  I
Sbjct  1     MTFPLAIFL--FMTVFVSPAISRNIPPPPSVKSWCAQTPYPQPCEYFLSQNPKYGYGYPI  58

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K KSDFLKV+ NLAL+ A +A++NT +LG+KC++  EKAAWEDC+ELYE+ + KI+ TVD
Sbjct  59    KGKSDFLKVSLNLALERAVHAQENTNNLGSKCQNEREKAAWEDCIELYESTIVKINKTVD  118

Query  1332  PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGF  1153
             P  KC+  +AQTWLSTALTNLETC  GF++LGV  +++P + SNNVS LISNTL++NK  
Sbjct  119   PYTKCNAVEAQTWLSTALTNLETCKQGFIELGVADHLVP-LMSNNVSCLISNTLSLNK--  175

Query  1152  tttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKR  973
                       Y EGFP WV PGDRKLLQSS+ +  + VVAQDGSGN+KT+  AV AAA R
Sbjct  176   ---VGYNEPSYKEGFPTWVTPGDRKLLQSSSPT-PNAVVAQDGSGNFKTIAAAVAAAATR  231

Query  972   SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAV  793
             SG+GRYVI+VKAG YKENVEIG+KLKNIMLVGDGIGKTIITGS SV GGTTTFKSATVAV
Sbjct  232   SGNGRYVIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIITGSNSVDGGTTTFKSATVAV  291

Query  792   VGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECD  613
             VGDGFI +GITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY ECD
Sbjct  292   VGDGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECD  351

Query  612   IYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL  433
             +YGTVD+IFGNAAVVFQNCN+Y+RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL
Sbjct  352   VYGTVDYIFGNAAVVFQNCNLYSRNPPNKINTITAQGRTDPNQNTGISIHNSRVTAASDL  411

Query  432   K----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAG  265
             K     VKTYLGRPW++YSRTVFMK+ LD LIDPAGWLPW GNFAL+TLYYGEY+NTG G
Sbjct  412   KPVQSSVKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGPG  471

Query  264   ASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +STANRV W GYH+ITSATEASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  472   SSTANRVSWKGYHLITSATEASKFTVGNFIAGNSWLPATNVPFTSGL  518



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 428/518 (83%), Gaps = 10/518 (2%)
 Frame = -3

Query  1662  IFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             I    F +I V S AV G S   IK+WCSQTP PQPCEY+ + +      IK+KSDF K+
Sbjct  19    ILTLLFASILVFSPAVSGGSSAAIKAWCSQTPNPQPCEYFFTHNPKYKVPIKNKSDFFKL  78

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL    + + N + LG KCR+  EKAAW DC+ELYE+ + KI+TTVDPN KC+ AD
Sbjct  79    STQLALDRCMHVQSNLHLLGPKCRNEREKAAWADCVELYEHTIHKINTTVDPNTKCTPAD  138

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC +GFVD G+T + +  + SNNVS L+SNTLA+NKG     N    
Sbjct  139   AQTWLSTALTNLETCKSGFVDFGITDDYMFPMMSNNVSLLLSNTLALNKG--PYANGPAG  196

Query  1125  gyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
              Y EGFP WV+PGDRKLLQSS  + A++VVAQDGSGNYKTV+EAV AA KRSGSGR+VI+
Sbjct  197   SYKEGFPSWVKPGDRKLLQSSTPT-ANVVVAQDGSGNYKTVSEAVAAAGKRSGSGRFVIH  255

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK G Y+ENV I +K  NIML+GDGIGKTIITGSRSVGGG+TTFKSATVA VGDGFI +G
Sbjct  256   VKQGTYRENVNIAAK--NIMLLGDGIGKTIITGSRSVGGGSTTFKSATVAAVGDGFIARG  313

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAGA NHQAVA RSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGTVDFIF
Sbjct  314   ITFRNTAGAQNHQAVAFRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIF  373

Query  585   GNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKT  418
             GNAAVVFQNCNIY RNPPNKTNT+TAQGR+DPNQNTGISIHNC+VTAA DL+     VKT
Sbjct  374   GNAAVVFQNCNIYPRNPPNKTNTLTAQGRTDPNQNTGISIHNCRVTAAPDLRPVQGSVKT  433

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPW++YSRTVFMK+ LDSLI+PAGW+PW GNFAL+TLYYGEY+NTG G+STANRVKW
Sbjct  434   YLGRPWQKYSRTVFMKTFLDSLINPAGWMPWSGNFALDTLYYGEYANTGPGSSTANRVKW  493

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GYHVITSA+EAS+FT G+FIA  SW+PATNVPFTSGL
Sbjct  494   KGYHVITSASEASRFTPGSFIAANSWIPATNVPFTSGL  531



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/519 (72%), Positives = 426/519 (82%), Gaps = 13/519 (3%)
 Frame = -3

Query  1662  IFICSFLA-IFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             IFI  FLA  F+  AV GY    ++SWCS+TP PQPCEY+LS    N   IKD+ DFLK+
Sbjct  6     IFIAIFLASFFLVPAVLGYGTNAVRSWCSKTPNPQPCEYFLSNDPKNT-PIKDEPDFLKI  64

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL+ A+ A+ +TY LG KCR+  EKAAW DCL LYE  + +++ TVD +IK +  D
Sbjct  65    SMQLALERAERAQSHTYLLGPKCRNKREKAAWADCLNLYELTILRLNKTVDSSIKLNKDD  124

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC  GF++LGV   ILP + SNNVS LISNTLA+NK           
Sbjct  125   AQTWLSTALTNLETCRTGFIELGVPDYILP-MMSNNVSNLISNTLALNKA-----PYKEP  178

Query  1125  gyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
              Y +GFP WV+PGDRKLLQSS+ AS+A+IVVAQDGSGNYKT+ +A++AA+KRSGSGRYVI
Sbjct  179   SYKDGFPTWVKPGDRKLLQSSSPASRANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVI  238

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVKAG YKENVEI SKLKNIMLVGDGIGKTIITGS+SVG G+TTF SATVA VGDGFI +
Sbjct  239   YVKAGTYKENVEIRSKLKNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIAR  298

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              IT RNTAG  NHQAV+LRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGTVD I
Sbjct  299   DITIRNTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVI  358

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVK  421
             FGNAAVV QNCNIYAR PPNKTNT+TAQ R+DPNQNTGI IHN +VTAASDLK     VK
Sbjct  359   FGNAAVVLQNCNIYARRPPNKTNTVTAQSRTDPNQNTGIIIHNSRVTAASDLKPVQSSVK  418

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPWK+YSRTVFMK+ LDSLI+PAGW+ WDGNFALNTLYY EY NTG G+ST+NRVK
Sbjct  419   TYLGRPWKQYSRTVFMKTFLDSLINPAGWMEWDGNFALNTLYYAEYMNTGTGSSTSNRVK  478

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GYHV+TSA+EASKFTV NF+AG SWLPAT VPFTSGL
Sbjct  479   WRGYHVLTSASEASKFTVSNFLAGNSWLPATGVPFTSGL  517



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/524 (70%), Positives = 427/524 (81%), Gaps = 12/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             +  LQ +   S +  F+     GY   +++SWC +TP PQPCEY+LS    N   IKD+S
Sbjct  3     LARLQILVALSLVPFFLFPVALGYRANDVRSWCRKTPNPQPCEYFLSHDPKNT-PIKDES  61

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F K++ +LAL+ A  A+ NT+SLG KCR+G E AAW DC+ LYE  + +++ TVD    
Sbjct  62    QFFKISMHLALERAARAESNTHSLGPKCRNGREMAAWSDCVNLYELTILRLNKTVDSGTN  121

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
              +  DAQTWLSTALTNLETC  GF++LGV   +LP + SNNVS LISNTLA+NK      
Sbjct  122   LNKDDAQTWLSTALTNLETCQTGFMELGVPDYLLPMM-SNNVSQLISNTLALNKA-----  175

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y +GFP WV+PGDRKLLQSS+ AS A+IVVAQDGSGNYKT+ +A++AA+KRSGS
Sbjct  176   PYQEPTYKDGFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGS  235

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GRYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  236   GRYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  295

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYG
Sbjct  296   GFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYG  355

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK  
Sbjct  356   TVDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPV  415

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTVFMK+ LDSLI+PA W+ WDGNFAL TLYY EY NTG G+ST
Sbjct  416   QSSVKTYLGRPWKQYSRTVFMKTYLDSLINPADWMEWDGNFALKTLYYAEYMNTGPGSST  475

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +NRVKWGGYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  476   SNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/524 (71%), Positives = 438/524 (84%), Gaps = 14/524 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  LQ   I  FL + +S  +  YS +++ SWCS+ PYPQPCEY+L+ +      IK KS
Sbjct  1     MGFLQKFMILLFLPLLLSQTISAYSSSDVTSWCSKMPYPQPCEYFLTHN-PKQAPIKQKS  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLK++  LAL+ A+ A D+T+SL +KC +  EKAAW DCL+LYE+ V +++ T+    +
Sbjct  60    DFLKISMQLALERAQLAHDHTHSLESKCSNEREKAAWADCLQLYEHTVLRLNRTIGH--E  117

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  +AQTWLSTALTNLETC AGFV+LG++ N+LP + SNNVS LISNTLA+N       
Sbjct  118   CTQDEAQTWLSTALTNLETCRAGFVELGISDNVLP-LMSNNVSKLISNTLALNYA-----  171

Query  1140  neattgyteGFPDWVRPGDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                T  YT+ FP WVRP DRKLLQSS+A SKA+IVVA+DGSGNYKT++EA+ AA+K++G+
Sbjct  172   PFTTPNYTKKFPTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASKQTGA  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              RY+IY+KAG Y EN+E+GSKL NIM VGDGIGKTIITGS+SVGGG+TTFKSATVAVVGD
Sbjct  232   ARYIIYIKAGTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGD  291

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GF+ Q ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYG
Sbjct  292   GFVAQDITFRNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYG  351

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK  
Sbjct  352   TVDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSI  411

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTVFMK+ LDSL++ AGW+ WDGNFAL+TLYYGEY NTG G+ST
Sbjct  412   QSSVKTYLGRPWKQYSRTVFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSST  471

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ANRVKW GYHVITSATEA+KFTVG+F+ GGSWLPAT VP+TSGL
Sbjct  472   ANRVKWVGYHVITSATEAAKFTVGSFLVGGSWLPATGVPYTSGL  515



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/524 (70%), Positives = 428/524 (82%), Gaps = 12/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             +  LQ +   S + +F+     GY   +++SWC +TP PQPCEY+LS        IKD+ 
Sbjct  3     LARLQILVALSLVPVFLFPVTLGYRANDVRSWCRKTPNPQPCEYFLSHD-PKKTPIKDEF  61

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F K++ +LAL+ A  A+ NT+SLGTKCR+  EKAAW DC+ LYE  + +++ TVD    
Sbjct  62    QFFKISTHLALERAARAESNTHSLGTKCRNEREKAAWSDCVNLYELTILRLNKTVDSGTN  121

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
              +  DAQTWLSTALTNLETC  GF++LGV   +LP + SNNVS LISNTLA+NK      
Sbjct  122   HNKDDAQTWLSTALTNLETCRTGFMELGVPDYLLPMM-SNNVSQLISNTLALNKA-----  175

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y +GFP WV+PGDRKLLQSS+ AS A+IVVAQDGSGNYKT+ +A++AA+KRSGS
Sbjct  176   PYKEPTYKDGFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGS  235

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GRYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  236   GRYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  295

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYG
Sbjct  296   GFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYG  355

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK  
Sbjct  356   TVDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPV  415

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTVFMK+ LDSLI+PAGW+ WDG+FAL TLYY EY NTG G+ST
Sbjct  416   QSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSST  475

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +NRVKWGGYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  476   SNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/501 (73%), Positives = 428/501 (85%), Gaps = 12/501 (2%)
 Frame = -3

Query  1611  YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYS  1432
             YS  ++KSWCSQTP PQPC+Y+LS+  ++   IK KSDFL ++  LAL+ A  A  NT S
Sbjct  19    YSFDDVKSWCSQTPNPQPCDYFLSQK-TDHSLIKQKSDFLNLSMQLALERAIIAHGNTLS  77

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCR+  EKAAW DCLELYE+ + K++ T+DPN +C+  DAQTWLSTALTNL+TC  G
Sbjct  78    LGSKCRNEREKAAWNDCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDG  137

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F++LGV+  +LP++ SNNVS LISNTL+INK        A   Y  G+P WV+PGDRKLL
Sbjct  138   FIELGVSDYLLPSM-SNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVKPGDRKLL  191

Query  1071  QSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS LK
Sbjct  192   QSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLK  251

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML+GDGIGKTI+TGS+SVGGG+TTFKSATVAVVGDGFI +G+TFRNTAGA+NHQAVAL
Sbjct  252   NIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVAL  311

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP
Sbjct  312   RSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  371

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKS  367
             PNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK     VKTYLGRPWKEYSRTVF+K+
Sbjct  372   PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKT  431

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+ RVKW GYHVITS+TEA+KFT 
Sbjct  432   YLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTA  491

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             GNFI+G SWLP+TNVPFTSGL
Sbjct  492   GNFISGNSWLPSTNVPFTSGL  512



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/501 (73%), Positives = 428/501 (85%), Gaps = 12/501 (2%)
 Frame = -3

Query  1611  YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYS  1432
             YS  ++KSWCSQTP PQPC+Y+LS+  ++   IK KSDFL ++  LAL+ A  A  NT S
Sbjct  19    YSFDDVKSWCSQTPNPQPCDYFLSQK-TDQSLIKQKSDFLNLSMQLALERAIIAHGNTLS  77

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCR+  EKAAW DCLELYE+ + K++ T+DPN +C+  DAQTWLSTALTNL+TC  G
Sbjct  78    LGSKCRNEREKAAWNDCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDG  137

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F++LGV+  +LP++ SNNVS LISNTL+INK        A   Y  G+P WV+PGDRKLL
Sbjct  138   FIELGVSDYLLPSM-SNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVKPGDRKLL  191

Query  1071  QSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS LK
Sbjct  192   QSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLK  251

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML+GDGIGKTI+TGS+SVGGG+TTFKSATVAVVGDGFI +G+TFRNTAGA+NHQAVAL
Sbjct  252   NIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQAVAL  311

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP
Sbjct  312   RSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  371

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKS  367
             PNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK     VKTYLGRPWKEYSRTVF+K+
Sbjct  372   PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKT  431

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+ RVKW GYHVITS+TEA+KFT 
Sbjct  432   YLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTA  491

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             GNFI+G SWLP+TNVPFTSGL
Sbjct  492   GNFISGNSWLPSTNVPFTSGL  512



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/524 (70%), Positives = 428/524 (82%), Gaps = 12/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             +  LQ +   S + +F+     GY   +++SWC +TP PQPCEY+LS        IKD+ 
Sbjct  3     LARLQILVALSLVPVFLFPVALGYRANDVRSWCRKTPNPQPCEYFLSHD-PKKTPIKDEF  61

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F K++ +LAL+ A  A+ NT+SLGTKCR+  EKAAW DC+ LYE  + +++ TVD    
Sbjct  62    QFFKISTHLALERAARAESNTHSLGTKCRNEREKAAWSDCVNLYELTILRLNKTVDSGTN  121

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
              +  DAQTWLSTALTNLETC  GF++LGV   +LP + SNNVS LISNTLA+NK      
Sbjct  122   LNKDDAQTWLSTALTNLETCRTGFMELGVPDYLLPMM-SNNVSQLISNTLALNKA-----  175

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y +GFP WV+PGDRKLLQSS+ AS A+IVVAQDGSGNYKT+ +A++AA+KRSGS
Sbjct  176   PYKEPTYKDGFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGS  235

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GRYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  236   GRYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  295

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYG
Sbjct  296   GFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYG  355

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVD+IFGNAAVVFQ+CNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK  
Sbjct  356   TVDWIFGNAAVVFQDCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPV  415

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTVFMK+ LDSLI+PAGW+ WDG+FAL TLYY EY NTG G+ST
Sbjct  416   QSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSST  475

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +NRVKWGGYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  476   SNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/521 (72%), Positives = 433/521 (83%), Gaps = 18/521 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L F+F+ SFL   +S  + GY+  E+KSWCS+TP PQPCEY+LS +  N   I+ +SDFL
Sbjct  7     LTFLFV-SFL---LSPTILGYNHDEVKSWCSKTPNPQPCEYFLSHNPKNT-PIQHESDFL  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL  A + K NTYSLG+KCR+G EKAAWEDCLELY+ +V  ++ T     KC+ 
Sbjct  62    KISIELALDRAMHGKVNTYSLGSKCRNGLEKAAWEDCLELYQEIVLWLNKTTGS--KCTK  119

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC  GF + G+T  ILP + SNNVS LISNTLAINK        +
Sbjct  120   YDAQTWLSTALTNLETCRTGFAEFGMTDYILPMM-SNNVSKLISNTLAINKA-----PYS  173

Query  1131  ttgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                +  GFP WVRPGDRKLLQSS+ AS+A+IVVAQDGSGN KT+ EA+ AA+KRSGSGRY
Sbjct  174   EPSFNGGFPSWVRPGDRKLLQSSSPASQANIVVAQDGSGNVKTIKEAIVAASKRSGSGRY  233

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVKAG Y ENVE+G K+KN+M+VGDGIGKTI+TGS+SVGGGTTTFKSAT AVVGD FI
Sbjct  234   VIYVKAGTYNENVEVGQKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFI  293

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              + +TFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYREC+IYGTVD
Sbjct  294   ARDMTFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECNIYGTVD  353

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             FIFGNAAVVFQNCNIYARNPPNKTNTITAQGR+DPNQNTGISIHNCKVTAASDLK     
Sbjct  354   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSS  413

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             VKTYLGRPW++YSRTVFMK+ LDSLI+ AGW+PW GNFAL+TLYYGEY NTG G+STANR
Sbjct  414   VKTYLGRPWQKYSRTVFMKTDLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTANR  473

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W GYHVITSA+ AS+FTV +FI+G +WLPATNVPFT+GL
Sbjct  474   VNWKGYHVITSASVASQFTVASFISGNNWLPATNVPFTAGL  514



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/524 (70%), Positives = 425/524 (81%), Gaps = 12/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             +  LQ +   S + +F+     GY   +++SWC +TP PQPCEY+LS         KD+ 
Sbjct  3     LARLQILVALSLVPVFLFPVTLGYRANDVRSWCRKTPNPQPCEYFLSHD-PKKTPTKDEF  61

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F K+  +LAL+ A  A+ NT+SLGTKCRS  EKAAW DC+ LYE  + +++ TVD    
Sbjct  62    QFFKIPTHLALERAARAESNTHSLGTKCRSEREKAAWSDCVNLYELTILRLNKTVDSGTN  121

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
              +  DAQTWLSTALTNLETC  GF++LGV  ++LP + SNNVS LISNTLA+NK      
Sbjct  122   LNKDDAQTWLSTALTNLETCRTGFMELGVPDHLLPMM-SNNVSQLISNTLALNKA-----  175

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y +GFP WV+PGDRKLLQSS+ AS A+IVVAQDGSGNYKT+ +A++AA+KRSGS
Sbjct  176   PYKEPTYKDGFPTWVKPGDRKLLQSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGS  235

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GRYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  236   GRYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  295

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYG
Sbjct  296   GFIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYG  355

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK  
Sbjct  356   TVDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPV  415

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRTVFMK+ LDSLI+PAGW+ WD +FA  TLYY EY NTG G+ST
Sbjct  416   QSSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDDDFAPKTLYYAEYMNTGPGSST  475

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +NRVKWGGYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  476   SNRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/513 (72%), Positives = 426/513 (83%), Gaps = 14/513 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             F++  +S+ + GY+  E+KSWCS+TP PQPCEY+LS +  N   I+ +SDFLK++  LAL
Sbjct  11    FVSFLLSSTILGYNHDEVKSWCSKTPNPQPCEYFLSHNPKNT-PIQHESDFLKISIELAL  69

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLS  1288
               A + K NTYSLG+KCR+G EKAAWEDCLELY+ +V  ++ T     KC+  DAQTWLS
Sbjct  70    DRAMHDKVNTYSLGSKCRNGLEKAAWEDCLELYQEIVLWLNKTTGS--KCTKYDAQTWLS  127

Query  1287  TALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGF  1108
             TALTNL TC  GF + G+T  ILP + SNNVS LISNTLAINK            +  GF
Sbjct  128   TALTNLATCRTGFAEFGMTDYILP-LMSNNVSKLISNTLAINKA-----PYREPSFNGGF  181

Query  1107  PDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGV  931
             P WVRPGDRKLLQSS+ AS+A+IVVAQDGSGN KT+ EA++AA+KRSGSGRYVIYVKAG 
Sbjct  182   PSWVRPGDRKLLQSSSPASQANIVVAQDGSGNVKTIKEAIDAASKRSGSGRYVIYVKAGT  241

Query  930   YKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRN  751
             Y ENVEI  K+KN+M+VGDGIGKTI+TGS+SVGGGTTTFKSAT AVVGD FI + +TFRN
Sbjct  242   YNENVEIARKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTFRN  301

Query  750   TAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAV  571
             TAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDFIFGNAAV
Sbjct  302   TAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAV  361

Query  570   VFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRP  403
             VFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGISIHNCKVTAASDLK     VKTYLGRP
Sbjct  362   VFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRP  421

Query  402   WKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHV  223
             W++YSRTVFMK+ LDSLI+ AGW+PW GNFAL+TLYYGEY NTG G+STANRV W GYHV
Sbjct  422   WQKYSRTVFMKTYLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTANRVNWKGYHV  481

Query  222   ITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ITSA+ AS+FTV NFI+G +WLPAT VPFT+GL
Sbjct  482   ITSASVASQFTVANFISGNNWLPATKVPFTAGL  514



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/501 (72%), Positives = 425/501 (85%), Gaps = 12/501 (2%)
 Frame = -3

Query  1611  YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYS  1432
             YS  ++K WCSQTP+PQPCEY+LS+  ++   IK KSDFL ++  LAL+ A  A  +T+S
Sbjct  19    YSSDDVKPWCSQTPHPQPCEYFLSQK-TDHSLIKQKSDFLNISMQLALERAMIAHGDTFS  77

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCR+  EKAAW DCLELYE+ + K++ T+D N +C+ ADAQTWLSTALTNL+TC  G
Sbjct  78    LGSKCRNEREKAAWNDCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDG  137

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F+DLGV+  +LP + SNNVS LISNTL+INK        A   Y  G+P WV+PGDRKLL
Sbjct  138   FIDLGVSDYVLP-LMSNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVKPGDRKLL  191

Query  1071  QSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS LK
Sbjct  192   QSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLK  251

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML+GDGIGKTI+TGS+SVGGG+TTF SATVAVVGDGFI +G+TFRNTAGA+NHQAVAL
Sbjct  252   NIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVAL  311

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGTVDFIFGNAAVVFQNCNIY RNP
Sbjct  312   RSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYVRNP  371

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKTYLGRPWKEYSRTVFMKS  367
             PNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK     VKTYLGRPWKEYSRTVF+K+
Sbjct  372   PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKT  431

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LDSLI+ AGW+ W G+FAL TLYYGEY NTG G+ST+ RV W GYHVITS+TEA+KFTV
Sbjct  432   YLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTV  491

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             GNFI+G SWLP+TNVPFTSGL
Sbjct  492   GNFISGNSWLPSTNVPFTSGL  512



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/524 (70%), Positives = 434/524 (83%), Gaps = 14/524 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  LQ   I  FL + +S  +  YS +++ SWCS+ PYPQPCEY+L+ +      IK KS
Sbjct  1     MGFLQKFMILLFLPLLLSQTISAYSSSDVTSWCSKMPYPQPCEYFLTHN-PKQAPIKQKS  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DFLK++  LAL+ A+ A D+T+SL +KC +  EK AW DCL+LYE+ V +++ T+  +  
Sbjct  60    DFLKISMQLALERAQLAHDHTHSLESKCSNEREKVAWADCLQLYEHTVLRLNRTIGHD--  117

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  +AQTWLSTALTNLETC AGFV+LG++ N+LP + SNNVS LISNTLA+N       
Sbjct  118   CTQDEAQTWLSTALTNLETCRAGFVELGISDNVLP-LMSNNVSKLISNTLALNYA-----  171

Query  1140  neattgyteGFPDWVRPGDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                T  YT+ FP WVRP DRKLLQSS+A SKA+IVVA+D SGNYKT++EA+ AA+KR+G+
Sbjct  172   PFTTPNYTKKFPTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAITAASKRTGT  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              RY+IY+KAG Y EN+E+GSKL NIM +GDGIGKTIITGS+SVGGG+TTF SATVAVVGD
Sbjct  232   ARYIIYIKAGTYNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  291

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYG
Sbjct  292   GFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYG  351

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK  
Sbjct  352   TVDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSI  411

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VKTYLGRPWK+YSRT+FMK+ LDSL++ AGW+ WDGNFAL+TLYYGEY NTG G+ST
Sbjct  412   QSSVKTYLGRPWKQYSRTIFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSST  471

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NRVKW GYHVITSATEA+KFTVG+F+AGGSWLPAT VP+TSGL
Sbjct  472   TNRVKWAGYHVITSATEAAKFTVGSFLAGGSWLPATGVPYTSGL  515



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/502 (72%), Positives = 424/502 (84%), Gaps = 12/502 (2%)
 Frame = -3

Query  1614  GYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTY  1435
             GYS  ++KSWCSQTPYPQPCEY+LS    +   IK KSDFL ++  +AL+ A  A  N +
Sbjct  19    GYSSHDVKSWCSQTPYPQPCEYFLSHK-PDHSPIKQKSDFLNISMQVALEQAMTAHGNIF  77

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHA  1255
             SLG+KCR+  EKAAW DC+ELY++ + K++ T+DPN +C+  DAQTWLSTALTNL+TC  
Sbjct  78    SLGSKCRNEREKAAWNDCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQD  137

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             GF++LGV+ + LP + SNNVS LISNTL+INK        A   Y  G+P WV+PGDRKL
Sbjct  138   GFIELGVSDHFLPLI-SNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVKPGDRKL  191

Query  1074  LQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKL  898
             LQSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS L
Sbjct  192   LQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGL  251

Query  897   KNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVA  718
             KNI L+GDGIGKTI+TGSRSVGGG+TT+ SATVAVVGDGFI +G+T RNTAGA+NHQAVA
Sbjct  252   KNITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTIRNTAGASNHQAVA  311

Query  717   LRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARN  538
             LRSGSDLSV+YQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQ CNIYARN
Sbjct  312   LRSGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQKCNIYARN  371

Query  537   PPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKTYLGRPWKEYSRTVFMK  370
             PPNK NT+TAQGR+DPNQNTGISIH+C+VTAASDLK     VKTYLGRPWKEYSRTVF+K
Sbjct  372   PPNKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLK  431

Query  369   SSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFT  190
             + LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+ RV W GYHVITS+TEA+KFT
Sbjct  432   TYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFT  491

Query  189   VGNFIAGGSWLPATNVPFTSGL  124
             VGNFI+G SWLP+TNVPFTSGL
Sbjct  492   VGNFISGNSWLPSTNVPFTSGL  513



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/501 (72%), Positives = 424/501 (85%), Gaps = 12/501 (2%)
 Frame = -3

Query  1611  YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYS  1432
             +S  ++KSWC QTPYPQPCEY+LS    +   IK KSDFL ++  LAL++A  A  +T+S
Sbjct  20    HSSDDVKSWCRQTPYPQPCEYFLSHK-PDHSPIKQKSDFLNISMQLALEHAMIAHGDTFS  78

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCR+  EKAAW DCLELY++ + K++ T+DPN +C+ ADAQTWLSTALTNL+TC  G
Sbjct  79    LGSKCRNEREKAAWNDCLELYDHTILKLNKTLDPNTRCTQADAQTWLSTALTNLQTCQDG  138

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F++LGV+G+ LP + SNNVS LISNTL+INK        +   Y  G+P WV+PGDRKLL
Sbjct  139   FIELGVSGHFLP-LMSNNVSKLISNTLSINK-----VPYSVPTYKGGYPTWVKPGDRKLL  192

Query  1071  QSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS+ AS+A+IVV++DG+ +Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS LK
Sbjct  193   QSSSLASQANIVVSKDGTHDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLK  252

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML+GDGIGKTI+TGS+SVGGG+TT+ SATVAVVGDGFI +G+TFRNTAGA+NHQAVAL
Sbjct  253   NIMLLGDGIGKTIVTGSKSVGGGSTTYNSATVAVVGDGFIARGMTFRNTAGASNHQAVAL  312

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSVFYQCSFEGYQDTLY YS+RQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP
Sbjct  313   RSGSDLSVFYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  372

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKTYLGRPWKEYSRTVFMKS  367
             PNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK     VK YLGRPWKEYSRTVF+K+
Sbjct  373   PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSSVKIYLGRPWKEYSRTVFLKT  432

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LDSLI+ AGW+ W G+FAL TLYYGEY NTG G+ST+ RV W GYHVITS+TEA+KFTV
Sbjct  433   YLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTV  492

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             GNFI+G SWLP+T VPFTSGL
Sbjct  493   GNFISGNSWLPSTKVPFTSGL  513



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/488 (75%), Positives = 416/488 (85%), Gaps = 14/488 (3%)
 Frame = -3

Query  1572  PYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAA  1393
             PYPQPCEY+L+        IK KSDFLKV+  LAL+ A+ A  NT+SLG+KC +  EKAA
Sbjct  2     PYPQPCEYFLTHD-PKQASIKQKSDFLKVSMQLALERAQMAHSNTHSLGSKCSNEHEKAA  60

Query  1392  WEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPA  1213
             W DCL+LYE  + +++ T+  +  C+  +AQTWLSTALTNLETC AGFV+LGV+GN+LP 
Sbjct  61    WADCLQLYEYTILRLNRTIVHD--CTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLP-  117

Query  1212  VTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA-SKADIVV  1036
             + SNNVS LISNTLA+N          T  YT+ FP WVRPGDRKLLQSS+A SKA+I+V
Sbjct  118   LMSNNVSKLISNTLALN-----YAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIV  172

Query  1035  AQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKti  856
             AQDGSGNYKT++EA+ AA+KRSG+ RY+IY+KAG Y ENVE+GSKL+NIM VGDGIGKTI
Sbjct  173   AQDGSGNYKTISEAITAASKRSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTI  232

Query  855   itgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCS  676
             ITGS+SVGGG+TTF SATVAVVGDGFI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C 
Sbjct  233   ITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCG  292

Query  675   FEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRS  496
             FEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNAAVV QNCNIYARNPPNK NT+TAQGR+
Sbjct  293   FEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARNPPNKVNTVTAQGRT  352

Query  495   DPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLP  328
             DPNQNTGISIHNCKVTAASDLK     VKTYLGRPW+EYSRTVFMK+ LDSLI+ AGW+ 
Sbjct  353   DPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWME  412

Query  327   WDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPAT  148
             WDGNFAL+TLYYGEY NTG G+STA+RV W GYHVITSATEASKFTVG+FIAGGSWLPAT
Sbjct  413   WDGNFALDTLYYGEYLNTGPGSSTASRVTWAGYHVITSATEASKFTVGSFIAGGSWLPAT  472

Query  147   NVPFTSGL  124
              VP+TSGL
Sbjct  473   GVPYTSGL  480



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/519 (71%), Positives = 424/519 (82%), Gaps = 16/519 (3%)
 Frame = -3

Query  1659  FICSFLAI--FVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
              + +FL +   +S+ + GY+  E+ SWCS+TP P PCEY+LS  + N   I  +SDFLK+
Sbjct  5     IVLTFLLVPFLLSSTILGYNSDEVMSWCSKTPNPHPCEYFLSHDHRNT-PITHESDFLKI  63

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL  A   K NTYSLG+KCR+G EKAAWEDCLELYE+ +  +  T     KC+  D
Sbjct  64    SMQLALDRAMQGKVNTYSLGSKCRNGLEKAAWEDCLELYEDTILWLTQTTSS--KCTDYD  121

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC  GF D G+T  ILP + +NNVS LISNTLAINK        +  
Sbjct  122   AQTWLSTALTNLETCRTGFTDFGMTDFILP-LMNNNVSKLISNTLAINK-----VPYSEP  175

Query  1125  gyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
              Y EGFP W+RPGDRKLLQSS+ AS+A+IVVA DGSGN KT+ EA++AA+KRSGSGRYVI
Sbjct  176   SYKEGFPSWLRPGDRKLLQSSSPASQANIVVATDGSGNVKTIKEAIDAASKRSGSGRYVI  235

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVKAG Y ENVE+G K+KN+M VGDGIGKTI+TGS+S GGGTTTF+SAT A VGD FI +
Sbjct  236   YVKAGTYNENVEVGKKVKNVMFVGDGIGKTIVTGSKSAGGGTTTFRSATFAAVGDNFIAR  295

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              +TFRNTAGA NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDFI
Sbjct  296   DMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFI  355

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVK  421
             FGNAAVVFQNCNIY R+PPNKTNTITAQGR+DPNQNTGISIHNC+VTAASDLK     VK
Sbjct  356   FGNAAVVFQNCNIYPRSPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASDLKPVQGSVK  415

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPWKEYSRTVFMK+ LDSLI+PAGWLPW+GNFAL+TLYYGEY NTG G+STANRV 
Sbjct  416   TYLGRPWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALDTLYYGEYMNTGPGSSTANRVN  475

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GY VITS+T AS+FTVG+FI+G +WLPATNVPFT+GL
Sbjct  476   WKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/519 (72%), Positives = 424/519 (82%), Gaps = 15/519 (3%)
 Frame = -3

Query  1662  IFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             I +  FL  F+ S+ + GY+  E+ SWCS+TP PQPCEY+LS  + N   I  +SDFLK+
Sbjct  5     IVLTYFLVPFLLSSTIVGYNSDEVMSWCSKTPNPQPCEYFLSHDHRNT-PITHESDFLKI  63

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL  A   K NTYSLG+KCR+G EKAAWEDCLELYE+ +  +  T     KC+  D
Sbjct  64    SMQLALDRAMQGKVNTYSLGSKCRNGLEKAAWEDCLELYEDSILWLTKTTSS--KCTDYD  121

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC  GF + G+T  ILP + SNNVS LISNTLAINK        +  
Sbjct  122   AQTWLSTALTNLETCRTGFTEFGMTDFILP-LMSNNVSKLISNTLAINK-----VPYSEP  175

Query  1125  gyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
              Y EGFP WVRPGDRKLLQSS+ AS+A+IVVA DGSGN KT+ EA++AA+KRSGSGRYVI
Sbjct  176   SYKEGFPSWVRPGDRKLLQSSSPASQANIVVATDGSGNVKTIKEAIDAASKRSGSGRYVI  235

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVKAG Y ENVE+G K+KN+M VGDGIGKTI+TGS+S GGGTTTFKSAT AVVGD FI +
Sbjct  236   YVKAGTYNENVEVGKKVKNVMFVGDGIGKTIVTGSKSAGGGTTTFKSATFAVVGDNFIAR  295

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              +TFRNTAGA NHQAVALRSGSD SVFY+CSFEGYQDTLYVYS RQFYRECDIYGTVDFI
Sbjct  296   DMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDTLYVYSQRQFYRECDIYGTVDFI  355

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVK  421
             FGNAAVVFQNCNIYAR+PPNK  TITAQGR+DPNQNTGISIHNC+VTAASDLK     VK
Sbjct  356   FGNAAVVFQNCNIYARSPPNKIITITAQGRTDPNQNTGISIHNCRVTAASDLKPVQGSVK  415

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPWK+YSRTVFMK+ LDSLI+PAGW PW+GNFAL+TLYYGEY NTG G+STANRV 
Sbjct  416   TYLGRPWKQYSRTVFMKTFLDSLINPAGWSPWNGNFALDTLYYGEYMNTGPGSSTANRVN  475

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GY VITS+T AS+FTVG+FI+G +WLPATNVPFT+GL
Sbjct  476   WKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/515 (72%), Positives = 423/515 (82%), Gaps = 11/515 (2%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-IKDKSDFLKV  1486
             +F+   L  F+S+ V  YS  ++K WCSQTP P+PCEY+LS + ++  + IK KS+F K+
Sbjct  6     LFLALSLPFFLSSFVSSYSWNDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSEFFKL  65

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LA + A N   NT SLG+KCR+  E AAW DC+ELYE  ++K++ T+DP+ K S  D
Sbjct  66    SLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNKTLDPSTKFSQVD  125

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
              QTWLSTALTNLETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK           
Sbjct  126   TQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VEYEEP  179

Query  1125  gyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
              Y +GFP WV+PGDR+LLQ SS ASKA++VVA+DGSG Y TV+EAVNAA K S SGRYVI
Sbjct  180   SYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-SNSGRYVI  238

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDGFI Q
Sbjct  239   YVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGFITQ  296

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGTVDFI
Sbjct  297   DITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  356

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLG  409
             FGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL GV+TYLG
Sbjct  357   FGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMGVRTYLG  416

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW++YSRTVFMK+ LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STANRV W GY
Sbjct  417   RPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLGY  476

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             HVITSA+EASKFTVGNFIAG SWLPAT+VPFTSGL
Sbjct  477   HVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  511



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 424/516 (82%), Gaps = 12/516 (2%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-IKDKSDFLK  1489
             ++ +C  +  F+S+ V  YS  ++K WCSQTP P+PCEY+LS + ++  + IK KSDF K
Sbjct  1     YLILC-IVPFFLSSFVSSYSWNDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSDFFK  59

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             ++  LA + A N   NT SLG+KCR+  E AAW DC+ELYE  ++K++ T+DP+ K S  
Sbjct  60    LSLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNKTLDPSTKFSQV  119

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
             D QTWLSTALTNLETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK          
Sbjct  120   DTQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VEYEE  173

Query  1128  tgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
               Y +GFP WV+PGDR+LLQ SS ASKA++VVA+DGSG Y TV+EAVNAA K S SGRYV
Sbjct  174   PSYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-SNSGRYV  232

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDGFI 
Sbjct  233   IYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGFIT  290

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGTVDF
Sbjct  291   QDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  350

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYL  412
             IFGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL GV+TYL
Sbjct  351   IFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMGVRTYL  410

Query  411   GRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGG  232
             GRPW++YSRTVFMK+ LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STANRV W G
Sbjct  411   GRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLG  470

Query  231   YHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YHVITSA+EASKFTVGNFIAG SWLPAT+VPFTSGL
Sbjct  471   YHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  506



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/521 (71%), Positives = 419/521 (80%), Gaps = 14/521 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L+ +    F+ +  ST V GY   E++SWC +TP P PCEY+LS    N   IK +SDFL
Sbjct  3     LRVLIALFFVPLLFSTTVLGYDHLEVQSWCKKTPNPGPCEYFLSHEPQNI-PIKQESDFL  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++K LAL+ A +A+ +TYSLG KCR+  EKAAW DCLELYE  V  ++ T     KCS 
Sbjct  62    KISKQLALERALHAQAHTYSLGKKCRNEREKAAWADCLELYEYTVLWLNQTTTS--KCSK  119

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC  GF +LGV+  ILP + SNNVS LI NTLA+NK         
Sbjct  120   YDAQTWLSTALTNLETCKTGFEELGVSDYILP-LMSNNVSKLICNTLALNK-----VPYT  173

Query  1131  ttgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                Y EGFP W++PGDRKLLQS S AS+A+IVVAQDGSGNYKT+ EAV AA+KRSG+GRY
Sbjct  174   EPSYKEGFPTWLKPGDRKLLQSTSPASQANIVVAQDGSGNYKTINEAVAAASKRSGTGRY  233

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             +IYVK+G YKENV+IG  LKNIM VGDGIGKTI+TGS+SVGGG TTF SAT AVVGDGFI
Sbjct  234   IIYVKSGTYKENVQIGKSLKNIMFVGDGIGKTIVTGSKSVGGGATTFNSATFAVVGDGFI  293

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              + +TFRNTAG  NHQAVALRSG+DLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVD
Sbjct  294   ARDMTFRNTAGPQNHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVD  353

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             FIFGNAAVV QNCNIY RNPPNKTNT+TAQGR+DPNQNTGISIHN +VTAASDL      
Sbjct  354   FIFGNAAVVLQNCNIYPRNPPNKTNTLTAQGRTDPNQNTGISIHNSRVTAASDLTPVQGS  413

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             V+TYLGRPWK+YSRTVFMK+ LDSLI+PAGW+ W GNFAL+TLYYGEY NTG G+STANR
Sbjct  414   VRTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANR  473

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W GYHVITS TEAS+FTVGNFI+G SWLP TNVPFTSGL
Sbjct  474   VNWKGYHVITSPTEASQFTVGNFISGNSWLPGTNVPFTSGL  514



>gb|KHN35617.1| Pectinesterase 2 [Glycine soja]
Length=511

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/515 (72%), Positives = 422/515 (82%), Gaps = 11/515 (2%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-IKDKSDFLKV  1486
             +F+   +  F+S+ V  YS  ++K WCSQTP P+PCEY+LS + ++  + IK KSDF K+
Sbjct  6     LFLTLSVPFFLSSFVSSYSWNDVKLWCSQTPNPEPCEYFLSNNPTHQYKPIKQKSDFFKL  65

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LA + A N   NT SLG+KCR+  E AAW DC+ELYE  ++K++ T+DP+ K S  D
Sbjct  66    SLQLAQERALNGHANTLSLGSKCRNPRETAAWADCVELYEQTIRKLNKTLDPSTKFSQVD  125

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
              QTWLSTALTNLETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK           
Sbjct  126   TQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VEYEEP  179

Query  1125  gyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
              Y +GFP WV+PGDR+LLQ SS ASKA++VVA+DGSG Y TV+EAVNAA K S SGRYVI
Sbjct  180   SYKDGFPTWVKPGDRRLLQASSPASKANVVVAKDGSGKYTTVSEAVNAAPK-SNSGRYVI  238

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDGFI Q
Sbjct  239   YVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDGFITQ  296

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGTVDFI
Sbjct  297   DITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  356

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLG  409
             FGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL GV+TYLG
Sbjct  357   FGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMGVRTYLG  416

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW++YSRTVFMK+ LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STANRV W GY
Sbjct  417   RPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLGY  476

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             HVITSA+EASKFTVGNFIAG SWL AT+VPFTSGL
Sbjct  477   HVITSASEASKFTVGNFIAGNSWLLATSVPFTSGL  511



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/513 (72%), Positives = 423/513 (82%), Gaps = 16/513 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             FL +++S  +FGYSP ++K+WCSQTP+P+ CE +LS + +    IK+KS F K++  LAL
Sbjct  10    FLVLYLSQIIFGYSPNDVKTWCSQTPHPKLCEDFLSHNPTTT-PIKEKSQFFKISTQLAL  68

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLS  1288
               A +A+ N +SLG+K ++  EK AW DCLEL++  +QK++ TV+P+ KC+  D QTWLS
Sbjct  69    DRAIHAQTNMHSLGSKFQNAHEKTAWADCLELFDFTIQKLNRTVNPSTKCTQYDKQTWLS  128

Query  1287  TALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG  1111
             TALTNLETC  GF DLGV+ N I P+V SNNVS LISNTLAINK            +  G
Sbjct  129   TALTNLETCREGFADLGVSNNYIFPSV-SNNVSNLISNTLAINKA----PYTPQPNHKNG  183

Query  1110  FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGV  931
             FP WV+PGDRKLLQSS+ + AD+VVA+DGSGNYKT++EAV+AA+KR GS RYVIYVKAG 
Sbjct  184   FPTWVKPGDRKLLQSSSPT-ADVVVAKDGSGNYKTISEAVSAASKRKGSARYVIYVKAGT  242

Query  930   YKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRN  751
             YKENV+I  K KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDGFI Q ITF+N
Sbjct  243   YKENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFQN  300

Query  750   TAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAV  571
             TAG  + QAVALRSGSDLSVFY+C FEG QDTLYVYSDRQFYRECDIYGTVDFIFGNAAV
Sbjct  301   TAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVYSDRQFYRECDIYGTVDFIFGNAAV  360

Query  570   VFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRP  403
             VFQNCNIY  N  +KTNTITAQGRSDPNQNTGISIHNC+VTAASDLK V    KTYLGRP
Sbjct  361   VFQNCNIYVHN--HKTNTITAQGRSDPNQNTGISIHNCRVTAASDLKSVQSSVKTYLGRP  418

Query  402   WKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHV  223
             W+EYSRTVFMK+ LDSLIDPAGW+ W GNFAL TLYYGEY NTG G+ST+NRVKW GYHV
Sbjct  419   WREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYHV  478

Query  222   ITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ITSA+EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  479   ITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>ref|XP_010325628.1| PREDICTED: pectinesterase 2 [Solanum lycopersicum]
Length=524

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/524 (69%), Positives = 421/524 (80%), Gaps = 5/524 (1%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK  1504
             M N+  IF   F++ F+  +   GYS   IK+WC+QTP+PQPCEY+LS++      I  K
Sbjct  1     MANIHLIFPLLFISCFIFPSTTNGYSNAIIKAWCTQTPHPQPCEYFLSQNPKITSPIVKK  60

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
             SDFLKV+ +L L  A  A+ NTYSLG KCR+  EK AW DC+ELYEN + KI +TVDPN 
Sbjct  61    SDFLKVSLDLVLDRALRAQLNTYSLGPKCRNEREKNAWADCIELYENSINKIKSTVDPNT  120

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGF-tt  1147
             KCS  DAQTWLSTALTNLETC AGF +LGVT  ++P +++NNVS LISN LA+N G+ T 
Sbjct  121   KCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLMSNNNVSSLISNALALNHGYYTE  180

Query  1146  tnneattgyteGFPDWVRPGDRKLLQSSAASKA---DIVVAQDGSGNYKTVTEAVNAAAK  976
                 +T+   +GFP WV PGDRKLLQSS++S A   ++VVA DGSG++KTV EAV+AAAK
Sbjct  181   PTKSSTSTQVDGFPTWVSPGDRKLLQSSSSSTASQANVVVATDGSGDFKTVKEAVDAAAK  240

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
               GSGR+VIYVKAG Y ENVEIG K+KN+ML+GDGIGKTIITGS+SVGGG+TTF+SATV 
Sbjct  241   NKGSGRFVIYVKAGTYNENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTFRSATVG  300

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
               GDGFI QGIT RNTAG   HQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY+EC
Sbjct  301   ASGDGFIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYKEC  360

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASD  436
             DIYGTVDFIFGNAAVV QNCNI+AR+PPNK NT+TAQGR+DPNQNTGISIHNC++T A  
Sbjct  361   DIYGTVDFIFGNAAVVLQNCNIFARDPPNKINTVTAQGRTDPNQNTGISIHNCRITGAGS  420

Query  435   LKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
              K  +TYLGRPW++YSRTV MK+ LD LI   GWLPW GNFALNTLYYGEY NTG G+ST
Sbjct  421   SKSARTYLGRPWQKYSRTVVMKTFLDGLISSEGWLPWSGNFALNTLYYGEYLNTGPGSST  480

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NRV WGGY VITS+ EASKFT  NFIAG SW+PATNVPFTSGL
Sbjct  481   GNRVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL  524



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/512 (71%), Positives = 421/512 (82%), Gaps = 14/512 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             FL +++S  +FGYSP ++K+WC+QTP+P+ C+ +LS + +    IK+KS F K++  LAL
Sbjct  10    FLVLYLSPIIFGYSPNDVKTWCTQTPHPKLCKDFLSHNPTTT-PIKEKSQFFKISTQLAL  68

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLS  1288
               A +A+ N YSLG+K ++  EK AW+DC EL++  +QK++ TV+P  KC+  D+QTWLS
Sbjct  69    DRAIHAQTNMYSLGSKFQNAHEKTAWDDCHELFDFTIQKLNKTVNPITKCTQDDSQTWLS  128

Query  1287  TALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGF  1108
             TALTNLETC  GF DLGV+ N +    SNNVS LISNTLAINK        +   Y  GF
Sbjct  129   TALTNLETCREGFADLGVSNNYIFPSMSNNVSNLISNTLAINKA----PFTSQPNYKNGF  184

Query  1107  PDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVY  928
             P WV+PGDRKLLQSS+A KAD+VVA+DGSGNYKT++EAV+AA+KR GS RYVIYVKAG Y
Sbjct  185   PTWVKPGDRKLLQSSSA-KADVVVAKDGSGNYKTISEAVSAASKRKGSARYVIYVKAGTY  243

Query  927   KENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNT  748
             KENV+I  K KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDGFI Q ITF+NT
Sbjct  244   KENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQDITFQNT  301

Query  747   AGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVV  568
             AG  + QAVALRSGSDLSVFY+C FEG QDTLYV+SDRQFYRECDIYGTVDFIFGNAAVV
Sbjct  302   AGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVHSDRQFYRECDIYGTVDFIFGNAAVV  361

Query  567   FQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPW  400
              QNCNIY  N  +KTNT+TAQGRSDPNQNTGISIHNCKVTAASDLK V    KTYLGRPW
Sbjct  362   LQNCNIYVHN--HKTNTVTAQGRSDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPW  419

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             +EYSRTVFMK+ LDSLIDPAGW+ W GNFAL TLYYGEY NTG G+ST+NRVKW GYHVI
Sbjct  420   REYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYHVI  479

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             TSA+EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  480   TSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/513 (72%), Positives = 421/513 (82%), Gaps = 17/513 (3%)
 Frame = -3

Query  1647  FLAIFVSTAV-FGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLA  1471
             FL +F+S  V FGYSP ++++WCSQTP+PQPCE +LS +  N   IK KS F K++  LA
Sbjct  10    FLVLFLSPLVIFGYSPNDVRTWCSQTPHPQPCESFLSHN-PNNIPIKGKSQFFKISTQLA  68

Query  1470  LQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWL  1291
             L  A  A  N YSLG+KC++  EKAAW DCLELY+  +QK++ ++DP    +  DAQ+WL
Sbjct  69    LDRAILAHTNLYSLGSKCQNAHEKAAWADCLELYDYTIQKLNKSIDPTNGATQNDAQSWL  128

Query  1290  STALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG  1111
             STALTNLETC AGFVDL V+ N L  + SNNVS LISNTL++NK        +   Y +G
Sbjct  129   STALTNLETCRAGFVDLAVSNNQL--MPSNNVSNLISNTLSVNK----VPYTSQPEYKQG  182

Query  1110  FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGV  931
             FP WV+PGDRKLL+SS+  KADIVVA+DGSGNYKT+ EA++AA+KR GSGRYVIYVKAG 
Sbjct  183   FPTWVKPGDRKLLKSSSP-KADIVVAKDGSGNYKTINEAISAASKRKGSGRYVIYVKAGS  241

Query  930   YKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRN  751
             YKENV+I  KL NIML+GDGIGKTIITGS+SVGGGTTTF SATVAVVGDGFI QGITF N
Sbjct  242   YKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDGFIAQGITFEN  299

Query  750   TAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAV  571
             TAG  + QAVALRSGSDLSVFY+CSFEG QDTLYV+S+RQFYRECDIYGTVDFIFGNAAV
Sbjct  300   TAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIFGNAAV  359

Query  570   VFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRP  403
             V QN NIY  N  +KTNTITAQGR+DPNQNTGISIHNCKVTAASDLK     VKTYLGRP
Sbjct  360   VIQNSNIYVHN--HKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTYLGRP  417

Query  402   WKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHV  223
             WK+YSRTVFMK+ LDSLI+PAGW+ W G+FAL TLYYGEY NTG GAST NRV W GYHV
Sbjct  418   WKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYHV  477

Query  222   ITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ITSA+EASKF+VGNFIAGGSWLPATNVPFTSGL
Sbjct  478   ITSASEASKFSVGNFIAGGSWLPATNVPFTSGL  510



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/517 (70%), Positives = 416/517 (80%), Gaps = 14/517 (3%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
              I  FL + +S  +  YS +E+KSWC + PY Q CEY+LS+S      +K KSDFL+ + 
Sbjct  1     MIPLFLPLLLSQTISCYSSSEVKSWCGKMPYSQSCEYFLSQS-PKQTPLKQKSDFLRASM  59

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQ  1300
              +AL+ A+ A  NTYSLG +CR+  E+ AW DCL+LY++ + +++ T+  N +C+  D Q
Sbjct  60    QVALERAQLAWTNTYSLGPRCRNEHERVAWADCLQLYKHTILRLNHTI--NRQCTQDDKQ  117

Query  1299  TWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgy  1120
             TWLSTALTNLETC AGFV+LGV+ N+LP + SNNVS LI N L+ N          T  Y
Sbjct  118   TWLSTALTNLETCRAGFVELGVSDNVLP-LMSNNVSELIRNILSANH-----VPYVTPNY  171

Query  1119  teGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
             T  FP WVRPGDRKLLQSS AASKA+IVVAQDGSGNYKT++EA+   +KRSG+ RY+IY+
Sbjct  172   TNEFPTWVRPGDRKLLQSSSAASKANIVVAQDGSGNYKTISEAITTTSKRSGTTRYIIYI  231

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             KAG Y ENV +G+ L NIM VGDGIGKTIITGS+SVGGG+TTF SATVA+VGDGFI Q I
Sbjct  232   KAGTYNENVGVGTNLVNIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAIVGDGFIAQDI  291

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TFRNTAGAANHQAVALRSGSDLS+FYQC FEGYQDTLYVYS RQFY+ECDIYGTVDFIFG
Sbjct  292   TFRNTAGAANHQAVALRSGSDLSIFYQCGFEGYQDTLYVYSARQFYKECDIYGTVDFIFG  351

Query  582   NAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTY  415
             NAAVV QNCNIYARNPPNK NTITAQGR+DPNQNTGISIHNCKVTAASDL      VKTY
Sbjct  352   NAAVVLQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNCKVTAASDLTSVQSSVKTY  411

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW++YSRTVF+K+ LDSLID AGWL W+G+FAL TL YGEY NTG G+ST NRVKW 
Sbjct  412   LGRPWQKYSRTVFLKTYLDSLIDSAGWLEWNGSFALTTLNYGEYMNTGPGSSTTNRVKWI  471

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GYHVITSATEASKFTVGNFIAGGSWLPAT VP+ S L
Sbjct  472   GYHVITSATEASKFTVGNFIAGGSWLPATGVPYISSL  508



>emb|CDP08022.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/508 (73%), Positives = 420/508 (83%), Gaps = 17/508 (3%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFG--YSPTEIKSWCSQTPYPQPCEYYLSRS--YSNGGQIKDKSDF  1495
             IF+  F+ +FVS A+      P  IKSWC+QTPYPQPCEY+LS+S  Y     IK KSDF
Sbjct  7     IFL--FMTVFVSPALARNIPPPPSIKSWCAQTPYPQPCEYFLSQSPKYGYNYPIKGKSDF  64

Query  1494  LKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCS  1315
              K++ NLAL+ A +A++NT +LG+KCR   EKAAWEDCLELYE+ + KI+ TVDP  KC+
Sbjct  65    FKMSLNLALERAVHAQENTNNLGSKCRDEREKAAWEDCLELYESTIVKINKTVDPYTKCN  124

Query  1314  TADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnne  1135
               DAQTWLSTALTNLETC  GF++LGV  +++P + SNNVS LISNTL++NK        
Sbjct  125   AVDAQTWLSTALTNLETCKQGFIELGVADHLVP-LMSNNVSCLISNTLSLNK-----VGY  178

Query  1134  attgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                 Y EGFP WV PGDRKLLQSS+ +  + VVAQDGSGN+KTV  AV AAA RSG+GRY
Sbjct  179   NEPSYKEGFPTWVTPGDRKLLQSSSPT-PNAVVAQDGSGNFKTVAAAVAAAATRSGNGRY  237

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VI+VKAG YKENVEIG+KLKNIMLVGDGIGKTII GS SVGGGTTTFKSATVAVVGDGFI
Sbjct  238   VIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIIMGSNSVGGGTTTFKSATVAVVGDGFI  297

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              +GITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY ECD+YGTVD
Sbjct  298   ARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGTVD  357

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             +IFGNAAVVFQNCN+Y+RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK     
Sbjct  358   YIFGNAAVVFQNCNLYSRNPPNKINTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQSS  417

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             VKTYLGRPW++YSRTVFMK+ LD LIDPAGWLPW GNFAL+TLYYGEY+NTG G+STANR
Sbjct  418   VKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGPGSSTANR  477

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGS  163
             V W GYH+ITSATEASKFTVGNFI  G+
Sbjct  478   VSWKGYHLITSATEASKFTVGNFIPVGA  505



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/507 (71%), Positives = 414/507 (82%), Gaps = 14/507 (3%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA  1450
             S  V GY+  E++SWCS+TP P PCEY+LS +  N   I  +SDFLK++  LALQ A +A
Sbjct  17    SPTVLGYNHIEVQSWCSKTPNPGPCEYFLSHNPKNT-PITHESDFLKISTELALQRAIHA  75

Query  1449  KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNL  1270
             + NTYSLGTKCR+  EK AW DCLELYE  V  ++ T     KC+  DAQTWLSTALTNL
Sbjct  76    QVNTYSLGTKCRNEREKTAWADCLELYEYAVLWLNHTTTS--KCTKYDAQTWLSTALTNL  133

Query  1269  ETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRP  1090
             ETC  GF++LGV+  +LP + SNNVS LISNTLAIN             Y  GFP WV+P
Sbjct  134   ETCRTGFMELGVSDYVLP-LMSNNVSKLISNTLAINN-----VPYEEPTYKGGFPTWVKP  187

Query  1089  GDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVE  913
             GDRKLLQ++  AS+A+IVVA+DGSGN+KT+ EAV AA+KRSGSGR++IYVKAGVY ENVE
Sbjct  188   GDRKLLQTTTPASQANIVVAKDGSGNFKTINEAVAAASKRSGSGRFIIYVKAGVYNENVE  247

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             IG+KLKN+M VGDGIGKTI+TGS+SVGGG TTF+SAT AVVG+GFI + +TFRNTAG  N
Sbjct  248   IGTKLKNLMFVGDGIGKTIVTGSKSVGGGATTFRSATFAVVGEGFIARDMTFRNTAGPEN  307

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
             HQAVALRSG+DLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDFIFGNAAVV QNCN
Sbjct  308   HQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCN  367

Query  552   IYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSR  385
             I+ARNPPN+TNT+TAQGR+DPNQNTGISIHN +VTAASDL      V+TYLGRPWKEYSR
Sbjct  368   IFARNPPNRTNTLTAQGRTDPNQNTGISIHNSRVTAASDLSPVQSSVRTYLGRPWKEYSR  427

Query  384   TVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATE  205
             TVFMK+ LDSLI+PAGW+ W GNFAL+TLYYGEY NTG G+STANRV W GY VITSA E
Sbjct  428   TVFMKTFLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVTWKGYRVITSAAE  487

Query  204   ASKFTVGNFIAGGSWLPATNVPFTSGL  124
             AS+FTV NFI+G SWLP TNVPFT GL
Sbjct  488   ASQFTVQNFISGNSWLPGTNVPFTPGL  514



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/521 (68%), Positives = 422/521 (81%), Gaps = 12/521 (2%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L  I    F++  +S     + P  +K WCSQTPYPQPC++Y+S +  + G +K  SDF 
Sbjct  3     LPLILTLVFISFLLSPGYSDHIPPNVKLWCSQTPYPQPCDFYMSHNPRSSG-LKRHSDFN  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             +++  +AL  A  A++N   LG KCR+  EKAAW DCLELYEN + +++ TV+P+  C+ 
Sbjct  62    RLSMQIALDRALRAENNNMMLGPKCRNHQEKAAWVDCLELYENTIIRLNRTVNPSASCTD  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLSTALTNLETC  GF++LGVT  +LP + SNNVS LISN+LAINK        +
Sbjct  122   VDFQTWLSTALTNLETCRNGFMELGVTDYVLP-LMSNNVSKLISNSLAINK-----PPPS  175

Query  1131  ttgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                YTEGFP WV+PGDRKLLQ SS  S+A++VVAQDGSGN+KTV EA++AA+K+  SGR+
Sbjct  176   PQAYTEGFPSWVKPGDRKLLQTSSPTSQANLVVAQDGSGNFKTVNEAISAASKQKRSGRF  235

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVKAG YKEN++IG+KL NIML+GDGIGKT+ITGS+SVGGG+TTF SATVAV+GDGFI
Sbjct  236   VIYVKAGTYKENLQIGNKLNNIMLIGDGIGKTVITGSKSVGGGSTTFNSATVAVLGDGFI  295

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              + ITFRN+AG AN QAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGTVD
Sbjct  296   ARDITFRNSAGPANGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSNRQFYRECDIYGTVD  355

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             FIFGNAAVVFQNCN++AR P N   T+TAQGRSDPNQNTGI IHN ++TAASDLK     
Sbjct  356   FIFGNAAVVFQNCNMFARKPKNSIVTVTAQGRSDPNQNTGIVIHNSRITAASDLKPVQSS  415

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             VKTYLGRPW++YSRTV +K+ LDSLI PAGWLPW G+FAL+TLYYGEY NTG G+STANR
Sbjct  416   VKTYLGRPWRQYSRTVVLKTFLDSLIQPAGWLPWSGSFALSTLYYGEYQNTGPGSSTANR  475

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKWGGYHVITS TEASKFTVG+FI GG+WLPATNVPFTSGL
Sbjct  476   VKWGGYHVITSVTEASKFTVGSFIVGGAWLPATNVPFTSGL  516



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/512 (71%), Positives = 419/512 (82%), Gaps = 15/512 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYS-NGGQIKDKSDFLKVAKNLA  1471
             FL +++S  + GYS  E+KSWC QTP PQPCEY+LS +   +   IK KSDF K++  LA
Sbjct  18    FLILYLSPTILGYSLQEVKSWCGQTPNPQPCEYFLSNNLEYDRTPIKQKSDFFKLSAKLA  77

Query  1470  LQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWL  1291
             L  A +A D+ +S+G KCRS  EKAAW DCLELYE+ V +++ T  P  KC+  D QTWL
Sbjct  78    LDRAMHAHDDLFSVGPKCRSQQEKAAWADCLELYESTVLRLNKTSKPTSKCTQDDLQTWL  137

Query  1290  STALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG  1111
             STALTNLETC AG ++LGV+  +LP + SNNVS LISN+LAINK       +    Y  G
Sbjct  138   STALTNLETCRAGLLELGVSDYLLP-LMSNNVSKLISNSLAINKS----PYKPDNKYNNG  192

Query  1110  FPDWVRPGDRKLLQSSA--ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKA  937
             FP WV+PGDR+LLQSS+  AS+A++VVA+DGSG+Y TV  AV A     GSGR+VIYVKA
Sbjct  193   FPTWVKPGDRRLLQSSSSPASRANVVVAKDGSGDYTTVKAAVTAV---KGSGRFVIYVKA  249

Query  936   GVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITF  757
             G Y ENVEI  K+KN+ML+GDGIGKTIITGS+SVGGG+TTF+SATVAVVGDGFI Q ITF
Sbjct  250   GTYNENVEI--KVKNVMLLGDGIGKTIITGSKSVGGGSTTFQSATVAVVGDGFIAQDITF  307

Query  756   RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  577
             RNTAGA+NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNA
Sbjct  308   RNTAGASNHQAVALRSGSDQSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNA  367

Query  576   AVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL-KGVKTYLGRPW  400
             AVV QNCNIYAR+PPNKTNTITAQGR+D NQNTGISIHNC+VTAAS L   VKTYLGRPW
Sbjct  368   AVVLQNCNIYARDPPNKTNTITAQGRTDSNQNTGISIHNCRVTAASSLSSSVKTYLGRPW  427

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             KEYSRTV MK++L SLI+PAGWL W GNFAL TLYY EY+NTG G+ST+NRVKW GYHVI
Sbjct  428   KEYSRTVVMKTNLGSLINPAGWLEWSGNFALKTLYYAEYANTGPGSSTSNRVKWTGYHVI  487

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
               A+EASKFTVGNFIAGGSWLPATNVP+TSGL
Sbjct  488   -GASEASKFTVGNFIAGGSWLPATNVPYTSGL  518



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/514 (72%), Positives = 420/514 (82%), Gaps = 18/514 (4%)
 Frame = -3

Query  1647  FLAIFVS-TAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLA  1471
             +L I +S   +FGYSP ++K+WCSQTP+P PCE +LS +  N   IK KS F K++  LA
Sbjct  10    YLVICLSPLIIFGYSPNDVKTWCSQTPHPHPCESFLSHN-PNNIPIKGKSQFFKISTQLA  68

Query  1470  LQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA-DAQTW  1294
             L  A  A  N YSLG+KC++  EKAAW DCLELY+  +QK++ ++DP    +T  DAQ+W
Sbjct  69    LDRAILAHTNLYSLGSKCQNAHEKAAWADCLELYDYTIQKLNKSIDPVTNGATQNDAQSW  128

Query  1293  LSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyte  1114
             LSTALTNLETC AGFVDL V+ N L  + SNNVS LISNTL+INK        +   Y +
Sbjct  129   LSTALTNLETCLAGFVDLAVSNNQL--MPSNNVSNLISNTLSINK----VPYTSQPEYKQ  182

Query  1113  GFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAG  934
             GFP WV+PGDRKLLQSS+  KADIVVA+DGSGNYKT+ EA++AA+KR GSGRYVIYVKAG
Sbjct  183   GFPTWVKPGDRKLLQSSSP-KADIVVAKDGSGNYKTINEAISAASKRKGSGRYVIYVKAG  241

Query  933   VYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFR  754
              YKENV+I  KL NIML+GDGIGKTIITGS+SVGGGTTTF SATVAVVGDGFI QGITF 
Sbjct  242   SYKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDGFIAQGITFE  299

Query  753   NTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAA  574
             NTAG  + QAVALRSGSDLSVFY+CSFEG QDTLYV+S+RQFYRECDIYGTVDFIFGNAA
Sbjct  300   NTAGLTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIFGNAA  359

Query  573   VVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGR  406
             VV QN NIY  N  +KTNT+TAQGR+DPNQNTGISIHNCKVTAASDLK     VKTYLGR
Sbjct  360   VVIQNSNIYVHN--HKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTYLGR  417

Query  405   PWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYH  226
             PWK+YSRTVFMK+ LDSLI+PAGW+ W G+FAL TLYYGEY NTG GAST NRV W GYH
Sbjct  418   PWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYH  477

Query  225   VITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VITSA+EAS+F+VGNFIAGGSWLPATNVPFTSGL
Sbjct  478   VITSASEASEFSVGNFIAGGSWLPATNVPFTSGL  511



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/518 (69%), Positives = 414/518 (80%), Gaps = 12/518 (2%)
 Frame = -3

Query  1647  FLAIFVSTAVF-GYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ--IKDKSDFLKVAKN  1477
             F  + VS  VF   S   +KS CSQTP+PQPCEY+L+      G   I  KSDF K++  
Sbjct  7     FSLLLVSYIVFPTVSSYSLKSRCSQTPFPQPCEYFLADHNRKYGALLINKKSDFHKMSLK  66

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             LAL  A  A +NT SLG+KCR+  EKAAW DC+ELY+N++ KI+ T+DP+IK +  D QT
Sbjct  67    LALDRALRAHENTLSLGSKCRNKHEKAAWADCVELYQNIIVKINKTIDPSIKSTADDVQT  126

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAVTSN-NVSYLISNTLAINKGFtttnneattgy  1120
             WLSTALTN+ETC +GF++LGVT  ++P + SN NVSYLISNTL +N+G+ +T        
Sbjct  127   WLSTALTNIETCRSGFIELGVTDYVMPILMSNINVSYLISNTLFLNRGYYSTEPSTNYED  186

Query  1119  teGFPDWVRPGDRKLLQSSA--ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
                FP+WV P D+ LLQSS+   S+A+IVVA+DGSGN+KTVTEAV AAAKR+GSGR+VIY
Sbjct  187   G--FPNWVSPNDQTLLQSSSNLGSQANIVVAKDGSGNFKTVTEAVVAAAKRTGSGRFVIY  244

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             V  G+Y ENVEIG  LKNIMLVGDGIGKTIITGS+SVGGG+TTFKSATVAV GDGFI QG
Sbjct  245   VNVGIYNENVEIGINLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVDGDGFIAQG  304

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAG  N QAVALRSGSDLSVFYQCSFEGYQDTL  +S RQFYR+CDIYGTVDFIF
Sbjct  305   ITFRNTAGPKNGQAVALRSGSDLSVFYQCSFEGYQDTLCAHSQRQFYRDCDIYGTVDFIF  364

Query  585   GNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKT  418
             GNAAVV QNCNI+ARNPP++ NT+TAQGRSDPNQNTGISIHNC+VT +SDLK     VKT
Sbjct  365   GNAAVVLQNCNIFARNPPSRINTVTAQGRSDPNQNTGISIHNCRVTPSSDLKPYQNSVKT  424

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPW++YSRTV MK+ LDSLIDPAGW+PW G FAL TLYYGEY N+G+G+STANRV W
Sbjct  425   YLGRPWQQYSRTVIMKTFLDSLIDPAGWMPWTGTFALKTLYYGEYLNSGSGSSTANRVNW  484

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GY VI SA EASKFT  NFIAG SWLPATNVPF S L
Sbjct  485   PGYRVIYSAAEASKFTPANFIAGNSWLPATNVPFKSNL  522



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/512 (69%), Positives = 412/512 (80%), Gaps = 13/512 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             F  IF+   VFGY   ++KSWCS+TP P+PCEY+L+ +  N   IK +S+FLK++  LAL
Sbjct  11    FFCIFLGPTVFGYDQKDVKSWCSKTPNPKPCEYFLTHN-PNHRPIKSESEFLKISMKLAL  69

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLS  1288
               A  AK + ++LG KCR   EKAAWEDCL+LY+  V K++ TVDP +KCS  DAQTWLS
Sbjct  70    DRALLAKSHAFTLGPKCRDSREKAAWEDCLKLYDYTVSKLNETVDPYVKCSKVDAQTWLS  129

Query  1287  TALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGF  1108
             +ALTNLETC  GF++LGV   +LP + SNNVS LISNTLAINK         T     GF
Sbjct  130   SALTNLETCRTGFIELGVPDFLLP-LMSNNVSKLISNTLAINK----VPFNYTPSQENGF  184

Query  1107  PDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVY  928
             P+WVRPGDRKLLQSS   +A++VVA+DGSGN++T+ EAVNAA++RSGSGR+VIYVK GVY
Sbjct  185   PEWVRPGDRKLLQSSTP-QANVVVAKDGSGNFRTIKEAVNAASRRSGSGRFVIYVKQGVY  243

Query  927   KENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNT  748
              EN+EI  + KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDGFI +GITFRNT
Sbjct  244   NENIEI--RAKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNT  301

Query  747   AGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVV  568
             AG  N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYREC+IYGTVDFIFGNAA V
Sbjct  302   AGPNNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECNIYGTVDFIFGNAAAV  361

Query  567   FQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPW  400
             FQNCNI+AR P NKTNT+TAQGRSDPNQNTGI IHN ++TA SDL+     VKTYLGRPW
Sbjct  362   FQNCNIFARRPQNKTNTVTAQGRSDPNQNTGIVIHNSRITAGSDLRPVLGSVKTYLGRPW  421

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             ++YSRTV MK+ LD LIDP GWL W+GNFAL TL+Y EY NTG  +ST  RV W G+ V+
Sbjct  422   RQYSRTVVMKTFLDGLIDPRGWLEWNGNFALRTLFYAEYQNTGPSSSTGGRVTWPGFRVL  481

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              +A+EAS+FTVGNFIAG SW+PATNVPFTSGL
Sbjct  482   RTASEASRFTVGNFIAGNSWIPATNVPFTSGL  513



>ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=516

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/522 (68%), Positives = 417/522 (80%), Gaps = 9/522 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK  1504
             M N+  IF   F++ F+  +   GYS   IK+WC+QTP+PQPCEY+LS++      I  K
Sbjct  1     MANIHLIFPLLFMSCFIFPSTTNGYSNAVIKAWCTQTPHPQPCEYFLSQNPKITSPIIKK  60

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
             SDFLKV+ +L L  A  A+  TYSLG KCR+  EK AW DC+ELYE+ + KI +TVDPN 
Sbjct  61    SDFLKVSLDLVLDRALRAQMTTYSLGPKCRNEREKNAWADCVELYEHTINKIKSTVDPNT  120

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
             KCS  DAQTWLSTALTNLETC AGF +LGVT  ++P + SNNVS LISN LA+N G+ T 
Sbjct  121   KCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMP-LMSNNVSSLISNALALNHGYYTE  179

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKA--DIVVAQDGSGNYKTVTEAVNAAAKRS  970
             ++         FP WV PGDRKLLQSS++  +  ++VVA DGSG++KTV EAV+AA K  
Sbjct  180   SSNTQVDG---FPTWVSPGDRKLLQSSSSPASQANVVVATDGSGDFKTVKEAVDAA-KNK  235

Query  969   GSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVV  790
             GSGR+VIYVKAG+Y ENVEIG K+KN+ML+GDGIGKTIITGS+SVGGG+TT +SATV V 
Sbjct  236   GSGRFVIYVKAGIYSENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTLRSATVGVS  295

Query  789   GDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDI  610
             GDGFI QGIT RNTAG   HQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY+ECDI
Sbjct  296   GDGFIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYKECDI  355

Query  609   YGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK  430
             YGTVDFIFGNAAVV QNCNI+AR+PPNK NT+TAQGR+DPNQNTGISIHNC++T A   K
Sbjct  356   YGTVDFIFGNAAVVLQNCNIFARDPPNKINTVTAQGRTDPNQNTGISIHNCRITGAG-AK  414

Query  429   GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTAN  250
              V+TYLGRPW++YSRTV MK+ LD LI+  GWLPW GNFALNTLYYGEY NTG G+ST N
Sbjct  415   SVRTYLGRPWQKYSRTVVMKTFLDGLINSEGWLPWSGNFALNTLYYGEYLNTGPGSSTGN  474

Query  249   RVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             RV WGGY VITS+ EASKFT  NFIAG SW+PATNVPFTSGL
Sbjct  475   RVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL  516



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/508 (70%), Positives = 413/508 (81%), Gaps = 15/508 (3%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYS-NGGQIKDKSDFLKVAKNLALQYAKN  1453
             S+ V GYS  E+K WC+QTP PQPCEY+LS + +     +K KSDFLK++  LA + A  
Sbjct  17    SSFVSGYSWNEVKLWCNQTPNPQPCEYFLSNNPTYQYKPLKQKSDFLKLSLQLAQERALK  76

Query  1452  AKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTN  1273
               +NT SLG+KCR+  E+ AW DC+ELYE  ++K++ T+ PN K S  DAQTWLSTALTN
Sbjct  77    GHENTLSLGSKCRNPRERVAWADCVELYEQTIRKLNQTLKPNTKLSQVDAQTWLSTALTN  136

Query  1272  LETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVR  1093
             LETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK            Y EGFP WV+
Sbjct  137   LETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VPYQEPSYKEGFPTWVK  190

Query  1092  PGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENV  916
             PGDRKLLQ SS AS+A++VVA+DGSG + TV+ A+NAA K S SGRYVIYVK GVY E V
Sbjct  191   PGDRKLLQASSPASRANVVVAKDGSGRFTTVSAAINAAPK-SSSGRYVIYVKGGVYDEQV  249

Query  915   EIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAA  736
             E+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDGFI QGITFRNTAGA 
Sbjct  250   EV--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAK  307

Query  735   NHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNC  556
             NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGTVDFIFGNAAVV QNC
Sbjct  308   NHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNC  367

Query  555   NIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYS  388
             NI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+     V+TYLGRPWK+YS
Sbjct  368   NIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTYLGRPWKQYS  427

Query  387   RTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSAT  208
             RTVFMK+ LD LI+PAGW+ W GNFAL+TLYYGEY NTG G+STA RVKW GY VITSA+
Sbjct  428   RTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTARRVKWSGYRVITSAS  487

Query  207   EASKFTVGNFIAGGSWLPATNVPFTSGL  124
             EASKF+V NFIAG +WLP+T VPFT  L
Sbjct  488   EASKFSVANFIAGNAWLPSTKVPFTPSL  515



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/469 (74%), Positives = 401/469 (86%), Gaps = 11/469 (2%)
 Frame = -3

Query  1515  IKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV  1336
             IK KSDFL ++  LAL+ A  A  +T+SLG+KCR+  EKAAW DCLELYE+ + K++ T+
Sbjct  35    IKQKSDFLNISMQLALERAMIAHGDTFSLGSKCRNEREKAAWNDCLELYEHTILKLNKTL  94

Query  1335  DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKG  1156
             D N +C+ ADAQTWLSTALTNL+TC  GF+DLGV+  +LP + SNNVS LISNTL+INK 
Sbjct  95    DSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLP-LMSNNVSKLISNTLSINK-  152

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAA  979
                    A   Y  G+P WV+PGDRKLLQSS+ AS+A+IVV++DGSG+Y T+  A+ AA+
Sbjct  153   ----VPYAEPSYKGGYPTWVKPGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAAS  208

Query  978   KRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATV  799
             KRSGSGRYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TTF SATV
Sbjct  209   KRSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFNSATV  268

Query  798   AVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRE  619
             AVVGDGFI +G+TFRNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLY YS+RQFYRE
Sbjct  269   AVVGDGFIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRE  328

Query  618   CDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAAS  439
             CDIYGTVDFIFGNAAVVFQNCNIY RNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAAS
Sbjct  329   CDIYGTVDFIFGNAAVVFQNCNIYXRNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAAS  388

Query  438   DLKG----VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             DLK     VKTYLGRPWKEYSRTVF+K+ LDSLI+ AGW+ W G+FAL TLYYGEY NTG
Sbjct  389   DLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTG  448

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G+ST+ RV W GYHVITS+TEA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  449   PGSSTSGRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  497



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/512 (68%), Positives = 413/512 (81%), Gaps = 13/512 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
                +F+   VF +   ++KSWCS+TP P PCEY+L+    N   IK +S+FLK++  LAL
Sbjct  11    LFCVFLGPTVFAFDSRDVKSWCSKTPNPTPCEYFLTYD-PNHQPIKSESEFLKISVKLAL  69

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLS  1288
               A  AK++ ++LG KCR   EK AWEDCL+LY+  V K++ T+DP++KCS  DAQTWLS
Sbjct  70    DRAMLAKNHAFTLGPKCRDSREKTAWEDCLKLYDYTVSKLNETIDPHVKCSKVDAQTWLS  129

Query  1287  TALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGF  1108
             +ALTNLETC  GF++LGV   +LP + SNNVS LISNTLAIN+         T     GF
Sbjct  130   SALTNLETCRTGFIELGVPDFLLP-LMSNNVSKLISNTLAINE----VPFNYTPPSENGF  184

Query  1107  PDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVY  928
             P+WVRPGDRKLLQSS   +A+ VVAQDGSGN++T+ EAV++A+KRSGSGR+VIYVK GVY
Sbjct  185   PEWVRPGDRKLLQSSTP-QANAVVAQDGSGNFRTIKEAVDSASKRSGSGRFVIYVKQGVY  243

Query  927   KENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNT  748
              EN+EI  K KNIML GDGIGKTIITGS+SVGGG TTF SATVAVVGDGFI +GITFRNT
Sbjct  244   NENIEI--KAKNIMLRGDGIGKTIITGSKSVGGGATTFNSATVAVVGDGFIARGITFRNT  301

Query  747   AGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVV  568
             AG +N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNAA V
Sbjct  302   AGPSNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAAV  361

Query  567   FQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPW  400
             FQNCNI+AR P NKTNT+TAQGRSDPNQNTGI IHN +VTA SDL+     VKTYLGRPW
Sbjct  362   FQNCNIFARRPRNKTNTVTAQGRSDPNQNTGIVIHNSRVTAGSDLQPVLGSVKTYLGRPW  421

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             ++YSRTVFMK+ LD LIDP GWL W+GNFAL+TL+Y EY NTG G+ST+ RV W G+ V+
Sbjct  422   RQYSRTVFMKTFLDGLIDPRGWLEWNGNFALSTLFYAEYQNTGPGSSTSGRVTWPGFRVL  481

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             T+A++AS+FTVG+FIAG SW+PATNVPFTSGL
Sbjct  482   TAASDASRFTVGSFIAGNSWIPATNVPFTSGL  513



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 413/520 (79%), Gaps = 16/520 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L+ +   S +   +S   FGYSP E+KSWC +TP PQPCEY+L++  ++   IK  +DF 
Sbjct  3     LRILITVSLVLFSLSHTSFGYSPEEVKSWCGKTPNPQPCEYFLTQK-TDVTSIKQDTDFY  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  A+  TY+LG+KCR+  EKAAWEDC ELYE  V K++ T + +  C+ 
Sbjct  62    KISLQLALERATTAQSRTYTLGSKCRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTK  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLSTALTNLETC A   DLGV   +LP + SNNV+ LISNTL++NK         
Sbjct  122   VDKQTWLSTALTNLETCRASLEDLGVPEYVLPLL-SNNVTKLISNTLSLNK-----VPYN  175

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +GFP WV+PGDRKLLQ++   +A+IVVAQDGSGN KT+ EAV AAA R+G  RYV
Sbjct  176   EPSYKDGFPTWVKPGDRKLLQTTP--RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYV  232

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD FI 
Sbjct  233   IYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIA  290

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDF
Sbjct  291   RDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDF  350

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GV  424
             IFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQ+TGI IHNC+VTAASDLK     V
Sbjct  351   IFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSV  410

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWK+YSRTV++K+ LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STANRV
Sbjct  411   KTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRV  470

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  471   KWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/520 (67%), Positives = 413/520 (79%), Gaps = 16/520 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L+ +   S +   +S   FGYSP E+KSWC +TP PQPCEY+L++  ++   IK  +DF 
Sbjct  3     LRILITVSLVLFSLSHTSFGYSPEEVKSWCGKTPNPQPCEYFLTQK-TDVTSIKQDTDFY  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  A+  TY+LG+KCR+  EKAAWEDC ELYE  V K++ T + +  C+ 
Sbjct  62    KISLQLALERATTAQSRTYTLGSKCRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTK  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLS+ALTNLETC A   DLGV   +LP + SNNV+ LISNTL++NK         
Sbjct  122   VDKQTWLSSALTNLETCRASLEDLGVPEYVLPLL-SNNVTKLISNTLSLNK-----VPYN  175

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +GFP WV+PGDRKLLQ++   +A+IVVAQDGSGN KT+ EAV AAA R+G  RYV
Sbjct  176   EPSYKDGFPTWVKPGDRKLLQTTP--RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYV  232

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD FI 
Sbjct  233   IYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIA  290

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDF
Sbjct  291   RDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDF  350

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GV  424
             IFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQ+TGI IHNC+VTAASDLK     V
Sbjct  351   IFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSV  410

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWK+YSRTV++K+ LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STANRV
Sbjct  411   KTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRV  470

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  471   KWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/520 (67%), Positives = 412/520 (79%), Gaps = 16/520 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L+ +   S +   +S   FGYSP E+KSWC +TP PQPCEY+L++  ++   IK  +DF 
Sbjct  3     LRILITVSLVLFSLSHTSFGYSPEEVKSWCGKTPNPQPCEYFLTQK-TDVTSIKQDTDFY  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  A+  TY+LG+KCR+  EKAAWEDC ELYE  V K++ T + +  C+ 
Sbjct  62    KISLQLALERATTAQSRTYTLGSKCRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTK  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLS+ALTNLETC A   DLGV   +LP + SNNV+ LISN L++NK         
Sbjct  122   VDKQTWLSSALTNLETCRASLEDLGVPEYVLPLL-SNNVTKLISNALSLNK-----VPYN  175

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +GFP WV+PGDRKLLQ++   +A+IVVAQDGSGN KT+ EAV AAA R+G  RYV
Sbjct  176   EPSYKDGFPTWVKPGDRKLLQTTP--RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYV  232

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD FI 
Sbjct  233   IYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIA  290

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDF
Sbjct  291   RDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDF  350

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GV  424
             IFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQNTGI IHNC+VTAASDLK     V
Sbjct  351   IFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSV  410

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWK+YSRTV++K+ LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STANRV
Sbjct  411   KTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRV  470

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  471   KWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/526 (68%), Positives = 419/526 (80%), Gaps = 25/526 (5%)
 Frame = -3

Query  1692  LITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQI  1513
             L+T +    F+F         ST V+GYS + IKSWCSQTPYPQPCEYYL+ +  N   I
Sbjct  6     LVTTLLIFPFLF---------STIVYGYSLSSIKSWCSQTPYPQPCEYYLTNNAFNQ-TI  55

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K KSDF KV+  +A++ AK  ++NT+++G KCRS  EKAAW DCLELY+  VQK+  T  
Sbjct  56    KSKSDFFKVSLEIAMERAKKGEENTHAVGPKCRSPQEKAAWADCLELYDFTVQKLSQT--  113

Query  1332  PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGF  1153
                KC+  ++QTWLSTALTNLETC  GF DLGVT  +LP + SNNV+ L+SNTL++NK  
Sbjct  114   KYTKCTQYESQTWLSTALTNLETCKNGFYDLGVTNYVLPLL-SNNVTKLLSNTLSLNK--  170

Query  1152  tttnneattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                       Y +GFP WV+PGDRKLLQ SSAASKA++VVA+DGSG Y TV  A +AA  
Sbjct  171   ---VPYQQPSYKDGFPTWVKPGDRKLLQTSSAASKANVVVAKDGSGKYTTVKAATDAAP-  226

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
              SGSGRYVIYVKAGVY E VEI  K KN+MLVGDGIGKTIITGS+SVGGGTTTF+SATVA
Sbjct  227   -SGSGRYVIYVKAGVYNEQVEI--KAKNVMLVGDGIGKTIITGSKSVGGGTTTFRSATVA  283

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
               GDGFI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC
Sbjct  284   ATGDGFIAQDITFRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYREC  343

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASD  436
             +IYGTVDFIFGNAAVV QNCNI+ARNPP KT T+TAQGR+DPNQNTGI IHN +V+A SD
Sbjct  344   NIYGTVDFIFGNAAVVLQNCNIFARNPPAKTITVTAQGRTDPNQNTGIIIHNSRVSAQSD  403

Query  435   L--KGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGA  262
             L    VK+YLGRPW++YSRTVFMK+ LD  I+PAGWLPWDGNFAL+TLYY EY+NTG+G+
Sbjct  404   LNPSSVKSYLGRPWQKYSRTVFMKTVLDGFINPAGWLPWDGNFALDTLYYAEYANTGSGS  463

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ST+NRV W GYHV+TSA++AS FTVGNFIAG SW+  T VPFTSGL
Sbjct  464   STSNRVTWKGYHVLTSASQASPFTVGNFIAGNSWIGNTGVPFTSGL  509



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/523 (69%), Positives = 417/523 (80%), Gaps = 16/523 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-IKDKSD  1498
             + F  + + L  F+ ++ V  YS  E+K WC+QTP P+PCEY+LS + S   + I+ K+D
Sbjct  2     IAFRILLTLLVPFLFASLVSCYSMNEVKLWCNQTPNPEPCEYFLSNNPSYQHKLIEQKAD  61

Query  1497  FLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKC  1318
             F K++  LA + A     NT SLG+KC +  EK+AW DC+ELYE  + K++ T+D N KC
Sbjct  62    FFKLSLELAQERALKGHANTLSLGSKCNNPREKSAWADCVELYEQTILKLNKTLDTNTKC  121

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             S  DAQTWLSTALTNLETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK       
Sbjct  122   SQVDAQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VQ  175

Query  1137  eattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
                 GY  GFP WV+ GDRKLLQ SS +S+A++VV++DGSG Y T+  AVNAA K +  G
Sbjct  176   YQEPGYKNGFPKWVKQGDRKLLQTSSPSSQANVVVSKDGSGKYTTIGAAVNAAPK-NNKG  234

Query  960   RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  781
             RYVI+VK GVY E VEI  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  235   RYVIHVKTGVYNEQVEI--KANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  292

Query  780   FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  601
             FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+SDRQFY+EC+IYGT
Sbjct  293   FIAQDITFRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSDRQFYKECNIYGT  352

Query  600   VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK---  430
             VDFIFGNAA VFQNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK   
Sbjct  353   VDFIFGNAAAVFQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQ  412

Query  429   -GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
               VKTYLGRPWK+YSRTVFMK+SLDSLI PAGWL W GNFAL+TLYYGEY NTG G+ST 
Sbjct  413   NSVKTYLGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALSTLYYGEYMNTGLGSSTR  472

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             NRVKW GYHVIT A+EASKFTVGNFIAG SWLP+T+VPFTS L
Sbjct  473   NRVKWQGYHVITRASEASKFTVGNFIAGNSWLPSTSVPFTSTL  515



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/520 (67%), Positives = 411/520 (79%), Gaps = 16/520 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L+ +   S +   +S   FGYSP E+KSWC +TP PQPCEY+L++  ++   IK  +DF 
Sbjct  3     LRILITVSLVLFSLSHTSFGYSPEEVKSWCGKTPNPQPCEYFLTQK-TDVTSIKQDTDFY  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  A+  TY+LG+KCR+  EKAAWEDC ELYE  V K++ T + +  C+ 
Sbjct  62    KISLQLALERATTAQSRTYTLGSKCRNEREKAAWEDCRELYELTVLKLNQTSNSSPGCTK  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLS+ALTNLETC A   DLGV   +LP + SNNV+ LISN L++NK         
Sbjct  122   VDKQTWLSSALTNLETCRASLEDLGVPEYVLPLL-SNNVTKLISNALSLNK-----VPYN  175

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +GFP WV+PGDRKLLQ++   +A+IVVAQDGSGN KT+ EAV AAA R+G  RYV
Sbjct  176   EPSYKDGFPTWVKPGDRKLLQTTP--RANIVVAQDGSGNVKTIQEAV-AAASRAGGSRYV  232

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD FI 
Sbjct  233   IYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIA  290

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGTVDF
Sbjct  291   RDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDF  350

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GV  424
             IFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQNTGI IHNC+VTAASDLK     V
Sbjct  351   IFGNAAVVLQNCNIFARXPPNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSV  410

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWK+YSRTV +K+ LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STANRV
Sbjct  411   KTFLGRPWKQYSRTVXIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRV  470

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  471   KWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/515 (69%), Positives = 413/515 (80%), Gaps = 13/515 (3%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVA  1483
             IF+     +++S  V GYS  +IK+WCS+TP P+PCE  LS +  N   IK KS F +++
Sbjct  5     IFLTLCFVLYLSPFVLGYSANDIKTWCSKTPNPKPCEELLSHN-KNQIPIKQKSQFFQIS  63

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
               LAL  A +A  N  SLG+K  +   KAAW+DCLELY+  +QK++TTV+P+ KC+  D 
Sbjct  64    TQLALDRAMHAHTNFLSLGSKFVNPRAKAAWDDCLELYDLTIQKLNTTVNPSTKCTQEDT  123

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNLETC  GF +LGV+   LP V SNNVS LISNTL+IN             
Sbjct  124   QTWLSTALTNLETCREGFSELGVSDFFLP-VMSNNVSNLISNTLSIN----YVPYNPAPP  178

Query  1122  yteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
               +GFP WV PG+R+LLQSS+ + A++VVA+DGSGNYKTVTEA+  A+KRSG+ RYVIYV
Sbjct  179   SKDGFPTWVNPGNRRLLQSSSPT-ANLVVAKDGSGNYKTVTEAITTASKRSGTARYVIYV  237

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             KAG YKENV I SK  NIML+GDGIGKTIITGS+SVGGG+TTF SATVAV GDGFI + I
Sbjct  238   KAGTYKENVVITSK--NIMLMGDGIGKTIITGSKSVGGGSTTFNSATVAVTGDGFIARDI  295

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TF+NTAG +N+QAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYREC+IYGTVDFIFG
Sbjct  296   TFQNTAGVSNNQAVALRSGSDLSVFYKCSFEGYQDTLYVYSDRQFYRECNIYGTVDFIFG  355

Query  582   NAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL--KGVKTYLG  409
             NAAVV QNCNIY  N  +KTNT+TAQGRSDPNQNTGISIHNCKVTAASDL     KTYLG
Sbjct  356   NAAVVLQNCNIYVHN--HKTNTVTAQGRSDPNQNTGISIHNCKVTAASDLVLSSTKTYLG  413

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW+EYSRT+FMK+ LDSLI+ AGWL WDG FAL TLYYGEY NTG G+ST+ RVKWGGY
Sbjct  414   RPWREYSRTIFMKTYLDSLINSAGWLEWDGTFALETLYYGEYMNTGPGSSTSGRVKWGGY  473

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             HVITS++EASKFTVGNFIAG SWLPATNVPFT+GL
Sbjct  474   HVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  508



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/518 (68%), Positives = 408/518 (79%), Gaps = 15/518 (3%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-IKDKSDFLKV  1486
             +F+   +   ++T V  YS  E+K WC+QTP PQPC Y+LS + S   + IK K DF K+
Sbjct  6     LFVTLLVPFLLATFVSSYSMNEVKLWCNQTPNPQPCVYFLSNNPSYKHKLIKQKVDFFKL  65

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  L  + A      T SLG+KC +  EK+AW DC+ELYE  + K++ T++P  KCS  D
Sbjct  66    SLELVQERALKGHAKTLSLGSKCSNSREKSAWADCVELYEQTILKLNKTLNPKTKCSQVD  125

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC AGF DLGV   ILP + SNNV+ L+SNTLA+NK           
Sbjct  126   AQTWLSTALTNLETCKAGFYDLGVQDYILP-LMSNNVTKLLSNTLALNK-----VQYQEP  179

Query  1125  gyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
              Y +GFP WVRPGDRKLLQ+S+  + ++VVA+DGSG Y TV+ AVNA  K +  GRYVI+
Sbjct  180   SYKDGFPTWVRPGDRKLLQTSSP-RPNVVVAKDGSGKYTTVSAAVNAIPK-NNKGRYVIH  237

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VKAGVY E VEI  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDGFI Q 
Sbjct  238   VKAGVYNEQVEI--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQD  295

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAG  NHQAVALRSGSDLSVFY+CSFEG+QDTLYV+SDRQFY++C+IYGTVDFIF
Sbjct  296   ITFRNTAGGKNHQAVALRSGSDLSVFYRCSFEGFQDTLYVHSDRQFYKQCNIYGTVDFIF  355

Query  585   GNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKT  418
             GNAA VFQNCNI+ RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK     VKT
Sbjct  356   GNAAAVFQNCNIFPRNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKT  415

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPWK+YSR VFMK+SLDSLI P+GWL W GNFAL+TLYYGEY NTG G+ST NRVKW
Sbjct  416   YLGRPWKQYSRAVFMKTSLDSLIHPSGWLEWSGNFALSTLYYGEYMNTGLGSSTRNRVKW  475

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G+HVITSA+EASKFTV NFIAG +WLPAT VPFTS L
Sbjct  476   QGFHVITSASEASKFTVSNFIAGNAWLPATKVPFTSTL  513



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/517 (67%), Positives = 418/517 (81%), Gaps = 11/517 (2%)
 Frame = -3

Query  1662  IFICSFLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             + I   L  F+ S+  F YS  +I+SWC+QTPYPQPCEYYL+ S++    IK KSDFL+V
Sbjct  11    VIITLLLVPFLFSSIAFSYSFKDIQSWCNQTPYPQPCEYYLT-SHTFNKPIKSKSDFLQV  69

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL+ A+  + NT+S+G KCR+  EK+AW DC+ELY+  +Q+++ T+DP  KC+  D
Sbjct  70    SLQLALERAERGQLNTHSIGPKCRNVHEKSAWTDCIELYDYTIQRLNKTLDPYTKCTQTD  129

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
              QTWLSTALTNLETC AG  +LGV   +LP + SNNV+ L+SNTL++NK   +       
Sbjct  130   TQTWLSTALTNLETCRAGLYELGVQDYMLP-LMSNNVTKLLSNTLSLNKD--SNYPFKPP  186

Query  1125  gyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
                EG+P WV+PGDRKLLQSS AAS+A++VVA+DGSG Y TV  AV+AA   S SGRYVI
Sbjct  187   SSQEGYPTWVKPGDRKLLQSSSAASQANVVVAKDGSGKYTTVKAAVDAAPS-SSSGRYVI  245

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVK+GVY E VEI  K KNIMLVGDGIGKTIITGS+SVGGG+TTF+SATVA VGDGFI Q
Sbjct  246   YVKSGVYNEQVEI--KSKNIMLVGDGIGKTIITGSKSVGGGSTTFRSATVAAVGDGFIAQ  303

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECD+YGTVDFI
Sbjct  304   DITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDVYGTVDFI  363

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL--KGVKTY  415
             FGNAAVV QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS      VK+Y
Sbjct  364   FGNAAVVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSSVKSY  423

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW++YSRTVFMK++LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TANRV W 
Sbjct  424   LGRPWQKYSRTVFMKTNLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWK  483

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GYH +T+A++A+ FTV NFIAG SW+P+T+VPFTSGL
Sbjct  484   GYHALTAASQATPFTVANFIAGNSWIPSTSVPFTSGL  520



>ref|XP_009143104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/520 (68%), Positives = 421/520 (81%), Gaps = 21/520 (4%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ--IKDKSDFL  1492
             +I    FL IFV++ V GY+  ++K+WCSQTP P+PCEY+L+    N GQ  IK +S+FL
Sbjct  6     YILTLMFLCIFVASTVSGYNSKDVKAWCSQTPNPKPCEYFLTH---NSGQKPIKSESEFL  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL+ A  AK +T +LG KCR   EKAAWEDCL+LY+  V KI+ T+DPN+KCS 
Sbjct  63    KISMKLALERAILAKSHTSTLGPKCRDTREKAAWEDCLKLYDVTVSKINETMDPNVKCSK  122

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         
Sbjct  123   TDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSSLICNTLAINK----VPFNY  177

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQSS     + VVA+DGSGN++T+ +AVNAA   SGSGR+V
Sbjct  178   TPPEKDGFPSWVKPGDRKLLQSSTPGD-NAVVAKDGSGNFRTIKDAVNAA---SGSGRFV  233

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGF+ 
Sbjct  234   IYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMA  291

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA+N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGTVDF
Sbjct  292   RGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDF  351

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA V QNCNI+AR P +KTNTITAQGRSD NQNTGI IHN +VTAASDL+ +    
Sbjct  352   IFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPILGST  411

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+SLDSLIDP GWL W+GNFAL+TL+Y E+ NTG+GAST+ RV
Sbjct  412   KTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGSGASTSGRV  471

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW G+ V+ SA+EAS+FTVG+FIAG SW+P++ VPFTSGL
Sbjct  472   KWPGFRVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  510



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 417/520 (80%), Gaps = 17/520 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             +  I    FL IFV++ V GY+  ++K+WCSQTP P+PCEY+L+ + SN   IK +S+FL
Sbjct  5     VSIITFVVFLCIFVASTVSGYNSKDVKAWCSQTPNPKPCEYFLTHN-SNQKPIKSESEFL  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL  A  AK +T +LG KCR   EKAAWEDCL+LY+  V KI+ T+DPN+KCS 
Sbjct  64    KISMKLALDRAILAKTHTSTLGPKCRDTREKAAWEDCLKLYDLTVSKINETMDPNVKCSK  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         
Sbjct  124   TDAQTWLSTALTNLDTCRAGFLELGVTDIVLPLI-SNNVSNLICNTLAINK----VPFNY  178

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQSS   + + VVA+DGSGN++T+ +A+NAA    GSGR+V
Sbjct  179   TPPEKDGFPSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---KGSGRFV  234

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  + KNIML GDG G+TIITGSRSVGGGTTTF SATVA VGDGFI 
Sbjct  235   IYVKQGVYSENLEI--RKKNIMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIA  292

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDF
Sbjct  293   RGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDF  352

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+ +    
Sbjct  353   IFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPILGST  412

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+ LD LIDP GWL WDGNFAL TL+Y E+ NTG GAST+ RV
Sbjct  413   KTYLGRPWRQYSRTVFMKTFLDGLIDPRGWLEWDGNFALRTLFYAEFQNTGRGASTSGRV  472

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW G+ V+ SA+EAS+FTVGNF+AGGSW+P++ +PFTSGL
Sbjct  473   KWPGFRVLRSASEASRFTVGNFLAGGSWIPSS-IPFTSGL  511



>ref|NP_566038.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
 sp|O22149.2|PME17_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
17; Includes: RecName: Full=Pectinesterase inhibitor 17; AltName: 
Full=Pectin methylesterase inhibitor 17; Includes: RecName: 
Full=Pectinesterase 17; Short=PE 17; AltName: Full=Pectin 
methylesterase 17; Short=AtPME17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32841.1|AF361829_1 At2g45220/F4L23.27 [Arabidopsis thaliana]
 gb|AAB82640.2| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10527.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
Length=511

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 418/520 (80%), Gaps = 21/520 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             + F+ +C    I V++ V GY+  ++K+WCSQTP P+PCEY+L+ + SN   IK +S+FL
Sbjct  9     INFVILC----ILVASTVSGYNQKDVKAWCSQTPNPKPCEYFLTHN-SNNEPIKSESEFL  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  L L  A  AK + ++LG KCR   EKAAWEDC++LY+  V KI+ T+DPN+KCS 
Sbjct  64    KISMKLVLDRAILAKTHAFTLGPKCRDTREKAAWEDCIKLYDLTVSKINETMDPNVKCSK  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNL+TC AGF++LGVT  +LP + SNNVS L+ NTLAINK         
Sbjct  124   LDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLLCNTLAINK----VPFNY  178

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQSS   K + VVA+DGSGN+KT+ EA++AA   SGSGR+V
Sbjct  179   TPPEKDGFPSWVKPGDRKLLQSSTP-KDNAVVAKDGSGNFKTIKEAIDAA---SGSGRFV  234

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  + KN+ML GDGIGKTIITGS+SVGGGTTTF SATVA VGDGFI 
Sbjct  235   IYVKQGVYSENLEI--RKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIA  292

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA+N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYR+CD+YGTVDF
Sbjct  293   RGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDF  352

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    
Sbjct  353   IFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGST  412

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+ RV
Sbjct  413   KTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALKTLFYAEFQNTGPGASTSGRV  472

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W G+ V+ SA+EASKFTVG F+AGGSW+P++ VPFTSGL
Sbjct  473   TWPGFRVLGSASEASKFTVGTFLAGGSWIPSS-VPFTSGL  511



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/521 (67%), Positives = 414/521 (79%), Gaps = 17/521 (3%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYS-NGGQIKDKSDFLKV  1486
             +F+   +   +S+ V GYS  ++K WC+QTP PQPCEY+LS + +     +K KSDFLK+
Sbjct  6     LFLTLLIPFLLSSFVSGYSWNDVKLWCNQTPNPQPCEYFLSNNPTYQYKALKQKSDFLKL  65

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV--DPNIKCST  1312
             +  LA + A     NT SLG+KCR+  E+ AW DC+ELYE  ++K++ T+  DPN K S 
Sbjct  66    SLQLAQERALKGHANTLSLGSKCRNPRERGAWADCVELYEQTIRKLNETLNPDPNTKYSQ  125

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC AGF +LGV   +LP + SNNV+ L+SNTL++NK         
Sbjct  126   VDAQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLSLNK-----VEYE  179

Query  1131  ttgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                Y EGFP WV+P DRKLLQSS+ AS+A++VVA+DGSG Y TV+ AVN+A K S  GRY
Sbjct  180   EPSYKEGFPKWVKPDDRKLLQSSSPASRANVVVAKDGSGKYTTVSAAVNSAPKNS-RGRY  238

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVK G+Y E VE+ SK  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDGFI
Sbjct  239   VIYVKGGIYNEQVEVKSK--NIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFI  296

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGTVD
Sbjct  297   AQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVD  356

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             FIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+     
Sbjct  357   FIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNS  416

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
             V+TYLGRPWK+YSRTVFMK+ LD LI+P+GW+ W GNFALNTLYY EY NTG G+ST  R
Sbjct  417   VRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYREYMNTGPGSSTGRR  476

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKW GY V+T A+EASKF+V NFIAG +WLPAT VP+T  L
Sbjct  477   VKWPGYRVMTRASEASKFSVANFIAGNAWLPATKVPYTPSL  517



>ref|XP_002882002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58261.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 418/520 (80%), Gaps = 21/520 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             + F+F+C    I V++ V GY+  ++K+WCSQTP P+PCEY+L+ + SN   IK +S+FL
Sbjct  9     ITFVFLC----ILVASTVSGYNQKDVKAWCSQTPNPKPCEYFLTHN-SNNKPIKSESEFL  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             +++  LAL  A  AK + ++LG KCR   EKAAWEDC++LY+  V KI+ T+DPN+KCS 
Sbjct  64    EISMKLALDRAVLAKTHAFTLGPKCRDTREKAAWEDCIKLYDLTVSKINETMDPNVKCSK  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNL+TC AGF++LGVT  +LP + SNNVS L+ NTLAINK         
Sbjct  124   TDAQTWLSTALTNLDTCRAGFLELGVTDVVLP-LMSNNVSNLLCNTLAINK----VPFNY  178

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQSS   K + VVA+DGSGN+KT+ +A+NAA   SGSGR+V
Sbjct  179   TPPEKDGFPSWVKPGDRKLLQSSTP-KDNAVVAKDGSGNFKTIKDAINAA---SGSGRFV  234

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  + KN+ML GDGIGKTIITGS+SVGGGTTTF SATVA VGDGFI 
Sbjct  235   IYVKQGVYSENLEI--RKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIA  292

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYR+CD+YGTVDF
Sbjct  293   RGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDF  352

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    
Sbjct  353   IFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGST  412

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+SLDSLIDP GWL W+GNFAL TL+Y E+ NTG GAST+ RV
Sbjct  413   KTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTSGRV  472

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W G+ V+ SA+EASKFTVG F+AG SW+P+T VPFTSGL
Sbjct  473   TWPGFRVLGSASEASKFTVGTFLAGSSWIPST-VPFTSGL  511



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/522 (66%), Positives = 408/522 (78%), Gaps = 14/522 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             + F  +   L  F   A+  YS   IKSWC+QTPYPQPCEYYL+++   G  IK KSDFL
Sbjct  1     MGFSIVMLLLLFFAFPAISSYSLPTIKSWCAQTPYPQPCEYYLTKNPKYGIPIKGKSDFL  60

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL ++  +K N  SLG+KCR+  EKAAW DC+ LYE++  K++ TVDP+ K ++
Sbjct  61    KLSLQLALDHSTQSKTNAISLGSKCRNEREKAAWSDCVTLYEDIPLKLNKTVDPSGKFTS  120

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLS A TNLETC  GFVDLG + N +P++    +  LISN LA NKG+       
Sbjct  121   EDVQTWLSAASTNLETCKQGFVDLGASDNAMPSLYDGVLGNLISNALATNKGYYGGAGNK  180

Query  1131  ttgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                    FP WV PGDRKLLQSSA A++A+IVVAQDGSGNY+TV +AV AA+KRSG+GR+
Sbjct  181   DG-----FPGWVSPGDRKLLQSSAQAAQANIVVAQDGSGNYRTVNDAVAAASKRSGNGRF  235

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvggg-ttTFKSATVAVVGDGF  778
             VIYVKAG Y E V IGSK  NIMLVGDGIGKTIITG +SVGGG +TT+ SATV + GDGF
Sbjct  236   VIYVKAGTYSETVSIGSK--NIMLVGDGIGKTIITGRKSVGGGGSTTYSSATVGITGDGF  293

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             + +GITFRNTAGA + QAVA RS SDLS +YQCSFEGYQDTLYV+S RQFY ECDIYGTV
Sbjct  294   LARGITFRNTAGAKSQQAVAFRSASDLSAYYQCSFEGYQDTLYVFSQRQFYSECDIYGTV  353

Query  597   DFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----  430
             DFIFGNAAVVFQNC+++ARN P  TNT+TAQGR+DPNQNTGISI+NCKVTA SDLK    
Sbjct  354   DFIFGNAAVVFQNCSLFARNTPTHTNTLTAQGRTDPNQNTGISIYNCKVTADSDLKPVQS  413

Query  429   GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTAN  250
              VKTYLGRPWK+YSRTVFMK+ LDSLI PAGWLPW G+FAL TLYYGEY NTG G+STAN
Sbjct  414   SVKTYLGRPWKQYSRTVFMKTFLDSLIAPAGWLPWSGSFALTTLYYGEYMNTGPGSSTAN  473

Query  249   RVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             RVKW GYHV+++A +ASKFTV NFI+G SW+PATNVPFTS L
Sbjct  474   RVKWPGYHVMSTA-DASKFTVRNFISGNSWIPATNVPFTSNL  514



>ref|XP_003517028.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/519 (67%), Positives = 415/519 (80%), Gaps = 13/519 (3%)
 Frame = -3

Query  1665  FIFICSFL--AIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             F F+ + L      S+    YS  +I+SWC+QTPYPQPCEYYL+    N   IK KSDFL
Sbjct  5     FPFLMTLLLAPFLFSSIASSYSFKDIQSWCNQTPYPQPCEYYLTNHAFNK-PIKSKSDFL  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KV+  LAL+ A+ ++ NT++LG KCR+  EKAAW DCL+LYE  +Q+++ T++PN KC+ 
Sbjct  64    KVSLQLALERAQRSELNTHALGPKCRNVHEKAAWADCLQLYEYTIQRLNKTINPNTKCNE  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLSTALTNLETC  GF +LGV   +LP + SNNV+ L+SNTL++NKG        
Sbjct  124   TDTQTWLSTALTNLETCKNGFYELGVPDYVLP-LMSNNVTKLLSNTLSLNKG---PYQYK  179

Query  1131  ttgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
                Y EGFP WV+PGDRKLLQSS+ AS A++VVA+DGSG Y TV  AV+AA K S SGRY
Sbjct  180   PPSYKEGFPTWVKPGDRKLLQSSSVASNANVVVAKDGSGKYTTVKAAVDAAPK-SSSGRY  238

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVK+GVY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDGFI
Sbjct  239   VIYVKSGVYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDGFI  296

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGTVD
Sbjct  297   AQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVD  356

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL--KGVK  421
             FIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS      VK
Sbjct  357   FIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSSVK  416

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             +YLGRPW++YSRTVFMK+ LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TANRV 
Sbjct  417   SYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVT  476

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GYHV+TSA++AS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  477   WKGYHVLTSASQASPFTVGNFIAGNNWIPSSGVPFTSGL  515



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/512 (68%), Positives = 414/512 (81%), Gaps = 12/512 (2%)
 Frame = -3

Query  1647  FLAIFV-STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLA  1471
              LA F+ S+    YS  +I+SWC+QTPYPQPCEYYL+    N   IK KSDFLKV+  LA
Sbjct  4     LLAPFLFSSIASSYSFKDIQSWCNQTPYPQPCEYYLTNHAFNK-PIKSKSDFLKVSLQLA  62

Query  1470  LQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWL  1291
             L+ A+ ++ NT++LG KCR+  EKAAW DCL+LYE  +Q+++ T++PN KC+  D QTWL
Sbjct  63    LERAQRSELNTHALGPKCRNVHEKAAWADCLQLYEYTIQRLNKTINPNTKCNETDTQTWL  122

Query  1290  STALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG  1111
             STALTNLETC  GF +LGV   +LP + SNNV+ L+SNTL++NKG           Y EG
Sbjct  123   STALTNLETCKNGFYELGVPDYVLP-LMSNNVTKLLSNTLSLNKG---PYQYKPPSYKEG  178

Query  1110  FPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAG  934
             FP WV+PGDRKLLQSS+ AS A++VVA+DGSG Y TV  AV+AA K S SGRYVIYVK+G
Sbjct  179   FPTWVKPGDRKLLQSSSVASNANVVVAKDGSGKYTTVKAAVDAAPK-SSSGRYVIYVKSG  237

Query  933   VYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFR  754
             VY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDGFI Q ITFR
Sbjct  238   VYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDGFIAQDITFR  295

Query  753   NTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAA  574
             NTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGTVDFIFGNAA
Sbjct  296   NTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGNAA  355

Query  573   VVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--GVKTYLGRPW  400
              V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS      VK+YLGRPW
Sbjct  356   AVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSSVKSYLGRPW  415

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             ++YSRTVFMK+ LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TANRV W GYHV+
Sbjct  416   QKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYHVL  475

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             TSA++AS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  476   TSASQASPFTVGNFIAGNNWIPSSGVPFTSGL  507



>gb|KFK37315.1| hypothetical protein AALP_AA4G241100 [Arabis alpina]
Length=509

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/521 (68%), Positives = 417/521 (80%), Gaps = 21/521 (4%)
 Frame = -3

Query  1674  NLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDF  1495
             ++ F+F+C    IFV+  V GY   ++K+WCSQTP P PCEY+L+ + SN   IK +S+F
Sbjct  6     HITFLFLC----IFVAWTVSGYKSKDVKAWCSQTPNPIPCEYFLTHN-SNNKPIKTESEF  60

Query  1494  LKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCS  1315
             LK++  LAL+ A  AK++ ++LG KCR   EKAAWEDCL LY+  V KI+ T+D N+KCS
Sbjct  61    LKLSMKLALERAILAKNHAFTLGPKCRDKREKAAWEDCLNLYDFTVSKINATMDTNVKCS  120

Query  1314  TADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnne  1135
               DAQTWLSTALTNL+TC AGF+DLGVT  +LP + SNNVS L+ NTLAINK        
Sbjct  121   KTDAQTWLSTALTNLDTCRAGFLDLGVTDIVLP-LMSNNVSKLLCNTLAINK----VPFN  175

Query  1134  attgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
              T    +GFP WV+PGDRKLLQSS  S  + VVA+DGSG +KT+ +A++AA   SGSGR+
Sbjct  176   YTPPEKDGFPSWVKPGDRKLLQSSTPSD-NAVVAKDGSGTFKTIKDAIDAA---SGSGRF  231

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVK GVY EN+EI  + KNIML GDGIGKTIITGSRSVGGGTTTF SATVA VGDGFI
Sbjct  232   VIYVKQGVYAENLEI--RKKNIMLRGDGIGKTIITGSRSVGGGTTTFNSATVAAVGDGFI  289

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              +GITFRNTAGA N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYRECD+YGTVD
Sbjct  290   ARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRECDVYGTVD  349

Query  594   FIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV---  424
             FIFGNAA V QNCNI+AR P + TNTITAQGRSDPNQNTGI IHN +VTAASDL+ V   
Sbjct  350   FIFGNAAAVLQNCNIFARRPRSSTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGS  409

Query  423   -KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
              KTYLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFALNTL+Y E+ NTG GAST+ R
Sbjct  410   TKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALNTLFYAEFQNTGPGASTSGR  469

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W G+ V+ SA+EASKFTVG+F+AG SW+P++ VPFTSGL
Sbjct  470   VTWKGFQVLGSASEASKFTVGSFLAGSSWIPSS-VPFTSGL  509



>ref|XP_006293950.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
 gb|EOA26848.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
Length=546

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/556 (65%), Positives = 430/556 (77%), Gaps = 30/556 (5%)
 Frame = -3

Query  1776  SHNSFYLKNQNVA**NHTT*VISYTTNLLITKMTNLQ-FIFICSFLAIFVSTAVFGYSPT  1600
             SH S YL+ Q        T + S    L++    N+  F+F+C    I V++ V GY+  
Sbjct  16    SHQSQYLQTQ--------TSLFSKAFGLIMAFRANITTFVFLC----ILVASTVSGYNRK  63

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +++ WCSQTP P+PCEY+L+ + S+   IK +S+FLK++  LAL  A  AK +  +LG K
Sbjct  64    DVEKWCSQTPNPKPCEYFLTHN-SDNKPIKSESEFLKISMKLALDRAVLAKTHASTLGPK  122

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
             CR   EKAAWEDC++LY+  V  I+ T+DPN+KCS  DAQTWLSTALTNL+TC  GF++L
Sbjct  123   CRDTREKAAWEDCIKLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLEL  182

Query  1239  GVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSA  1060
             GVT  +LP + SNNVS LI NTLAINK         T    +GFP WV+PGDRKLLQ+SA
Sbjct  183   GVTDMVLP-LMSNNVSNLICNTLAINK----VPFNYTAPEKDGFPSWVKPGDRKLLQTSA  237

Query  1059  ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLV  880
               K + VVA+DGSGN+KT+ +A+NAA   SGSGR+VIYVK GVY EN+EI  + KN+ML 
Sbjct  238   P-KDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIYVKQGVYSENLEI--RKKNVMLR  291

Query  879   GDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSD  700
             GDG GKTIITGSRSVGGGTTTF SATVA VGD FI +GITFRNTAGA N QAVALRSGSD
Sbjct  292   GDGKGKTIITGSRSVGGGTTTFNSATVAAVGDAFIARGITFRNTAGANNAQAVALRSGSD  351

Query  699   LSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTN  520
             LSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGTVDFIFGNAA V QNCNI+AR P +KTN
Sbjct  352   LSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGNAAAVLQNCNIFARRPRSKTN  411

Query  519   TITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSL  352
             TITAQGRSDPNQNTGI IHN +VTAASDL+ V    KTYLGRPW++YSRTVFMK+SLDSL
Sbjct  412   TITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPWRQYSRTVFMKTSLDSL  471

Query  351   IDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIA  172
             IDP GWL W+GNFAL TL+Y E+ NTG GAST++RV W G+ V+ SA+EASKFTVG F+A
Sbjct  472   IDPRGWLEWNGNFALKTLFYAEFQNTGPGASTSSRVTWPGFRVLGSASEASKFTVGTFLA  531

Query  171   GGSWLPATNVPFTSGL  124
             GGSW+P++ VPFTSGL
Sbjct  532   GGSWIPSS-VPFTSGL  546



>ref|XP_010508199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/523 (67%), Positives = 415/523 (79%), Gaps = 17/523 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             MT   +I     L I V++ V GY+  ++K+WCSQTP P+PCEY+L+ +  N   IK +S
Sbjct  1     MTFRAYITTFVLLCILVASTVSGYNRKDVKAWCSQTPNPKPCEYFLTHNLDNK-PIKSES  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             +FLK++  LAL  A  AK +T +LG KCR   EKAAWEDC++LY+  +  I+ T+DPN+K
Sbjct  60    EFLKISMKLALDRAILAKTHTSTLGPKCRDTREKAAWEDCIKLYDYTISNINETMDPNVK  119

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             CS  DAQTWLSTALTNL+TC AGFVDLGVT  +LP + SNNVS L+ NTLAINK      
Sbjct  120   CSKTDAQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNLLCNTLAINK----VP  174

Query  1140  neattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
                T    +GFP WV+PGDRKLLQ+S   + + VVA+DGSGN+KT+ +A+NAA   SGSG
Sbjct  175   FNYTPPEKDGFPSWVKPGDRKLLQTSTP-RDNAVVAKDGSGNFKTIKDAINAA---SGSG  230

Query  960   RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  781
             R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDG
Sbjct  231   RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDG  288

Query  780   FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  601
             FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  289   FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  348

Query  600   VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV-  424
             VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+ V 
Sbjct  349   VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  408

Query  423   ---KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
                KTYLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  409   GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTS  468

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RV W G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  469   GRVTWPGFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_010506460.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/518 (67%), Positives = 414/518 (80%), Gaps = 21/518 (4%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             F+ +C    I V++ V GY+  ++K+WCSQTP P+PCEY+L+ +  N   IK +S+FLK+
Sbjct  10    FVLLC----ILVASTVSGYNRKDVKAWCSQTPNPKPCEYFLTHNLDNK-PIKSESEFLKI  64

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL  A  AK +T +LG KCR   EKAAWEDC++LY+  +  I+ T+DPN+KCS  D
Sbjct  65    SMKLALDRAILAKTHTSTLGPKCRDTREKAAWEDCIKLYDYTISNINETMDPNVKCSKTD  124

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNL+TC AGFVDLGVT  +LP + SNNVS L+ NTLAINK         T 
Sbjct  125   AQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNLLCNTLAINK----VPFNYTP  179

Query  1125  gyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
                +GFP WV+PGDRKLLQ+S   + + VVA+DGSGN+KT+ +A+NAA   SGSGR+VIY
Sbjct  180   PEKDGFPSWVKPGDRKLLQTSTP-RDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIY  235

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDGFI +G
Sbjct  236   VKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARG  293

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIF
Sbjct  294   ITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIF  353

Query  585   GNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KT  418
             GNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    KT
Sbjct  354   GNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKT  413

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+ RV W
Sbjct  414   YLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTW  473

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  474   PGFRVLGSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/520 (66%), Positives = 418/520 (80%), Gaps = 21/520 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L F+F+C    I  ++ V GY+  ++K+WCSQTP P+PCEY+L+ + SN   IK +S+FL
Sbjct  8     LTFVFLC----ILAASTVSGYNSKDVKAWCSQTPNPKPCEYFLTHN-SNQKPIKSESEFL  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL  A  AK +  +LG KCR   EKAAWEDC++LY+  V KI+ T++PN+KCS 
Sbjct  63    KISMKLALDRAILAKSHASTLGPKCRDTREKAAWEDCIKLYDFTVSKINETMNPNVKCSK  122

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         
Sbjct  123   TDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLICNTLAINK----VPFNY  177

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQSS   + + VVA+DGSGN++T+ +A+NAA   SGSGR+V
Sbjct  178   TPPGKDGFPSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---SGSGRFV  233

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGFI 
Sbjct  234   IYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIA  291

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDF
Sbjct  292   RGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDF  351

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    
Sbjct  352   IFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGST  411

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL+TL+Y E+ NTG GAST+ RV
Sbjct  412   KTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTSGRV  471

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W G+ V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  472   TWPGFRVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  510



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/506 (68%), Positives = 407/506 (80%), Gaps = 13/506 (3%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYS-NGGQIKDKSDFLKVAKNLALQYAKN  1453
             S+ V GYS  E+K WC+QTP PQPCEY+LS + +     +K KSDFLK++  LA + A  
Sbjct  17    SSFVSGYSWNEVKLWCNQTPNPQPCEYFLSNNPTYQYKPLKQKSDFLKLSLQLAQERALK  76

Query  1452  AKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTN  1273
               +NT SLG+KCR+  E+ AW DC+ELYE  ++K++ T+ PN K S  DAQTWLSTALTN
Sbjct  77    GHENTLSLGSKCRNPRERVAWADCVELYEQTIRKLNQTLKPNTKLSQVDAQTWLSTALTN  136

Query  1272  LETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVR  1093
             LETC AGF +LGV   +LP + SNNV+ L+SNTLA+NK            Y EGFP WV+
Sbjct  137   LETCKAGFYELGVQDYVLP-LMSNNVTKLLSNTLALNK-----VPYQEPSYKEGFPTWVK  190

Query  1092  PGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENV  916
             PGDRKLLQ SS AS+A++VVA+DGSG + TV+ A+NAA K S SGRYVIYVK GVY E V
Sbjct  191   PGDRKLLQASSPASRANVVVAKDGSGRFTTVSAAINAAPK-SSSGRYVIYVKGGVYDEQV  249

Query  915   EIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAA  736
             E+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDGFI Q ITFRNTAGAA
Sbjct  250   EV--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDGFIAQDITFRNTAGAA  307

Query  735   NHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNC  556
             NHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGTVDFIFGNAA V QNC
Sbjct  308   NHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGNAAAVLQNC  367

Query  555   NIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL--KGVKTYLGRPWKEYSRT  382
             NIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS      VK+YLGRPW++YSRT
Sbjct  368   NIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSSVKSYLGRPWQKYSRT  427

Query  381   VFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             VFMK+ LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TANRV W GYHV+TSA+EA
Sbjct  428   VFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYHVLTSASEA  487

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S FTVGNFIAG +W+P++ VPFTSGL
Sbjct  488   SPFTVGNFIAGSNWIPSSGVPFTSGL  513



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/518 (67%), Positives = 413/518 (80%), Gaps = 21/518 (4%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             F+ +C    I V++ V GY+  ++K+WCSQTP P+PCEY+L+ +  N   IK +S+FLK+
Sbjct  10    FVLLC----ILVASTVSGYNRKDVKAWCSQTPNPKPCEYFLTHNLDNK-PIKSESEFLKI  64

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             +  LAL     AK +T +LG KCR   EKAAWEDC++LY+  +  I+ T+DPN+KCS  D
Sbjct  65    SMKLALDRTILAKTHTSTLGPKCRDTREKAAWEDCIKLYDYTISNINETMDPNVKCSKTD  124

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNL+TC AGFVDLGVT  +LP + SNNVS L+ NTLAINK         T 
Sbjct  125   AQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNLLCNTLAINK----VPFNYTP  179

Query  1125  gyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
                +GFP WV+PGDRKLLQ+S   + + VVA+DGSGN+KT+ +A+NAA   SGSGR+VIY
Sbjct  180   PEKDGFPSWVKPGDRKLLQTSTP-RDNAVVAKDGSGNFKTIKDAINAA---SGSGRFVIY  235

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDGFI +G
Sbjct  236   VKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDGFIARG  293

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIF
Sbjct  294   ITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIF  353

Query  585   GNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KT  418
             GNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    KT
Sbjct  354   GNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKT  413

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+ RV W
Sbjct  414   YLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSARVTW  473

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  474   PGFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_010058468.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=720

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/515 (67%), Positives = 407/515 (79%), Gaps = 14/515 (3%)
 Frame = -3

Query  1656  ICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKN  1477
             I  F  + ++  +  YS +++KSWCS  PYPQPCEY+L+        +K KS FL  +  
Sbjct  9     ILLFWPLLITQTISSYSSSDVKSWCSTMPYPQPCEYFLTH-LPQQTPLKQKSHFLMASTR  67

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             +AL+ A+ A+  +YSLG+ CR+  EKAAW DCL LYE++V  ++ T+  + +C+  D QT
Sbjct  68    VALERAQLAQMKSYSLGSMCRNEREKAAWTDCLRLYEHIVHHLNRTI--HRQCTQDDVQT  125

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyt  1117
             WLSTALTNLETC AGFV+LG+  N+LP + SNN+S LISN L+ N         A   YT
Sbjct  126   WLSTALTNLETCRAGFVELGILDNVLP-LMSNNISKLISNALSANH-----EPYAMPNYT  179

Query  1116  eGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVK  940
               FP W+RPG+RKLL+S SA+S A+IVVA DGSGNYKT++EAV AA++RSG  R +IY+K
Sbjct  180   REFPTWLRPGNRKLLRSLSASSMANIVVAHDGSGNYKTISEAVIAASERSGMARCIIYIK  239

Query  939   AGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGIT  760
             AG Y+EN+E+GSKL+NI+ VGDGIG TIITGSRSVG G TTF SATVAV GDGFI Q IT
Sbjct  240   AGTYEENIEVGSKLENIVFVGDGIGMTIITGSRSVGEGFTTFNSATVAVDGDGFIAQDIT  299

Query  759   FRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  580
             FRNTAGAAN QAVALRS SDLSVFY+CSFEGYQDTL+V+S+RQFY+ECDIYGT+DFIFGN
Sbjct  300   FRNTAGAANGQAVALRSSSDLSVFYRCSFEGYQDTLFVHSERQFYKECDIYGTIDFIFGN  359

Query  579   AAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYL  412
             AAVVFQNCNIYARNPPNK N ITAQGR+DPNQNTGISIHNCKVTAASDL  V    KTYL
Sbjct  360   AAVVFQNCNIYARNPPNKVNIITAQGRTDPNQNTGISIHNCKVTAASDLLSVQSFAKTYL  419

Query  411   GRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGG  232
             GRPW+EYSRTVFM + LDSLID AGWL WDG+FAL+TLYYGEY N G G+ST NRV W G
Sbjct  420   GRPWQEYSRTVFMTTYLDSLIDSAGWLEWDGDFALSTLYYGEYMNIGPGSSTTNRVTWAG  479

Query  231   YHVITSATEASKFTVGNFIAGGSWLPATNVPFTSG  127
             YHVITS  EASKFT+GNFI GGSWL AT +P+TSG
Sbjct  480   YHVITSTIEASKFTIGNFIPGGSWLFATGIPYTSG  514



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/448 (74%), Positives = 386/448 (86%), Gaps = 11/448 (2%)
 Frame = -3

Query  1452  AKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTN  1273
             A  N +SLG+KCR+  EKAAW DC+ELY++ + K++ T+DPN +C+  DAQTWLSTALTN
Sbjct  3     AHGNIFSLGSKCRNEREKAAWNDCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTN  62

Query  1272  LETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVR  1093
             L+TC  GF++LGV+ + LP + SNNVS LISNTL+INK        A   Y  G+P WV+
Sbjct  63    LQTCQDGFIELGVSDHFLPLI-SNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVK  116

Query  1092  PGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENV  916
             PGDRKLLQSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV
Sbjct  117   PGDRKLLQSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENV  176

Query  915   EIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAA  736
             +IGS LKNI L+GDGIGKTI+TGSRSVGGG+TT+ SATVAVVGDGFI +G+T RNTAGA+
Sbjct  177   QIGSGLKNITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDGFIARGMTIRNTAGAS  236

Query  735   NHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNC  556
             NHQAVALRSGSDLSV+YQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQ C
Sbjct  237   NHQAVALRSGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQKC  296

Query  555   NIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKTYLGRPWKEYS  388
             NIYARNPPNK NT+TAQGR+DPNQNTGISIH+C+VTAASDLK     VKTYLGRPWKEYS
Sbjct  297   NIYARNPPNKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLGRPWKEYS  356

Query  387   RTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSAT  208
             RTVF+K+ LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+ RV W GYHVITS+T
Sbjct  357   RTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVNWTGYHVITSST  416

Query  207   EASKFTVGNFIAGGSWLPATNVPFTSGL  124
             EA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  417   EAAKFTVGNFISGNSWLPSTNVPFTSGL  444



>gb|EYU31969.1| hypothetical protein MIMGU_mgv1a005025mg [Erythranthe guttata]
Length=500

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/527 (66%), Positives = 410/527 (78%), Gaps = 30/527 (6%)
 Frame = -3

Query  1695  LLITK-MTNLQFIFICSFLAIFVSTAVFGYSP-TEIKSWCSQTPYPQPCEYYLSRSYS-N  1525
             + IT+ +  L F+ I S     +S A+ G+S    IKSWCSQTP PQPCEY+L+ +    
Sbjct  1     MAITRILATLLFVAISS-----ISPAISGHSSDAAIKSWCSQTPNPQPCEYFLTHNPKYK  55

Query  1524  GGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKID  1345
                I  KSDF K++  LAL    +AK N YSLG KCR+  EK+AW DC+ELY++ +  ++
Sbjct  56    IPAINKKSDFFKLSSQLALDRCMHAKSNLYSLGPKCRNEREKSAWADCIELYDSTIHAVN  115

Query  1344  TTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAI  1165
              TVDP  KC+ ADAQTWLS ALTNLETC +GFVD G+T  I P + SNNVS L+SNTLA+
Sbjct  116   KTVDPTTKCTPADAQTWLSAALTNLETCKSGFVDFGLTDYIFP-LMSNNVSLLLSNTLAL  174

Query  1164  NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNA  985
             NKG       A+    +GFP WV  GDRKLLQSS   +A++VVA+DGSGN++TV  AV A
Sbjct  175   NKG-GAYVGGASNNNKDGFPRWVNTGDRKLLQSSNP-RANVVVAKDGSGNFRTVAAAVAA  232

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             A KR+GSGRYVIYVK GVY ENV+IG  LKNIML+GDGIGKTIITGSRSV GG+TTFKSA
Sbjct  233   AGKRTGSGRYVIYVKQGVYSENVDIGKGLKNIMLLGDGIGKTIITGSRSVDGGSTTFKSA  292

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T +VVG GFI +G+TFRNTAGA NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY
Sbjct  293   TFSVVGSGFIARGVTFRNTAGARNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFY  352

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTA  445
             R+CDIYGTVDFIFGNAAVV QNCNI+ARNPPN+TNT+TAQGR+DPNQNTGISIHNC    
Sbjct  353   RDCDIYGTVDFIFGNAAVVLQNCNIFARNPPNRTNTLTAQGRTDPNQNTGISIHNC----  408

Query  444   ASDLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAG  265
                            ++YSRTVFMK+++DSL++PAGW+PW G+FAL+TLYYGEY+NTG G
Sbjct  409   ---------------RKYSRTVFMKTTMDSLVNPAGWMPWSGSFALDTLYYGEYANTGPG  453

Query  264   ASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +STANRVKW GY VITSA EA++F  G+FIA GSW+PATNVPFTSGL
Sbjct  454   SSTANRVKWKGYRVITSAAEAARFAPGSFIAAGSWIPATNVPFTSGL  500



>emb|CDY27388.1| BnaC04g50170D [Brassica napus]
Length=510

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/520 (67%), Positives = 413/520 (79%), Gaps = 21/520 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L F+F+C FLA  VS    GY+   +K+WCS+TP P+PCEY+L+ + S+   IK  S+FL
Sbjct  8     LTFVFLCIFLASTVS----GYNSKHVKAWCSKTPNPKPCEYFLTHN-SDQKPIKSLSEFL  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL  A  AK +  +LG KCR   EKAAWEDCL+LY+  V KI+ T+DP+ KCS 
Sbjct  63    KISMKLALDRAILAKSHASTLGPKCRDTREKAAWEDCLKLYDFTVSKINKTMDPDTKCSK  122

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D+QTWLSTALTNL+TC AGF++LGVT  ILP + SNNVS LI NTLAINK         
Sbjct  123   TDSQTWLSTALTNLDTCKAGFLELGVTDFILP-LMSNNVSDLICNTLAINK----VPFNY  177

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQ+S   + ++VVA+DGSGN++T+ EA+NAA   SGSGR+V
Sbjct  178   TPPEKDGFPSWVKPGDRKLLQNSTP-RDNVVVAKDGSGNFRTIKEAINAA---SGSGRFV  233

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  +  N+ML GDG G+TIITGSRSVGGG+TTFKSATVA VGDGFI 
Sbjct  234   IYVKQGVYSENLEI--QKDNVMLRGDGKGRTIITGSRSVGGGSTTFKSATVAAVGDGFIA  291

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY +CD+YGTVDF
Sbjct  292   RGITFRNTAGANNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYSDCDVYGTVDF  351

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA +FQNCNI+AR PP +TNTITAQGRS P+QNTGI IHN +VTAASDL+ V    
Sbjct  352   IFGNAAAIFQNCNIFARRPPGRTNTITAQGRSYPDQNTGIIIHNSRVTAASDLRPVLGST  411

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSR VFMK+SLDSLIDP GWL W+GNFAL TL+YGE+ NTG GAST++RV
Sbjct  412   KTYLGRPWRQYSRAVFMKTSLDSLIDPRGWLEWNGNFALTTLFYGEFQNTGPGASTSSRV  471

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W G+ VI SATEA +FTV +FIAG SW+P+  VPFTSGL
Sbjct  472   TWPGFRVIGSATEALQFTVDSFIAGSSWIPSY-VPFTSGL  510



>ref|XP_004514850.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=511

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/522 (67%), Positives = 417/522 (80%), Gaps = 14/522 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M +L  +     ++   S  V  +S + I+SWCS+TPYPQPCEYYLS    N   IK+KS
Sbjct  1     MASLPMLTTLLVVSFLFSCIVSSHSLSSIESWCSKTPYPQPCEYYLSNQGYNQ-TIKNKS  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             DF KV+  +A++ AK  + NT SLG KCR+  EKAAW+DC+ELY   ++K++ T+    K
Sbjct  60    DFFKVSLKIAIERAKMGQQNTNSLGPKCRNPKEKAAWDDCIELYHYTIKKLNETI--GTK  117

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+   +QTWLSTALTNLETC  GF DLGVT  +LP +++NN++ L+SNTL++NK      
Sbjct  118   CTQIQSQTWLSTALTNLETCKNGFYDLGVTNYVLPLLSNNNITKLLSNTLSLNK-----V  172

Query  1140  neattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y +GFP WV+PGDRKLLQ SSAASKA++VVA+DGSG + TV  AV+AA   S S
Sbjct  173   PYQQPNYKDGFPTWVKPGDRKLLQTSSAASKANVVVAKDGSGKFTTVNAAVSAAPSSS-S  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GRYVIYVK+GVY E V+I  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATV+ VGD
Sbjct  232   GRYVIYVKSGVYNEQVDI--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVSAVGD  289

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GF+ Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYG
Sbjct  290   GFMAQDITFRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYG  349

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVV QNCNI+ARNPP KT T+TAQGR+DPNQNTGI IHN KV+ ASDL   
Sbjct  350   TVDFIFGNAAVVLQNCNIFARNPPQKTITVTAQGRTDPNQNTGIIIHNSKVSPASDLNPS  409

Query  429   GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTAN  250
              VK+YLGRPW++YSRTVFM + LDS I+PAGWL WDGNFAL+TLYY EY+NTG+G+ST+N
Sbjct  410   SVKSYLGRPWQKYSRTVFMDTVLDSFINPAGWLEWDGNFALDTLYYAEYANTGSGSSTSN  469

Query  249   RVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             RVKW GYHV+TSA++AS FTVGNFIAG SWLP T VPFTSGL
Sbjct  470   RVKWKGYHVLTSASQASPFTVGNFIAGNSWLPKTGVPFTSGL  511



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/519 (64%), Positives = 406/519 (78%), Gaps = 13/519 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             F+ + S ++ F + A+   +   +  WCS+TP+P+PC+Y++ ++  +    K KS+F ++
Sbjct  8     FLLVISLISFF-APALSSVASYSVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQKSEFRRM  66

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             A +LAL  A  A+ +   LG+KCR+  EK AW DCL+LY++ + +++ T+D N KC+  D
Sbjct  67    AMSLALDRALTAQSHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNTKCTDFD  126

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             AQTWLSTALTNLETC AGFV+LGV   +LP + SNNV+ LISNTLA+        +    
Sbjct  127   AQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISNTLALRNA-----STVPE  180

Query  1125  gyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
              Y  GFP WV+PGDRKLLQ+S   + ++VVAQDGSGNY+T+  A++AAAKR+GSGR+VI+
Sbjct  181   TYKGGFPSWVKPGDRKLLQTSPV-RPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFVIH  239

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDGFI +G
Sbjct  240   VKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIARG  299

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGTVDFIF
Sbjct  300   ITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIF  359

Query  585   GNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----K  421
             GNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL  V    K
Sbjct  360   GNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFK  419

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             T+LGRPWKEYSRTV+M++ LDSL+DPAGWL W GNFALNTL+YGEY N G  AST+ RVK
Sbjct  420   TFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVK  479

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GY VITSATEASKFTVG+FIAG SWLPAT VPF SGL
Sbjct  480   WRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/525 (66%), Positives = 406/525 (77%), Gaps = 17/525 (3%)
 Frame = -3

Query  1677  TNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRS--YSNGGQIKDK  1504
             T +    +C   A+  S A+     T I SWCS+TPYP+ C+Y L+ +  YS   ++   
Sbjct  3     TKMSSFLLCFSFALLFSPALSNILNTGINSWCSKTPYPETCKYTLTHAQKYSVPTRM---  59

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
             SDF K+A  + +Q A  A+ +   LG KCR+  EKAAW DCL LY++ +  ++ T+DP  
Sbjct  60    SDFKKLAVQVTMQQALKAQSHNKWLGPKCRNKIEKAAWADCLSLYQDTIMLLNQTIDPAT  119

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
             KC+  DAQTWLSTALTNL+TC AGFV+LGV+  +LP + SNNVS LISNTL+I  G  + 
Sbjct  120   KCTDYDAQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISNTLSIGNG--SN  176

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                 T  Y EGFP WV PGDRKLLQS  A  AD+VVAQDGSGNYKT+ EA+ AAAKRSGS
Sbjct  177   VPAVTNRYKEGFPTWVSPGDRKLLQSLPA--ADVVVAQDGSGNYKTIKEALAAAAKRSGS  234

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VI+VK GVYKEN+EI   LKNIML+GDG+  TIITGSRSV GG+TTF SATVAV GD
Sbjct  235   KRFVIHVKRGVYKENLEI--TLKNIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGD  292

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+EC +YG
Sbjct  293   GFIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYG  352

Query  603   TVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLK-  430
             TVDFIFGNAAVV QNC IYAR P N + NTITAQGR+DPNQNTGISIH+ +V A SDLK 
Sbjct  353   TVDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKP  412

Query  429   ---GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAS  259
                 VKTYLGRPWKEYSRTVF++S LD+L+D AGWL WDGNFAL TLYYGEY NTG G+S
Sbjct  413   VLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSS  472

Query  258   TANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             T  RV WGGYHVITS++EASKFTVGNFIAG SWLPATNVPFT+GL
Sbjct  473   TRGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/521 (65%), Positives = 407/521 (78%), Gaps = 16/521 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L FI + SF A  VS+     +   +  WCS+TP+P+PC+Y++ ++  +    K +S+F 
Sbjct  9     LLFISLISFFAPAVSSV----ASNGVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQESEFR  64

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             ++A +LAL  A  A+++   LG+KCR+  EK AW DCL+LY++ + +++ T+D N KC+ 
Sbjct  65    RMAMSLALDRALTAQNHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNTKCTD  124

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC AGFV+LGV   +LP + SNNV+ LISNTLA+        +  
Sbjct  125   FDAQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISNTLALRNA-----STV  178

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y  GFP WV+PGDRKLLQ+S   + ++VVAQDGSGNY+T+  A++AAAKR+GSGR+V
Sbjct  179   PETYKGGFPSWVKPGDRKLLQTSPV-RPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFV  237

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             I+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDGFI 
Sbjct  238   IHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIA  297

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGTVDF
Sbjct  298   RGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  357

Query  591   IFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV---  424
             IFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL  V   
Sbjct  358   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSK  417

Query  423   -KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
              KT+LGRPWKEYSRTV+M++ LDSL+DPAGWL W GNFALNTL+YGEY N G  AST+ R
Sbjct  418   FKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGR  477

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKW GY VITSATEASKFTVG+FIAG SWLPAT VPF SGL
Sbjct  478   VKWRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/501 (68%), Positives = 396/501 (79%), Gaps = 12/501 (2%)
 Frame = -3

Query  1620  VFGYSPTEIKSWCSQTPYPQPCEYYLSR--SYSNGGQIKDKSDFLKVAKNLALQYAKNAK  1447
             V  YS  EIK+WCSQTPYP PCE +L    S      I  KS F ++    AL+ A +A 
Sbjct  21    VLCYSEKEIKNWCSQTPYPAPCEEFLKTKASTKKSTPITTKSHFFEILVETALERAVSAH  80

Query  1446  DNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLE  1267
              N  SLG KCR+  EK AW DC++LY+ ++ +++ T D   +C+ ADAQTWLS ALT LE
Sbjct  81    KNALSLGPKCRNSKEKTAWTDCVDLYDEIITRLNRTSD---RCTPADAQTWLSAALTALE  137

Query  1266  TCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPG  1087
             TC  GF +LG++    P +T+NNVS LIS+ L++NK  +    E TT   +GFP WVRPG
Sbjct  138   TCRTGFDELGLSAFGYP-LTANNVSKLISDGLSVNKPASPEGYEPTTIMDDGFPTWVRPG  196

Query  1086  DRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIG  907
             DRKLLQS  + KA++VVAQDGSGN+KTV EAV AA    G GR+VIYVK+GVY EN++I 
Sbjct  197   DRKLLQS-GSPKANVVVAQDGSGNFKTVKEAVAAA---KGGGRFVIYVKSGVYNENLDI-  251

Query  906   SKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQ  727
              K KN+M+VGDGIGKTIITGSRSVGGG+TTF+SATVAV GDGFI + ITFRNTAGA NHQ
Sbjct  252   -KAKNVMMVGDGIGKTIITGSRSVGGGSTTFRSATVAVDGDGFIARDITFRNTAGAKNHQ  310

Query  726   AVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIY  547
             AVALRSGSDLSVFY+C FEGYQDTLYVY++RQFY++CDIYGTVDFIFGNAAVV Q+CNI 
Sbjct  311   AVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQCDIYGTVDFIFGNAAVVLQDCNII  370

Query  546   ARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLGRPWKEYSRTVFMKS  367
             AR+PPNKT T+TAQGRSDPNQNTGISIHNC++T+A  L GVK YLGRPW++YSRTV MKS
Sbjct  371   ARDPPNKTITVTAQGRSDPNQNTGISIHNCRITSAGGLSGVKAYLGRPWRQYSRTVVMKS  430

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
             S+   I PAGW+PW GNFALNTLYYGEY NTG GASTANRV W GY VITSA EASKFTV
Sbjct  431   SIGGFISPAGWMPWSGNFALNTLYYGEYMNTGPGASTANRVNWKGYRVITSAAEASKFTV  490

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             GNFIAGGSWLP+T VPFTSGL
Sbjct  491   GNFIAGGSWLPSTGVPFTSGL  511



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/530 (65%), Positives = 410/530 (77%), Gaps = 14/530 (3%)
 Frame = -3

Query  1692  LITKMTNLQFIFICSFLAIFVSTAVFGYSPT--EIKSWCSQTPYPQPCEYYLSRSYSNGG  1519
             + TK+  L F FI   L+ F S   F  +P+  +I  WC+QTPYP+ C Y+     +N  
Sbjct  1     MATKIGWLFFTFIS--LSSFFS-PCFSKNPSSGDINWWCNQTPYPEQCNYFFLNHGTNHF  57

Query  1518  QIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTT  1339
               K+K+D  K+A  + L+ A  AK +T +L +KCR+  EKAAW DCL+LYEN + +++ T
Sbjct  58    MPKEKADVKKMAMQITLERALKAKTHTENLESKCRNEREKAAWADCLKLYENTILQLNRT  117

Query  1338  VDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINK  1159
             +D N KC+  DAQTWLSTALTNLETC +GF +LGV+  +LP + SNNVS LI NTLA+N 
Sbjct  118   LDSNTKCTDFDAQTWLSTALTNLETCRSGFQELGVSDFVLP-LMSNNVSKLICNTLALNN  176

Query  1158  GFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAA  979
                 +    T      FP WV PGDRKLLQSS   + +++VAQDGSGNY+T+  A++AAA
Sbjct  177   NINVSVETQTYKDG--FPTWVTPGDRKLLQSSLV-RPNLIVAQDGSGNYRTIKAALDAAA  233

Query  978   KRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATV  799
             KRSGSGR+VI VK G Y+EN+EIG+K+KNIML+G G+  TIITGSRSVGGG+TTF SATV
Sbjct  234   KRSGSGRFVIQVKRGTYRENLEIGNKMKNIMLLGAGMRDTIITGSRSVGGGSTTFDSATV  293

Query  798   AVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRE  619
             AV GDGFI QGITFRNTAG  NHQAVALRSGSDLSVF++C FEGYQDTLYV+S RQFY+E
Sbjct  294   AVTGDGFIAQGITFRNTAGPQNHQAVALRSGSDLSVFHRCGFEGYQDTLYVHSQRQFYKE  353

Query  618   CDIYGTVDFIFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAA  442
             C IYGTVDFIFGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V AA
Sbjct  354   CYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAA  413

Query  441   SDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNT  274
             SDL+ V    KTYLGRPWK+YSRTVF+++ LDSL+DPAGWL WDGNFA NTLYYGEY N+
Sbjct  414   SDLRPVLSSFKTYLGRPWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNS  473

Query  273   GAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G G+ST+ RVKW GYHVIT+ TEAS+FTV NFIAG SWLPATNVPF +GL
Sbjct  474   GPGSSTSRRVKWRGYHVITNPTEASRFTVANFIAGRSWLPATNVPFAAGL  523



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/519 (64%), Positives = 410/519 (79%), Gaps = 10/519 (2%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKS-WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             +   S  ++F+   V GY P+++ S WC+QTPYP+ CEYYLS +  N   IK KSDFLK+
Sbjct  13    VLFTSLFSLFMH--VEGYGPSKLLSYWCNQTPYPKQCEYYLSHN-QNPPNIKRKSDFLKM  69

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
                 A++ A  A  N  SLG  C+   EKAAW+DCL++YE  +Q ++ T+  +  C+  D
Sbjct  70    MMQSAIENAGKAHKNVNSLGHNCKDEKEKAAWKDCLDVYELSIQGLNNTMTTS-SCTKDD  128

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAVTS-NNVSYLISNTLAIN---KGFtttnn  1138
              QTWLS+ALT ++TC  GF +LGVT NI+P +++ NNVS LISN LAIN           
Sbjct  129   TQTWLSSALTLMQTCQNGFRELGVTENIMPMLSNDNNVSCLISNALAINGDGSNGRRLEG  188

Query  1137  eattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
             +   G   GFP WVRP DRKLLQS S++ +AD+VVAQDGSG+YKT+ +A++ A+++ GSG
Sbjct  189   QDWAGTKGGFPRWVRPSDRKLLQSVSSSGRADLVVAQDGSGDYKTIGQAISDASRKGGSG  248

Query  960   RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  781
             R+VIY+K G+YKEN+EI  KLKNIML+GDGIG+TIITGS+SVGGG+TTF+SATVAV+G G
Sbjct  249   RFVIYIKKGIYKENLEIEDKLKNIMLLGDGIGRTIITGSKSVGGGSTTFRSATVAVMGSG  308

Query  780   FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  601
             F+ QGITFRNTAG +NHQAVALRS SDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  309   FMAQGITFRNTAGPSNHQAVALRSNSDLSVFYKCSFEGYQDTLYVFSNRQFYRECDIYGT  368

Query  600   VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK  421
             VDFIFGNAA V QNCNIYAR  P++T  ITAQGRSDPN+NTGISIHN +V+A+ DLKG K
Sbjct  369   VDFIFGNAAAVIQNCNIYARFGPSRTVAITAQGRSDPNENTGISIHNSRVSASEDLKGSK  428

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPWK+YSRTVFMK+ L  ++DP GWL W+G+FAL+TLYYGEY+NTG G+ST+NRVK
Sbjct  429   TYLGRPWKKYSRTVFMKTYLSGIVDPKGWLEWNGDFALSTLYYGEYANTGPGSSTSNRVK  488

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GYHVITS+ EA KF VGNFIAG +WLP+T VPF SGL
Sbjct  489   WSGYHVITSSAEAGKFNVGNFIAGNNWLPSTGVPFKSGL  527



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/521 (64%), Positives = 406/521 (78%), Gaps = 16/521 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L FI + SF A  +S+     +   +  WCS+TP+P+PC+Y++ ++  +    K KS+F 
Sbjct  9     LLFISLISFFAPALSSV----ASNGVDYWCSKTPHPEPCKYFMQQNSKHFAVPKQKSEFR  64

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             ++A +LAL  A  A+++   LG+KCR+  EK AW DCL+LY++ + +++ T+D N KC+ 
Sbjct  65    RMAMSLALDRALTAQNHNKWLGSKCRNHKEKVAWADCLKLYQDTINQLNHTLDSNTKCTD  124

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC AGFV+LGV   +LP + SNNV+ LISNTLA+        +  
Sbjct  125   FDAQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISNTLALRNA-----STV  178

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y  GFP WV+PGDRKLLQ+S   + ++VVAQDGSGNY+T+  A++AAAKR+GSGR+V
Sbjct  179   PETYKGGFPSWVKPGDRKLLQTSPV-RPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFV  237

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             I+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDGFI 
Sbjct  238   IHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIA  297

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGTVDF
Sbjct  298   RGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDF  357

Query  591   IFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV---  424
             IFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL  V   
Sbjct  358   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSK  417

Query  423   -KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
              KT+LGRPWKEYSRTV+M++ LDSL+DPAGWL W GNFALNTL+YGEY N G  AST+ R
Sbjct  418   FKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGR  477

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKW GY VITSATEASKFTVG+FI G SWLPAT VPF SGL
Sbjct  478   VKWRGYRVITSATEASKFTVGSFITGNSWLPATGVPFRSGL  518



>ref|XP_009142324.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/520 (66%), Positives = 411/520 (79%), Gaps = 21/520 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L F+F+C FLA  VS    GY+   +K+WCS+TP P+PCEY+L+ + S+   IK  S+FL
Sbjct  8     LTFVFLCIFLASTVS----GYNSKHVKAWCSKTPNPKPCEYFLTHN-SDQKPIKSLSEFL  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K++  LAL  A  AK +  +LG KCR   EKAAWEDCL+LY+  V KI+ T+DP+ KCS 
Sbjct  63    KISMKLALDRAILAKSHASTLGPKCRDTREKAAWEDCLKLYDFTVSKINKTMDPDTKCSK  122

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D+QTWLSTALTNL+TC AGF++LGVT  ILP + SNNVS LI NTLAINK         
Sbjct  123   TDSQTWLSTALTNLDTCKAGFLELGVTDFILP-LMSNNVSDLICNTLAINK----VPFNY  177

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
             T    +GFP WV+PGDRKLLQ+S   + ++VVA+DGSGN++T+ EA+NAA   SGSGR+V
Sbjct  178   TPPEKDGFPSWVKPGDRKLLQNSTP-RDNVVVAKDGSGNFRTIKEAINAA---SGSGRFV  233

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY EN+EI  +  N+ML GDG G+TIITGSRSV GG+TTFKSATVA VGDGFI 
Sbjct  234   IYVKQGVYSENLEI--QKDNVMLRGDGKGRTIITGSRSVRGGSTTFKSATVAAVGDGFIA  291

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY +C++YGTVDF
Sbjct  292   RGITFRNTAGANNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYSDCNVYGTVDF  351

Query  591   IFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             IFGNAA +FQNCNI+AR PP +TNTITAQGRS  +QNTGI IHN +VTAASDL+ V    
Sbjct  352   IFGNAAAIFQNCNIFARRPPGRTNTITAQGRSYQDQNTGIIIHNSRVTAASDLRPVLGST  411

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPW++YSRTVFMK+SLDSLIDP GWL W+GNF L TL+YGE+ NTG GAST++RV
Sbjct  412   KTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFGLTTLFYGEFHNTGPGASTSSRV  471

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W G+ VI SATEA +FTV +FIAG SW+P+  VPFTSGL
Sbjct  472   TWPGFRVIRSATEALQFTVDSFIAGSSWIPSY-VPFTSGL  510



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/518 (65%), Positives = 410/518 (79%), Gaps = 15/518 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFG--YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQI---KDKSDFLKVA  1483
             FL ++ S  V     + + I SWC+QTP P+PC+Y++++   N       K+KSDFLK+A
Sbjct  11    FLFLYFSPRVLSSTVASSSIDSWCNQTPNPEPCKYFMNQIAQNRNHFRFPKNKSDFLKLA  70

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
              +LA+Q A+ A+     LG KCR+  EKAA  DCL+LYE+ +  ++ T+DP+ KC+  D 
Sbjct  71    IDLAMQRAQTAQSQNKWLGKKCRNEKEKAALADCLKLYEDTIINLNHTIDPSAKCTDYDV  130

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNLETC AGFV+LGVT  +LP + SNNVS LI NTLAIN     + +     
Sbjct  131   QTWLSTALTNLETCKAGFVELGVTDFMLP-LMSNNVSSLIRNTLAINNS---STSVLPQT  186

Query  1122  yteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
             Y +GFP WV  GDRKLLQ+S+ S  ++VVAQDGSGN++T+ +A++AAAKRSGSGR+VI++
Sbjct  187   YKDGFPHWVTSGDRKLLQTSSPS-PNLVVAQDGSGNFRTIKQALDAAAKRSGSGRFVIHI  245

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             K+G+Y+EN+EIG+ + NIMLVGDG+  TIITGSRSVGGG+TTF SATVAV GDGFI +GI
Sbjct  246   KSGIYRENLEIGNDMINIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGDGFIARGI  305

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFIFG
Sbjct  306   TFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFG  365

Query  582   NAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KT  418
             NAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+ DLK V    KT
Sbjct  366   NAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPVLSSFKT  425

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             YLGRPWK+YSRTV++++ LDSL+DPAGWL WDG+FALNTLYYGEY N G  AST+ RV W
Sbjct  426   YLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTW  485

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GY VITS+TEA++FTV NFIAGGSWLPA++VPFTSGL
Sbjct  486   RGYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/520 (64%), Positives = 401/520 (77%), Gaps = 12/520 (2%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             F+   SF A             +I +WC++ PYP  C+Y+++    +    K  +DF K+
Sbjct  8     FVLFISFSAFLFPAFSITLFDNDINNWCNKAPYPNQCKYFMNHGPYHFAP-KHNTDFKKM  66

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             A  +A++ A  A+  T  LGTKCR+  EKAAW DC+ LYE+ + +++ T+DPN KC+  D
Sbjct  67    AMQIAMERALQAETYTKQLGTKCRNEREKAAWSDCVNLYESTILQLNKTLDPNTKCTDFD  126

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
              QTWLSTALTNLETC  GFV+LGV  + ILP++ SNNVS LI NTLA+N       +   
Sbjct  127   TQTWLSTALTNLETCRTGFVELGVNSDYILPSIMSNNVSELICNTLALNNN----GSTLK  182

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
               Y  GFP W  PGDRKLLQSS   + +IVVAQDG+GN++T+  A++AAAKRSG+GR++I
Sbjct  183   QTYKYGFPTWFSPGDRKLLQSSTV-RPNIVVAQDGTGNFRTIKAALDAAAKRSGNGRFII  241

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             +VK GVY+EN+EIGSK+KNIMLVGDG+  TIITGSRSV GG+TTFKSATVAV G+GFI +
Sbjct  242   HVKRGVYRENLEIGSKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGFIAR  301

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
             GITFRNTAG  NHQAVALRSGSD SVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFI
Sbjct  302   GITFRNTAGPQNHQAVALRSGSDQSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFI  361

Query  588   FGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             FGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+ V    
Sbjct  362   FGNAAVVLQNCMIFARQPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLNTF  421

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPWK+YSRTVFMK+ LDSL+DPAGWL WDGNFALNTLYYGEY N+GAGAST+ RV
Sbjct  422   KTYLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGAGASTSRRV  481

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +W GY VIT++ EA+KF+V NFIAG SWLPATNVPF +GL
Sbjct  482   RWRGYRVITNSNEAAKFSVENFIAGRSWLPATNVPFRAGL  521



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/529 (64%), Positives = 414/529 (78%), Gaps = 18/529 (3%)
 Frame = -3

Query  1692  LITKMT-NLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ  1516
             + TK+  +L F+ +CS L+  ++      S  +I  WCS+TP P+PC+Y++ ++  +   
Sbjct  1     MATKLCLSLLFMCLCSLLSSSIA------SNDQIDYWCSKTPNPEPCKYFMKQNPKHFVP  54

Query  1515  IKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV  1336
              K KSDF K+A  LA+Q A NA+++   LG KCR+  EKAAW DCL+LYE+ + +++ T+
Sbjct  55    -KQKSDFRKMAIELAVQRALNAQNHNKWLGPKCRNEKEKAAWADCLKLYEDTIAELNHTI  113

Query  1335  DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKG  1156
             D N KC+  DAQTWLSTALTNLETC AGF DLGV+  +LP + SNNVS LI NTLA+   
Sbjct  114   DSNTKCTQFDAQTWLSTALTNLETCKAGFKDLGVSDFVLP-LMSNNVSKLIRNTLALKDN  172

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                 ++     Y +GFP WV+ GDRKLLQ+S+ S  ++VVAQDGSGN++T+  A++AAAK
Sbjct  173   ---ASSTLPQTYKDGFPSWVKAGDRKLLQTSSPS-PNLVVAQDGSGNHRTIKAALDAAAK  228

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             RSGS R+VI +K+GVY+EN++IG KLKNIMLVGDG+  TIITGSRSVGGG TTF SATVA
Sbjct  229   RSGSRRFVIRIKSGVYRENLDIGKKLKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVA  288

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             V G+GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC
Sbjct  289   VTGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKEC  348

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAAS  439
              IYGTVDFIFGNAAV+ QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+S
Sbjct  349   YIYGTVDFIFGNAAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASS  408

Query  438   DLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             DL+ V    KTYLGRPWKEYSRTVF+++ LDSL+DPAGWL WDGNFALNTLYYGEY N+G
Sbjct  409   DLRPVLSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSG  468

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GAST  RVKW GY VITS+TEAS+FTV NFIAG SWLPAT VPF  GL
Sbjct  469   PGASTRGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/518 (66%), Positives = 402/518 (78%), Gaps = 12/518 (2%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVA  1483
              F+C   A+F S A+     T I SWC +TPYP  C+Y L++   +       SDF K+A
Sbjct  9     FFLCVSFALFFSPALSNILNTGIDSWCKKTPYPDTCKYTLTQDQKSLSIPNKVSDFKKIA  68

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
               +AL+ A  A+ +   LG KCR+  EKAAW DCL LYE  ++ ++ TVDP IKC+  D+
Sbjct  69    IQVALKRALKAQSHNKWLGQKCRNKKEKAAWADCLSLYEETIKLLNHTVDPAIKCTDYDS  128

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNL+TC AGFV+LGV+  +LP + SNNVS LISNTL++  G ++     T  
Sbjct  129   QTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISNTLSL--GNSSNVPPVTNL  185

Query  1122  yteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
             YTEGFP WV PGDRKLLQS+ A  AD+VVAQDGSGNYKT+ EA++ AAKRSGS R+VI+V
Sbjct  186   YTEGFPSWVSPGDRKLLQSTPA--ADVVVAQDGSGNYKTIKEALDVAAKRSGSKRFVIHV  243

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             K GVYKEN++I  KLKN+ L+GDG+  TIITGSRSV GG+TTF SATVAV G+GFI +GI
Sbjct  244   KRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEGFIARGI  301

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TFRNTAG  NHQAVALRSG+DLSVFY CSFEGYQDTLY +S RQFY++C +YGTVDFIFG
Sbjct  302   TFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFG  361

Query  582   NAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKT  418
             NAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D K     VKT
Sbjct  362   NAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKT  421

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             +LGRPWKEYSRTVFM+S LD+L+DPAGWL W GNFAL TLYYGEY N G GA T+ RVKW
Sbjct  422   FLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKW  481

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GGY VITS++EASKFTV NFIAG SWLPATNVPFT+GL
Sbjct  482   GGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/524 (64%), Positives = 396/524 (76%), Gaps = 12/524 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M   +F+ +   +++ VS +     P  I++WCSQT YPQ CEYY+   + +   +    
Sbjct  1     MALHEFLTLVILISLLVSPSFSDNIPPNIRTWCSQTSYPQSCEYYMGH-HPHSSFLSGHL  59

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
             D  K+A  +AL  A  A+ N   LG KCR+  EKAAW DC+ELY+N + +++ TV+P  K
Sbjct  60    DSKKLAMQIALDQAIQAESNNMLLGPKCRNEREKAAWTDCIELYKNTIARLNLTVNPGAK  119

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  D QTWLSTALTNLETC  GFV+LGV+  ILP + SNNVS LISN LAINK      
Sbjct  120   CTDVDLQTWLSTALTNLETCRTGFVELGVSDYILP-LMSNNVSKLISNILAINK---PVA  175

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   Y EGFP WV P DRKLLQ++A AS+A +VVAQDGSGN+KT+ EA+NAAAK++  
Sbjct  176   LPNEQTYHEGFPTWVSPRDRKLLQATALASRAILVVAQDGSGNFKTINEAINAAAKQNTG  235

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GR+VI VKAG Y E++ IGS   N+MLVGDGIG T+ITGS SVGGG+TTF SATVAVVGD
Sbjct  236   GRFVIQVKAGTYAEHLHIGSP--NLMLVGDGIGNTVITGSMSVGGGSTTFNSATVAVVGD  293

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI + ITFRNTAG    QAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC IYG
Sbjct  294   GFIARDITFRNTAGPGKGQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECAIYG  353

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK--  430
             TVDFIFGNAAVV QNCNI++R P N   T+TAQGR DPNQNTGI IH  ++TAASDLK  
Sbjct  354   TVDFIFGNAAVVLQNCNIFSRKPINGVVTVTAQGRIDPNQNTGIVIHTSQITAASDLKPV  413

Query  429   --GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                VK YLGRPW++YSRTV +KS LD+LI P GWL W G+F LNTLYYGEY NTG G+ST
Sbjct  414   QSSVKAYLGRPWRQYSRTVILKSFLDNLIQPVGWLEWSGSFGLNTLYYGEYQNTGPGSST  473

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ANRVKWGGY VITS  EASKFTVGNFIAG SWLPA+NVPFTSGL
Sbjct  474   ANRVKWGGYRVITSVAEASKFTVGNFIAGSSWLPASNVPFTSGL  517



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/518 (66%), Positives = 401/518 (77%), Gaps = 12/518 (2%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVA  1483
              F+C   A+F S A+     T I SWC +TPYP  C+Y L+    +       SDF K+A
Sbjct  9     FFLCVSFALFFSPALSNILNTGIDSWCKKTPYPDTCKYTLTHDQKSLSIPNKISDFKKLA  68

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
               +AL+ A  A+ +   LG KCR+  EKAAW DCL LYE  ++ ++ TVDP IKC+  D+
Sbjct  69    IQVALKRALKAQSHNKWLGQKCRNKKEKAAWADCLSLYEETIKLLNHTVDPAIKCTDYDS  128

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNL+TC AGFV+LGV+  +LP + SNNVS LISNTL++  G ++     T  
Sbjct  129   QTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISNTLSL--GNSSNVPPVTNL  185

Query  1122  yteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
             YTEGFP WV PGDRKLLQS+ A  AD+VVAQDGSGNYKT+ EA++ AAKRSGS R+VI+V
Sbjct  186   YTEGFPSWVSPGDRKLLQSTPA--ADVVVAQDGSGNYKTIKEALDVAAKRSGSKRFVIHV  243

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             K GVYKEN++I  KLKN+ L+GDG+  TIITGSRSV GG+TTF SATVAV G+GFI +GI
Sbjct  244   KRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEGFIARGI  301

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TFRNTAG  NHQAVALRSG+DLSVFY CSFEGYQDTLY +S RQFY++C +YGTVDFIFG
Sbjct  302   TFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFG  361

Query  582   NAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG----VKT  418
             NAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D K     VKT
Sbjct  362   NAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKT  421

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKW  238
             +LGRPWKEYSRTVFM+S LD+L+DPAGWL W GNFAL TLYYGEY N G GA T+ RVKW
Sbjct  422   FLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKW  481

Query  237   GGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GGY VITS++EASKFTV NFIAG SWLPATNVPFT+GL
Sbjct  482   GGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/519 (65%), Positives = 402/519 (77%), Gaps = 14/519 (3%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVA  1483
             IF+ S    F S+ +      ++  WC +TPYP PC+Y++S         K KS+F K+A
Sbjct  10    IFMLSL--SFFSSTILASDSGDVNWWCDKTPYPAPCKYFMSHGGHKYNAPKKKSEFQKMA  67

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
               +A++ A  A+ +   LG+KCR+  EKAAW DCL+ Y++ +Q+++ T+DP  KC+  D 
Sbjct  68    MQVAMERALTAQSHNKWLGSKCRNEREKAAWADCLKQYQDTIQQLNQTLDPATKCTDFDQ  127

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNL+TC AGFV+LGV+  +LP + SNNVS LISN+LA+       +      
Sbjct  128   QTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISNSLAMKNDIPEKHTYKEG-  185

Query  1122  yteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIY  946
                 FP WV+ GDR+LLQS S A+KA++VVAQDGSGNYKT+  A+ AAAKRSGSGRYVI+
Sbjct  186   ----FPSWVKAGDRRLLQSTSTAAKANLVVAQDGSGNYKTIKAAIEAAAKRSGSGRYVIH  241

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV G+GFI +G
Sbjct  242   VKKGVYKENIEIGNKMKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEGFIARG  301

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             ITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY+EC IYGTVDFIF
Sbjct  302   ITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGTVDFIF  361

Query  585   GNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----K  421
             GNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA+DLK V    K
Sbjct  362   GNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFK  421

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPWKEYSRTV++ + LD+L+D AGWL WDGNFALNTLYYGEY N G G+ST+ RVK
Sbjct  422   TYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVK  481

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GY VITSATEASKF+V NFIAG SWLPAT VPF SGL
Sbjct  482   WRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  520



>ref|XP_004133929.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN56617.1| hypothetical protein Csa_3G126810 [Cucumis sativus]
Length=509

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/520 (64%), Positives = 400/520 (77%), Gaps = 12/520 (2%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK-  1504
             M     +F    + +   + +  YS  EIK+WCSQTPYP PCE +L    +         
Sbjct  1     MARHTIVFFVVLIVLIFPSDILCYSEKEIKNWCSQTPYPAPCEEFLKTKATTKKTPITTK  60

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
             S F ++    AL+ A +A  N  SLG KCR+  EK AW DC++LY+ ++ +++ T   + 
Sbjct  61    SHFFEILVETALERAVSAHKNALSLGPKCRNSKEKTAWTDCVDLYDQIITRLNRT---SA  117

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
             +CS ADAQTWLS ALT LETC  GF +LG++    P +T+NNVS LIS+ L++NK   + 
Sbjct  118   RCSPADAQTWLSAALTALETCRTGFEELGLSAFGYP-LTANNVSKLISDGLSVNKP-ASP  175

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                  T  T+GFP WV PG+RKLLQS +  KAD+VVAQDGSGN+KTV +A++AA    G 
Sbjct  176   EGYEPTTMTDGFPTWVSPGNRKLLQSESP-KADVVVAQDGSGNFKTVKDAISAA---KGG  231

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GR+VIY+K+GVY EN++I  K KN+M+VGDGIGKTIITGSRSVGGG+TTF+SATVAV GD
Sbjct  232   GRFVIYIKSGVYNENLDI--KAKNVMMVGDGIGKTIITGSRSVGGGSTTFRSATVAVDGD  289

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI + ITFRNTAGA NHQAVALRSGSDLSVFY+C FEGYQDTLYVY++RQFY++CDIYG
Sbjct  290   GFIARDITFRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQCDIYG  349

Query  603   TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV  424
             TVDFIFGNAAVV Q+CNI AR+PPNKT T+TAQGRSDPNQNTGISIHNC++T++  L GV
Sbjct  350   TVDFIFGNAAVVLQDCNIIARDPPNKTITLTAQGRSDPNQNTGISIHNCRITSSGGLSGV  409

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             K YLGRPW++YSRTV MKSS+   I PAGW+PW GNFALNTLYY EY NTG GASTANRV
Sbjct  410   KAYLGRPWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGPGASTANRV  469

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W GYHVITSA+EASKFTVGNFIAGGSWLP+T VPFTSGL
Sbjct  470   NWKGYHVITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  509



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/520 (65%), Positives = 399/520 (77%), Gaps = 21/520 (4%)
 Frame = -3

Query  1644  LAIFVSTAVFGYSPTEIKS--------WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
             LA+FV    F   P  + S        WC +TP PQPC+Y++ R        K KS+F K
Sbjct  5     LALFVIFMSFSLVPPTLSSVVTNGIDYWCDRTPNPQPCKYFM-RQKGKSYVPKQKSEFRK  63

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             +A  +AL  A NA+ +   LG KCR+  EKAAW DCL+LYE  + +++ T+D + KC+  
Sbjct  64    MAVQIALDRALNAQSHNKGLGKKCRNDKEKAAWADCLKLYEETILQLNQTLD-STKCTDF  122

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
             D QTWLSTALTNLETC AGFV+LGV+  ILP + SNNVS LISNTLA+N       +   
Sbjct  123   DVQTWLSTALTNLETCRAGFVELGVSDYILP-LMSNNVSKLISNTLALNNN----ASFVP  177

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
               Y  GFP W++ GDRKLLQSS+ +  ++VVAQDGSGN++T+ EA++AAAKRSGSGR+VI
Sbjct  178   QTYKHGFPRWLKAGDRKLLQSSSPT-PNLVVAQDGSGNHRTIKEALDAAAKRSGSGRFVI  236

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             +VK GVYKEN+EIG+KLKNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G+GFI +
Sbjct  237   HVKRGVYKENLEIGNKLKNIMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGEGFIAR  296

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
             GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFI
Sbjct  297   GITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFI  356

Query  588   FGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             FGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA+DL  V    
Sbjct  357   FGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPVLSSF  416

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWKEYSRTVFM++ LDSL+DPAGW  WDG+FALNTLYYGEY N G  A T+ RV
Sbjct  417   KTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRRV  476

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W GY VITSATEASKFTV NFIAG SWLP T +PFTSGL
Sbjct  477   TWKGYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/492 (69%), Positives = 393/492 (80%), Gaps = 17/492 (3%)
 Frame = -3

Query  1578  QTPYPQPCEYYLSRS--YSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGG  1405
             +TPYP+ C+Y L+ +  YS   ++   SDF K+A  + +Q A  A+ +   LG KCR+  
Sbjct  1     KTPYPETCKYTLTHAQKYSVPTRM---SDFKKLAVQVTMQQALKAQSHNKWLGPKCRNKI  57

Query  1404  EKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGN  1225
             EKAAW DCL LY++ +  ++ T+DP  KC+  DAQTWLSTALTNL+TC AGFV+LGV+  
Sbjct  58    EKAAWADCLSLYQDTIMLLNQTIDPATKCTDYDAQTWLSTALTNLDTCRAGFVELGVSDF  117

Query  1224  ILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKAD  1045
             +LP + SNNVS LISNTL+I  G  +     T  Y EGFP WV PGDRKLLQSS A  AD
Sbjct  118   VLP-LMSNNVSKLISNTLSIGNG--SNVPAVTNRYKEGFPTWVSPGDRKLLQSSPA--AD  172

Query  1044  IVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIG  865
             +VVAQDGSGNYKT+ E + AA KRSGS R+VI+VK GVYKEN+EI  KLKNIML+GDG+ 
Sbjct  173   VVVAQDGSGNYKTIKEGLAAAEKRSGSNRFVIHVKRGVYKENLEI--KLKNIMLLGDGLR  230

Query  864   KtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFY  685
              TIITGSRSV GG+TTF SATVAV GDGFI +GITFRNTAG  NHQAVALRSG+DLSVFY
Sbjct  231   YTIITGSRSVVGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALRSGADLSVFY  290

Query  684   QCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITA  508
             +C FEGYQDTLYV+S RQFY+EC +YGTVDFIFGNAAVV QNC IYAR P N + NTITA
Sbjct  291   RCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFGNAAVVLQNCMIYARRPMNGQKNTITA  350

Query  507   QGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPA  340
             QGR+DPNQNTGISIH+ +V A SDLK     VKTYLGRPWKEYSRTVF++S LD+L+DPA
Sbjct  351   QGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTYLGRPWKEYSRTVFLQSYLDTLVDPA  410

Query  339   GWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSW  160
             GWL WDGNFAL TLYYGEY NTG G+ST+ RV WGGYHVITS++EASKFTVGNFIAG SW
Sbjct  411   GWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNWGGYHVITSSSEASKFTVGNFIAGSSW  470

Query  159   LPATNVPFTSGL  124
             LPATNVPFT+GL
Sbjct  471   LPATNVPFTAGL  482



>gb|KCW73024.1| hypothetical protein EUGRSUZ_E01466, partial [Eucalyptus grandis]
Length=523

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/514 (65%), Positives = 392/514 (76%), Gaps = 23/514 (4%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA  1450
             S  + GYS   +KSWCS+ PYPQPCE++L+R+      +K +S FL+ +  +AL+ A+ A
Sbjct  18    SQTISGYSSRVVKSWCSKMPYPQPCEHFLTRN-PKQTPLKRRSHFLRASMQVALESAQLA  76

Query  1449  KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNL  1270
             + + YSLG+ CR   EKAAW DCL+LYE+ V  ++ T+  N +C+  D QTWLS ALTNL
Sbjct  77    RTHMYSLGSGCRDEREKAAWADCLKLYEHTVHHLNRTI--NRQCTQDDMQTWLSAALTNL  134

Query  1269  ETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRP  1090
             +TC  GFV+LG++ N+LP + SNNVS LISNTL+ N          T  YT  FP WVRP
Sbjct  135   QTCGTGFVELGISDNVLP-LMSNNVSKLISNTLSAN-----YVPYTTLNYTNEFPTWVRP  188

Query  1089  GDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVE  913
              DRKLLQSS   S A+I+VAQDGSGNYKT+ EAV AA  RS + R++IY+KAG Y+ENVE
Sbjct  189   SDRKLLQSSPVLSTANIMVAQDGSGNYKTINEAVTAALMRSDTTRFIIYIKAGTYEENVE  248

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDGFI Q ITFRNTAG+AN
Sbjct  249   VGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFHSATVAVDGDGFIAQDITFRNTAGSAN  308

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
             +QAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY  CDIYGT DFIFGNAAVVF NCN
Sbjct  309   NQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYNGCDIYGTTDFIFGNAAVVFHNCN  368

Query  552   IYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSR  385
             IY RN PNK NTITAQGR++PNQNTGISI NCKV A S+L      VKTYLGRPW++YSR
Sbjct  369   IYVRNSPNKVNTITAQGRTNPNQNTGISILNCKVIADSELILVQSSVKTYLGRPWQKYSR  428

Query  384   TVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATE  205
             TVFM++  DSLID AGWL WD +FAL+TLYYGEY NTG G+STANRV W GYHVITS TE
Sbjct  429   TVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGPGSSTANRVTWAGYHVITSTTE  488

Query  204   ASKFTVGNFIAGGSWLPAT---------NVPFTS  130
             ASKFT+GN I GG+WL AT         NVP+TS
Sbjct  489   ASKFTIGNLIPGGTWLLATGMPNPSVGYNVPYTS  522



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/529 (63%), Positives = 412/529 (78%), Gaps = 16/529 (3%)
 Frame = -3

Query  1692  LITKM-TNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ  1516
             ++TK   +L  I  CS L    S++V      +I  WC++TP P+PC+Y++ ++  +   
Sbjct  1     MVTKFFISLLLICFCSLL----SSSVASNHDHQIDYWCNKTPNPEPCKYFMKQNPKHFVP  56

Query  1515  IKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV  1336
              + KSDF K+A  L++Q A  A  +   LG+KCR+  E+AAW DCL LYE+ + +++ T+
Sbjct  57    -QQKSDFRKLAIELSMQRAHTALIHNKGLGSKCRNDKERAAWADCLRLYEDTIVELNHTL  115

Query  1335  DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKG  1156
             D + KC+  DAQTWLSTALTNLETC AGF D GV+  +LP + SNNVS LI N+LA+   
Sbjct  116   DSHTKCTEFDAQTWLSTALTNLETCKAGFKDFGVSDFMLP-LMSNNVSKLICNSLALKDN  174

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                 ++     Y +GFP WV+PGDRKLLQ+S+ S +++VVAQDGSGN++T+  A++AAAK
Sbjct  175   ---ASSNPPQTYNDGFPSWVKPGDRKLLQASS-STSNLVVAQDGSGNHRTIKAALDAAAK  230

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             RSGSGR+VI +K+GVY+EN++IG  LKNIMLVGDG+  TIITGSRSVGGG+TTFKSATVA
Sbjct  231   RSGSGRFVIRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFKSATVA  290

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             V G GFI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+EC
Sbjct  291   VTGGGFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKEC  350

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAAS  439
             DIYGTVDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+S
Sbjct  351   DIYGTVDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASS  410

Query  438   DLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             DL+ V    KT+LGRPWK YSRTVF+++ LDSL+D AGWL WDGNFALNTLYYGEY N+G
Sbjct  411   DLRPVLSSFKTFLGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSG  470

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GAST+ RVKW GY VITSATEAS+FT  NFIAG SWLPAT VPF+SGL
Sbjct  471   PGASTSGRVKWRGYRVITSATEASRFTAANFIAGRSWLPATGVPFSSGL  519



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/521 (63%), Positives = 408/521 (78%), Gaps = 12/521 (2%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             +  +FIC F ++  S+    +   +I  WC++TP P+PC+Y++ ++  +    + KSDF 
Sbjct  7     ISLLFIC-FCSLLSSSVASNHDHDQIDYWCNKTPNPEPCKYFMKQNPKHFVP-QQKSDFR  64

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K+A  L++Q A  A  +   LG+KCR+  E+AAW DCL LYE+ + +++ T+D + KC+ 
Sbjct  65    KLAIELSMQRAHTALSHNKGLGSKCRNEKERAAWADCLSLYEDTIVELNHTLDSHTKCTD  124

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              DAQTWLSTALTNLETC AGF D GV+  +LP + SNNVS LI N+LA+       ++  
Sbjct  125   FDAQTWLSTALTNLETCKAGFKDFGVSDFMLP-LMSNNVSKLIRNSLALKDN---ASSNP  180

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +GFP WV+PGDRKLL +S+ S +++VVAQDGSGN++T+  A++AAAKRSGSGR+V
Sbjct  181   PQTYNDGFPSWVKPGDRKLLLASS-STSNLVVAQDGSGNHRTIKAALDAAAKRSGSGRFV  239

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             I +K+GVY+EN++IG  LKNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G GFI 
Sbjct  240   IRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFNSATVAVTGGGFIA  299

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+ECDIYGTVDF
Sbjct  300   RGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDF  359

Query  591   IFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV---  424
             IFGNAAVV QNC IYAR P +K  N +TAQGR+D NQNTGISIHN +V A+SDL+ V   
Sbjct  360   IFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSDLRPVLSS  419

Query  423   -KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
              KT+LGRPWKEYSRTVF+++ LDSL+D AGWL WDGNFALNTLYYGEY N+G GAST+ R
Sbjct  420   FKTFLGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGR  479

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKW GY VITSATEAS+FTV NFIAG SWLPAT VPF+SGL
Sbjct  480   VKWRGYRVITSATEASRFTVANFIAGRSWLPATGVPFSSGL  520



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/533 (62%), Positives = 410/533 (77%), Gaps = 14/533 (3%)
 Frame = -3

Query  1701  TNLLITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNG  1522
             T +++  + N+  IF+  F  +    A F   P  +  WC +TPYP  C+ +++    + 
Sbjct  3     TMMVMPLIINVFLIFVVQFSFLLSPAASFDV-PGGVNWWCGKTPYPDACKSFINHD-PHT  60

Query  1521  GQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDT  1342
                + KS+F K+A  +A+  A  A+ +T  L  KCR+  EKAAW DCL+LY++ V +++ 
Sbjct  61    YVTRTKSEFRKMALQVAMDRALRAESHTKWLEPKCRNEREKAAWADCLKLYQDTVLQLNR  120

Query  1341  TVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAIN  1162
             T+DP+IKC+  DAQTWLSTALTNL+TC AGF++LGV+  +LP + SNNVS LISNTLAIN
Sbjct  121   TLDPSIKCTDFDAQTWLSTALTNLQTCRAGFIELGVSDFMLP-LMSNNVSKLISNTLAIN  179

Query  1161  KGFtttnneattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNA  985
             K  +   N         FP WV PGDRKLLQSS+ AS+A++VVAQDGSGN++T+  A++A
Sbjct  180   KAISQNQNYTDGR----FPSWVSPGDRKLLQSSSPASRANMVVAQDGSGNFRTIKAALDA  235

Query  984   AAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKS  808
              +K R GSGR++I+VKAGVY+EN+EIG+ +KNIMLVGDG+  TIITGSRSVGGG TTF S
Sbjct  236   VSKQRKGSGRFIIHVKAGVYRENLEIGNGMKNIMLVGDGMRSTIITGSRSVGGGFTTFNS  295

Query  807   ATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQF  628
             ATVAV G+GFI  GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQF
Sbjct  296   ATVAVTGEGFIAMGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQF  355

Query  627   YRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKV  451
             YREC IYGTVDFIFGNAAVV QNC I  R P + ++N +TAQGR+DPNQNTGISIHNC+V
Sbjct  356   YRECYIYGTVDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRV  415

Query  450   TAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEY  283
              A+SDLK V    KT+LGRPWKEYSRTV++++ LD+L+DPAGW+ W GNFALNTLYYGEY
Sbjct  416   MASSDLKPVQSSFKTFLGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEY  475

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G  +STA RVKW GY VIT+ +EAS+FTVGNFI+GGSWLPAT VPF SGL
Sbjct  476   RNFGPASSTARRVKWRGYRVITNPSEASRFTVGNFISGGSWLPATGVPFNSGL  528



>ref|XP_010058469.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=607

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/514 (65%), Positives = 392/514 (76%), Gaps = 23/514 (4%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA  1450
             S  + GYS   +KSWCS+ PYPQPCE++L+R+      +K +S FL+ +  +AL+ A+ A
Sbjct  18    SQTISGYSSRVVKSWCSKMPYPQPCEHFLTRN-PKQTPLKRRSHFLRASMQVALESAQLA  76

Query  1449  KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNL  1270
             + + YSLG+ CR   EKAAW DCL+LYE+ V  ++ T+  N +C+  D QTWLS ALTNL
Sbjct  77    RTHMYSLGSGCRDEREKAAWADCLKLYEHTVHHLNRTI--NRQCTQDDMQTWLSAALTNL  134

Query  1269  ETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRP  1090
             +TC  GFV+LG++ N+LP + SNNVS LISNTL+ N          T  YT  FP WVRP
Sbjct  135   QTCGTGFVELGISDNVLP-LMSNNVSKLISNTLSAN-----YVPYTTLNYTNEFPTWVRP  188

Query  1089  GDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVE  913
              DRKLLQSS   S A+I+VAQDGSGNYKT+ EAV AA  RS + R++IY+KAG Y+ENVE
Sbjct  189   SDRKLLQSSPVLSTANIMVAQDGSGNYKTINEAVTAALMRSDTTRFIIYIKAGTYEENVE  248

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDGFI Q ITFRNTAG+AN
Sbjct  249   VGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFHSATVAVDGDGFIAQDITFRNTAGSAN  308

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
             +QAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY  CDIYGT DFIFGNAAVVF NCN
Sbjct  309   NQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYNGCDIYGTTDFIFGNAAVVFHNCN  368

Query  552   IYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSR  385
             IY RN PNK NTITAQGR++PNQNTGISI NCKV A S+L      VKTYLGRPW++YSR
Sbjct  369   IYVRNSPNKVNTITAQGRTNPNQNTGISILNCKVIADSELILVQSSVKTYLGRPWQKYSR  428

Query  384   TVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATE  205
             TVFM++  DSLID AGWL WD +FAL+TLYYGEY NTG G+STANRV W GYHVITS TE
Sbjct  429   TVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGPGSSTANRVTWAGYHVITSTTE  488

Query  204   ASKFTVGNFIAGGSWLPAT---------NVPFTS  130
             ASKFT+GN I GG+WL AT         NVP+TS
Sbjct  489   ASKFTIGNLIPGGTWLLATGMPNPSVGYNVPYTS  522



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/468 (69%), Positives = 385/468 (82%), Gaps = 8/468 (2%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K KSDF K+A  LAL+ A  A DNT SLG KCR+  EKAAW DC++LY+N +++++ T+D
Sbjct  11    KHKSDFRKMAVQLALERAIRAGDNTKSLGHKCRNEREKAAWADCVKLYDNAIEQLNKTID  70

Query  1332  PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGF  1153
             PN KC+  DAQTWLSTALTNLETC  GFV+LGV+  +LP + SNNVS LI NTLA+    
Sbjct  71    PNTKCTDFDAQTWLSTALTNLETCRTGFVELGVSDFVLP-LMSNNVSKLICNTLALGSN-  128

Query  1152  tttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKR  973
              TT+  +     +GFP WV PGDR+LLQSS+  + ++VVAQDGSGNY+T+  A++AAA R
Sbjct  129   KTTHETSGYYKDDGFPTWVSPGDRRLLQSSSV-RPNLVVAQDGSGNYRTIKAALDAAAGR  187

Query  972   SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAV  793
             SGSGR+VI+VK GVY+EN+EIGSKL+NIMLVGDG+  TIITGSRSVGGG+TTF SATVAV
Sbjct  188   SGSGRFVIHVKRGVYRENLEIGSKLRNIMLVGDGMKYTIITGSRSVGGGSTTFNSATVAV  247

Query  792   VGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECD  613
              G+GFI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC 
Sbjct  248   TGEGFIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECY  307

Query  612   IYGTVDFIFGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASD  436
             ++GTVDFIFGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V A++D
Sbjct  308   VFGTVDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASAD  367

Query  435   LKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGA  268
             L  V    +++LGRPWKEYSRTVFM++ LDSL+DPAGWL WDGNFALNTLYYGEY NTG 
Sbjct  368   LVPVLGSFRSFLGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGP  427

Query  267   GASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G+ST+ RV+W GY VITSA EA +FTV NFIAG SWLPAT VPFT+GL
Sbjct  428   GSSTSRRVRWRGYRVITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>gb|KCW73025.1| hypothetical protein EUGRSUZ_E01468, partial [Eucalyptus grandis]
Length=513

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 379/488 (78%), Gaps = 14/488 (3%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             WCS+ PYPQPCE++L+R+      +K +S FL+ +  +AL+ A+ A+ +TYSLG+ C   
Sbjct  32    WCSKMPYPQPCEHFLTRN-PKQTPLKRRSHFLRASMQVALESAQLAQTHTYSLGSGCHDE  90

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
              EKAAW DCL+LYE+ V  ++ T+  N +C+  D QTWLS ALTNL+TC  GFV+LG++ 
Sbjct  91    REKAAWADCLKLYEHTVHHLNRTI--NRRCTQDDMQTWLSAALTNLQTCGTGFVELGISD  148

Query  1227  NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA-SK  1051
             N+LP + SNNVS LISNTL+ N          T  YT  FP WVR GDRKLLQSS   S 
Sbjct  149   NVLP-LMSNNVSKLISNTLSAN-----YVPYTTPNYTNEFPTWVRLGDRKLLQSSPMLST  202

Query  1050  ADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDG  871
             A+I+VAQDGSGNYKT+ EAV     RS + R++IY+KAG Y+ENVE+GSKL+NI  VGDG
Sbjct  203   ANIMVAQDGSGNYKTINEAVTVGLMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDG  262

Query  870   IGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSV  691
             IGKTIITGS+S  GG TTF SATVAV GDGFI Q ITFRNTAG+ANHQAVALRS SDLSV
Sbjct  263   IGKTIITGSKSNAGGFTTFNSATVAVDGDGFIAQDITFRNTAGSANHQAVALRSSSDLSV  322

Query  690   FYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTIT  511
             FY+C FEGYQDTL+V+S RQFY+ECDIYGT DFIFGNAAVVF NCNIY RNPPNK NTIT
Sbjct  323   FYRCGFEGYQDTLFVHSKRQFYKECDIYGTTDFIFGNAAVVFHNCNIYVRNPPNKVNTIT  382

Query  510   AQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSRTVFMKSSLDSLIDP  343
             AQGR+DPNQNTGISI NCKV A S+L      VKTYLGRPW++YSRTVFM + LD LID 
Sbjct  383   AQGRTDPNQNTGISILNCKVIADSELILVQSSVKTYLGRPWQKYSRTVFMMTYLDGLIDS  442

Query  342   AGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGS  163
             AGWL WDG+FAL+TLYYGEY NTG  +ST NRV W GYHVITS TEASKFT+GN I GG+
Sbjct  443   AGWLEWDGDFALDTLYYGEYMNTGPRSSTTNRVTWAGYHVITSTTEASKFTIGNLIPGGT  502

Query  162   WLPATNVP  139
             WL AT +P
Sbjct  503   WLLATGMP  510



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/460 (70%), Positives = 384/460 (83%), Gaps = 10/460 (2%)
 Frame = -3

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             +A +LA+Q A  A+ +   LG+KCR+  EKAAW DCL+LYE+ + +++ T+DPN KC+  
Sbjct  1     MAIDLAMQRAITAQSHNKYLGSKCRNEKEKAAWADCLKLYEDTIIQLNHTLDPNTKCTDY  60

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
             DAQTWLSTALTNLETC AGFV+LGV+  +LP + SNNVS LI NTLAIN G   +++ + 
Sbjct  61    DAQTWLSTALTNLETCRAGFVELGVSDFMLP-LMSNNVSKLIGNTLAINNG---SSSASP  116

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
               Y +GFP WV+PGDRKLLQ+S+ S  ++VVAQDGSGNY+T+ +A++AAAKRSG GR+VI
Sbjct  117   QTYKDGFPSWVKPGDRKLLQTSS-STPNLVVAQDGSGNYRTIKQALDAAAKRSGKGRFVI  175

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
              +K+G+Y+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G+GFI  
Sbjct  176   RIKSGIYRENLEIGNKMKNIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGEGFIAS  235

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
             GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLY++S RQFY+EC IYGTVDFI
Sbjct  236   GITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFI  295

Query  588   FGNAAVVFQNCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             FGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V AASDLK V    
Sbjct  296   FGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSF  355

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KT+LGRPWK+YSRTVF+++ LDSL+DPAGWL WDGNFALNTLYYGEY N G  +ST+ RV
Sbjct  356   KTFLGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRV  415

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GY VITSATEAS+FTV NFIAG SWLPAT VPF+SGL
Sbjct  416   KWRGYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/497 (66%), Positives = 391/497 (79%), Gaps = 11/497 (2%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +I  WCS+TP P+PC+Y++ ++  +    K KSDF K+A  LA+Q A +A+++   LGTK
Sbjct  27    QIDYWCSKTPNPEPCKYFMKQNPKHFVP-KQKSDFRKMAIELAVQRAVDAQNHNKWLGTK  85

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
             CR+  EKAAW DCL+LYE+ + +++ T+  N KC+  DAQTWLSTALTNLETC AGF D 
Sbjct  86    CRNEKEKAAWADCLKLYEDTIAELNHTIASNTKCTEFDAQTWLSTALTNLETCKAGFKDF  145

Query  1239  GVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSA  1060
             GV+  +LP + SNNVS LI NTLA+       ++     Y +GFP WV+ GDRKLLQ S+
Sbjct  146   GVSDFVLP-LMSNNVSKLIRNTLALKDN---ASSTLPQTYNDGFPSWVKAGDRKLLQKSS  201

Query  1059  ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLV  880
              S  ++VVAQDGSGN++T+  A++AAAKRSGS R+VI +K GVY+EN++IG  LKNIMLV
Sbjct  202   PS-PNLVVAQDGSGNHRTIKAALDAAAKRSGSKRFVIRIKRGVYRENLDIGKNLKNIMLV  260

Query  879   GDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSD  700
             GDG+  T ITGSRSVGGG TTF SATVAV G+GFI +GITFRNTAG  NHQAVALRSGSD
Sbjct  261   GDGLRNTSITGSRSVGGGFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGSD  320

Query  699   LSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKT-  523
             LSVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P +K  
Sbjct  321   LSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQK  380

Query  522   NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDS  355
             N +TAQGR+DPNQNT ISIHN +V A+SDL+ V    KTYLGRPWKEYSRTVF+++ LDS
Sbjct  381   NVVTAQGRTDPNQNTPISIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSRTVFLQTYLDS  440

Query  354   LIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFI  175
             L+DPAGWL WDGNFALNTLYYGEY N G GAST  RVKW GY VITS+TEAS+FTV NFI
Sbjct  441   LVDPAGWLEWDGNFALNTLYYGEYRNFGPGASTRGRVKWRGYRVITSSTEASRFTVANFI  500

Query  174   AGGSWLPATNVPFTSGL  124
             AG SWLPAT VPF  GL
Sbjct  501   AGRSWLPATGVPFYPGL  517



>ref|XP_010058471.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=565

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 379/488 (78%), Gaps = 14/488 (3%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             WCS+ PYPQPCE++L+R+      +K +S FL+ +  +AL+ A+ A+ +TYSLG+ C   
Sbjct  32    WCSKMPYPQPCEHFLTRN-PKQTPLKRRSHFLRASMQVALESAQLAQTHTYSLGSGCHDE  90

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
              EKAAW DCL+LYE+ V  ++ T+  N +C+  D QTWLS ALTNL+TC  GFV+LG++ 
Sbjct  91    REKAAWADCLKLYEHTVHHLNRTI--NRRCTQDDMQTWLSAALTNLQTCGTGFVELGISD  148

Query  1227  NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA-SK  1051
             N+LP + SNNVS LISNTL+ N          T  YT  FP WVR GDRKLLQSS   S 
Sbjct  149   NVLP-LMSNNVSKLISNTLSAN-----YVPYTTPNYTNEFPTWVRLGDRKLLQSSPMLST  202

Query  1050  ADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDG  871
             A+I+VAQDGSGNYKT+ EAV     RS + R++IY+KAG Y+ENVE+GSKL+NI  VGDG
Sbjct  203   ANIMVAQDGSGNYKTINEAVTVGLMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDG  262

Query  870   IGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSV  691
             IGKTIITGS+S  GG TTF SATVAV GDGFI Q ITFRNTAG+ANHQAVALRS SDLSV
Sbjct  263   IGKTIITGSKSNAGGFTTFNSATVAVDGDGFIAQDITFRNTAGSANHQAVALRSSSDLSV  322

Query  690   FYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTIT  511
             FY+C FEGYQDTL+V+S RQFY+ECDIYGT DFIFGNAAVVF NCNIY RNPPNK NTIT
Sbjct  323   FYRCGFEGYQDTLFVHSKRQFYKECDIYGTTDFIFGNAAVVFHNCNIYVRNPPNKVNTIT  382

Query  510   AQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSRTVFMKSSLDSLIDP  343
             AQGR+DPNQNTGISI NCKV A S+L      VKTYLGRPW++YSRTVFM + LD LID 
Sbjct  383   AQGRTDPNQNTGISILNCKVIADSELILVQSSVKTYLGRPWQKYSRTVFMMTYLDGLIDS  442

Query  342   AGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGS  163
             AGWL WDG+FAL+TLYYGEY NTG  +ST NRV W GYHVITS TEASKFT+GN I GG+
Sbjct  443   AGWLEWDGDFALDTLYYGEYMNTGPRSSTTNRVTWAGYHVITSTTEASKFTIGNLIPGGT  502

Query  162   WLPATNVP  139
             WL AT +P
Sbjct  503   WLLATGMP  510



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/520 (63%), Positives = 400/520 (77%), Gaps = 10/520 (2%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
             F+ + SF + F          + I +WC++TPYP  C+Y+++   S     K+K DF K+
Sbjct  8     FVLLISFSSFFFPILSINIFDSGINAWCNKTPYPDQCKYFMNHG-SYHFAPKNKIDFKKM  66

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTAD  1306
             A  +AL+ A  A+  T  LG KCR+  E+AAW DC++LYE+ + +++ T+D N KC+  D
Sbjct  67    AVKIALERALQAETYTKGLGVKCRNELERAAWSDCVKLYESTILQLNKTLDSNTKCTDFD  126

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
              QTWLSTA+TNLETC  GF++LGV  + ILP++ SNNVS LI NTLA+N       +   
Sbjct  127   IQTWLSTAMTNLETCQTGFIELGVNSDYILPSLMSNNVSELICNTLALNN--VDFVSNRK  184

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
               Y +GFP WV PGDRKLLQ S+ S  ++VVAQDG+GN+ T+  A++AAAKRSG+ R+VI
Sbjct  185   QTYKDGFPSWVSPGDRKLLQLSSIS-PNLVVAQDGTGNFLTIKAALDAAAKRSGNERFVI  243

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
              VK GVY+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF S TV V G+GFI Q
Sbjct  244   RVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVVVTGEGFIAQ  303

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
             GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFI
Sbjct  304   GITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFI  363

Query  588   FGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             FGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+ V    
Sbjct  364   FGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVVGTF  423

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRV  244
             KTYLGRPWK+YSRTV MK+ LDSL+DPAGWL WDG+FALNTLYYGEY N G GAST++RV
Sbjct  424   KTYLGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGPGASTSSRV  483

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GY VIT++ EA++F+V N IAGGSWLPATNVPF +GL
Sbjct  484   KWPGYRVITNSNEAARFSVENLIAGGSWLPATNVPFRAGL  523



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/523 (62%), Positives = 402/523 (77%), Gaps = 20/523 (4%)
 Frame = -3

Query  1647  FLAIFVSTAVF---GYSPT----EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
             F A+F+S + F    +S T    +I  WC++ PYP  C+Y+++    +    K  +DF  
Sbjct  7     FFALFISFSTFLFPAFSITLFDNDINDWCNKAPYPNQCKYFMNHGMYHFAP-KHTTDFKN  65

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             +A  +A++ A  A+  T  LG KCR+  EKAAW DC+ LYE+ + +++ T+DPN KC+  
Sbjct  66    MAMQIAMERALEAETYTKQLGAKCRNEREKAAWSDCVNLYESTILQLNKTLDPNTKCTDF  125

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
             D QTWLSTALTNLETC  GFV+LGV  + ILP++ SNNVS LI NTLA+N       +  
Sbjct  126   DTQTWLSTALTNLETCRTGFVELGVNSDYILPSLMSNNVSELICNTLALNN---INGSTL  182

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG--R  958
                Y +GFP WV PGDRKLLQ S+  + ++VVAQDG+GN++T+  A++AAAKRSG+G  R
Sbjct  183   KQTYRDGFPTWVPPGDRKLLQLSSI-RPNLVVAQDGTGNFRTIKAALDAAAKRSGNGNGR  241

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             ++I+VK G Y+EN+EIG+K+KNIMLVGDG+  TIITGSRSV GG+TTFKSATVAV G+GF
Sbjct  242   FIIHVKRGAYRENLEIGNKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGF  301

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I +GITFRNTAG  NHQAVALRSGSD SVFY+C FEGYQDTLYV+S RQFY+EC IYGTV
Sbjct  302   IARGITFRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTV  361

Query  597   DFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGV-  424
             DFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+ V 
Sbjct  362   DFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVL  421

Query  423   ---KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
                KT+LGRPWK+YSRTVFMK+ L SL+DPAGWL WDGNFALNTLYYGEY N+G GAST+
Sbjct  422   STFKTFLGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTS  481

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RV+W GY VIT++ EA+KF+V NFI G SWLPATNVPF +GL
Sbjct  482   RRVRWRGYRVITNSNEAAKFSVENFIGGRSWLPATNVPFRAGL  524



>ref|XP_010259196.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=515

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/519 (63%), Positives = 395/519 (76%), Gaps = 17/519 (3%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFG-YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVA  1483
              +   + +F+S  VF  Y P  IK WC QTPYPQ CEY+++  + + G +K +SDF K+A
Sbjct  7     LLIILVHLFLSPVVFSSYIPPNIKLWCRQTPYPQHCEYFMNHKHHSSG-VKSRSDFKKLA  65

Query  1482  KNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADA  1303
               +AL+ A  A  N   LG KCR+  EK AW DCLELY+N + +++ T++ N      D 
Sbjct  66    VRIALEQALMATSNAMLLGPKCRNEREKVAWADCLELYDNTIIRLNDTINSNYD----DY  121

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
              TWLSTALTNLETC  GFV+LG+T  ILP +  NNVS LISNTLA++K    T   AT  
Sbjct  122   MTWLSTALTNLETCRTGFVELGITDYILP-LMPNNVSELISNTLAVSK--LPTGEPATYE  178

Query  1122  yteGFPDWVRPGDRKLLQSSA--ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
                  P WV+  D+KLLQ+++   S+AD+VVAQDG+G+++TV EA+NAAAK+   GR +I
Sbjct  179   DGSWRPSWVKADDQKLLQTASRPTSEADVVVAQDGTGDFETVNEAMNAAAKQKRRGRLLI  238

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVKAG Y+ENV+IG KLKNIML+GDG+GKTIITGS+SV GG+TTF SATVAV GDGFI +
Sbjct  239   YVKAGTYRENVQIGKKLKNIMLIGDGMGKTIITGSKSVRGGSTTFSSATVAVSGDGFIAR  298

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
              ITF+NTAG  N QAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGTVDFI
Sbjct  299   DITFQNTAGPENGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFI  358

Query  588   FGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVK  421
             FGNAAVVFQ CNIYAR   +   T+TAQGR+DPNQN+GI IHN +V AASDLK     VK
Sbjct  359   FGNAAVVFQKCNIYARR--HSIITVTAQGRNDPNQNSGIVIHNSRVMAASDLKPVQSSVK  416

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
              YLGRPW++YSRTV++K+ LDSLI P GWL W+ N ALN LYYGEY NTG G+STANRVK
Sbjct  417   AYLGRPWRQYSRTVYLKTFLDSLIHPGGWLEWNENSALNKLYYGEYQNTGPGSSTANRVK  476

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             WGGYH+IT+ +EAS FTV NF+AG SWLP T VPFTSGL
Sbjct  477   WGGYHIITTLSEASTFTVENFLAGDSWLPVTGVPFTSGL  515



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/496 (64%), Positives = 384/496 (77%), Gaps = 9/496 (2%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I  WC +T YP+ C+Y+ +  +      KD +DF K+    A++ A +A+ +T  +G+KC
Sbjct  35    IDWWCKKTTYPETCKYFFN--HGTKSPPKDMTDFKKMVIQFAMERALSAESHTKGVGSKC  92

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
             R+G EKAAW DCL+LY+N + +++ T+D + K +  D QTWLSTALTNLETC  GF +L 
Sbjct  93    RNGKEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRTGFAELN  152

Query  1236  VTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA  1057
             V+  ILP + S+NV+ LISN+LAIN   +         Y +GFP W+  GDR+LLQSS+ 
Sbjct  153   VSDYILPLIMSDNVTELISNSLAINNA-SAGVGNGKETYKKGFPSWLSGGDRRLLQSSS-  210

Query  1056  SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
             +K D+VVAQDGSGNY TV  A+  AAKR  SGR+VI VK GVY+EN+EIGSK+KNIML+G
Sbjct  211   TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIMLIG  270

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DG+  T ITG+RSVGGG+TTF SATVAV G+GFI +GITFRNTAG  NHQAVALRSG+DL
Sbjct  271   DGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADL  330

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTN  520
             SVFY+C+FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P N + N
Sbjct  331   SVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKN  390

Query  519   TITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSL  352
              +TAQGR+DPNQNTGISIHN +V A  DLK     VKTYLGRPWKEYSRTVFMK+ +DSL
Sbjct  391   AVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSL  450

Query  351   IDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIA  172
             +DPAGWL WDG+FALNTLYYGEY+N G G+  + RVKW GYHVIT+ TEAS+FTV NFIA
Sbjct  451   VDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIA  510

Query  171   GGSWLPATNVPFTSGL  124
             G SWLP T VPFT GL
Sbjct  511   GQSWLPDTEVPFTPGL  526



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/496 (64%), Positives = 384/496 (77%), Gaps = 9/496 (2%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I  WC +T YP+ C+Y+ +  +      KD +DF K+    A++ A +A+ +T  +G+KC
Sbjct  80    IDWWCKKTTYPETCKYFFN--HGTKSPPKDMTDFKKMVIQFAMERALSAESHTKGVGSKC  137

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
             R+G EKAAW DCL+LY+N + +++ T+D + K +  D QTWLSTALTNLETC  GF +L 
Sbjct  138   RNGKEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRTGFAELN  197

Query  1236  VTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA  1057
             V+  ILP + S+NV+ LISN+LAIN   +         Y +GFP W+  GDR+LLQSS+ 
Sbjct  198   VSDYILPLIMSDNVTELISNSLAINNA-SAGVGNGKETYKKGFPSWLSGGDRRLLQSSS-  255

Query  1056  SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
             +K D+VVAQDGSGNY TV  A+  AAKR  SGR+VI VK GVY+EN+EIGSK+KNIML+G
Sbjct  256   TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIMLIG  315

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DG+  T ITG+RSVGGG+TTF SATVAV G+GFI +GITFRNTAG  NHQAVALRSG+DL
Sbjct  316   DGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADL  375

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTN  520
             SVFY+C+FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P N + N
Sbjct  376   SVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKN  435

Query  519   TITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSL  352
              +TAQGR+DPNQNTGISIHN +V A  DLK     VKTYLGRPWKEYSRTVFMK+ +DSL
Sbjct  436   AVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSL  495

Query  351   IDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIA  172
             +DPAGWL WDG+FALNTLYYGEY+N G G+  + RVKW GYHVIT+ TEAS+FTV NFIA
Sbjct  496   VDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIA  555

Query  171   GGSWLPATNVPFTSGL  124
             G SWLP T VPFT GL
Sbjct  556   GQSWLPDTEVPFTPGL  571



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/465 (69%), Positives = 377/465 (81%), Gaps = 12/465 (3%)
 Frame = -3

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
             SDF K++    ++ A   + +   LG KCR+  EKAAW DCL+LYE  +  ++ TVDPN 
Sbjct  2     SDFKKISIQSTIENALKTQSHNKWLGQKCRTEKEKAAWSDCLKLYEESISLLNRTVDPNT  61

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
             KC+  D+QTWLSTALTNLETC AGFV+LGV+  +LP + SNNVS LISNTL+IN G  ++
Sbjct  62    KCTEFDSQTWLSTALTNLETCRAGFVELGVSDFVLP-LMSNNVSKLISNTLSINNG--SS  118

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                 T  YTEGFP WV+PG R+LLQS+ A  A++VVAQDGSGNYKT+ EA++AAAKRSGS
Sbjct  119   APAVTNQYTEGFPSWVKPGVRRLLQSTPA--ANVVVAQDGSGNYKTIKEALDAAAKRSGS  176

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VI VK+GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTF SATVAV GD
Sbjct  177   QRFVIRVKSGVYKENLEI--KLKNIYLLGDGLRSTIITGSRSVVGGSTTFNSATVAVTGD  234

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITFRNTAG  NHQAVALRSG+DLSVFY+CSFEGYQDTLY +S RQFY+EC IYG
Sbjct  235   GFIARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYG  294

Query  603   TVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDL--  433
             TVDFIFGNAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ ++ AA+DL  
Sbjct  295   TVDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAP  354

Query  432   --KGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAS  259
               K VKT+LGRPWK YSRTVF++S LDSL+DPAGWL WDGNFAL TLYYGEY N G G+ 
Sbjct  355   VIKSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSG  414

Query  258   TANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             T+ RVKWGGY VITS++EASKFTVGN IAG SWLPAT VPFTSGL
Sbjct  415   TSGRVKWGGYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  459



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/493 (64%), Positives = 383/493 (78%), Gaps = 9/493 (2%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             WC +T YP+ C+Y+ +  +      KD +DF K+    A++ A +A+ +T  +G+KCR+G
Sbjct  254   WCKKTTYPETCKYFFN--HGTKSPPKDMTDFKKMVIQFAMERALSAESHTKGVGSKCRNG  311

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
              EKAAW DCL+LY+N + +++ T+D + K +  D QTWLSTALTNLETC  GF +L V+ 
Sbjct  312   KEKAAWADCLKLYQNTILQLNQTLDSSTKSTEFDIQTWLSTALTNLETCRTGFAELNVSD  371

Query  1227  NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKA  1048
              ILP + S+NV+ LISN+LAIN   +         Y +GFP W+  GDR+LLQSS+ +K 
Sbjct  372   YILPLIMSDNVTELISNSLAINNA-SAGVGNGKETYKKGFPSWLSGGDRRLLQSSS-TKV  429

Query  1047  DIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGI  868
             D+VVAQDGSGNY TV  A+  AAKR  SGR+VI VK GVY+EN+EIGSK+KNIML+GDG+
Sbjct  430   DLVVAQDGSGNYTTVAAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIMLIGDGM  489

Query  867   GKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVF  688
               T ITG+RSVGGG+TTF SATVAV G+GFI +GITFRNTAG  NHQAVALRSG+DLSVF
Sbjct  490   RFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPENHQAVALRSGADLSVF  549

Query  687   YQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTIT  511
             Y+C+FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P N + N +T
Sbjct  550   YRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKNAVT  609

Query  510   AQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDP  343
             AQGR+DPNQNTGISIHN +V A  DLK     VKTYLGRPWKEYSRTVFMK+ +DSL+DP
Sbjct  610   AQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSLVDP  669

Query  342   AGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGS  163
             AGWL WDG+FALNTLYYGEY+N G G+  + RVKW GYHVIT+ TEAS+FTV NFIAG S
Sbjct  670   AGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVITNLTEASEFTVQNFIAGQS  729

Query  162   WLPATNVPFTSGL  124
             WLP T VPFT GL
Sbjct  730   WLPDTEVPFTPGL  742



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/500 (64%), Positives = 386/500 (77%), Gaps = 15/500 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQI---KDKSDFLKVAKNLALQYAKNAKDNTYSLG  1426
             I  WC++TPYP+ C+    R   N  ++   K K+DF K+   ++L+ A  A  +   LG
Sbjct  30    IDWWCNRTPYPETCKQSW-RDNDNHQKLFIPKLKADFKKLELQISLKQALKADSHNKWLG  88

Query  1425  TKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFV  1246
             +KCR+  EKAAW DCL+LYE+ +  ++ T+DP+ KC+  DAQTWLSTALTNL+TC AGFV
Sbjct  89    SKCRNDKEKAAWSDCLKLYEDAILLLNKTLDPSTKCTDFDAQTWLSTALTNLDTCRAGFV  148

Query  1245  DLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
             +LGV+  + P + SNNVS LISNTLA N     +    T  Y +GFP W+ PGDRKLLQS
Sbjct  149   ELGVSDFVWP-LMSNNVSKLISNTLATNNA---SAPPVTNAYKDGFPIWLSPGDRKLLQS  204

Query  1065  SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIM  886
             S+ S  ++VVA+DGSG+++T+  A++AAAKRSGSGR++I+VK GVY EN+EIG+KLKNIM
Sbjct  205   SSQS-PNLVVAKDGSGDHETIKAALDAAAKRSGSGRFIIHVKRGVYNENLEIGNKLKNIM  263

Query  885   LVGDGIG-KtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             LVGDG+    I       GGG TTF SATVAV G+GFI QGITFRNTAG  NHQAVALRS
Sbjct  264   LVGDGLRYTIITGSRSVGGGGYTTFNSATVAVTGEGFIAQGITFRNTAGPENHQAVALRS  323

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  529
             G+DLSVFY+C FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAA V QNC IYAR P +
Sbjct  324   GADLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAAVLQNCMIYARRPMS  383

Query  528   KT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
             K  NTITAQGR+DPNQNTGISIHN +V AA+DLK V    KTYLGRPWK+YSRTVFM++ 
Sbjct  384   KQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKPVLSSFKTYLGRPWKQYSRTVFMQTY  443

Query  363   LDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVG  184
             LDSL+DPAGWL WDG+FALNTLYYGEY N G  AST+ RVKW GY VITS++EAS+FTV 
Sbjct  444   LDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWSGYRVITSSSEASQFTVA  503

Query  183   NFIAGGSWLPATNVPFTSGL  124
             NFIAG SWLPAT V FT+GL
Sbjct  504   NFIAGQSWLPATGVRFTAGL  523



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 375/455 (82%), Gaps = 16/455 (4%)
 Frame = -3

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             LAL+ A  AK +T +LG KCR   EKAAWEDCL+LY+  V KI+ T+DPN+KCS  DAQT
Sbjct  3     LALERAILAKSHTSTLGPKCRDTREKAAWEDCLKLYDVTVSKINETMDPNVKCSKTDAQT  62

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyt  1117
             WLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         T    
Sbjct  63    WLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSSLICNTLAINK----VPFNYTPPEK  117

Query  1116  eGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKA  937
             +GFP WV+PGDRKLLQSS     + VVA+DGSGN++T+ +AVNAA   SGSGR+VIYVK 
Sbjct  118   DGFPSWVKPGDRKLLQSSTPGD-NAVVAKDGSGNFRTIKDAVNAA---SGSGRFVIYVKQ  173

Query  936   GVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITF  757
             GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGF+ +GITF
Sbjct  174   GVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITF  231

Query  756   RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  577
             RNTAGA+N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGTVDFIFGNA
Sbjct  232   RNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGNA  291

Query  576   AVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLG  409
             A V QNCNI+AR P +KTNTITAQGRSD NQNTGI IHN +VTAASDL+ +    KTYLG
Sbjct  292   AAVLQNCNIFARRPRSKTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPILGSTKTYLG  351

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW++YSRTVFMK+SLDSLIDP GWL W+GNFAL+TL+Y E+ NTG GAST+ RVKW G+
Sbjct  352   RPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWPGF  411

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              V+ SA+EAS+FTVG+FIAG SW+P++ VPFTSGL
Sbjct  412   RVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  445



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/523 (63%), Positives = 395/523 (76%), Gaps = 12/523 (2%)
 Frame = -3

Query  1677  TNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSD  1498
             TNL    +C    +F S A+     T I SWC +TPYP+ C+Y +++   +    K  S+
Sbjct  3     TNLSSFVLCVSFVLFFSHALSNILHTSIDSWCEKTPYPETCKYTMTQDEKSLSIPKQLSN  62

Query  1497  FLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKC  1318
             F K+A  + L+ A  A+ +   L  KCR+  E+AAW DC+ LYE  ++ ++ T+DP  KC
Sbjct  63    FKKLAVQVTLERALKAQSHNKWLREKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKC  122

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             +  D QTWLSTALTNL+TC AGFV+L V+  + P + SNNVS LISNTL++     +  +
Sbjct  123   TDYDTQTWLSTALTNLDTCRAGFVELAVSDFVFP-LMSNNVSKLISNTLSLWNS--SNVS  179

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
               T  YTEG+P WV PG+RKLLQS+    AD+VVAQDGSGNYKT+  A++AAA RSGS R
Sbjct  180   PLTNMYTEGYPSWVSPGNRKLLQSTPT--ADVVVAQDGSGNYKTIKAALDAAAARSGSKR  237

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             +VI+VK GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTFKSATVAV G+GF
Sbjct  238   FVIHVKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGF  295

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGTV
Sbjct  296   IARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTV  355

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG--  427
             DFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D +   
Sbjct  356   DFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESSV  415

Query  426   --VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
               VKT+LGRPWKEYSRTVFM+S LD+L+DPAGWL W G+FAL TLYYGEY N G GA T 
Sbjct  416   GSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTT  475

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RVKWGGY +ITS++EASKFTV NFIAG SWLPATNV F +GL
Sbjct  476   GRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/523 (62%), Positives = 395/523 (76%), Gaps = 12/523 (2%)
 Frame = -3

Query  1677  TNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSD  1498
             TNL    +C    +F S A+     T I SWC +TPYP+ C+Y +++   +    K  S+
Sbjct  3     TNLSSFVLCVSFVLFFSHALSNILHTSIDSWCEKTPYPETCKYTMTQDEKSLSIPKQLSN  62

Query  1497  FLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKC  1318
             F ++A  + L+ A  A+ +   L  KCR+  E+AAW DC+ LYE  ++ ++ T+DP  KC
Sbjct  63    FKRLAVQVTLERALKAQSHNKWLREKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKC  122

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             +  D QTWLSTALTNL+TC AGFV+L V+  + P + SNNVS LISNTL++     +  +
Sbjct  123   TDYDTQTWLSTALTNLDTCRAGFVELAVSDFVFP-LMSNNVSKLISNTLSLWNS--SNVS  179

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
               T  YTEG+P WV PG+RKLLQS+    AD+VVAQDGSGNYKT+  A++AAA RSGS R
Sbjct  180   PLTNMYTEGYPSWVSPGNRKLLQSTPT--ADVVVAQDGSGNYKTIKAALDAAAARSGSKR  237

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             +VI+VK GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTFKSATVAV G+GF
Sbjct  238   FVIHVKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGF  295

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGTV
Sbjct  296   IARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTV  355

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG--  427
             DFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D +   
Sbjct  356   DFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESSV  415

Query  426   --VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
               VKT+LGRPWKEYSRTVFM+S LD+L+DPAGWL W G+FAL TLYYGEY N G GA T 
Sbjct  416   GSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTT  475

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RVKWGGY +ITS++EASKFTV NFIAG SWLPATNV F +GL
Sbjct  476   GRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/496 (63%), Positives = 382/496 (77%), Gaps = 9/496 (2%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I  WC +T YP+ C+Y+ +  +      KD +DF K+    A++ A +A+ +T  +G+KC
Sbjct  80    IDWWCKKTTYPETCKYFFN--HGTKSPPKDMTDFKKMVIQFAMERALSAESHTKGVGSKC  137

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
             R+G EKAAW DCL+LY+N + +++ T+D + K +  D QTWLSTALTNLETC  GF +L 
Sbjct  138   RNGKEKAAWADCLKLYQNTILQLNQTLDSSTKRTEFDIQTWLSTALTNLETCRTGFAELN  197

Query  1236  VTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA  1057
             V   I P + S+NV+ LISN+LAIN   +         Y +GFP W+  GDR+LLQS A+
Sbjct  198   VLDYIWPLIMSDNVTKLISNSLAINNA-SAAVGNGKVTYKKGFPSWLSGGDRRLLQS-AS  255

Query  1056  SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
             +K D+VVAQDGSGNY TV  A+  AAKR  SGR+VI VK GVY+EN+EIGSK+KNIML+G
Sbjct  256   TKVDLVVAQDGSGNYTTVGAALEEAAKRKTSGRFVIQVKRGVYRENLEIGSKMKNIMLIG  315

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DG+  T ITG+RSVGGG+TTF SATVAV G+GFI +GITF+NTAG  NHQAVALRSG+DL
Sbjct  316   DGMRFTFITGNRSVGGGSTTFNSATVAVTGEGFIARGITFQNTAGPENHQAVALRSGADL  375

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTN  520
             SVFY+C+FEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P N + N
Sbjct  376   SVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARKPMNGQKN  435

Query  519   TITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSL  352
              +TAQGR+DPNQNTGISIHN +V A  DLK     VKTYLGRPWKEYSRTVFMK+ +DSL
Sbjct  436   AVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTYLGRPWKEYSRTVFMKTYIDSL  495

Query  351   IDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIA  172
             +DP GWL WDG+FALNTLYYGEY+N G G+  + RVKW GYHVI+++TEAS+FTV NFIA
Sbjct  496   VDPTGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYHVISNSTEASEFTVQNFIA  555

Query  171   GGSWLPATNVPFTSGL  124
             G SWLP T VPFT GL
Sbjct  556   GQSWLPNTEVPFTPGL  571



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/523 (62%), Positives = 394/523 (75%), Gaps = 12/523 (2%)
 Frame = -3

Query  1677  TNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSD  1498
             TNL    +C    +F S A+     + I SWC +TPYP+ C+Y +++   +    K  S+
Sbjct  3     TNLSSFVLCVSFVLFFSPALSNILHSSIDSWCKKTPYPETCKYTMTQDEKSLSIPKQLSN  62

Query  1497  FLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKC  1318
             F K+A  + L+ A  A+ +   LG KCR+  E+AAW DC+ LYE  ++ ++ T+DP  K 
Sbjct  63    FKKLAVQVTLERALKAQSHNKWLGQKCRNKKERAAWADCMSLYEETIKLLNQTIDPATKS  122

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             +  D QTWLSTALTNL+TC AGFV+L V+  + P + SNNVS LISNTL++     +  +
Sbjct  123   TDYDTQTWLSTALTNLDTCRAGFVELEVSDFVFP-LMSNNVSKLISNTLSLWNS--SNVS  179

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
               T  YTEG+P WV PGDRKLLQS+    AD+VVAQDGSGNYKT+  A++AAA R GS R
Sbjct  180   PVTXMYTEGYPSWVSPGDRKLLQSTPT--ADVVVAQDGSGNYKTIKAALDAAAARGGSKR  237

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             +VI+VK GVYKEN+EI  KLK I L+GDG+  TIITGSRSV GG+TTFKSATVAV G+GF
Sbjct  238   FVIHVKRGVYKENLEI--KLKXIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEGF  295

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGTV
Sbjct  296   IARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTV  355

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG--  427
             DFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA DL+   
Sbjct  356   DFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDLESSV  415

Query  426   --VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
               VKT+LGRPWKEYSRTVFM+S LD+L+DPAGWL W G+FAL TLYYGEY N G GA T 
Sbjct  416   GSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFALKTLYYGEYKNIGPGAPTT  475

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RVKWGGY +ITS++EASKFTV NFIAG SWLPATN PFT+ L
Sbjct  476   GRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNXPFTAXL  518



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 373/455 (82%), Gaps = 16/455 (4%)
 Frame = -3

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             LAL  A  AK +  +LG KCR   EKAAWEDC++LY+  V KI+ T+DPN+KCS  DAQT
Sbjct  3     LALDRAILAKSHASTLGPKCRDTREKAAWEDCIKLYDFTVSKINETMDPNVKCSKTDAQT  62

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyt  1117
             WLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         T    
Sbjct  63    WLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLICNTLAINK----VPFNYTPPGK  117

Query  1116  eGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKA  937
             +GFP WV+PGDRKLLQSS   + + VVA+DGSGN++T+ +A+NAA   SGSGR+VIYVK 
Sbjct  118   DGFPSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---SGSGRFVIYVKQ  173

Query  936   GVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITF  757
             GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGFI +GITF
Sbjct  174   GVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITF  231

Query  756   RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  577
             RNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIFGNA
Sbjct  232   RNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNA  291

Query  576   AVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLG  409
             A V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    KTYLG
Sbjct  292   AAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLG  351

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL+TL+Y E+ NTG GAST+ RV W G+
Sbjct  352   RPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTSGRVTWPGF  411

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  412   RVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  445



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 372/455 (82%), Gaps = 16/455 (4%)
 Frame = -3

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             LAL  A  AK +  +LG KCR   EKAAWEDC++LY+  V KI+ T+DPN+KCS  DAQT
Sbjct  3     LALDRAILAKSHASTLGPKCRDTREKAAWEDCIKLYDFTVSKINETMDPNVKCSKTDAQT  62

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyt  1117
             WLSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         T    
Sbjct  63    WLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLICNTLAINK----VPFNYTPPGK  117

Query  1116  eGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKA  937
             +GFP WV+PGDRKLLQSS   + + VVA+DGSGN++T+ +A+NAA   SGSGR+VIYVK 
Sbjct  118   DGFPSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAINAA---SGSGRFVIYVKQ  173

Query  936   GVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITF  757
             GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGFI +GITF
Sbjct  174   GVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFIARGITF  231

Query  756   RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  577
             RNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIFGNA
Sbjct  232   RNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNA  291

Query  576   AVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLG  409
             A V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+ V    KTYLG
Sbjct  292   AAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLG  351

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGY  229
             RPW++YSRTVFMK+SLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+ RV W G+
Sbjct  352   RPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTWPGF  411

Query  228   HVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  412   RVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  445



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/501 (63%), Positives = 387/501 (77%), Gaps = 12/501 (2%)
 Frame = -3

Query  1605  PTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLG  1426
             P  +  WC++TPYP  C+  ++    +    K K +F K++   A++ A  A+ +T  LG
Sbjct  32    PGGVNWWCNRTPYPDTCKSSMNPDPRSNAP-KRKHEFRKMSLQAAMERALRAESHTKWLG  90

Query  1425  TKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFV  1246
              KCR+  EK AW DCL+LY+N V +++TT++P  + +  D QTWLSTALTNLETC  GF+
Sbjct  91    PKCRNKREKVAWADCLQLYQNTVLQLNTTLNPYSRYTDVDVQTWLSTALTNLETCKTGFI  150

Query  1245  DLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
             +LGV+  +LP + SNNVS LISNTLAIN             YT G+P WV  GDRKLLQS
Sbjct  151   ELGVSDFMLP-LMSNNVSKLISNTLAINNN---ATTTQNQSYTGGYPSWVSAGDRKLLQS  206

Query  1065  SA-ASKADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLKN  892
             S+ AS+A+IVVAQDGSGN++T+ EA++AA++ R+GSGR+VIYVK G Y EN+EIGS L+N
Sbjct  207   SSPASQANIVVAQDGSGNFRTIKEALSAASQQRTGSGRFVIYVKKGAYIENLEIGSSLQN  266

Query  891   IMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALR  712
             IMLVGDG+  TIITG+RSVGGG+TTF SATVAV G GFI  GITFRNTAG  NHQAVALR
Sbjct  267   IMLVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQGFIAMGITFRNTAGPENHQAVALR  326

Query  711   SGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-  535
             SGSDLSVFY+C FEGYQDTLYV+S RQ Y+EC IYGTVDFIFGNAAVV QNC I+AR P 
Sbjct  327   SGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNAAVVLQNCMIFARRPM  386

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKS  367
              N+ N +TAQGR+DPNQNTGISIHN ++ A+SDL  V    KT+LGRPWK+YSRTV++ S
Sbjct  387   DNQNNVVTAQGRTDPNQNTGISIHNSRIMASSDLVPVLSSFKTFLGRPWKQYSRTVYLTS  446

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              +D+L+DPAGW+ W GNFAL+TLYYGEY N G G+STANRV WGGY VIT ++EAS+FTV
Sbjct  447   YIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGSSTANRVNWGGYRVITKSSEASQFTV  506

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             G FI+G SWLPAT VPF SGL
Sbjct  507   GKFISGDSWLPATGVPFKSGL  527



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/469 (66%), Positives = 377/469 (80%), Gaps = 11/469 (2%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K+K DF K+A  +AL+ A +A+  T  LG KC +  E+AAW DC++LYE+ + +++ T+D
Sbjct  11    KNKIDFKKMAVKIALERALHAETYTKGLGVKCSNELERAAWSDCVKLYESTILQLNKTLD  70

Query  1332  PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINKG  1156
              N KC+  D QTWLSTA+TNLETC  GF++LGV  + ILP++ SNNVS LI NTL++N  
Sbjct  71    SNTKCTDFDIQTWLSTAMTNLETCQTGFIELGVNSDYILPSLMSNNVSELICNTLSLNN-  129

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                  +     Y +GFP WV PGDRKLLQ S+ S  ++VVAQDG+GN+ T+  A++AAAK
Sbjct  130   ---IGSNMKQTYKDGFPTWVSPGDRKLLQLSSIS-PNLVVAQDGTGNFLTIKAALDAAAK  185

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             RSG+ R+VI+VK GVY+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF S TV 
Sbjct  186   RSGNERFVIHVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVV  245

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             V G+GFI QGITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC
Sbjct  246   VTGEGFIAQGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKEC  305

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAAS  439
              IYGTVDFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AAS
Sbjct  306   YIYGTVDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAAS  365

Query  438   DLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             DL+ V    KT+LGRPWK+YSRTVFMK+ LDSL+DPAGWL WDG+FAL+TLYYGEY N G
Sbjct  366   DLRPVLGTFKTFLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALSTLYYGEYRNAG  425

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GAST++RVKW GY VIT++ EA++F+V NFIAG SWLPATNVPF +GL
Sbjct  426   PGASTSSRVKWSGYRVITNSNEAARFSVENFIAGRSWLPATNVPFRAGL  474



>ref|XP_010277646.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=521

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/528 (60%), Positives = 390/528 (74%), Gaps = 25/528 (5%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L F+ I   +++ +S  +    P  IK+WCSQTPYPQ CE Y++    + G +K  SDF 
Sbjct  7     LTFVLISVLVSLSLSDDI----PPNIKTWCSQTPYPQYCEDYMAHDSRSSG-LKSHSDFK  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             K+A  + L  A  AK N      K  +G EKAAW DC ELY+N + +++ TV+P   C+ 
Sbjct  62    KLAMQITLDQAIQAKSNNRLHEPKFSNGREKAAWADCTELYQNTIARLNLTVNPCAMCTD  121

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLSTALTNLETC    ++LGV+ NI  ++ SNNVS LI N LAINK         
Sbjct  122   YDVQTWLSTALTNLETCRTSVMELGVSDNIF-SLVSNNVSNLIINALAINK-----PPPK  175

Query  1131  ttgyteGFPDWVRPGDRKLLQ---SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
                + +GFP W  P DRKLLQ   +S A KAD+VVAQDGSGN+KTV+EA+N  AK + SG
Sbjct  176   EETFDDGFPTWASPRDRKLLQMERTSLAWKADLVVAQDGSGNFKTVSEAINEVAKWNPSG  235

Query  960   -----RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
                  R+V+++KAG+Y+E++++ +   N+M  GDGIGKT+ITGS SVGGG TTF SAT+A
Sbjct  236   VGPGRRHVVHMKAGIYQEHMQVYTP--NMMFTGDGIGKTVITGSMSVGGGATTFNSATIA  293

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             V+GDGFI + ITF+NTAG  NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S+RQFY++C
Sbjct  294   VMGDGFIARDITFQNTAGPQNHQAVALRSGSDASVFYRCSFEGYQDTLYVHSNRQFYKQC  353

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASD  436
             DIYGTVDFIFGNAA V Q+CNIYAR P   T  +TAQGR + NQ+TGI IHN ++TAA D
Sbjct  354   DIYGTVDFIFGNAAAVLQDCNIYARKPIAGTVVVTAQGRLNANQSTGIVIHNSRITAAPD  413

Query  435   LK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGA  268
             LK     V+TYLGRPW+ YSRTV +K+ LDSLI+PAGW+ W+G FALNTLYYGE+ NTG 
Sbjct  414   LKPVQRSVETYLGRPWQLYSRTVILKTFLDSLINPAGWMEWNGTFALNTLYYGEFQNTGP  473

Query  267   GASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G+STANRVKWGGYHVITSA EAS+FTVGNFI G SWLP TNVPFTSGL
Sbjct  474   GSSTANRVKWGGYHVITSAAEASQFTVGNFIDGNSWLPDTNVPFTSGL  521



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/499 (61%), Positives = 388/499 (78%), Gaps = 13/499 (3%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQI---KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             WC+QTPYP+PC++++S++ +N  +    + KSDF K+A  LAL+ A  A  NT +LG KC
Sbjct  34    WCNQTPYPEPCKHFMSQNNNNPRKYFSPQKKSDFRKMAIQLALERATCAVGNTKALGAKC  93

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
             R+  E+AAW DC++LYE+ +++++ TVDP I C+  D+QTWLSTALTN+ETC  GF++L 
Sbjct  94    RNERERAAWSDCVKLYESTIEQLNKTVDPTINCTDFDSQTWLSTALTNIETCRTGFLELN  153

Query  1236  VTGNILPAVTSNNVSYLISNTLAI-NKGFtttnneattgyteGFPDWVRPGDRKLLQSSA  1060
             VT  + P +++NNVS LI NTLA+ + G  T +         GFP W   G+R+LLQ++ 
Sbjct  154   VTDFVFPLISNNNVSKLICNTLALGDSGNETNHETKGYYNKAGFPTWFSKGNRRLLQTTV  213

Query  1059  ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS-GRYVIYVKAGVYKENVEI-GSKLKNIM  886
             +  AD+VVAQDGSG+ +T+  A++ AA+RS + GR+VI VK GVY EN+EI GSK+KNIM
Sbjct  214   S--ADVVVAQDGSGDNRTIKAALDVAARRSSTAGRFVILVKRGVYSENIEIAGSKMKNIM  271

Query  885   LVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSG  706
             +VGDGI  TIITG+RSVGGG+TTF+SATV V  +GFI +GIT RNTAG  NHQAVALRSG
Sbjct  272   IVGDGIDNTIITGNRSVGGGSTTFESATVIVTAEGFIARGITIRNTAGPENHQAVALRSG  331

Query  705   SDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNK  526
             +DLSVFY+CSFE YQDTLYV+S RQFY+ECDIYGT+DFIFGNAA V Q+C IYAR P  K
Sbjct  332   ADLSVFYRCSFEAYQDTLYVHSQRQFYKECDIYGTIDFIFGNAAAVLQDCKIYARRPMVK  391

Query  525   T-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSL  361
               N +TAQGR+DPNQNTGISIHN +V A+ DL  V    +++LGRPWK YSRTV+M++ +
Sbjct  392   QKNVVTAQGRTDPNQNTGISIHNSRVMASPDLVPVLGSFRSFLGRPWKLYSRTVYMQTYI  451

Query  360   DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGN  181
             DSLIDP GWL WDG+FAL+TLYYGEY N+G G++T  RV W GY VIT+A+EAS FTV N
Sbjct  452   DSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGSNTTRRVNWSGYRVITNASEASTFTVAN  511

Query  180   FIAGGSWLPATNVPFTSGL  124
             FIAG SWLPAT VPFT+GL
Sbjct  512   FIAGQSWLPATGVPFTAGL  530



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/528 (61%), Positives = 391/528 (74%), Gaps = 25/528 (5%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKS---WCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             L F  +   L I  ST++   + T  K+   WCS+TPYP  C     +++ N GQ   K+
Sbjct  5     LHFSILLFSLFILSSTSLPFSTKTNKKAIDLWCSRTPYPDVC-----KNFFNDGQFDPKN  59

Query  1500  --DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPN  1327
               D  K A  +A++ A   +  T +LG KCR+  E+AAW DCLELY+  +  ++ T   +
Sbjct  60    LLDIQKTALKIAMERAIRTETLTKALGQKCRNKKERAAWADCLELYQTTILHLNKTFSDH  119

Query  1326  IKCSTADAQTWLSTALTNLETCHAGFVDLGVT--GNILPAVTSNNVSYLISNTLAINKGF  1153
               CS  D QTWLS+ALTNL+TC AGFVDLG+   G + P + +NN++ LISN+LA+N   
Sbjct  120   --CSNFDIQTWLSSALTNLDTCRAGFVDLGIKDYGVVFPFLANNNITKLISNSLAMNN--  175

Query  1152  tttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKR  973
               + ++      EGFP WVR GDR+LLQ+ A  KAD+VVAQDGSGNYKTV  AV+AA KR
Sbjct  176   -CSESDEGNTSDEGFPKWVRGGDRRLLQA-AEPKADLVVAQDGSGNYKTVQAAVDAAGKR  233

Query  972   SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAV  793
              GSGR+VI +K GVYKENV I  K+KN+MLVGDG+  TIITGSRSVGGG+TTF SATVAV
Sbjct  234   KGSGRFVIRIKKGVYKENVVI--KVKNLMLVGDGLRYTIITGSRSVGGGSTTFNSATVAV  291

Query  792   VGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECD  613
              G+ FI +GITFRNTAG  NHQAVALRSG+DLSVF++C FEGYQDTLY +S RQFYREC 
Sbjct  292   TGERFIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYAHSQRQFYRECY  351

Query  612   IYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASD  436
             IYGT+DFIFGNAAVV QNC IYAR P   +   +TAQGR+DPNQNTGISIHN +V AA D
Sbjct  352   IYGTIDFIFGNAAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMAADD  411

Query  435   LK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGA  268
             LK     V+TYLGRPWKEYSRTV+++S ++SL++PAGWL W GNFALNTLYYGE+ N G 
Sbjct  412   LKPVIKSVRTYLGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGP  471

Query  267   GASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G+STANRVKW GY VITSA EA+KFTVGNFIAG SWLP T VPFT+GL
Sbjct  472   GSSTANRVKWKGYRVITSANEAAKFTVGNFIAGNSWLPGTGVPFTAGL  519



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/529 (61%), Positives = 392/529 (74%), Gaps = 26/529 (5%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTE---IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             L F  I   + I  S+++   + T    I+ WCS+TPYP  C+++      N G+   ++
Sbjct  5     LHFSIILFSMFILSSSSLPFSTKTNNKAIELWCSRTPYPDVCKHFF-----NNGEFDPRN  59

Query  1500  --DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV-DP  1330
               D  K A  +A++ A   +  T +LG KCR+  E+AAW DCLELY+  +  ++ T  D 
Sbjct  60    LLDIKKAALKIAMERAMKTETLTKALGQKCRNKKERAAWADCLELYQTTILHLNKTFSDK  119

Query  1329  NIKCSTADAQTWLSTALTNLETCHAGFVDLGVT--GNILPAVTSNNVSYLISNTLAINKG  1156
             N  CS  D QTWLS+ALTNL TC AGFVDLG+   G + P + +NN++ LISN+LA+N  
Sbjct  120   N--CSNFDIQTWLSSALTNLHTCRAGFVDLGIKDYGVVFPFLENNNITKLISNSLAMNN-  176

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                + ++      EGFP W+  GDR+LLQ+ A  KAD+VVAQDGSGNYKTV  AV+AA K
Sbjct  177   --CSESDEGNTSDEGFPKWLHGGDRRLLQA-AEPKADLVVAQDGSGNYKTVQAAVDAAGK  233

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             R GSGR+VI VK GVYKENV I  K+KN+MLVGDG+  TIITGSRSVGGG+TTF SATVA
Sbjct  234   RKGSGRFVIRVKKGVYKENVVI--KVKNLMLVGDGLKYTIITGSRSVGGGSTTFNSATVA  291

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             V G+ FI +GITFRNTAG  NHQAVALRSG+DLSVF++C FEGYQDTLYV+S RQFYREC
Sbjct  292   VTGERFIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYREC  351

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAAS  439
              IYGTVDFIFGN+AVV QNC IYAR P   +   +TAQGR+DPNQNTGISIHN +V A  
Sbjct  352   YIYGTVDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATD  411

Query  438   DLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             DLK     V+TYLGRPWKEYSRTV+++S +DSL++PAGWL W GNFALNTLYYGE+ N+G
Sbjct  412   DLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSG  471

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G+STANRVKW GY VITSA+EA+KFTVG+FIAG SWLP T VPFT+GL
Sbjct  472   PGSSTANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL  520



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/496 (62%), Positives = 378/496 (76%), Gaps = 12/496 (2%)
 Frame = -3

Query  1590  SWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRS  1411
             SWC++TPYP+ C+Y++  +       +  S+F K+A  +A++ A  A+ +   LG KCR 
Sbjct  29    SWCNKTPYPEQCKYFMQNAPRRFVPAR-MSEFRKMAVEMAMEGALQAQSHNKWLGPKCRG  87

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
               E+AAW DCL+LY+  + +++ T      C+ +D QTWLS ALTNL+TC  GF +LGV 
Sbjct  88    HKERAAWADCLKLYQETIHRLNRTAG---DCTDSDQQTWLSAALTNLDTCRTGFAELGVA  144

Query  1230  GNILPAVTSNNVSYLISNTLAI--NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAA  1057
               +   + ++NV+ LISN LA+  N   ++   + T    +GFP WV  G R+LLQS A+
Sbjct  145   DYVFQLMYNSNVTKLISNALALKNNNASSSATQDTTHNDGQGFPSWVTAGVRRLLQS-AS  203

Query  1056  SKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
                D+ VAQDGSGN++T+ +A++AAAKRSGS R+VIYVK GVY+EN+ IGS L NIM+VG
Sbjct  204   PTPDVTVAQDGSGNFRTIQQALDAAAKRSGSKRFVIYVKRGVYQENLVIGSGLDNIMMVG  263

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DG+  T+ITGSRSVGGG+TTF SATVAV GDGFI +GITFRNTAG  NHQAVALRSGSDL
Sbjct  264   DGLRFTVITGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRSGSDL  323

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTN  520
             SVFY+C FEGYQDTLYV+S+RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P   + N
Sbjct  324   SVFYRCGFEGYQDTLYVHSERQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMSGQKN  383

Query  519   TITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSL  352
             TITAQGR+DPNQNTGISIHN +V AA DLK V    K+YLGRPWK+YSRTV++++ LD+L
Sbjct  384   TITAQGRTDPNQNTGISIHNSRVMAAPDLKPVLSSFKSYLGRPWKQYSRTVYLQTYLDTL  443

Query  351   IDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIA  172
             IDPAGWL WDGNFAL+TLYYGEY N G  A T+ RVKW GY VITS++EASKFTV NFIA
Sbjct  444   IDPAGWLEWDGNFALSTLYYGEYKNLGPAAWTSGRVKWPGYRVITSSSEASKFTVANFIA  503

Query  171   GGSWLPATNVPFTSGL  124
             G SWLP+T VPFT GL
Sbjct  504   GQSWLPSTGVPFTPGL  519



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/535 (58%), Positives = 388/535 (73%), Gaps = 24/535 (4%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKS---------WCSQTPYPQPCEYYLSRSYS  1528
             M+N+  + +  FLA F+S   F  S     S         WC +TPYP  C   L     
Sbjct  1     MSNMVAMLVPIFLA-FLSCTSFLSSTLADSSYNVSGGTDWWCQKTPYPDDCRSSLGDLDP  59

Query  1527  NGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKI  1348
             N    K K +F K+A   A++ A  A+ +T  LG  CR+  E+AAW DCL+LYE+ + ++
Sbjct  60    NPSVPKQKPEFRKMALQAAMERALQAESHTKWLGQICRNDRERAAWVDCLKLYEDTILQL  119

Query  1347  DTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLA  1168
             + T++P   C+ +D QTWLSTALTNL+TC AG V+LGV+  +LP V SNNVS+LISN LA
Sbjct  120   NRTLNPIANCTDSDTQTWLSTALTNLDTCKAGIVELGVSDVLLPLV-SNNVSHLISNALA  178

Query  1167  INKGFtttnneattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAV  991
             IN             YT GFP WV   DRKLLQSS+ AS+A++VVAQDGSG+++T+  A+
Sbjct  179   IND-----IPSEQQNYTGGFPTWVSAADRKLLQSSSLASRANLVVAQDGSGHFRTIKAAI  233

Query  990   NAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTF  814
             +AA+K R GS R++IYVKAGVY+EN+EIG+ + NIML+GDG+ +T+ITGSRSV  G TTF
Sbjct  234   SAASKLRRGSRRFIIYVKAGVYRENIEIGNNMPNIMLIGDGMRRTLITGSRSVRKGYTTF  293

Query  813   KSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDR  634
              SATVAV G+ F+  GITFRNTAG  + QAVAL SGSDLSVFY+C F GYQDTLYV+S R
Sbjct  294   NSATVAVSGERFVATGITFRNTAGPLS-QAVALVSGSDLSVFYRCGFIGYQDTLYVHSQR  352

Query  633   QFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNC  457
             QFY++C IYGT+DFIFGNAAVV QNC I AR P + + N ITAQGRSDP+QNTGISIH  
Sbjct  353   QFYKQCYIYGTIDFIFGNAAVVLQNCMIVARRPLHGQANVITAQGRSDPHQNTGISIHKS  412

Query  456   KVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYG  289
             +V A+SDL+     VKT+LGRPW++YSRTV++++ LD L+DPAGWL W G+FALNTLYYG
Sbjct  413   RVIASSDLRPVLSSVKTFLGRPWQQYSRTVYLQTYLDGLVDPAGWLEWGGSFALNTLYYG  472

Query  288   EYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             EY N G G+STA RVKW GY VI + +EAS FTVGNFI+G SWLP T VPFTSGL
Sbjct  473   EYKNIGPGSSTARRVKWRGYRVIRNPSEASLFTVGNFISGRSWLPGTGVPFTSGL  527



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/501 (60%), Positives = 371/501 (74%), Gaps = 20/501 (4%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKD---KSDFLKVAKNLALQYAKN----AKDNTYSL  1429
             WC+QTP+PQ C+++++    N  +++D   KS F    KN  LQ A +    A+ +   L
Sbjct  33    WCNQTPHPQTCKHFVT---INSHRLQDGIPKSAFQ--FKNFILQIAMDQSVKAQIHIMWL  87

Query  1428  GTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGF  1249
             G+KCRS  EKAAW DC  LY++ +  ++  ++P  + ++ D QTWLSTALTN++TC  GF
Sbjct  88    GSKCRSKQEKAAWSDCTTLYQDTINILNQALNPTKQSTSYDLQTWLSTALTNIDTCQTGF  147

Query  1248  VDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ  1069
              +LGV  N+L  + + NVS +IS+ LA+N    ++       Y  G P W+ P DRKLL+
Sbjct  148   HELGVGNNVLSLIPNKNVSEIISDFLALNNA--SSFIPPKKTYKNGLPRWLPPNDRKLLE  205

Query  1068  SSAAS-KADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKN  892
             SS  S   D VVA+DGSG++KT+ EA+ A  KR+ + R+VIYVK G+Y EN+EIG+ +KN
Sbjct  206   SSPPSLSPDFVVAKDGSGDFKTIKEALKAIPKRNEAKRFVIYVKRGIYNENIEIGNSMKN  265

Query  891   IMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALR  712
             IML GDG   TII+GSRSVGGG+TTF SATVAV GDGFI +GITFRNTAG  NHQAVALR
Sbjct  266   IMLYGDGTRLTIISGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVALR  325

Query  711   SGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPP  532
              G+DLSVFY+C+FEGYQDTLYV+S RQFY+EC+IYGTVDFIFGNAAVVFQ+CNIYAR P 
Sbjct  326   CGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRPM  385

Query  531   NKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKS  367
              K  N ITAQGR+DPNQNTGI I N +V AA DL  V    KT+LGRPW+EYSRTVF+++
Sbjct  386   QKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPVLSSFKTFLGRPWREYSRTVFLQT  445

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LD L+DPAGWL W G+FAL+TLYYGEY N G   ST  RVKWGGYH ITSATEASKFTV
Sbjct  446   YLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGSTRGRVKWGGYHAITSATEASKFTV  505

Query  186   GNFIAGGSWLPATNVPFTSGL  124
              NFIAG SWLPAT +PF  GL
Sbjct  506   ENFIAGKSWLPATGIPFLFGL  526



>gb|KHN35620.1| Pectinesterase 2 [Glycine soja]
Length=355

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/362 (81%), Positives = 317/362 (88%), Gaps = 9/362 (2%)
 Frame = -3

Query  1206  SNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQ  1030
             SNNV+ L+SNTLA+NK            Y +GFP WV+PGDR+LLQ SS ASKA++VVA+
Sbjct  2     SNNVTKLLSNTLALNK-----VEYEEPSYKDGFPTWVKPGDRRLLQASSPASKANVVVAK  56

Query  1029  DGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiit  850
             DGSG Y TV+EAVNAA K S SGRYVIYVK G+Y E VEI  K  NIMLVGDGIGKTIIT
Sbjct  57    DGSGKYTTVSEAVNAAPK-SNSGRYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIIT  113

Query  849   gsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFE  670
              S+SVGGGTTTF+SATVAVVGDGFI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFE
Sbjct  114   SSKSVGGGTTTFRSATVAVVGDGFITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFE  173

Query  669   GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDP  490
             GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNK NTITAQGR+DP
Sbjct  174   GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDP  233

Query  489   NQNTGISIHNCKVTAASDLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFA  310
             NQNTGISIHN KVTAASDL GV+TYLGRPW++YSRTVFMK+ LDSLI+P GWL W GNFA
Sbjct  234   NQNTGISIHNSKVTAASDLMGVRTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFA  293

Query  309   LNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTS  130
             L+TLYYGEY NTG G+STANRV W GYHVITSA+EASKFTVGNFIAG SWLPAT+VPFTS
Sbjct  294   LSTLYYGEYMNTGPGSSTANRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTS  353

Query  129   GL  124
             GL
Sbjct  354   GL  355



>emb|CBI24286.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/399 (71%), Positives = 337/399 (84%), Gaps = 8/399 (2%)
 Frame = -3

Query  1611  YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYS  1432
             YS  ++K WCSQTP+PQPCEY+LS+  ++   IK KSDFL ++  LAL+ A  A  +T+S
Sbjct  19    YSSDDVKPWCSQTPHPQPCEYFLSQK-TDHSLIKQKSDFLNISMQLALERAMIAHGDTFS  77

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCR+  EKAAW DCLELYE+ + K++ T+D N +C+ ADAQTWLSTALTNL+TC  G
Sbjct  78    LGSKCRNEREKAAWNDCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDG  137

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F+DLGV+  +LP + SNNVS LISNTL+INK        A   Y  G+P WV+PGDRKLL
Sbjct  138   FIDLGVSDYVLP-LMSNNVSKLISNTLSINK-----VPYAEPSYKGGYPTWVKPGDRKLL  191

Query  1071  QSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS+ AS+A+IVV++DGSG+Y T+  A+ AA+KRSGSGRYVIYVKAG Y ENV+IGS LK
Sbjct  192   QSSSLASQANIVVSKDGSGDYTTIGAAITAASKRSGSGRYVIYVKAGTYSENVQIGSGLK  251

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML+GDGIGKTI+TGS+SVGGG+TTF SATVAVVGDGFI +G+TFRNTAGA+NHQAVAL
Sbjct  252   NIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDGFIARGMTFRNTAGASNHQAVAL  311

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGTVDFIFGNAAVVFQNCNIY RNP
Sbjct  312   RSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGTVDFIFGNAAVVFQNCNIYVRNP  371

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKT  418
             PNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK + T
Sbjct  372   PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAIYT  410



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/534 (57%), Positives = 379/534 (71%), Gaps = 25/534 (5%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  L   F+C  LA+     V G   +E  S CSQTPYP+ CE ++S +       + + 
Sbjct  6     MDKLVLGFVCISLAL-----VIGVVNSETISSCSQTPYPEICESFISSNKPLATLEETQF  60

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F + A +  +  A  A     ++         K AW DC+ELY + V +++ T+     
Sbjct  61    SFRESALSFTMDQALRAHGLISAMDLSSFDDKAKVAWADCVELYADTVTQLNRTMGSKNP  120

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFtt  1147
              S +DAQTWLS A+TN +TC  GF +L +   +   P + SN  S ++SN+LAINK   +
Sbjct  121   LSWSDAQTWLSAAITNEQTCQNGFTELNLPSYLSSFPFMLSN-FSKMVSNSLAINKAAAS  179

Query  1146  tnneat-------tgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVTEAV  991
             +               ++GFP WV   DRKLLQSS AAS+AD+VVA DGSGNY+T+++AV
Sbjct  180   SVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSGNYRTISQAV  239

Query  990   NAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFK  811
              A++KRSG  R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGS++V  G+TTF+
Sbjct  240   AASSKRSGK-RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFR  296

Query  810   SATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQ  631
             SATVAV G GFI + +TF+NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYVYS RQ
Sbjct  297   SATVAVTGGGFIARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQ  356

Query  630   FYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCK  454
             FYR+CDIYGTVDFIFG+A  V QNCNIY R P + + NT+TAQGR DPN+NTGISIHN +
Sbjct  357   FYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNENTGISIHNSR  416

Query  453   VTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGE  286
             VTAASDL+ V    KTYLGRPW++YSRTVFMK+SLDSLIDPAGWL W GNFAL+TLYYGE
Sbjct  417   VTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGE  476

Query  285   YSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             Y NTGAGAST+ RVKW G+HV+ SA++A KFTVGNF+ GGSW+ A  VPFTSGL
Sbjct  477   YMNTGAGASTSRRVKWPGFHVM-SASDAGKFTVGNFLGGGSWIAAAGVPFTSGL  529



>ref|XP_010662407.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Vitis vinifera]
Length=524

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/501 (59%), Positives = 363/501 (72%), Gaps = 17/501 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             IK WC+ TP+P+PC+Y++S S+        KSDF ++   +A+  A + +      G+ C
Sbjct  31    IKWWCNTTPHPEPCKYFMSHSHQRFAP-DHKSDFRRMLVQVAMDRALHGQRQVLRSGSNC  89

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDP---NIKCSTADAQTWLSTALTNLETCHAGFV  1246
              +  +K A  DCL+LYE+ V +++ T+     N  CS  DAQTWLSTA TNLETC     
Sbjct  90    VNKWQKGALNDCLKLYEDTVYQLNQTLQGLHGNQSCSDFDAQTWLSTAFTNLETCQDSAK  149

Query  1245  DLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
             DL VT  I P + SNNVS LISN+LAIN G     +         FP WV  G+RKLLQS
Sbjct  150   DLNVTNFIFP-LMSNNVSELISNSLAINDGLMEGTSYRGG-----FPSWVSAGERKLLQS  203

Query  1065  -SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNI  889
              S A+ A++VVA+DGSG++ ++  A+NAAAKR+ SGR++IYVK G+Y+EN+E+G  + NI
Sbjct  204   TSLATSANLVVAKDGSGDFSSIQAAINAAAKRTSSGRFIIYVKKGLYRENIEVGINVNNI  263

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
              LVGDG+ KTIITGSRSV GG TT+ SAT  + G  FI +GITF+NTAG  N QAVALRS
Sbjct  264   TLVGDGMKKTIITGSRSVRGGYTTYNSATAGIQGLRFIARGITFKNTAGPKNGQAVALRS  323

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-P  532
              SDLSVFY C+F+GYQDTL V+S RQFYREC IYGT+DFIFGNAAVVFQ C I+AR P  
Sbjct  324   SSDLSVFYHCAFQGYQDTLMVHSQRQFYRECYIYGTIDFIFGNAAVVFQQCMIFARRPLQ  383

Query  531   NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
              + N ITAQGR DP QNTGISIHN ++ AASDLK V    KTYLGRPW++YSRTV +K+ 
Sbjct  384   GQANVITAQGRGDPYQNTGISIHNSRILAASDLKPVVGSFKTYLGRPWQQYSRTVILKTY  443

Query  363   LDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
             LDSL+DP+GW PW   NFA +TLYYGEY N G  +ST NRVKW GYHVITSAT AS+FTV
Sbjct  444   LDSLVDPSGWSPWGTSNFAQSTLYYGEYQNFGPSSSTRNRVKWSGYHVITSATVASRFTV  503

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             G+FIAG SWLPAT VPFTSGL
Sbjct  504   GSFIAGQSWLPATGVPFTSGL  524



>ref|XP_011010930.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=516

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/517 (57%), Positives = 364/517 (70%), Gaps = 14/517 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDF--L  1492
             FI  CS  +  +S+  +     EI SWCS+TP+P+PC+Y + +   N        +F   
Sbjct  11    FISFCSLFSPTLSSITYN----EIDSWCSKTPHPEPCKYSMKQ---NPSHFIPNQEFESR  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KVA  LALQ A  A+++   L    R   EK AW+ CL  Y   + ++   +  NIK + 
Sbjct  64    KVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASNIKSTN  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              + QTWLS A T LE+C     DLGV+G++L  + SNNVS LI+N+LA++      ++  
Sbjct  124   FNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMMSNNVSKLITNSLALHN---KASSVF  180

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y + FP WV+  DRKLLQ  + S  D+VVAQDGSG+Y  +  A+ AA K SG+GR+V
Sbjct  181   PQTYQDDFPTWVKAADRKLLQEPSPS-PDLVVAQDGSGDYSIIKAALEAAEKSSGNGRFV  239

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G GFI 
Sbjct  240   IYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQGFIA  299

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT+DF
Sbjct  300   RDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDF  359

Query  591   IFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTY  415
             IFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A DL   KTY
Sbjct  360   IFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDLGSSKTY  419

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW++YSRTVF+ + LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST+ RVKW 
Sbjct  420   LGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWP  479

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GY VITSA EASKFTV NFI G SWLPAT V F +GL
Sbjct  480   GYKVITSAEEASKFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/533 (57%), Positives = 369/533 (69%), Gaps = 35/533 (7%)
 Frame = -3

Query  1644  LAIFVSTAVFGYSP-----TEIKSWCSQTPYPQPCEYY-----LSRSYSNGGQIKDKSDF  1495
             LAIF    +F YS      +++ + C++TPYP+ C Y+     L   Y  G     +   
Sbjct  6     LAIFYVHFLF-YSLELIHGSKLITSCARTPYPEVCNYFIETNLLQTQYQTGTTFSFRDQS  64

Query  1494  LKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCS  1315
             L V  N A++    A     S+  K      K AW+DC+ELYE+ V  ++ ++   I   
Sbjct  65    LLVTMNQAIK----AHQMVSSMNFKSFDKKAKLAWDDCMELYEDTVDHLNRSLSSTIPI-  119

Query  1314  TADAQTWLSTALTNLETCHAGFVDLGVTGN----ILPAVTSNNVSYLISNTLAINKGFtt  1147
               D+QTWLS A+ N +TC  GF+DL ++ +     +P + SN +S L+SN+LA+NK    
Sbjct  120   --DSQTWLSAAIANQQTCQNGFIDLNLSYDDHLESMPIMLSN-LSMLLSNSLAVNKVSVP  176

Query  1146  tnneattgyteG----FPDWVRPGDRKLLQSSA--ASKADIVVAQDGSGNYKTVTEAVNA  985
              N +   G        FP WV   DR+LLQSS+  A KADIVVAQDGSGNYKT+TEAV A
Sbjct  177   HNTKQVNGRRLLIFDGFPSWVSATDRRLLQSSSGVAPKADIVVAQDGSGNYKTITEAVAA  236

Query  984   AAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKS  808
             A K RSGS R VIYVK G+YKEN+EI   +KN+M VGDGI  TI+TGS++   G+TTF+S
Sbjct  237   AVKQRSGSKRLVIYVKKGIYKENIEIKKSMKNLMFVGDGIDATIVTGSKNAKDGSTTFRS  296

Query  807   ATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQF  628
             AT AV G GFI +G+TF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYVYS RQF
Sbjct  297   ATFAVSGQGFIAKGMTFENTAGPQKHQAVALRSGSDFSVFYGCSFKGYQDTLYVYSQRQF  356

Query  627   YRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKV  451
             YR+CDIYGT+DFIFG+A  V QNCNIY R P N + NT+TAQGR DPN+NTGI IHN  V
Sbjct  357   YRDCDIYGTIDFIFGDAVAVLQNCNIYVRRPMNGQKNTVTAQGRKDPNENTGIVIHNSNV  416

Query  450   TAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEY  283
              A SD++ V    KTYLGRPW++YSRT+FMKS+LD LIDPAGWLPW GNFAL+TLYYGEY
Sbjct  417   MATSDMRPVQGSFKTYLGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFALSTLYYGEY  476

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NTG+GASTA RV W GYHVIT AT+A KFTVGNF+AG SW+P T VPF SGL
Sbjct  477   MNTGSGASTARRVNWPGYHVITKATDAGKFTVGNFLAGDSWIPGTGVPFDSGL  529



>ref|XP_011010924.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=516

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/517 (57%), Positives = 364/517 (70%), Gaps = 14/517 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDF--L  1492
             FI  CS  +  +S+  +     EI SWCS+TP+P+PC+Y + +   N        +F   
Sbjct  11    FISFCSLFSPTLSSITY----NEIDSWCSKTPHPEPCKYSMKQ---NPNHFIPNQEFESR  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KVA  LALQ A  A+++   L    R   EK AW+ CL  Y   + ++   +  NIK + 
Sbjct  64    KVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASNIKSTN  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              + QTWLS A T LE+C     DLGV+G++L  + SNNVS LI+N+LA++      ++  
Sbjct  124   FNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMMSNNVSKLITNSLALHN---KASSIF  180

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y + FP WV+  DRKLLQ  + S  D+VVAQDGSG+Y  +  A+ AA K SG+GR+V
Sbjct  181   PQSYQDDFPTWVKSADRKLLQEPSPS-PDLVVAQDGSGDYSIIKAALEAAEKSSGNGRFV  239

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G GFI 
Sbjct  240   IYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQGFIA  299

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT+DF
Sbjct  300   RDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDF  359

Query  591   IFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTY  415
             IFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A DL   KTY
Sbjct  360   IFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDLGSSKTY  419

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW++YSRTVF+ + LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST+ RVKW 
Sbjct  420   LGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWP  479

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  480   GYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/439 (67%), Positives = 347/439 (79%), Gaps = 16/439 (4%)
 Frame = -3

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTV-DPNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
             R+  E+AAW DCLELY+  +  ++ T  D N  CS  D QTWLS+ALTNL TC AGFVDL
Sbjct  1     RNKKERAAWADCLELYQTTILHLNKTFSDKN--CSNFDIQTWLSSALTNLHTCRAGFVDL  58

Query  1239  GVT--GNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
             G+   G + P + +NN++ LISN+LA+N     + ++      EGFP W+  GDR+LLQ+
Sbjct  59    GIKDYGVVFPFLENNNITKLISNSLAMNN---CSESDEGNTSDEGFPKWLHGGDRRLLQA  115

Query  1065  SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIM  886
              A  KAD+VVAQDGSGNYKTV  AV+AA KR GSGR+VI VK GVYKENV I  K+KN+M
Sbjct  116   -AEPKADLVVAQDGSGNYKTVQAAVDAAGKRKGSGRFVIRVKKGVYKENVVI--KVKNLM  172

Query  885   LVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSG  706
             LVGDG+  TIITGSRSVGGG+TTF SATVAV G+ FI +GITFRNTAG  NHQAVALRSG
Sbjct  173   LVGDGLKYTIITGSRSVGGGSTTFNSATVAVTGERFIARGITFRNTAGPQNHQAVALRSG  232

Query  705   SDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PN  529
             +DLSVF++C FEGYQDTLYV+S RQFYREC IYGTVDFIFGN+AVV QNC IYAR P   
Sbjct  233   ADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPMQG  292

Query  528   KTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSL  361
             +   +TAQGR+DPNQNTGISIHN +V A  DLK     V+TYLGRPWKEYSRTV+++S +
Sbjct  293   QQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFM  352

Query  360   DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGN  181
             DSL++PAGWL W GNFALNTLYYGE+ N+G G+STANRVKW GY VITSA+EA+KFTVG+
Sbjct  353   DSLVNPAGWLEWSGNFALNTLYYGEFKNSGLGSSTANRVKWKGYRVITSASEAAKFTVGS  412

Query  180   FIAGGSWLPATNVPFTSGL  124
             FI+G SWLP T VPFT+GL
Sbjct  413   FISGNSWLPGTGVPFTAGL  431



>ref|XP_011010925.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=518

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/519 (57%), Positives = 364/519 (70%), Gaps = 16/519 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDF--L  1492
             FI  CS  +  +S+  +     EI SWCS+TP+P+PC+Y + +   N        +F   
Sbjct  11    FISFCSLFSPTLSSITYN----EIDSWCSKTPHPEPCKYSMKQ---NPNHFIPNQEFESR  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KVA  LALQ A  A+++   L    R   EK AW+ CL  Y   + ++   +  NIK + 
Sbjct  64    KVAIELALQSALTAQNHHQRLWPTLRIEKEKNAWKHCLNFYNKTIDELILALASNIKSTN  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVT--SNNVSYLISNTLAINKGFtttnn  1138
              + QTWLS A T LE+C     DLGV+G++L  +   SNNVS LI+N+LA++      ++
Sbjct  124   FNTQTWLSAASTYLESCKDTINDLGVSGSMLSLMIFPSNNVSKLITNSLALHN---KASS  180

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
                  Y + FP WV+  DRKLLQ  + S  D+VVAQDGSG+Y  +  A+ AA K SG+GR
Sbjct  181   IFPQSYQDDFPTWVKSADRKLLQEPSPS-PDLVVAQDGSGDYSIIKAALEAAEKSSGNGR  239

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             +VIY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G GF
Sbjct  240   FVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQGF  299

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT+
Sbjct  300   IARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTI  359

Query  597   DFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK  421
             DFIFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A DL   K
Sbjct  360   DFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDLGSSK  419

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPW++YSRTVF+ + LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST+ RVK
Sbjct  420   TYLGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVK  479

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  480   WPGYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  518



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/542 (56%), Positives = 380/542 (70%), Gaps = 34/542 (6%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTE-IKSWCSQTPYPQPCEYYLSRSYSNG--GQIK  1510
             M  L   F+C  LA+     V G   +E I S CSQTPYP+ CE Y   SYSN     + 
Sbjct  1     MDKLVLGFVCISLAL-----VIGVVNSETISSSCSQTPYPEICESYF-MSYSNKPLATLD  54

Query  1509  DKS---DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTT  1339
             D      F + A +  +  A  A     ++         K AW DC+ELY + + +++ T
Sbjct  55    DHETQFSFREAALSFTMDQALRAHGLISAMDLSSFDDKAKVAWADCVELYADTITQLNRT  114

Query  1338  VDPNIK-CSTADAQTWLSTALTNLETCHAGFVDLGVTG---NILPAVTSNNVSYLISNTL  1171
             +  N      +DAQTWLS A+TN +TC  GF +L ++    N  P + SN  S +ISN+L
Sbjct  115   MGSNKNPLRWSDAQTWLSAAITNQQTCQNGFTELNLSSYLSNSFPFMLSN-FSKMISNSL  173

Query  1170  AINKGFtttnneat-------tgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGN  1015
             AINK   ++               ++GFP WV   DRKLLQSS AAS+AD+VVA DGSGN
Sbjct  174   AINKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQSSSAASQADVVVAADGSGN  233

Query  1014  YKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsv  835
             Y+T+++AV A++KRSG  R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGS++V
Sbjct  234   YRTISQAVAASSKRSGK-RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNV  290

Query  834   gggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDT  655
               G+TTF+SATVAV  D F+ + +TF NTAG   HQAVALRSGSDLSVFY+CSF+GYQDT
Sbjct  291   QDGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDT  350

Query  654   LYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNT  478
             LYVYS RQFYR+CDIYGTVDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NT
Sbjct  351   LYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNENT  410

Query  477   GISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFA  310
             GISIHN +VTAASDL+ +    KTYLGRPW++YSRTVFMK+SLDSLIDP GWL W G+FA
Sbjct  411   GISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFA  470

Query  309   LNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTS  130
             L+TLYYGEY NTG GAST+ RVKW G+HV+ SA++A KFTVGNF+ G +W+PAT VPFTS
Sbjct  471   LSTLYYGEYMNTGVGASTSQRVKWPGFHVM-SASDAGKFTVGNFLGGDTWIPATGVPFTS  529

Query  129   GL  124
             G+
Sbjct  530   GM  531



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 339/442 (77%), Gaps = 8/442 (2%)
 Frame = -3

Query  1431  LGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAG  1252
             LG+KCRS  EKAAW DC  LY++ +  ++  ++P  + ++ D QTWLSTALTN++TC  G
Sbjct  3     LGSKCRSKQEKAAWSDCTTLYQDTINILNQALNPTKQSTSYDLQTWLSTALTNIDTCQTG  62

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
             F +LGV  N+L  + + NVS +IS+ LA+N    ++       Y  G P W+ P DRKLL
Sbjct  63    FHELGVGNNVLSLIPNKNVSEIISDFLALNNA--SSFIPPKKTYKNGLPRWLPPNDRKLL  120

Query  1071  QSSAAS-KADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             +SS  S   D VVA+DGSG++KT+ EA+ A  KR+ + R+VIYVK G+Y EN+EIG+ +K
Sbjct  121   ESSPPSLSPDFVVAKDGSGDFKTIKEALKAIPKRNEAKRFVIYVKRGIYNENIEIGNSMK  180

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIML GDG   TII+GSRSVGGG+TTF SATVAV GDGFI +GITFRNTAG  NHQAVAL
Sbjct  181   NIMLYGDGTRLTIISGSRSVGGGSTTFNSATVAVTGDGFIARGITFRNTAGPENHQAVAL  240

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             R G+DLSVFY+C+FEGYQDTLYV+S RQFY+EC+IYGTVDFIFGNAAVVFQ+CNIYAR P
Sbjct  241   RCGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGNAAVVFQSCNIYARRP  300

Query  534   PNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMK  370
               K  N ITAQGR+DPNQNTGI I N +V AA DL  V    KT+LGRPW+EYSRTVF++
Sbjct  301   MQKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPVLSSFKTFLGRPWREYSRTVFLQ  360

Query  369   SSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFT  190
             + LD L+DPAGWL W G+FAL+TLYYGEY N G   ST  RVKWGGYH ITSATEASKFT
Sbjct  361   TYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGSTRGRVKWGGYHAITSATEASKFT  420

Query  189   VGNFIAGGSWLPATNVPFTSGL  124
             V NFIAG SWLPAT +PF  GL
Sbjct  421   VENFIAGKSWLPATGIPFLFGL  442



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 381/541 (70%), Gaps = 31/541 (6%)
 Frame = -3

Query  1689  ITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIK  1510
             + K+  L F+   S LA F   A+ G    +  S CSQTPYP+ CE +++   S      
Sbjct  1     MDKLALLGFVMSVS-LAYF---AIIGVVNADAISSCSQTPYPEICESFIT---SKPLVTL  53

Query  1509  DKS--DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV  1336
             D++  +F + A  + L  A+ A     ++         K AW DC+ELY + V +++ ++
Sbjct  54    DETQFNFRETALTVTLDQAQRAHGLISAMDLGSFDDKSKMAWADCVELYADTVSQLNRSM  113

Query  1335  DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAIN  1162
                     +DAQTWLS A+TN +TC  GF++L  +  +   P + +N +S ++SN+LAIN
Sbjct  114   ASKNPLIWSDAQTWLSAAITNEQTCRNGFIELSSSSQLSSFPFMLTN-LSKMVSNSLAIN  172

Query  1161  KG---------FtttnneattgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNY  1012
             K          F           ++GFP WV   DRKLLQSS AAS+AD+VVA DGSGNY
Sbjct  173   KAAASTSSASLFGKQGANNRRLLSDGFPTWVSAADRKLLQSSGAASQADVVVAADGSGNY  232

Query  1011  KTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvg  832
             KT++EAV A++KRSGS R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGSR+V 
Sbjct  233   KTISEAVAASSKRSGS-RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSRNVQ  289

Query  831   ggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTL  652
              G+TTF+SATVAV G GFI + +TF NTAG   HQAVALRSGSDLSVFY+CS +GYQDTL
Sbjct  290   DGSTTFRSATVAVTGGGFIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTL  349

Query  651   YVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTG  475
             YVYS RQFYR+CDIYGTVDFIFG+A  V QNCNIY R P   + NT+TAQGR+DPN+NTG
Sbjct  350   YVYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNENTG  409

Query  474   ISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFAL  307
             ISIHN +VTAASDL+ V    KTYLGRPW++YSRTVFMK+SLDSLIDPAGWL W G+FAL
Sbjct  410   ISIHNSRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFAL  469

Query  306   NTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSG  127
             +TLYYGEY NTGAGAST  RVKW GYHV+ SA +A KFTVG+F+ GGSW+ +  VPFTSG
Sbjct  470   STLYYGEYMNTGAGASTGGRVKWAGYHVM-SAADAGKFTVGSFLGGGSWIGSAGVPFTSG  528

Query  126   L  124
             L
Sbjct  529   L  529



>ref|XP_002322399.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06526.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=516

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/517 (56%), Positives = 364/517 (70%), Gaps = 8/517 (2%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             L  +FI SF ++F S  +   +  EI SWC++ P+P+PC+Y + ++  N      + +  
Sbjct  7     LSVLFI-SFCSLF-SPTLSSITSNEIDSWCNKIPHPEPCKYSMKQN-PNPFIPNQEFESR  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KVA  LAL+ A  A+++   L    R+  EK AW+ CL  Y   + ++   +D NIK + 
Sbjct  64    KVAIELALKSALTAQNHHQRLWPTLRNEKEKNAWKHCLNFYNKTIDELILALDSNIKSTN  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea  1132
              D QTWLS A T LE C     DLGV+ ++LP + SNNVS LI+N+LA++      ++  
Sbjct  124   FDTQTWLSAASTYLECCKDTINDLGVSDSMLPLMMSNNVSKLITNSLALHN---KASSVF  180

Query  1131  ttgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYV  952
                Y +  P WV+  DRKLLQ  + S  D+VVAQDGSG+Y  +  A+ AA K SG+GR+V
Sbjct  181   PQTYQDDLPTWVKASDRKLLQEPSPS-PDLVVAQDGSGDYSNIKAALEAAEKSSGNGRFV  239

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++  GGG  TF +ATV V G GFI 
Sbjct  240   IYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKRSGGGVDTFHTATVGVDGHGFIA  299

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT+DF
Sbjct  300   RDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDF  359

Query  591   IFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTY  415
             IFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V AA DL   KTY
Sbjct  360   IFGDAAVVLQNCMIYVRRPIGSQNNVITAQGRSCPYTNTGIVIHNSQVFAAEDLGSSKTY  419

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW++YSRTVF+ + LDS +DPAGWL W+G+FALNTLYYGEY NTG GAST+ RVKW 
Sbjct  420   LGRPWRKYSRTVFLSTYLDSSVDPAGWLEWNGSFALNTLYYGEYKNTGPGASTSGRVKWP  479

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  480   GYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/403 (71%), Positives = 322/403 (80%), Gaps = 14/403 (3%)
 Frame = -3

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSY---LISNTLAINKGFtttnn  1138
             D   W + +   L   H    DLG+   + P + S N       ISN L+ N        
Sbjct  42    DLLLWPTHSDPTLSFSHRKLSDLGLL-VLKPPLKSLNGRLKVSTISNILSTNH-----VP  95

Query  1137  eattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
               T  YT  FP WVRPGDRKLLQS S  SKA+ +VAQDGSGNYKT++EA+  A+KRSG+ 
Sbjct  96    YVTPNYTNEFPTWVRPGDRKLLQSLSVTSKANTMVAQDGSGNYKTISEAITTASKRSGTA  155

Query  960   RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  781
             RY+IY+KAG Y E V +G+ L NIML+GDGIGKTIIT S+SV GG+TTF SA VAVVGDG
Sbjct  156   RYIIYIKAGTYNEIVRVGTNLVNIMLMGDGIGKTIITESKSVDGGSTTFNSARVAVVGDG  215

Query  780   FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  601
             FI + ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  216   FIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  275

Query  600   VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK---  430
             VDFIFGNAAVVFQNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNC+VTAAS+LK   
Sbjct  276   VDFIFGNAAVVFQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQ  335

Query  429   -GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
               VKTYLGRPWKEYSRTVFMK+ LDSLI+PAGW+ W+GNFAL TLYYGEY NTG G+ST 
Sbjct  336   SSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTK  395

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             NRVKWGGY VITSA+EASKFTVG+ IAG SWLPAT VPFTSGL
Sbjct  396   NRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  438



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/502 (59%), Positives = 365/502 (73%), Gaps = 29/502 (6%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGT----KC  1417
             CSQ P P  C   +  S     Q K +S FL    +LALQ AK+     + L +      
Sbjct  28    CSQNPNPHVCSSMVGSS-PLFAQAKTQSGFL----HLALQAAKDRAVRVHELASAMDVSS  82

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
                G KAAW DCLEL E+ + K++ ++  +   S  DAQTWLS A+ N +TC  GF++LG
Sbjct  83    LDKGAKAAWVDCLELCEDTIGKLNRSMSSS---SYDDAQTWLSAAMANQQTCRNGFIELG  139

Query  1236  VTGNILP----AVTSNNVSYLISNTLAINKGFtttnneattgyteG-FPDWVRPGDRKLL  1072
              +    P      TS N+S  +SN+LAINK  T   +        G FP+W+   DRKLL
Sbjct  140   SS---FPFGSSPFTSYNISESLSNSLAINKATTAAKSGGNRRLLSGGFPNWLSAADRKLL  196

Query  1071  QSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGRYVIYVKAGVYKENVEIGSKLK  895
              SS  + AD+VVA+DGSGNYKT++EA+ AA K+S G  R+VI+VKAGVY ENV+  + +K
Sbjct  197   HSSTIN-ADLVVAKDGSGNYKTISEAIAAATKQSNGRSRFVIHVKAGVYNENVQ--TPMK  253

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             N+M+VGDG+  T++TGSR+V  G+TTF+SAT AV GDGFI + +TF+NTAG   HQAVAL
Sbjct  254   NLMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFIARDMTFQNTAGPHKHQAVAL  313

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSDLSVFY+CSFEGYQDTLY+YS RQFYR CD+YGTVDFIFG+AAVV QNC++Y R P
Sbjct  314   RSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCSMYVRKP  373

Query  534   PN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMK  370
              + + NT+TAQGR+DPN+NTGISIH+  VTAAS+LK V    KTYLGRPWK+YSRTVFMK
Sbjct  374   MSGQKNTVTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTYLGRPWKKYSRTVFMK  433

Query  369   SSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFT  190
             +SLD LIDPAGWL W GNFAL+TLYYGEY NTGAGA T+ RVKW GYHVITSATEASKFT
Sbjct  434   TSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWPGYHVITSATEASKFT  493

Query  189   VGNFIAGGSWLPATNVPFTSGL  124
             V NF++G SW+PAT V FTSGL
Sbjct  494   VANFLSGNSWIPATGVAFTSGL  515



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/532 (57%), Positives = 369/532 (69%), Gaps = 29/532 (5%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGG-QIKDKSDFLKVA  1483
              +  F+ IF+   + G     I S C QTPYP+ CE Y   SYSN      D++ F    
Sbjct  4     LVSGFVTIFLVLVIEGVISDTISS-CGQTPYPEICESYF-MSYSNKPLATLDETQF--SL  59

Query  1482  KNLALQYAKNAKDNTYSL--GTKCRSGGEKA--AWEDCLELYENMVQKIDTTVDPNIKCS  1315
             ++ AL    +     Y L       S  EKA  AW DC+ELY + V +++  +      S
Sbjct  60    RDAALGSTLDQAQRAYGLISAMDVSSFDEKAKMAWADCVELYSDTVTQLNRAMGSKNPLS  119

Query  1314  TADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINK------  1159
              +DAQTWLS A+TN +TC  GFV+LG +  +   P + SN  S ++SN+LAINK      
Sbjct  120   WSDAQTWLSAAITNQQTCQNGFVELGKSSYLSSFPFMLSN-FSKMVSNSLAINKEADSSA  178

Query  1158  -GFtttnneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNA  985
                           ++GFP WV   DRKLLQS SAAS+AD+VVA DGSGNYKT++EAV A
Sbjct  179   ASLLGKQGGNRRLLSDGFPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISEAVAA  238

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             ++KRSG  R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+T S++   G+TTF++A
Sbjct  239   SSKRSGK-RFVIYVKKGVYKENVEI--KASNIMLIGDGIDATIVTDSKNAQDGSTTFRTA  295

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             TV V GDGF+ + +TF NTAG   HQAVALRSGSDLSVFY CSF+GYQDTLYVYS RQFY
Sbjct  296   TVGVTGDGFMARDMTFENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFY  355

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVT  448
             R+CDIYGTVDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VT
Sbjct  356   RDCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVT  415

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYS  280
             AASDL+ V    KTYLGRPW++YSRTVFMK+SLDSL+D AGWL W G FAL++LYYGEY 
Sbjct  416   AASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLVDRAGWLEWSGKFALSSLYYGEYM  475

Query  279   NTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             NTG GAST+ RV W G+HV+ SA +A KFTVG+F+ GGSW+ A  VPFT GL
Sbjct  476   NTGPGASTSGRVNWEGFHVM-SADDAGKFTVGSFLGGGSWIAAAGVPFTPGL  526



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/531 (56%), Positives = 374/531 (70%), Gaps = 34/531 (6%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
             F+C   A+     V G   ++  S CS TPYP+ CE ++    S      D++ F    +
Sbjct  14    FVCISFAL-----VIGGVNSDTISSCSLTPYPEICESFMG---SKPLATLDETQF--SFR  63

Query  1479  NLALQYAKNAKDNTYSL--GTKCRSGGEKA--AWEDCLELYENMVQKIDTTVDPNIKCST  1312
             + AL    +     Y L       S  EKA  AW+DC+ELY + V +++  +      S 
Sbjct  64    DAALGSTLDQAQRAYGLISAMDVSSFDEKARIAWDDCVELYADTVTQLNRALGSKNPLSW  123

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINK-------  1159
             +DAQTWLS A+TN +TC  GF++LG +  +   P + SN  S ++SN+LAINK       
Sbjct  124   SDAQTWLSAAITNQQTCQNGFIELGKSSYLSSFPFMLSN-FSKMVSNSLAINKEAASSAA  182

Query  1158  GFtttnneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAA  982
                          ++GFP WV   DRKLLQS SAAS+AD+VVA DGSGNYKT+++AV A+
Sbjct  183   SLLGKQGGNRRLLSDGFPTWVSAADRKLLQSPSAASQADVVVAADGSGNYKTISQAVAAS  242

Query  981   AKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSAT  802
              KRSG  R+VIYVK GVY+ENVEI +   NIML+GDGI  T +TGS++V  G+TTF++AT
Sbjct  243   PKRSGK-RFVIYVKRGVYRENVEITAS--NIMLIGDGIDATTVTGSKNVQDGSTTFRTAT  299

Query  801   VAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYR  622
             VAV GDGFI + +TF NTAG   HQAV+LRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR
Sbjct  300   VAVTGDGFIARDMTFENTAGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYR  359

Query  621   ECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTA  445
             +CDIYGTVDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VTA
Sbjct  360   DCDIYGTVDFIFGDAVAVLQNCNIYVRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTA  419

Query  444   ASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSN  277
             ASDL+ V    KTYLGRPW++YSRTVFMK+SLDSL+DPAGWL W GNFAL+TLYYGEY N
Sbjct  420   ASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMN  479

Query  276   TGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G GAST+ RVKW G+HV+ SA++A KFTV NF+ GGSW+ AT VPFTSGL
Sbjct  480   IGGGASTSRRVKWPGFHVM-SASDAGKFTVENFLGGGSWIAATGVPFTSGL  529



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 368/523 (70%), Gaps = 21/523 (4%)
 Frame = -3

Query  1668  QFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
              F     F+A  ++T+     P  I   C QTPYP  C   +S S     Q K +S F  
Sbjct  7     HFFAFSLFMAFRIATS----EPILIS--CRQTPYPHVCSSMVSSS-PLFAQAKTQSGFRH  59

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             +A   A+  A  A +   ++         KAAW DCLEL E+ + K++ ++  +   S  
Sbjct  60    LALQAAIDRAIRAHELASTMDVSSLDERVKAAWADCLELCEDTIGKLNRSMSSS---SYD  116

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPA-VTSNNVSYLISNTLAINKGFtttnnea  1132
             DAQTWLS A+ N +TC  GF++L  +  +  +   S N+S  +SN LAIN   T   +  
Sbjct  117   DAQTWLSAAMANQQTCRNGFLELDSSFPLGSSPFMSYNISESLSNLLAINMATTPAMSGG  176

Query  1131  ttgyteG-FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGR  958
                     FP+W+   DRKLL+SS  + AD+VVA+DGSG+YKT++EA+ AA K+S G  R
Sbjct  177   NRRLLSDGFPNWLSATDRKLLRSSTIN-ADLVVAKDGSGDYKTISEAIAAAMKQSSGKSR  235

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             +VI+VK GVY ENV+  + +KN+M++GDG+  T++TGS++V  G+TTF+SAT AV GDGF
Sbjct  236   FVIHVKTGVYDENVQ--TSMKNLMIIGDGMDATVVTGSKNVKDGSTTFRSATFAVTGDGF  293

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I + +TF NTAG    QAVALRSGSDLSVFYQCSF+GYQDTLYVYS RQFYR CDIYGTV
Sbjct  294   IARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYGTV  353

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK  421
             DFIFG+AAVV QNCN++ R P + + NT+TAQGR+DPN+NTGISIH+  VTAASDLK V+
Sbjct  354   DFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQ  413

Query  420   ----TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  253
                 TYLGRPW+EYSRTVFMK+SLDSLIDPAGWL W GNFAL+TLYYGEY NTG GA T+
Sbjct  414   GSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTS  473

Query  252   NRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              RVKW GYHVITSA EASKFTVGNF++G SW+PAT VPFTSGL
Sbjct  474   QRVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/536 (56%), Positives = 374/536 (70%), Gaps = 27/536 (5%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  L F  + S    FV   V G + T     CSQTPYP+ CEY++S  + +   + +K+
Sbjct  1     MDKLAFGLLLSVCLAFVVGVVNGDANTIS---CSQTPYPEICEYFMSSKH-DLVTLDEKT  56

Query  1500  DF--LKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPN  1327
              F     A ++ +  A+ A     ++         K AW DC+ELY + V +++ ++   
Sbjct  57    QFSFRDAALSVTMDQAQRAHGLISAMDLSSFDEKVKMAWADCVELYADTVSQLNRSLGSK  116

Query  1326  IKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKG-  1156
                S +D+QTWLS ALTN +TC  GF+DL ++  +  LP++ SN  S ++SN+LAINK  
Sbjct  117   NPLSWSDSQTWLSAALTNEQTCRNGFMDLNLSHRLSSLPSMLSN-FSKMVSNSLAINKAA  175

Query  1155  ------FtttnneattgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVTE  997
                               ++GFP WV   DRKLLQSS AAS+AD+VVA DGSGNYKT++E
Sbjct  176   ASSSASLLGRQGGNRRLLSDGFPAWVSAADRKLLQSSGAASQADVVVAADGSGNYKTISE  235

Query  996   AVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttT  817
             AV AA+   G  R++IYVK GVYKENVEI  +  NIML+GDGI  TI++ SR+V  G+TT
Sbjct  236   AVAAAS--GGGSRFIIYVKRGVYKENVEI--RASNIMLIGDGIDATIVSSSRNVQQGSTT  291

Query  816   FKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSD  637
             F+SATVAV G GFI + +TF N+AG  NHQAVALRSGSDLSV Y CSF+GYQDTLYV+S 
Sbjct  292   FRSATVAVSGGGFIARDMTFENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLYVHSQ  351

Query  636   RQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHN  460
             RQFYR+CDIYGT DFI GNAA VFQNCNIY R P   + NT+TAQ R+DPNQNTGISIHN
Sbjct  352   RQFYRDCDIYGTQDFICGNAAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGISIHN  411

Query  459   CKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYY  292
              +VTAASDL+ V    KTYLGRPW++YSRTVFMK+SLDSLIDPAGWL W G+FAL+TLYY
Sbjct  412   SRVTAASDLRAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYY  471

Query  291   GEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GE+ N+GAGAST+ RV W GY V++S  EA +FTVG+F+ GGSW+ A  VPFTSGL
Sbjct  472   GEFMNSGAGASTSGRVTWPGYRVMSS-EEAGEFTVGSFLGGGSWIAAAGVPFTSGL  526



>ref|XP_007038414.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY22915.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=524

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/528 (55%), Positives = 368/528 (70%), Gaps = 20/528 (4%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             +  IF+ SF +IF STA+   S + I  WCS+TP+P+PC+Y++ R  S+    +  ++F 
Sbjct  5     ILLIFLISFSSIF-STALARGSRSNITWWCSKTPHPEPCKYFM-RHGSHRFAPEHMTEFR  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD-----PN  1327
             K+   +AL  A  A+ N    G  C S  +KAAW DCL+L++N + +++ T+        
Sbjct  63    KMIVRVALDRAVVAEKNVLEFGQSCESRHQKAAWRDCLKLFDNTILQLNLTLQGLETGRR  122

Query  1326  IKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtt  1147
             I CS  DAQTWLSTALTN++TC AGF+D  V+    P +TSNN+S LISN+LA+N  F  
Sbjct  123   ISCSDFDAQTWLSTALTNIQTCEAGFMDFNVSDFSTP-ITSNNISQLISNSLAVNGVFLH  181

Query  1146  tnneattgyteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNAAAKRS  970
               N          P W+   DR LL S++   KA +VVA+DGSGN+KTV  A++AAAKR 
Sbjct  182   MKNHTEVS-----PGWLSRHDRWLLASASTKVKAHLVVAKDGSGNFKTVQAALDAAAKRR  236

Query  969   GSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVV  790
              + R +IYVK GVY+EN+E+ +   NIML+GDG+ +TIIT SRSV  G TT+ SAT  + 
Sbjct  237   RTSRLIIYVKKGVYRENIEVVNTNSNIMLIGDGMKRTIITSSRSVKTGYTTYSSATAGID  296

Query  789   GDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDI  610
             G GFI + ITF NTAG    QAVALRS SDLSVFY+C+ +GYQDTL V+S RQFYREC I
Sbjct  297   GPGFIARDITFSNTAGPTKGQAVALRSASDLSVFYRCAIQGYQDTLMVHSQRQFYRECYI  356

Query  609   YGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL  433
             YGT+D IFGNAAVV QNC+I+AR P   + N ITAQGR DP QNTGI+IHN ++ AA+DL
Sbjct  357   YGTIDIIFGNAAVVLQNCSIFARKPLKGQANIITAQGRGDPYQNTGIAIHNSRILAANDL  416

Query  432   KGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGA  268
             K V    KTYLGRPW++YSRTV +K+ L SL+ PAGW  W D NFAL+TLYYGEY N G 
Sbjct  417   KPVVRSFKTYLGRPWQKYSRTVVLKTYLGSLVSPAGWSKWGDSNFALDTLYYGEYKNNGP  476

Query  267   GASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              +ST  RVKW G+HVITS   AS+FTV + IAGGSWLPAT VPFT+GL
Sbjct  477   ASSTRYRVKWRGFHVITSPNVASRFTVNSLIAGGSWLPATGVPFTAGL  524



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   533 bits (1372),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 288/538 (54%), Positives = 359/538 (67%), Gaps = 23/538 (4%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  L   F+ ++  +     V G +P    S CSQTPYP+ C Y++       G  + + 
Sbjct  1     MARLLLHFLSAYFVVLYVRVVDG-API---SSCSQTPYPEVCNYFIGNYKPTAGIDEIQF  56

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F      + +  AK       ++         K AW DCLELYEN +  ++ +++    
Sbjct  57    PFRDRVLGVTMNQAKRLHLLVSAMDLSSSDERTKLAWADCLELYENTIDLVNRSINSISP  116

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPA-----VTSNNVSYLISNTLAINKG  1156
                 D+QTWLS A+ N +TC  GF+D   + +   +     ++++N S L+SN+LAINK 
Sbjct  117   AVMFDSQTWLSAAIANQQTCLDGFIDFNPSSDQFQSFPSMSISTSNFSKLLSNSLAINKA  176

Query  1155  -------FtttnneattgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVT  1000
                     +          + GFP WV   DRKLLQSS AAS+ADIVVA DGSGNYKT++
Sbjct  177   AVSATSILSNNQAGGRRLLSNGFPTWVSAADRKLLQSSGAASRADIVVAHDGSGNYKTIS  236

Query  999   EAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggt  823
             EAV A+ K RSG+ R+VIYVKAGVY+ENVEI  K+KNIM++GDG   TI+TG+++V  G+
Sbjct  237   EAVAASVKLRSGTKRFVIYVKAGVYRENVEIKRKMKNIMIIGDGKDATIVTGNKNVQDGS  296

Query  822   tTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVY  643
             TTF+SAT AV G GFI + +TF NTAG   HQAVALRS SD SVFY CSF+GYQDTLYV+
Sbjct  297   TTFRSATFAVSGHGFIARDMTFENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVH  356

Query  642   SDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISI  466
             + RQFYR CD+YGTVDFIFG+A  V QNCNIY R P  N+ N ITAQGRSD N+NTGISI
Sbjct  357   TQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISI  416

Query  465   HNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTL  298
             HN +V AA DL+ V    KTYLGRPW++YSRTVFMK+SLD LI P GW PW G+F L+TL
Sbjct  417   HNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTL  476

Query  297   YYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YYGEY NTG+GAST  RVKW GYHVITSA EA KFTVG F+ G SW+P T VP+ SGL
Sbjct  477   YYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  534



>ref|XP_010672022.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   531 bits (1369),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 283/501 (56%), Positives = 357/501 (71%), Gaps = 17/501 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I  WC+QTP P PC+Y++S       + K K+DF K+   +AL   + + + T  L  K 
Sbjct  28    INWWCNQTPNPNPCKYFMSHDL----KPKHKADFKKMMIQIALDRTRFSHNQTKELIHKL  83

Query  1416  RSG-GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA-DAQTWLSTALTNLETCHAGFVD  1243
             ++   +K AW DCL LYEN + +++ T++P  K  T  D QTWLSTALTNLETC +   D
Sbjct  84    KNNEHDKVAWADCLTLYENTISELNKTLNPTKKYRTEFDKQTWLSTALTNLETCKSELFD  143

Query  1242  -LGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
              LG   + +P    NNVS LISN LA++        +        FP WV   DRKLLQS
Sbjct  144   QLGHVLDFIPPHIYNNVSELISNGLAMHNKLAIPQTQTYKLG---FPTWVTRRDRKLLQS  200

Query  1065  SAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGRYVIYVKAGVYKENVEIGSKLKNI  889
             S+   A++VVA+DGSGN+KT+ EA++AAAKR+  SGR+VI++K+GVY E + IG+ LKNI
Sbjct  201   SSTKAANLVVAKDGSGNFKTIREALDAAAKRTRSSGRFVIHIKSGVYAEYLRIGTDLKNI  260

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             MLVGDG+  TIITG+RS GGG T F SATVAV  DGFI + ITFRNTAG  N+QAVALR 
Sbjct  261   MLVGDGMESTIITGNRSKGGGFTIFTSATVAVTSDGFIARDITFRNTAGPQNNQAVALRV  320

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-P  532
             GSDLSVFY+C FEGYQDTLY +S RQFYREC+IYGT+DFIFGNAA +FQNCNI+ R P  
Sbjct  321   GSDLSVFYKCGFEGYQDTLYAHSQRQFYRECNIYGTIDFIFGNAASIFQNCNIFVRKPLS  380

Query  531   NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
             ++ N +TAQGR+DPNQNTGI I   ++  +SDLK V     TYLGRPWK+YSRT+FM++ 
Sbjct  381   SQKNVVTAQGRTDPNQNTGIIIQKSRIAPSSDLKPVISSFPTYLGRPWKKYSRTIFMENF  440

Query  363   LDSLIDPAGWLPWDGN-FALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
             LDS I+P+GWL WDG+ FA NTL+YGEY N G G+ST+ RV WGGY + TS  + S+F+V
Sbjct  441   LDSFINPSGWLKWDGSKFAPNTLFYGEYKNYGPGSSTSERVNWGGYKIFTSVAQVSQFSV  500

Query  186   GNFIAGGSWLPATNVPFTSGL  124
              NFI G SWLPA  VPF+SG+
Sbjct  501   ANFIGGQSWLPAAGVPFSSGI  521



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   525 bits (1352),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 280/366 (77%), Positives = 313/366 (86%), Gaps = 13/366 (4%)
 Frame = -3

Query  1206  SNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQ  1030
             SNNV+ L+SNTLA+NK            Y EGFP WV+PGDRKLLQ SS AS+A++VVA+
Sbjct  2     SNNVTKLLSNTLALNK-----VPYQEPSYKEGFPTWVKPGDRKLLQASSPASRANVVVAK  56

Query  1029  DGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiit  850
             DGSG + TV+ A+NAA K S SGRYVIYVK GVY E VE+  K KNIMLVGDGIGKTIIT
Sbjct  57    DGSGRFTTVSAAINAAPK-SSSGRYVIYVKGGVYDEQVEV--KAKNIMLVGDGIGKTIIT  113

Query  849   gsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFE  670
             GS+SVGGGTTTF+SATVAVVGDGFI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFE
Sbjct  114   GSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFE  173

Query  669   GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDP  490
             GYQDTLYV+S+RQFYREC+IYGTVDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DP
Sbjct  174   GYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDP  233

Query  489   NQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD  322
             NQNTGISIHN +VTAASDL+     V+TYLGRPWK+YSRTVFMK+ LD LI+PAGW+ W 
Sbjct  234   NQNTGISIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWS  293

Query  321   GNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNV  142
             GNFAL+TLYYGEY NTG G+STA RVKW GY VITSA+EASKF+V NFIAG +WLP+T V
Sbjct  294   GNFALDTLYYGEYMNTGPGSSTARRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKV  353

Query  141   PFTSGL  124
             PFT  L
Sbjct  354   PFTPSL  359



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   529 bits (1362),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 292/536 (54%), Positives = 366/536 (68%), Gaps = 38/536 (7%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGG---QIKDKSDFLK  1489
             F+ ++   +    V G S T     C QTP+P+ C Y++  + S       ++D+S  L 
Sbjct  10    FLNAYFLFYSLALVHGDSVTS----CDQTPFPEACNYFIDTNISKTPPLFALRDQS--LS  63

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
             +  N A++    A     S+     +   K AW+DCL+LYE+ V  ++ ++  N   + A
Sbjct  64    ITMNKAIE----AHQMVSSMELSSFNQQAKLAWDDCLKLYEDTVDHVNRSMSSN---NLA  116

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFtttnne  1135
             D+QTWLS A+ N  TC  GF+D  +   +  LP +   N + L+SNTL++NK   ++   
Sbjct  117   DSQTWLSAAIANQRTCENGFIDFNIVSYLESLPNML-RNFTKLLSNTLSLNKAIISSTPI  175

Query  1134  attgyteG---------FPDWVRPGDRKLLQSS--AASKADIVVAQDGSGNYKTVTEAVN  988
                   +G         FP WV   DRKLLQS+  AA KADIVVAQDGSG+YKT++EAV 
Sbjct  176   LLDTKQDGGRRRLLVDGFPSWVPASDRKLLQSNGRAAPKADIVVAQDGSGDYKTISEAVA  235

Query  987   AAAK-RSG--SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttT  817
             A+AK RSG  S R+VIYVK GVYKENVEI   +KN+M VGDGI  T+IT +++   GTTT
Sbjct  236   ASAKLRSGTKSKRFVIYVKGGVYKENVEIKKSMKNLMFVGDGIDATVITSNKNTQDGTTT  295

Query  816   FKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSD  637
             F+SATV V G GFI + ITF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYV+S 
Sbjct  296   FRSATVGVSGKGFIARDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQ  355

Query  636   RQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHN  460
             RQFYR+CDIYGTVDFIFG+A  V QNCNIY R P +K TNT+TAQGR+DP++NTGI IHN
Sbjct  356   RQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRRPMSKQTNTVTAQGRTDPDENTGIVIHN  415

Query  459   CKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYY  292
              +V AA DL+ V    K+YLGRPWK+YSRTVF+KS++D LIDPAGWLPW G+FAL+TLYY
Sbjct  416   SRVMAAPDLRPVQGSFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYY  475

Query  291   GEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GEY +TG+GAST  RVKW GYH ITS  EA KFTV NF+AG SW+ A  VPF SGL
Sbjct  476   GEYMSTGSGASTKGRVKWPGYHTITSPLEAGKFTVENFLAGNSWISAAGVPFESGL  531



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   529 bits (1363),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 372/546 (68%), Gaps = 39/546 (7%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             +Q IF  SFL  F S    G+      + CSQTPYP+ C ++++ +     + +    F 
Sbjct  7     VQAIFYLSFL--FYS---LGFIDGATIASCSQTPYPEICNHFMNTNILETEKDQTPFTFR  61

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKA--AWEDCLELYENMVQKIDTT--VDPNI  1324
               +  + + +A  A     SL     S  EKA  A  DC+ELYE+ +  ++ +  V  + 
Sbjct  62    DQSLLVTMNHAIKAHQMILSLEMN-DSFDEKAKLARADCVELYEDTIDHLNRSLFVSSSN  120

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGN-----ILPAVTSNNVSYLISNTLAINK  1159
               +  D+QTWLS A TNL+TC  GF +  +T N     +LP + SN  S L+SN+LAINK
Sbjct  121   NNNPVDSQTWLSAANTNLQTCQNGFTEFNLTSNYLESLLLPDMLSN-FSKLLSNSLAINK  179

Query  1158  GFtttnneattgyte---------------GFPDWVRPGDRKLLQSSAASKADIVVAQDG  1024
                  +    +                    FP WV   DRKLLQSS   +ADIVVAQDG
Sbjct  180   ENYYISPLYNSKTVHPGSSGGGGRKLLHDDEFPWWVSVTDRKLLQSSP--EADIVVAQDG  237

Query  1023  SGNYKTVTEAVNAAA-KRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitg  847
             SGNYKT+ EAV A+A +RSG+ R+VIYVK GVYKE VEI + + N+ML+GDGI  TI+TG
Sbjct  238   SGNYKTIGEAVAASATRRSGNKRFVIYVKKGVYKEYVEIKNSMNNLMLIGDGIDATIVTG  297

Query  846   srsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEG  667
             +++   G+TTF+SAT AV G+GFI + ITF NTAG   HQAVALRSGSD SVFY CSF+G
Sbjct  298   NKNNQDGSTTFRSATFAVSGEGFIAKDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKG  357

Query  666   YQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDP  490
             YQDTLYVYS RQFYR+CDIYGTVDFIFGNA VVFQNCNIY R P + + NT+TAQ R+DP
Sbjct  358   YQDTLYVYSQRQFYRDCDIYGTVDFIFGNAVVVFQNCNIYVRKPMSGQKNTVTAQARTDP  417

Query  489   NQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD  322
             N+NTGI IHN +VTAASDL+ V    K+YLGRPW+EYSRTV +KS+LD LIDPAGWLPW 
Sbjct  418   NENTGIIIHNSRVTAASDLRPVQGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGWLPWS  477

Query  321   GNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNV  142
             GNFAL+TLYY EY N+G+GAST +RVKW GYHVIT  T+A KFTVGNF+AG SW+PAT V
Sbjct  478   GNFALSTLYYAEYMNSGSGASTGDRVKWPGYHVITKVTDAGKFTVGNFLAGDSWIPATGV  537

Query  141   PFTSGL  124
             PF SGL
Sbjct  538   PFDSGL  543



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   528 bits (1360),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 289/521 (55%), Positives = 374/521 (72%), Gaps = 18/521 (3%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
              I  F A+ +   +   +   I S C +TP+P  C   +S S     Q K +S F  +A 
Sbjct  4     LITHFFALSLIMVISVATSNPILS-CQETPHPHVCSSVISTS-PLAAQTKTQSGFRNLAL  61

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQ  1300
               A+  A  A +   ++      G  KAAW DCLEL ++ + K++ ++      S  D+Q
Sbjct  62    QAAMDRAARALELVSAMDVSSLDGQAKAAWADCLELCQDTIGKLNRSMS---SPSYDDSQ  118

Query  1299  TWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             TWLS A+ N +TC  GF++LG +  +  LP  TS N+S L+SN+LAINK      +    
Sbjct  119   TWLSAAMANHQTCRNGFIELGSSFPLDSLP-FTSYNISELLSNSLAINKAMAPAKSGGIR  177

Query  1125  gyteG-FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGRYV  952
                   FP+W+   DRKLLQSS+ + AD+VVA+DGSG+Y T++ A+ AA K+S G+ R+V
Sbjct  178   RLLSDGFPNWLSAADRKLLQSSSIN-ADLVVAKDGSGDYDTISAAIAAATKQSSGTSRFV  236

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             I+VKAGVY ENV  G+ +KN+M++GDGI  T++TGS++V  G+TTF SAT AV GDGFI 
Sbjct  237   IHVKAGVYNENV--GTSIKNLMIIGDGIDATVVTGSKNVQDGSTTFSSATFAVTGDGFIA  294

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +G+TF+NTAG   +QAVA RS SDLS +YQCSFEGYQDTLYVYS RQFYR+C+IYGTVDF
Sbjct  295   RGMTFQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTLYVYSQRQFYRDCNIYGTVDF  354

Query  591   IFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK--  421
             IFG+AAVVFQNC++Y R P + + NT+TAQGR+DPN+NTGISIH+  VTAASDLK V+  
Sbjct  355   IFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGS  414

Query  420   --TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
               TYLGRPW++YSRTV+MK+SLDSLIDPAGWL W+G+FAL+TLYYGEY NTGAGA T+ R
Sbjct  415   FQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGAGADTSRR  474

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W GYHVITSA  AS+FTVGNF++GGSW+PAT VP+TS L
Sbjct  475   VNWPGYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTSDL  515



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   528 bits (1361),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 291/550 (53%), Positives = 367/550 (67%), Gaps = 42/550 (8%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSP-TEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS-DFLK  1489
             + I + L IF S+  F   P   I + CSQTPYPQ C +Y++ +  +   ++D+   F  
Sbjct  4     LVILAILTIFTSS--FLVVPIVSITASCSQTPYPQVCSHYITNNLLSTLDVRDQRFAFRD  61

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKA--AWEDCLELYENMVQKIDTTVDPNIKCS  1315
             +A  + +  A  A     S         E+A  AW DCLELYE+ + K++ ++  N   +
Sbjct  62    LALKVTMDQAVKAHRLVSSAVNSKSLYNERAKLAWNDCLELYEDTIDKLNRSMSSN---N  118

Query  1314  TADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSN------NVSYLISNTLAINKGF  1153
               DA TWLS ++ N +TC  GF DL +  + L +   N      ++  L+SN+LAI+K  
Sbjct  119   ALDAITWLSASIANQQTCQNGFNDLNIPNSHLQSSFPNFYKLSTDLPMLLSNSLAIHKES  178

Query  1152  tttn-------------------neattgyteGFPDWVRPGDRKLLQSSAASK-ADIVVA  1033
             +T++                             FP WV   DRKLLQSSA  K ADIVVA
Sbjct  179   STSSSSSSSTSSSAMHFSKQVRGRRLLLKSDAIFPAWVSASDRKLLQSSAGPKSADIVVA  238

Query  1032  QDGSGNYKTVTEAVNAAAKRSGSG--RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKt  859
             QDGSGNYKT+TEAV AA K SGSG  R VIYVKAGVYKENVE+   +K +M VGDG+  T
Sbjct  239   QDGSGNYKTITEAVAAAKKSSGSGTKRVVIYVKAGVYKENVEVKKTMKKLMFVGDGMDAT  298

Query  858   iitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQC  679
             I+TG+++   G+TTF+SAT  V G+GFI Q +TF NTAG   HQAVALRSG+D SVFY+C
Sbjct  299   IVTGNKNAQDGSTTFRSATFGVSGEGFIAQDMTFENTAGPQKHQAVALRSGADHSVFYRC  358

Query  678   SFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQG  502
             SF+GYQDTLYVYS RQFYR+C+IYGTVDFIFG+A+ + QNCNIY R P  N+ NT+TAQ 
Sbjct  359   SFKGYQDTLYVYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKPSSNQINTVTAQS  418

Query  501   RSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGW  334
             R DPN+NTGI IHNC++TAA DL+ V    +TYLGRPW++YSR V MKS+LD LI+P GW
Sbjct  419   RRDPNENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLIEPQGW  478

Query  333   LPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLP  154
              PW G+F L+TLYYGEY NTGAGA+T  RVKW G+ VITSATEA KFTVGNF+AG +WLP
Sbjct  479   FPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLP  538

Query  153   ATNVPFTSGL  124
              T VPF +GL
Sbjct  539   GTGVPFEAGL  548



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   527 bits (1357),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 286/519 (55%), Positives = 367/519 (71%), Gaps = 15/519 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGY--SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNL  1474
             F ++F+   V G   S   I S CSQTPYPQ C   +S       Q + +S F  +    
Sbjct  8     FFSLFLLLVVMGVTGSGDPILS-CSQTPYPQVCSSMVS-GVPLFAQSETQSGFRDLLLQT  65

Query  1473  ALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTW  1294
              L     A  +  ++         KAAW DCLEL+E+ +  ++ ++  +   S  DAQTW
Sbjct  66    TLDRTLLAHKHASAMNLAPLDEPAKAAWADCLELFEDTIGHLNRSLGHS--SSAEDAQTW  123

Query  1293  LSTALTNLETCHAGFVDLGVTGNILPAV-TSNNVSYLISNTLAINKGFtttnneattgyt  1117
             LS A+ N +TC  GF +LG +     ++  +NN+S  +SN+LA+N               
Sbjct  124   LSAAMANQQTCKNGFAELGTSFLFTSSLFMANNISESLSNSLAVNNAMPRGKAPGNRRLL  183

Query  1116  eG-FPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIY  946
                FP WV+  DRKLLQSS+++ KA++VVA+DGSG+YKT++EAV A+AK RSG+ R+VI 
Sbjct  184   SQGFPGWVKAADRKLLQSSSSTIKANLVVAKDGSGDYKTISEAVAASAKLRSGTSRFVIL  243

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VK+G+Y ENV I + +KNIM++GDG+  T++TGS++V  G+TTF+SAT AV G GFI + 
Sbjct  244   VKSGIYNENVVITNSMKNIMMIGDGMDATVVTGSKNVQDGSTTFRSATFAVSGGGFIARD  303

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             +TF+NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR CDIYGTVDFIF
Sbjct  304   MTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIF  363

Query  585   GNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----K  421
             G+A VVFQ+CNIY R P + + NT+TAQGR+D N+NTGISIHN  VTAASDL+ V    K
Sbjct  364   GDAVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTGISIHNSIVTAASDLRPVQGSFK  423

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVK  241
             TYLGRPW++YSRTVFMK+SLDSLI+PAGWL W G+F L+TLYY EY NTGAGA T+ RV 
Sbjct  424   TYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGADTSKRVN  483

Query  240   WGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             W GYHVI S++EASKFTVG F++G SW+PAT VPF+ GL
Sbjct  484   WPGYHVIASSSEASKFTVGGFLSGDSWIPATGVPFSFGL  522



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 276/366 (75%), Positives = 311/366 (85%), Gaps = 13/366 (4%)
 Frame = -3

Query  1206  SNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQ  1030
             SNNV+ L+SNTL++NK            Y EGFP WV+PGDRKLLQSS+ AS+A++VVA+
Sbjct  2     SNNVTKLLSNTLSLNK-----VEYEEPSYKEGFPKWVKPGDRKLLQSSSPASRANVVVAK  56

Query  1029  DGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiit  850
             DGSG Y TV+ AVN+A K S  GRYVIYVK G+Y E VE+  K KNIMLVGDGIGKTIIT
Sbjct  57    DGSGKYTTVSAAVNSAPKNS-RGRYVIYVKGGIYNEQVEV--KSKNIMLVGDGIGKTIIT  113

Query  849   gsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFE  670
             GS+SVGGGTTTF+SATVAVVGDGFI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFE
Sbjct  114   GSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFE  173

Query  669   GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDP  490
             GYQDTLYV+S+RQFYREC+IYGTVDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DP
Sbjct  174   GYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDP  233

Query  489   NQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD  322
             NQNTGISIHN +VTAASDL+     V+TYLGRPWK+YSRTVFMK+ LD LI+P+GW+ W 
Sbjct  234   NQNTGISIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWS  293

Query  321   GNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNV  142
             GNFALNTLYYGEY NTG G+ST  RVKW GY VIT A+EASKF+V NFIAG +WLPAT V
Sbjct  294   GNFALNTLYYGEYMNTGPGSSTGRRVKWPGYRVITRASEASKFSVANFIAGNAWLPATKV  353

Query  141   PFTSGL  124
             P+T  L
Sbjct  354   PYTPSL  359



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   525 bits (1353),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 284/538 (53%), Positives = 366/538 (68%), Gaps = 29/538 (5%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
             F   FL  +    +  +S   I + CSQTP+PQ C +Y++ +  +    + +  F  +  
Sbjct  3     FNAYFLVFYSLLFMLQHSSCRITAPCSQTPHPQVCHHYINTNLLSTLDYQQRFSFRDLVL  62

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGE---KAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
                ++ A  A     SL      G +   K A  DCLELYE+ V K++ ++  +   +  
Sbjct  63    KATMEQAIKAHQLVSSLNLNSLDGDDERAKLACNDCLELYEDTVDKLNRSIGSS---NXF  119

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPA-----VTSNNVSYLISNTLAINK-----  1159
             DA TWLS +L NL+TC  GFVD  ++ + L +       S+N+S ++SN+L+++K     
Sbjct  120   DANTWLSASLANLKTCQNGFVDFNISSSHLQSFPNYVTLSSNLSKMLSNSLSVHKVSTFP  179

Query  1158  -----GFtttnneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTE  997
                           T    +GFP+WV   DR+LLQS S+  KAD++VAQDGSGNYK+++E
Sbjct  180   SALHFSKQVRGRRRTLLSDDGFPEWVSAADRRLLQSGSSGPKADMIVAQDGSGNYKSISE  239

Query  996   AVNAAAK-RSG-SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggt  823
             AVN+A K RSG + R+VI+VKAGVY+ENVEI   +KNIM +GDGI  TI+TG+++   G+
Sbjct  240   AVNSAHKLRSGATKRFVIHVKAGVYRENVEIKKTMKNIMFIGDGIDATIVTGNKNSQDGS  299

Query  822   tTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVY  643
             TT++SAT  V G+GFI Q +TF NTAG   HQAVALRS SD SVFY+CSF+GYQDTLYV+
Sbjct  300   TTYRSATFGVTGEGFIAQDMTFENTAGPQKHQAVALRSSSDHSVFYRCSFKGYQDTLYVH  359

Query  642   SDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISI  466
             S RQFYR+CDI+GTVDFI G+A  V QNCNIYAR P  N+ NTITAQ R+DPN+NTGI I
Sbjct  360   SQRQFYRDCDIHGTVDFICGDATAVLQNCNIYARKPMSNQINTITAQSRTDPNENTGIVI  419

Query  465   HNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTL  298
             HN ++TAA DL+ V    KTYLGRPWK+YSRTV MKS+LD LIDPAGW PW G+FAL+TL
Sbjct  420   HNSRITAAQDLRPVQGSFKTYLGRPWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFALSTL  479

Query  297   YYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YYGEY N+GAGA T  RV W GY VI SATEA KFTVGN +AG SW+P T VPFT+GL
Sbjct  480   YYGEYMNSGAGAGTGGRVNWPGYRVIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTGL  537



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   524 bits (1349),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 285/504 (57%), Positives = 360/504 (71%), Gaps = 37/504 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK-CRSG  1408
             CSQTPYP+ C  +L              D +   +N+A+  A +    T S   +   S 
Sbjct  32    CSQTPYPEACNSFLPTV---------SQDTVSGFRNVAIMAAMDQAQATLSWCPRGSMSS  82

Query  1407  GEKAAWEDCLELYENMVQKIDTT-VDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
               +AAW DCLEL E+ V K++ T V  N+  +++D  TWLS A+TN +TC  GF +    
Sbjct  83    RAQAAWADCLELTEDTVSKLNKTLVSSNL--ASSDTLTWLSAAITNDDTCRTGFSET---  137

Query  1230  GNILPAVTSNNVSYLISNTLAINKGFtt--------tnneattgyteGFPDWVRPGDRKL  1075
                 P + S ++S L+SN+LA+ K F          TN +  +  + GFP+WV  GDR+L
Sbjct  138   ----PWLKSTDLSKLLSNSLAVEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRL  193

Query  1074  LQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK--RSGSGRYVIYVKAGVYKENVEIGSK  901
             LQ+S   KA++VVA+DGSG + T++ A+ A+ K  ++ + R+VIYVK G YKEN+EI   
Sbjct  194   LQASTG-KANLVVAKDGSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKS  252

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
             +KN+M VGDGI KTIITGSR+V  G+TTF+SAT AV  DGFI + +TF NTAG   HQAV
Sbjct  253   MKNLMFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADGFIAKDLTFENTAGPQKHQAV  312

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             A RSGSDLSV Y+CSF+GYQDTLY YS RQFYRECDIYGTVDFIFGNAA V QNCNIY R
Sbjct  313   AFRSGSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGNAAAVLQNCNIYVR  372

Query  540   NP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P  ++ NTITAQGR+DPNQNTG+SIH+ KV+A+SDLK V    KTYLGRPWKEYSRTVF
Sbjct  373   KPMSSQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAVQNSFKTYLGRPWKEYSRTVF  432

Query  375   MKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASK  196
             MK++LD+LIDP+GWL W GNFAL TLYYGEY N+GAGA T +RVKW G+HV+ SA+EA+K
Sbjct  433   MKTALDNLIDPSGWLQWSGNFALRTLYYGEYMNSGAGAVTKSRVKWSGFHVM-SASEAAK  491

Query  195   FTVGNFIAGGSWLPATNVPFTSGL  124
             FTVG+FI+GGSW+P T +P+TSGL
Sbjct  492   FTVGSFISGGSWIPNTGLPYTSGL  515



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   523 bits (1347),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 354/505 (70%), Gaps = 18/505 (4%)
 Frame = -3

Query  1590  SWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRS  1411
             S C+QTPYPQ C ++L+ ++ +    K    F  +A    ++ A  A     ++ +    
Sbjct  12    STCNQTPYPQVCHHFLNTNHLSTLDDKTTVSFHDLALKATMKQAVEAHRLVSTMDSDSFG  71

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
                K+AW+DCLELY++ V  ++ +V+ N K +  D  TWLS +L N  TC  GF D  + 
Sbjct  72    ERGKSAWQDCLELYKDTVDLLNRSVNSNNK-NPLDTHTWLSASLANQHTCRNGFTDFQIP  130

Query  1230  GNI--LPAVTSNNVSYLISNTLAINKGFtttnneattgyteG-------FPDWVRPGDRK  1078
              +    P++ SN  S L+SN+LAINK    +   + +            FP+WV   DRK
Sbjct  131   SHYDSFPSMLSN-FSKLLSNSLAINKATIPSTATSFSKQVRSRRLLSDGFPEWVSAADRK  189

Query  1077  LLQSS-AASKADIVVAQDGSGNYKTVTEAVNAAAKRSG-SGRYVIYVKAGVYKENVEIGS  904
             LLQS  AA+KADIVVAQDGSG +KT++EAV AA    G S R V+YVKAGVYKENVEI +
Sbjct  190   LLQSGGAAAKADIVVAQDGSGGFKTISEAVEAAKNLGGGSKRIVVYVKAGVYKENVEIKN  249

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +KN+M VGDGI  TI+TG+R+   G+TTF+SAT  V GDGFI Q +TF NTAG A HQA
Sbjct  250   DIKNLMFVGDGIDATIVTGNRNNVDGSTTFQSATFGVSGDGFIAQDMTFENTAGPAKHQA  309

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRSGSD SVF++CSF+GYQDTLYVYS RQFYR+C++YGTVDFI G+A  + QNCNI  
Sbjct  310   VALRSGSDHSVFHRCSFKGYQDTLYVYSQRQFYRDCNVYGTVDFICGDAVAILQNCNILV  369

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK----TYLGRPWKEYSRTV  379
             R P  ++ NT+T+Q R+DPN+NTGI IHN ++TA+SDL+ V+    TYLGRPW++YSRTV
Sbjct  370   RKPMSDQRNTVTSQARTDPNENTGIIIHNSRITASSDLRPVQGSFETYLGRPWQKYSRTV  429

Query  378   FMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
              MKSSLD LIDP GWLPW GNFAL+TLYY E+ N+GAGA+T  RV W GYHV+TSA EA 
Sbjct  430   IMKSSLDGLIDPKGWLPWSGNFALSTLYYAEFMNSGAGAATGGRVSWPGYHVLTSAAEAG  489

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             KFTVGNF+ G SW+PAT VPF +GL
Sbjct  490   KFTVGNFLGGDSWIPATGVPFAAGL  514



>ref|XP_002510939.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51541.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=526

 Score =   521 bits (1342),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 279/506 (55%), Positives = 348/506 (69%), Gaps = 17/506 (3%)
 Frame = -3

Query  1608  SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSL  1429
             S T +  WCSQTP+P+ C+Y++         +K +S+F K+   +AL+ A +A+     L
Sbjct  27    SKTNVTWWCSQTPHPETCKYFIGHRLQRVA-LKHRSEFRKITVQVALERALSAQKKVSKL  85

Query  1428  GTKCRSGGEKAAWEDCLELYENMVQKIDTTVD-----PNIKCSTADAQTWLSTALTNLET  1264
               KC+   ++A W DC +L+ + + +++ T+          C+  DAQTWLSTALTN++T
Sbjct  86    RPKCQDHHQRAVWVDCHKLHSDTIVQLNRTLQGLAAKKKKSCTDFDAQTWLSTALTNIQT  145

Query  1263  CHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGD  1084
             C  G +D  V+  I+P V+SN +S LISN LAIN       +         FP W    +
Sbjct  146   CRTGSLDFNVSDFIMPIVSSN-LSKLISNGLAIN---GVLLSVQNNSIEGLFPRWFSRKE  201

Query  1083  RKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             R+LLQ+ +  KA++VVAQDGSG+++TV  A+NAAAKR    R+VI+VK GVY+EN+E+G 
Sbjct  202   RRLLQAPSI-KANLVVAQDGSGHFRTVQAAINAAAKRRYGTRFVIHVKKGVYRENIEVGI  260

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
                NI LVGDG+  TIIT  RSVG G TT+ SAT  + G  F+ +GITFRNTAG    QA
Sbjct  261   NNNNIWLVGDGLRNTIITSGRSVGAGYTTYSSATAGIDGLRFVARGITFRNTAGPLKGQA  320

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY+CSFEGYQDTL+V+S RQFYREC +YGT+DFIFGNAAVVFQNC IY 
Sbjct  321   VALRSASDLSVFYRCSFEGYQDTLFVHSQRQFYRECYVYGTIDFIFGNAAVVFQNCIIYV  380

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTV  379
             R P   + N ITAQGR+DP QNTGISIHN ++  A DLK     V+TYLGRPW +YSRTV
Sbjct  381   RRPLKGQANMITAQGRNDPFQNTGISIHNSRILPAPDLKPVVRAVQTYLGRPWMQYSRTV  440

Query  378   FMKSSLDSLIDPAGWLPWDG-NFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
              +KS +DS I PAGW  W G NFALNTLYY EY N G G+ST  RVKW GYHVITS+T A
Sbjct  441   VLKSYIDSFIHPAGWSQWQGSNFALNTLYYAEYKNFGPGSSTRRRVKWKGYHVITSSTVA  500

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S FTVG  IAG SWLPAT VPF SGL
Sbjct  501   SSFTVGRLIAGQSWLPATGVPFISGL  526



>ref|XP_006490218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Citrus sinensis]
Length=528

 Score =   520 bits (1339),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 277/506 (55%), Positives = 360/506 (71%), Gaps = 16/506 (3%)
 Frame = -3

Query  1608  SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSL  1429
             S T I  WCS+TP+P+PC+Y+LSRS+      K +SDF K+   +A++ A  A +     
Sbjct  28    SATNITWWCSKTPHPEPCKYFLSRSHHRY-TFKHRSDFRKIIVQVAIEQAHKAHEQLMEF  86

Query  1428  GTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTADAQTWLSTALTNLETCH  1258
             GT C +  +KAAW DC++LY N V +++ T+     +  C+  DAQTWLSTALTN+ TC 
Sbjct  87    GTNCENKHQKAAWSDCVKLYANTVLQLNRTLQGLKSDRSCTDFDAQTWLSTALTNIRTCQ  146

Query  1257  AGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRK  1078
             +G+++L V+  I P V SNN+S LISN+LA+N             YT GFP W+   +R 
Sbjct  147   SGYMELNVSDFITP-VMSNNLSQLISNSLAVN---GVLLKSENVTYTNGFPSWLSGHERN  202

Query  1077  LLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             LL+SS+  ++A++VVA DGSGNY+T+  A+NAAA R GSGR++I+VK GVY+EN+E+G  
Sbjct  203   LLESSSLEARANLVVATDGSGNYRTIQAAINAAAGRRGSGRFIIHVKRGVYRENIEVGLN  262

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVG+G+  TIIT  RSVG G+TT+ SAT  + G  F+ + ITF+NTAG    QAV
Sbjct  263   NNNIMLVGEGMRNTIITSGRSVGSGSTTYSSATAGIDGLHFMARDITFQNTAGPLKGQAV  322

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ALRS SDLSVFY+C+F+GYQDTL V+S RQFY++C IYGT+DFIFGNAAVVFQNC I+ R
Sbjct  323   ALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYKKCCIYGTIDFIFGNAAVVFQNCIIFVR  382

Query  540   NP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P   + N ITAQGR+DP QNT ISIH+ +V  A+DLK V    K+YLGRPW++YSRTV 
Sbjct  383   KPLKGQANVITAQGRNDPFQNTAISIHSSRVLPANDLKPVVRNFKSYLGRPWQQYSRTVI  442

Query  375   MKSSLDSLIDPAGWLPWD--GNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             +K+ +D  + P GW  W    NFAL+TL+YGEY N G G+ST +RVKW G+HVITS   A
Sbjct  443   LKTYIDGFVSPLGWSTWSPGNNFALDTLFYGEYKNYGPGSSTRHRVKWRGFHVITSPNVA  502

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S+FTVG+ IAG SWLPAT VPF  GL
Sbjct  503   SQFTVGSLIAGRSWLPATGVPFILGL  528



>ref|XP_011038599.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=531

 Score =   519 bits (1336),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 282/511 (55%), Positives = 353/511 (69%), Gaps = 34/511 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGG---QIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCR  1414
             C QTP+P+ C Y++  + S       ++D+S  L +  N A++    A     S+     
Sbjct  31    CDQTPFPEACNYFIDTNISKTPPLFALRDQS--LLITMNKAIE----AHQMVSSMELSSF  84

Query  1413  SGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGV  1234
             +   K AW+DCL+LYE+ V  ++ ++  N   + AD+QTWLS A+ N  TC  GF+D  +
Sbjct  85    NQQAKLAWDDCLKLYEDTVDHVNRSMSSN---NLADSQTWLSAAIANQRTCENGFIDFNI  141

Query  1233  TG--NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG---------FPDWVRPG  1087
                   LP +   N + L+SNTL++NK   ++         +G         FP WV   
Sbjct  142   VSYLEFLPNML-RNFTKLLSNTLSLNKAIISSPPILLDTKQDGGRRRLLVDGFPSWVPAS  200

Query  1086  DRKLLQSS--AASKADIVVAQDGSGNYKTVTEAVNAAAK-RSG--SGRYVIYVKAGVYKE  922
             DRKLLQS+  AA  ADIVVAQDGSG+YKT++EA+ A+AK R G  S R+VIYVK GVYKE
Sbjct  201   DRKLLQSNGRAAPMADIVVAQDGSGDYKTISEALAASAKLRRGTRSKRFVIYVKRGVYKE  260

Query  921   NVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAG  742
             NVEI   +KN+M VGDGI  T+IT +++   GTTTF+SATV V G GFI + +TF NTAG
Sbjct  261   NVEIKKSMKNLMFVGDGIDATVITSNKNTQDGTTTFRSATVGVSGKGFIARDMTFENTAG  320

Query  741   AANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQ  562
                HQAVALRSGSD SVFY CSF+GYQDTLYV+S RQFYR+CDIYGTVDFIFG+A  V Q
Sbjct  321   PQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQRQFYRDCDIYGTVDFIFGDAVAVLQ  380

Query  561   NCNIYARNPPNKT-NTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWK  397
             NCNIY R P +K  NT+TAQGR+DP +NTGI IHN +V AASDL+ V    K+YLGRPWK
Sbjct  381   NCNIYVRRPMSKQENTVTAQGRTDPGENTGIVIHNSRVMAASDLRPVQGLFKSYLGRPWK  440

Query  396   EYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVIT  217
             +YSRTVF+KS++D LIDPAGWLPW G+FAL+TLYYGEY +TG+GAST  RVKW GYH IT
Sbjct  441   KYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYYGEYMSTGSGASTKGRVKWPGYHTIT  500

Query  216   SATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             S  EA KFTV NF+AG SW+ A  VPF +GL
Sbjct  501   SPLEAGKFTVENFLAGNSWISAAGVPFEAGL  531



>gb|EYU33116.1| hypothetical protein MIMGU_mgv1a022674mg [Erythranthe guttata]
Length=521

 Score =   517 bits (1332),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 276/498 (55%), Positives = 356/498 (71%), Gaps = 19/498 (4%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA--KDNTYSLGTKCRS  1411
             C+QTPYP+ C    +         +  + F  V+    L  A+NA  K +   L +    
Sbjct  32    CTQTPYPELCNSLTTSPTPQSTFDESLTLFRDVSLRATLLQAENAHKKISDMDLSSLFND  91

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
                K A  DCL+LYE+ + +++ +    I  S  DAQTWLS+++ N + C  GF+D  ++
Sbjct  92    DLSKLASVDCLDLYEDTIYQLNRS----IFGSKNDAQTWLSSSIANEQACRNGFLDFNLS  147

Query  1230  GNILPAVTSNNVSYLISNTLAINKGFtttnneattg-------yteGFPDWVRPGDRKLL  1072
              +++  + S++ S  +SN+LAINK   + ++  T          T  FP+WV  GDR+LL
Sbjct  148   FSMM--LMSDDFSKYLSNSLAINKATASASSYTTKQKRNRRLLSTVDFPEWVSHGDRRLL  205

Query  1071  QSSAASKADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLK  895
             QSS  +K DIVVAQDGSGNYKT+ EA+ AA K RSG+ R+VIYVK GVYKENVE+   +K
Sbjct  206   QSS--TKGDIVVAQDGSGNYKTINEALAAAEKQRSGTRRFVIYVKKGVYKENVEVKRSMK  263

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             N+M +GDGI  T++TGS++V  G+TTF+SAT AV GDGFI + +TF NTAG   HQAVAL
Sbjct  264   NLMFIGDGIDSTVVTGSKNVQDGSTTFRSATFAVTGDGFIARDMTFENTAGPQKHQAVAL  323

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSD SVFY+CSF+GYQDTLYVYS RQFYR+CD+YGT+DFIFG+A  V QN NIY R P
Sbjct  324   RSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCDVYGTIDFIFGDAVSVIQNSNIYIRKP  383

Query  534   -PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLGRPWKEYSRTVFMKSSLD  358
               N+ NT+TAQGR DPN+NTGI IHN +VT+AS      +YLGRPW++YSRTVFMK ++D
Sbjct  384   MSNQKNTVTAQGRKDPNENTGIVIHNSRVTSASGSGSGPSYLGRPWQQYSRTVFMKCAID  443

Query  357   SLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNF  178
              +I+PAGWLPW G+FAL+TLYYGEY NTG+GAST  RVKW G+HVITSA EA KF+VGNF
Sbjct  444   GIIEPAGWLPWSGSFALSTLYYGEYMNTGSGASTGGRVKWPGFHVITSAAEAGKFSVGNF  503

Query  177   IAGGSWLPATNVPFTSGL  124
             +AGGSW+PAT VP+TSG+
Sbjct  504   LAGGSWIPATGVPYTSGV  521



>ref|XP_006421696.1| hypothetical protein CICLE_v10004719mg [Citrus clementina]
 gb|ESR34936.1| hypothetical protein CICLE_v10004719mg [Citrus clementina]
Length=528

 Score =   516 bits (1329),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 285/527 (54%), Positives = 370/527 (70%), Gaps = 23/527 (4%)
 Frame = -3

Query  1650  SFLAIFVSTAVFGY-------SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             S L IF+S +   Y       S T I  WCS+TP+P+PC Y+LSRS+ +    K +SDF 
Sbjct  7     SLLIIFISLSSIFYHALSRRPSATNITWWCSKTPHPEPCNYFLSRSH-HRYTFKHRSDFR  65

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIK  1321
             K+   +A++ A  A D     GT C +  +KAAW DC++LY N V +++ T+     +  
Sbjct  66    KIIVQVAIEQAHKAHDQVMEFGTNCENKHQKAAWSDCVKLYANTVLQLNRTLQGLKSDRS  125

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttn  1141
             C+  DAQTWLSTALTN+ TC +G+++L V+  I P V SNN+S LISN+LA+N       
Sbjct  126   CTDFDAQTWLSTALTNIRTCQSGYMELNVSDFITP-VMSNNLSQLISNSLAVN---GVLL  181

Query  1140  neattgyteGFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                   YT GFP W+   +R LL+SS+  ++A++VVA DGSGNY+T+  A+NAAA+R GS
Sbjct  182   KRENVTYTNGFPSWLSGHERNLLESSSLEARANLVVATDGSGNYRTIQAAINAAARRRGS  241

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
             GR++I+VK GVY+EN+E+G    NIMLVG+G+  TIIT  +SVG G+TT+ SAT  + G 
Sbjct  242   GRFIIHVKRGVYRENIEVGLNNNNIMLVGEGMRNTIITSGQSVGSGSTTYSSATAGIDGL  301

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
              F+G+ ITF+NTAG    QAVALRS SDLSVFY+C+F+GYQDTL V+S RQFY++C IYG
Sbjct  302   HFMGRDITFQNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYKKCYIYG  361

Query  603   TVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  427
             T+DFIFGNAAVVFQNC I+ R P   + N ITAQGR+DP QNT ISIH+ +V  A+DLK 
Sbjct  362   TIDFIFGNAAVVFQNCIIFVRKPLKGQANVITAQGRNDPFQNTAISIHSSRVLPANDLKP  421

Query  426   V----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD--GNFALNTLYYGEYSNTGAG  265
             V    KTYLGRPW++YSRTV +K+ +D  + P GW  W    NFAL+TL+YGEY N G G
Sbjct  422   VVRNFKTYLGRPWQQYSRTVILKTYIDGFVSPLGWSTWSPGNNFALDTLFYGEYENYGPG  481

Query  264   ASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +ST +RVKW G+HVITS   AS+FTVG+ IAG SWLPAT VPF  GL
Sbjct  482   SSTRHRVKWRGFHVITSPKVASQFTVGSLIAGRSWLPATGVPFILGL  528



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   515 bits (1326),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 291/533 (55%), Positives = 368/533 (69%), Gaps = 34/533 (6%)
 Frame = -3

Query  1656  ICSFLAIFVSTA-VFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
             +  F  + +S A V G   +E  S+CSQTPYP+ CE +++RS         +  F +   
Sbjct  12    VLGFAVVSISLALVIGVVNSETTSFCSQTPYPETCESFMARSRPL--VTLTQFSFRETTL  69

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKA--AWEDCLELYENMVQKIDTTV----DPNIKC  1318
             NL L  A  A     ++  +  S GE+A  AW DC+ELY + + +++ TV    +P    
Sbjct  70    NLTLDQALRAHGLISAM--ELSSFGERAKVAWADCVELYADTITQLNRTVLVTQNP---L  124

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFttt  1144
             +  +AQTWLS A+ N +TC  GF+DL ++  +   P + SN  S ++SN+LAINK    +
Sbjct  125   AWWNAQTWLSAAIANEQTCQNGFLDLNMSSYLSSFPYMLSN-FSKMVSNSLAINKASVLS  183

Query  1143  nnea-------ttgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVN  988
                            ++GFP WV   DRKLLQS  AA +AD+VVA DGSGNYKT+++AV 
Sbjct  184   AASLLGKQGGNRRLLSDGFPTWVSAADRKLLQSPGAALRADVVVAADGSGNYKTISQAV-  242

Query  987   AAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKS  808
             AAA   GS R+VIYVK GVYKE VEI  K  NIML+GDGI  T++TGS+S+    T+F+S
Sbjct  243   AAAPGGGSKRFVIYVKRGVYKETVEI--KAPNIMLIGDGIDVTVVTGSKSIQDAGTSFRS  300

Query  807   ATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQF  628
             ATV + G+GFI + +TF NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYV+S+RQF
Sbjct  301   ATVGITGNGFIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVHSNRQF  360

Query  627   YRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKV  451
             YR CDIYGTVDFI+G+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN  V
Sbjct  361   YRNCDIYGTVDFIWGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSLV  420

Query  450   TAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEY  283
             TA SDLK V    KTYLGRPW++YSRTVFMK+SLDSLIDP GWL W GNFAL+TLYYGE+
Sbjct  421   TATSDLKAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPEGWLEWSGNFALSTLYYGEF  480

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NTG GAST+ RVKW G+HV+  A +A KFTV +F+ G SW+ A  VPFT GL
Sbjct  481   LNTGPGASTSGRVKWAGFHVMNKA-DAQKFTVESFLGGSSWIAAAGVPFTPGL  532



>ref|XP_004503381.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cicer arietinum]
Length=546

 Score =   515 bits (1327),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 274/555 (49%), Positives = 369/555 (66%), Gaps = 41/555 (7%)
 Frame = -3

Query  1698  NLLITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGG  1519
             N+  + M  L   F  ++  IF    V G   +     C+QTPYP  C +Y+  + +N  
Sbjct  3     NIPFSHMDKLSINFCIAYFLIFSLLFVHGKELS-----CNQTPYPHVCNHYIGTTTTNTL  57

Query  1518  QIKDKSDFLKVAKNLALQYAKNAKD--NTYSLGTKCRSGGEKAAWEDCLELYENMVQKID  1345
                D S F  +A  + ++ A  A    +T  L    +    K+AWEDCLELYE+ + ++ 
Sbjct  58    STLDSSSFHDMALKVTMEQAIEAHKLVSTMELNNNFKDKRAKSAWEDCLELYEDTIYQLK  117

Query  1344  TTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG--NILPAVTSNNVSYLISNTL  1171
              +++ N   +  D  TW S ++TN +TC  GF+D  +    N  P++ SN  S L+SN+L
Sbjct  118   RSINSN---NINDKLTWQSASITNHQTCQNGFIDFNLPSQLNYFPSMLSN-FSKLLSNSL  173

Query  1170  AINKGFtttnnea---------------------ttgyteGFPDWVRPGDRKLLQSSAAS  1054
             +I     ++++                           ++GFP+WV   DRKLLQ +   
Sbjct  174   SITNTIASSSHSLSSTSTSSSSSSSSSTNKQNGGRRLLSDGFPNWVSFSDRKLLQETI--  231

Query  1053  KADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGD  874
             +ADIVVAQDGSGNYKT++E V AAAK  G GR V+YVK GVYKENV++   +KN+M+VGD
Sbjct  232   EADIVVAQDGSGNYKTISEGVAAAAKLRGKGRVVVYVKRGVYKENVDVKKTVKNLMIVGD  291

Query  873   GIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLS  694
             G+  TIIT + +   G TTF+SAT  ++GDGFI + +TF NTAG  NHQAVALRSG+D S
Sbjct  292   GMDSTIITSNHNAQHGYTTFRSATFGIMGDGFIAKDMTFENTAGPQNHQAVALRSGADYS  351

Query  693   VFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNT  517
             VFY+C+F+GYQDTLYVY+ RQFYR+C+IYGTVDFIFGNA  V QNCNI+ R P  N+ NT
Sbjct  352   VFYRCAFKGYQDTLYVYAQRQFYRDCNIYGTVDFIFGNAVTVLQNCNIFVRKPMGNQQNT  411

Query  516   ITAQGRSDPNQNTGISIHNCKVTAASDLK----GVKTYLGRPWKEYSRTVFMKSSLDSLI  349
             +TAQ R+DPN+NTGI IHNC++TA++DLK     VKT+LGRPW++YSRTV MKS+LD LI
Sbjct  412   VTAQARTDPNENTGIIIHNCRITASNDLKPVQNSVKTFLGRPWQKYSRTVVMKSNLDGLI  471

Query  348   DPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAG  169
             +P GW  W+G FAL+TLYYGEY N GAGA+T  RV+W G+H+IT ++EA+KF+V NF+AG
Sbjct  472   NPKGWSVWNGGFALSTLYYGEYMNIGAGANTGGRVQWPGFHLITQSSEAAKFSVSNFLAG  531

Query  168   GSWLPATNVPFTSGL  124
             GSW+ +T VPF +GL
Sbjct  532   GSWISSTGVPFDAGL  546



>ref|XP_009402517.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   514 bits (1325),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 277/506 (55%), Positives = 349/506 (69%), Gaps = 21/506 (4%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQI---KDKSDFLKVAKNLALQYAKNAKDNTYSL  1429
             +I  WCS  P+P+PC YYL     N   +   KD + F +V+  LA      A+      
Sbjct  29    DIDYWCSNMPHPEPCRYYLG----NNPHVEIPKDTAQFYQVSLRLAFDLTVRAQSQLKRR  84

Query  1428  GTKCRSGGEKAAWEDCLELYENMVQKIDTTVD-PNIKCSTADAQTWLSTALTNLETCHAG  1252
             G  CR   E+ AW DC +LY+N V +++ T+D P+  C+  D+QTWLS ALTNL+TC  G
Sbjct  85    GPACRQARERTAWLDCWKLYDNTVLQLNRTLDAPHGACTAFDSQTWLSAALTNLQTCLTG  144

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG--FPDWVRPGDRK  1078
             F D G +  I+  VT  NVS LISN LAIN+          +  T+      W+   +R+
Sbjct  145   FNDTGTSSEIIEPVTRYNVSDLISNCLAINRPAAAAAATNVSTTTDRGRVSSWMMIANRR  204

Query  1077  LLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR---YVIYVKAGVYKENVEIG  907
             LLQ SA+  AD+VVA+DGSGN++T+ EA++AAA R  SGR   +VIYVKAGVY E V++ 
Sbjct  205   LLQLSAS--ADLVVAKDGSGNFRTIKEALDAAAARMQSGRLSKFVIYVKAGVYNEYVQVT  262

Query  906   SKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQ  727
             S L N++++GDGIGKTIITG+RSV  G TT  SAT +V GDGF   GITFRNT G  + Q
Sbjct  263   SSLSNLVMLGDGIGKTIITGNRSVASGYTTLSSATFSVFGDGFKASGITFRNTFGPGS-Q  321

Query  726   AVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIY  547
             AVAL S SDLSV+Y+CS EGYQDTL+VYS RQFYRECDI+GT+DFIFGNAAVV Q CNIY
Sbjct  322   AVALLSASDLSVYYRCSIEGYQDTLFVYSQRQFYRECDIHGTIDFIFGNAAVVLQRCNIY  381

Query  546   ARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSRT  382
             AR P + ++N ITAQGRSDPNQNTGI I    +  A++L    K V++YLGRPW +YSRT
Sbjct  382   ARRPRHGESNVITAQGRSDPNQNTGIVIQFSNIEPAAELLPVRKTVRSYLGRPWMQYSRT  441

Query  381   VFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             +F++S +D +IDPAGWLP++GNFALNTLYYGE+ NTG G+  + RVKW GYHVI   +  
Sbjct  442   LFLQSYIDGIIDPAGWLPFNGNFALNTLYYGEFENTGPGSRMSKRVKWPGYHVIQRRSIV  501

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
               FTVG FIAG SW+P+T VPF   L
Sbjct  502   RPFTVGRFIAGRSWIPSTGVPFDPSL  527



>ref|XP_008234390.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60 
[Prunus mume]
Length=528

 Score =   514 bits (1324),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 283/526 (54%), Positives = 358/526 (68%), Gaps = 23/526 (4%)
 Frame = -3

Query  1647  FLAIFVSTAVF-------GYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
              L+I + + +F        +    I++WC +TP+P+PC Y +S S  +    K  S+F K
Sbjct  8     LLSILIFSFIFQTALSRSHHHSNRIRTWCQKTPHPEPCNYCMSHS-RHRLVPKHTSEFRK  66

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKC  1318
             +   +AL+ A NAK      G  C++  +KAAW DCL+L+E+ V +++ T+D       C
Sbjct  67    MMVQVALERALNAKSYASQFGQNCQNNQQKAAWADCLKLFEDTVHQLNITLDGLGTKRNC  126

Query  1317  ST-ADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNN-VSYLISNTLAINKGFttt  1144
             S   DAQTWLS ALTN+ TC  G ++L V+  I P  TSNN VS LISN LAI      T
Sbjct  127   SNFDDAQTWLSAALTNIHTCQVGSMELNVSDFIAPIYTSNNNVSELISNGLAIGSQLLGT  186

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
                        +P+WV   +R+LLQ+S   KA++VVA+DGSG+++TV  A++AAAKR  +
Sbjct  187   EENYADEE---YPNWVSKHERRLLQASKI-KANLVVAKDGSGHFRTVQAAIDAAAKRKIT  242

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R++IYVK GVY+EN+E+ +   NIML+G  +  TIIT SRSV GG+TT+ SAT  + G 
Sbjct  243   SRFIIYVKKGVYRENIEVSNTNNNIMLIGASMRYTIITASRSVNGGSTTYNSATAGIDGP  302

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
             GFI +GITF NTAG    QAVALRS SDLSVFY+C+F+GYQDTL V+S RQFYREC IYG
Sbjct  303   GFIARGITFSNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFYRECYIYG  362

Query  603   TVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  427
             T+DFIFGNAA VFQ+C IY R P   + N ITAQ R+DP QNT ISIHN +V AA+DLK 
Sbjct  363   TIDFIFGNAAAVFQSCIIYVRRPLKGQVNVITAQARNDPYQNTAISIHNSQVRAAADLKP  422

Query  426   V----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEYSNTGAGA  262
             V    KTYLGRPW +YSR VFMK  LDSL++P GWL W   NFAL+TLYY EY N G  +
Sbjct  423   VVTAFKTYLGRPWMQYSRVVFMKCYLDSLVNPVGWLEWQRSNFALSTLYYAEYKNFGPAS  482

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ST  RVKW G+HVITSA  ASKFTV + IAG SWLPAT VP+T+GL
Sbjct  483   STRYRVKWPGFHVITSANVASKFTVSSLIAGRSWLPATGVPYTAGL  528



>gb|KHN35616.1| Pectinesterase 2 [Glycine soja]
Length=358

 Score =   507 bits (1306),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 307/364 (84%), Gaps = 10/364 (3%)
 Frame = -3

Query  1206  SNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQ  1030
             SNNV+ L+SNTL++NKG           Y EGFP WV+PGDRKLLQSS AASKA++VVA+
Sbjct  2     SNNVTKLLSNTLSLNKG---PYQYKPPSYKEGFPTWVKPGDRKLLQSSSAASKANVVVAK  58

Query  1029  DGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiit  850
             DGSG Y TV  AV+AA   S SGRYVIYVK GVY E VE+  K  NIMLVGDGIGKTIIT
Sbjct  59    DGSGKYTTVKAAVDAAP--SSSGRYVIYVKGGVYNEQVEV--KANNIMLVGDGIGKTIIT  114

Query  849   gsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFE  670
             GS+SVGGGTTTF+SATVA VGDGFI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFE
Sbjct  115   GSKSVGGGTTTFRSATVAAVGDGFIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFE  174

Query  669   GYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDP  490
             G+QDTLYV+S+RQFYRECDIYGTVDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DP
Sbjct  175   GFQDTLYVHSERQFYRECDIYGTVDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDP  234

Query  489   NQNTGISIHNCKVTAASDL--KGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGN  316
             NQNTGI IHN KVT AS      VK+YLGRPW++YSRTVFMK+ LDSLI+PAGW+ WDGN
Sbjct  235   NQNTGIIIHNSKVTGASGFNPSSVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGN  294

Query  315   FALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  136
             FAL+TLYY EY+NTG G++TANRV W GYHV+TSA+EAS FTVGNFIAG +W+P++ VPF
Sbjct  295   FALDTLYYAEYANTGPGSNTANRVTWKGYHVLTSASEASPFTVGNFIAGSNWIPSSGVPF  354

Query  135   TSGL  124
             TSGL
Sbjct  355   TSGL  358



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   513 bits (1320),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 350/535 (65%), Gaps = 28/535 (5%)
 Frame = -3

Query  1689  ITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIK  1510
             + K+  L  IFI  F    ++  V G + T     CSQTPYP+ C Y++  S       +
Sbjct  1     MDKLNVLAVIFIAHFFIFPLAYFVHGATITS----CSQTPYPEVCNYFMGNSIVAASLDQ  56

Query  1509  DKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDP  1330
              +  F  +   + L  A  A     ++         K AW DCLELYEN V  ++ +   
Sbjct  57    TQFSFRDLVIQVTLNQAVRAHRLVSTMDLSSFDERAKLAWNDCLELYENTVNHLNHSKST  116

Query  1329  NIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKG  1156
             N   +  DAQTWLS A+ N +TC  GF+D  +  ++   P++  N  S L+SN+LAINK 
Sbjct  117   N---NPMDAQTWLSAAIANQQTCQNGFIDFNLASHLQTFPSMLGN-FSKLLSNSLAINKA  172

Query  1155  Ftttnneattg-----yteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEA  994
               T+++ A           GFP W+   DRKLLQ + A  KADIVVAQDGSGN+K+++EA
Sbjct  173   TVTSSSTAKQVGNRRLLAHGFPAWLSAADRKLLQKTGAPPKADIVVAQDGSGNFKSISEA  232

Query  993   VNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTF  814
             V AA    G  R VIYVKAGVY+ENV I  K  NIML+GDG+    +         TTTF
Sbjct  233   VAAAG---GGKRTVIYVKAGVYRENVNI--KKSNIMLIGDGM-DATVVTGSKSAQTTTTF  286

Query  813   KSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDR  634
              SATV V GD F+ + ITF N+AG   HQAVA RSGSD SV Y+CSF+GYQDTLYVYS R
Sbjct  287   SSATVGVAGDRFVARDITFDNSAGPQKHQAVAFRSGSDHSVIYRCSFKGYQDTLYVYSQR  346

Query  633   QFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNC  457
             QFYR+CDIYGT+DFIFG+A  V QNCNIY R P  N+ NT+TAQGR+D N+NTGI IHN 
Sbjct  347   QFYRDCDIYGTLDFIFGDAVAVLQNCNIYIRKPMSNQRNTVTAQGRTDANENTGIIIHNS  406

Query  456   KVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYG  289
             +VTA+SDL+GV    K+YLGRPW++YSRTVFMKS LD +I   GWLPW G+FAL+TLYY 
Sbjct  407   RVTASSDLRGVQGSFKSYLGRPWQKYSRTVFMKSVLDGVITAEGWLPWSGSFALSTLYYA  466

Query  288   EYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             E+ NTGAGA T+ RVKWGGYHVI SA EA KFTVGNF+AG +W+P T VPF +GL
Sbjct  467   EHMNTGAGADTSGRVKWGGYHVI-SAAEAGKFTVGNFLAGDAWIPGTGVPFDAGL  520



>gb|KDP22413.1| hypothetical protein JCGZ_26244 [Jatropha curcas]
Length=531

 Score =   512 bits (1319),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 268/500 (54%), Positives = 351/500 (70%), Gaps = 16/500 (3%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             WC++TPYP+PC Y+++R       +K +S+F K+   +AL+ +  A+   + L  KC++ 
Sbjct  36    WCNKTPYPEPCNYFMNRRQHRHSALKHRSEFRKIMVEIALERSLTAQRKVFKLRPKCQNH  95

Query  1407  GEKAAWEDCLELYENMVQKIDTTVD-----PNIKCSTADAQTWLSTALTNLETCHAGFVD  1243
              ++A W DC +L+ + + +++ T+          C+  DAQTWLSTALTN+ TC  G +D
Sbjct  96    QQRAVWADCYKLHADTILQLNRTLQGLQSKKKKSCTNFDAQTWLSTALTNIGTCRTGSLD  155

Query  1242  LGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSS  1063
             L V+  I+P + S+N+S LISN+LA+              YT+GFP W+   +R+LLQSS
Sbjct  156   LNVSDFIMP-IMSHNLSELISNSLALT---GVLLAVEDNNYTQGFPKWIAMNERRLLQSS  211

Query  1062  A-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIM  886
             + A+KA++VVAQDGSGN++++  A+N AAKR    R++I+VK GVY+EN+E+G    NI 
Sbjct  212   SVAAKANLVVAQDGSGNFRSIQAAINVAAKRRYKTRFIIHVKRGVYRENIEVGVNNNNIW  271

Query  885   LVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSG  706
             L+GDG+  TIIT SRSVG G TT+ SAT  + G  F+ +GITF NTAG    QAVALRS 
Sbjct  272   LIGDGMRNTIITSSRSVGAGYTTYSSATAGIDGLRFVARGITFSNTAGPLKGQAVALRSA  331

Query  705   SDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PN  529
             SDLSVFY+CSF+GYQDTL+V+S RQFY+EC IYGT+DFIFGNAAVVFQNC IY R P   
Sbjct  332   SDLSVFYRCSFQGYQDTLFVHSQRQFYKECYIYGTIDFIFGNAAVVFQNCIIYVRKPLKG  391

Query  528   KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSL  361
             + N ITAQGR+DP QNTGISIHN ++  A DLK V    +TYLGRPW +YSRTV +K+ +
Sbjct  392   QANMITAQGRNDPYQNTGISIHNSQILPAPDLKPVVRSFQTYLGRPWMQYSRTVILKTYI  451

Query  360   DSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVG  184
             D  I+PAGW  W D +FAL+TLY+ EY N+G G+ST  RVKW GYHVITS   AS FTV 
Sbjct  452   DGFINPAGWSKWLDSDFALDTLYFAEYKNSGPGSSTRQRVKWKGYHVITSNIVASSFTVA  511

Query  183   NFIAGGSWLPATNVPFTSGL  124
               IAG SWLP T VPF SGL
Sbjct  512   RLIAGQSWLPGTGVPFISGL  531



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   511 bits (1317),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 272/501 (54%), Positives = 348/501 (69%), Gaps = 16/501 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             +K WC +TP+P+ C   + +S S     K K++   +    A+  A  A+ +       C
Sbjct  26    VKRWCIRTPHPESCTQLMGQSPSP----KSKANLHHMVVKAAMDRALQAQADNLKHSKSC  81

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLG  1237
              +  E+ AW DC ELY+  +  ++ T+    + +  D QTWLS +LTNLETC  GF+DL 
Sbjct  82    TNKLERVAWSDCFELYKATIVHLNRTLRSPTR-TELDTQTWLSASLTNLETCTNGFIDLD  140

Query  1236  VTGNILPAVTSNNVSYLISNTLAINKGFtt---tnneattgyteGFPDWVRPGDRKLLQS  1066
             V   I PA  + NVS LI N LAINK  ++             + FP WV  GD++ LQ+
Sbjct  141   VQAQI-PAKLAKNVSQLICNALAINKPPSSNGPKTRLNGRFLHDRFPGWVSVGDQRFLQA  199

Query  1065  -SAASKADIVVAQDGSGNYKTVTEAVNAAAKR-SGSGRYVIYVKAGVYKENVEIGSKLKN  892
              + AS+A++ VA DGSGNYKT+ EA+  A+ + SG+ R++I+VKAGVY ENV+I + +KN
Sbjct  200   KTLASQANLKVAADGSGNYKTIREALRVASNQISGTQRFIIHVKAGVYNENVQITNSMKN  259

Query  891   IMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALR  712
             +M VGDG G TIIT SRSV GG+TTF SAT AV GD F+ + +TFRNTAG  NHQAVALR
Sbjct  260   LMFVGDGKGNTIITASRSVRGGSTTFSSATFAVSGDRFMARDMTFRNTAGPENHQAVALR  319

Query  711   SGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-  535
               SD + FY+CS +GYQDTL+  + RQFYRECDIYGTVDFIFGNA  VFQNCNI+ R P 
Sbjct  320   VSSDFAAFYRCSIDGYQDTLHADTLRQFYRECDIYGTVDFIFGNAIAVFQNCNIFVRRPM  379

Query  534   PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK----TYLGRPWKEYSRTVFMKS  367
               + NTITAQGRSDPNQNTGISIHN +++AA DL  V+    TYLGRPW++++RT+F+K 
Sbjct  380   SQQKNTITAQGRSDPNQNTGISIHNSRISAAPDLSPVQGSFATYLGRPWQKHARTIFLKC  439

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
              LD LI+PAGWL W  NFAL+TLYYGEY NTG G++T  RVKW GYH ITS +EASKF+V
Sbjct  440   FLDDLINPAGWLEWSENFALSTLYYGEYRNTGPGSNTGKRVKWNGYHFITSPSEASKFSV  499

Query  186   GNFIAGGSWLPATNVPFTSGL  124
             G+F+ GGSW+PAT VPFT  L
Sbjct  500   GSFLDGGSWIPATGVPFTLDL  520



>ref|XP_009351519.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   512 bits (1319),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 278/534 (52%), Positives = 352/534 (66%), Gaps = 29/534 (5%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             FL  F    +  YS   I + CSQTPYPQ C +Y++ +  +      +  F  +   +++
Sbjct  7     FLVFFSLLLMLQYSSCRITAPCSQTPYPQVCRHYINTNLLSTLDRHQRFAFRDLVLKVSM  66

Query  1467  QYAKNAKDNTYSLGTKCRSGGE---KAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
               A  A     SL +    G     K AW DCLELYE+ V K++ ++      +  D  T
Sbjct  67    DQAIEAHQLVLSLNSNSLDGDHTRAKGAWNDCLELYEDTVDKLNRSIG---STNALDVNT  123

Query  1296  WLSTALTNLETCHAGFVDLGVTGNILPAV---------------TSNNVSYLISNTLAIN  1162
             WLS +LTN +TC  GF +L +  + L +                 S ++  + +++ A++
Sbjct  124   WLSASLTNQQTCQNGFTNLNIPSSHLQSFPNYVTLSTNLSKLLSNSLSIHKVSTSSSALH  183

Query  1161  KGFtttnneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNA  985
                            +GFP WV   DRKLLQS S+   AD+VVAQDGSGNYK+++EAV+A
Sbjct  184   FSKQIRGRRRLLLSDDGFPGWVSAADRKLLQSISSGPNADMVVAQDGSGNYKSISEAVDA  243

Query  984   AAKRSG--SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFK  811
             A K  G  S R+VI+VKAGVY+EN+EI   +KNIM +GDGI  TI+TG+++V  G+TT++
Sbjct  244   AYKLQGGASKRFVIHVKAGVYRENIEIKKTMKNIMFIGDGIDATIVTGNKNVQDGSTTYR  303

Query  810   SATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQ  631
             SAT    GDGFI Q +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQ
Sbjct  304   SATFGATGDGFIAQDMTFENTAGPQKHQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQ  363

Query  630   FYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCK  454
             FYR+CDIYGTVDFI G+A VV QNCNIYAR P  N+ NT+TAQ R+DPN+NTGI IHN +
Sbjct  364   FYRDCDIYGTVDFICGDATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVIHNSR  423

Query  453   VTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGE  286
             +TAA DL+ V    KTY+GRPWK+YSRTV MKS+LD LI PAGW PW G+ AL+TLYYGE
Sbjct  424   ITAAQDLRPVQGSFKTYMGRPWKQYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGE  483

Query  285   YSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             Y N+GAGA T  RV W GY VIT A EA KFTVGNF+AG SW+  T VPFT+GL
Sbjct  484   YMNSGAGAGTGGRVNWPGYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>emb|CDP00815.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   512 bits (1318),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 278/532 (52%), Positives = 359/532 (67%), Gaps = 25/532 (5%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPTEIKS-WCSQTPYPQPCEYYLSRSYSNGGQIKDKS-DFLK  1489
             IF      IFV  A FG +     S +CSQTPYP  C      + S   ++   S +   
Sbjct  6     IFALFSFHIFV--ASFGVAKAATSSSFCSQTPYPDLCNSLSINTMSPQTKLDQTSFNVRD  63

Query  1488  VAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
              A    L  A+  +    ++     +   K+AW DC+ELYE+ +  ++  +         
Sbjct  64    AALKFTLSQAQYVQKLLSTMDLSSLNQLGKSAWADCVELYEDSIDNLNRAITSANPTKLD  123

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFtttnne  1135
             DAQTWLS A+ N +TC  GF+D  ++ N+   P + ++  S  +SN+LAINK   +  + 
Sbjct  124   DAQTWLSAAIANHQTCQNGFLDFQLSSNLQSFPFLVNSTFSKHLSNSLAINKAALSAASA  183

Query  1134  attgyteG---------FPDWVRPGDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNA  985
              ++              FP+W+  GDRKLLQSS   +KADI VAQDGSGNYKT+ EA+ A
Sbjct  184   HSSTQQIKGRRLLSSNGFPEWLSVGDRKLLQSSGGPTKADITVAQDGSGNYKTIAEAL-A  242

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             AAK  G GR VIYVK G+YKENV +   +KNIM +GDGI  T++TG+++V  G+TTF+SA
Sbjct  243   AAKGKG-GRVVIYVKKGIYKENVVV--TMKNIMFIGDGIDATVVTGNKNVQDGSTTFRSA  299

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T A+ G GFI + +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVY+ RQFY
Sbjct  300   TFAITGSGFIARDMTFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYAQRQFY  359

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVT  448
             R+CD+YGT DF+FG+A VVFQNCN   R P  N+ NT+TAQ R+DPN+NTGI IHN ++T
Sbjct  360   RDCDVYGTQDFVFGDAIVVFQNCNFNLRRPLGNQMNTLTAQARTDPNENTGIIIHNSRIT  419

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYS  280
             AASDLK V    K+YLGRPW++YSRTV M +S+D++IDPAGWLPW GNFAL+TLYY EY 
Sbjct  420   AASDLKSVQGSIKSYLGRPWQKYSRTVIMTTSIDNVIDPAGWLPWSGNFALSTLYYAEYM  479

Query  279   NTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             N+G GA+T  RVKWGG+H++TS  EA KF+VGNF+AG SW+P T VPFTSGL
Sbjct  480   NSGPGAATGGRVKWGGFHILTSPAEAGKFSVGNFLAGNSWIPGTGVPFTSGL  531



>ref|XP_010035022.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Eucalyptus grandis]
Length=525

 Score =   511 bits (1316),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 283/527 (54%), Positives = 366/527 (69%), Gaps = 17/527 (3%)
 Frame = -3

Query  1671  LQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             ++   IC+    F S+A       +I  WC  TP+P+PC+Y++  S  +    KD+S+F 
Sbjct  5     IRVFLICTLF--FPSSAHSRKHINDIDRWCKDTPHPEPCKYFVGNSRHHRSPPKDQSEFR  62

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNI  1324
             ++  ++++  A N + +    G  C +  ++  W  C +LY N + +++ TV+     + 
Sbjct  63    QIMVDVSMDQAFNTQWHVLQFGENCTTKRQRQVWSVCTKLYYNTIWQLNRTVEGLGGAHK  122

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
              C+  DAQTWLSTALTN+  C  GF DL V+  I PA+ S N+S LISNTLA+N+     
Sbjct  123   NCTNFDAQTWLSTALTNIRACQLGFQDLNVSDFISPAL-STNLSQLISNTLAVNR--ILL  179

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
              NE    Y  GFP WV   DRKLLQSS   KA++VVA+DGSGN++TV  A++AAAKRS +
Sbjct  180   QNEEQESYEGGFPSWVSRHDRKLLQSSTI-KANLVVAKDGSGNFQTVQAALDAAAKRSST  238

Query  963   -GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVG  787
               R++IYVK GVY+EN+E+ +   NI+++GDG+  TIITGSRS GGG TT+ SAT  + G
Sbjct  239   TARFIIYVKRGVYRENIEVANNNNNILMIGDGVKYTIITGSRSAGGGYTTYSSATAGIDG  298

Query  786   DGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIY  607
               FI + ITF NTAG    QAVALRS SDLSVFY C+F+GYQDTL+V S RQFY+ C I+
Sbjct  299   AKFIARDITFANTAGPQKGQAVALRSASDLSVFYHCAFQGYQDTLWVLSQRQFYKSCYIF  358

Query  606   GTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDL-  433
             GT+DFIFGNAAVVFQNC IYAR P + + N ITAQGR DPNQ+TGISIHN +V A SDL 
Sbjct  359   GTIDFIFGNAAVVFQNCYIYARKPLHGQANVITAQGRDDPNQSTGISIHNSRVLATSDLL  418

Query  432   ---KGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDG-NFALNTLYYGEYSNTGAG  265
                  V+TYLGRPW +Y+RTV++K+ L SLI+PAGW+ W G N   NTLY+GEY+N+G G
Sbjct  419   QSTDSVQTYLGRPWMQYARTVYLKTYLGSLINPAGWVTWQGSNSVWNTLYFGEYANSGPG  478

Query  264   ASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +ST NRV W G+HVITSAT AS +TV  FIAG SWLPAT VPFTSGL
Sbjct  479   SSTKNRVTWPGHHVITSATVASSYTVQKFIAGTSWLPATGVPFTSGL  525



>ref|XP_008376203.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Malus domestica]
Length=531

 Score =   511 bits (1316),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 290/530 (55%), Positives = 364/530 (69%), Gaps = 17/530 (3%)
 Frame = -3

Query  1674  NLQFIFICSFLAIFVSTAV---FGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK  1504
             +L  + I  F ++F  T V        + I++WC +TP+P+PC Y +S S  +  + K  
Sbjct  6     SLPLLSILIFFSLFFHTTVARSHHRHSSRIRTWCKKTPHPEPCNYCMSNS-RHHFRPKHT  64

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---  1333
             S+F K+   +AL+ A +A   T   G  C++  EKA W DCL+L+ N V +++ T++   
Sbjct  65    SEFRKMLVQVALERALSAITYTSQYGQNCQNDKEKAVWTDCLKLFHNTVSQLNXTLEGLG  124

Query  1332  PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNN-VSYLISNTLAINKG  1156
               + CS  DAQTWLS ALTN+ETC  G ++L VT  I+P  TSNN VS LISN+LAI  G
Sbjct  125   TKLNCSNFDAQTWLSAALTNIETCRVGSLELXVTNFIMPIYTSNNNVSELISNSLAI--G  182

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
                   E +   +E FP+WV   DR+LLQ+ A  +A++VVA+DGSGN+ TV  A++AAA+
Sbjct  183   SQLLGTEESYTESEKFPNWVSKHDRRLLQA-ANIRANLVVAKDGSGNFLTVQAALDAAAR  241

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             R    +++IYVK GVY EN+++ +    IMLVG GI  T+IT SRSV GG TT+ SAT  
Sbjct  242   RRVKSKFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVSGGYTTYNSATAG  301

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             + G GFI +GITFRNTAG    QAVAL S SDLSVFY+C+F+GYQDTL V+S RQFYREC
Sbjct  302   INGPGFIARGITFRNTAGQLKGQAVALMSASDLSVFYRCAFQGYQDTLMVHSQRQFYREC  361

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAAS  439
              I+GT+DFIFGNAA VFQNC IY R P   + N ITAQGR+DP QNT ISIHN +V AA+
Sbjct  362   YIFGTIDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSQVLAAA  421

Query  438   DLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEYSNT  274
             DLK V    KTYLGRPW +YSR VFMK  LDSLI+PAGWL W   NFAL+TLYYGEY N 
Sbjct  422   DLKPVASSYKTYLGRPWMQYSRVVFMKCYLDSLINPAGWLQWQRSNFALSTLYYGEYKNF  481

Query  273   GAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G  +ST  RVKW G+H ITS   AS FT G+ IAG SWLPAT VPFT+GL
Sbjct  482   GPASSTRYRVKWPGFHAITSPNVASMFTAGSLIAGRSWLPATGVPFTTGL  531



>ref|XP_009799202.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Nicotiana sylvestris]
Length=556

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 292/566 (52%), Positives = 375/566 (66%), Gaps = 25/566 (4%)
 Frame = -3

Query  1779  ISHNSFYLKNQNVA**NHTT*VISYTTNLLITKMTNLQFIFICSF-LAIFVSTAVFGYSP  1603
             I H++ Y   QN++  N+TT    Y T +   K+ +L    + SF L +  S ++     
Sbjct  2     IRHSNRY-PCQNIS--NNTT----YHTTMTFYKLNSLVLFILFSFSLFLHESYSIEEQPS  54

Query  1602  TEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGT  1423
              +I  WCS TP+P+PC+Y+++       + K K +F  +   +AL+ A   + +   +G 
Sbjct  55    DDINWWCSTTPHPEPCKYFMADVAPERYKPKCKEEFRTMTTEVALEQALLVQSHAKYMGQ  114

Query  1422  KCRSGGEKAAWEDCLELYENMVQKIDTTV----DPNIKCSTADAQTWLSTALTNLETCHA  1255
              CR   +K  W DC +L ++ + +++ T+      +  CS  DAQTWLS +LTN+ETC +
Sbjct  115   HCRGKRKKLVWMDCDKLIDDTILQLNRTLHGIQSNSTSCSDFDAQTWLSASLTNIETCLS  174

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             G   L V+ N+L    S NVS LISN LAIN     + N         FP WV   +RKL
Sbjct  175   GSNQLNVS-NVLHPTLSTNVSQLISNCLAINGELVDSQNSTQVDG---FPSWVTARERKL  230

Query  1074  LQS---SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             LQS   S ASKA  VVAQDGSGN+++V  A+NA +K+  + R +IY+K GVY+ENV IG 
Sbjct  231   LQSKTRSLASKAIYVVAQDGSGNFRSVQAAINAVSKKVTNQRTIIYIKKGVYRENVAIGP  290

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +  IMLVG G+  TIITGSRS  GG TT+ +ATV V G+GFI +GITFRNTAG  N QA
Sbjct  291   GISKIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGNGFIARGITFRNTAGPKNGQA  350

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY C FEGYQDT++V S RQF++ C IYGT+DFIFGNAAVVFQNC I+ 
Sbjct  351   VALRSASDLSVFYACGFEGYQDTIFVQSQRQFFKTCHIYGTIDFIFGNAAVVFQNCVIFV  410

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P   + N ITAQGR DP QNTGISIHN ++TA+  LK V    +TYLGRPW+EYSRTV
Sbjct  411   RRPLVGQVNVITAQGRGDPFQNTGISIHNSRITASPSLKPVVRAFQTYLGRPWQEYSRTV  470

Query  378   FMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
              ++S +D LI+P+GWLPW + +FA  TLYYGE+ N G GAST NRVKW GYHVIT+  EA
Sbjct  471   IIRSYIDGLINPSGWLPWLNSDFAFKTLYYGEHGNWGPGASTRNRVKWPGYHVITNTNEA  530

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             SKFTV N I G SWLP+T VPFT+GL
Sbjct  531   SKFTVANLIGGRSWLPSTGVPFTAGL  556



>ref|XP_009609130.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Nicotiana tomentosiformis]
Length=534

 Score =   509 bits (1311),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 280/505 (55%), Positives = 348/505 (69%), Gaps = 17/505 (3%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +I  WCS TP+P+PC+Y ++       + K K +F  +   +AL+ A   + +  ++G  
Sbjct  34    DINWWCSTTPHPEPCKYLMADVSPQRYKPKCKQEFRTMTTEVALEQALQVQKHAKNVGQH  93

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTT---VDPNI-KCSTADAQTWLSTALTNLETCHAG  1252
             CR   +K  W DC +L ++ + +++ T   +  N   CS  DAQTWLS +LTN+ETC + 
Sbjct  94    CRGKRKKLVWMDCDKLIDDTILQLNRTLHGIQSNFTSCSDFDAQTWLSASLTNIETCLSS  153

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL  1072
                L V+ N+L    S NVS LISN LAIN     + N         FP WV   +RKLL
Sbjct  154   SNQLNVS-NVLHPTLSTNVSQLISNCLAINGELVDSQNSTQVDG---FPSWVTARERKLL  209

Query  1071  QS---SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             QS   S ASKA  VVAQDGSGN+++V  A+NAA+K+  + R +IY+K GVY+ENV IG  
Sbjct  210   QSTTRSLASKAIYVVAQDGSGNFRSVQAAINAASKKVANQRTIIYIKKGVYRENVAIGPG  269

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
             + NIMLVG G+  TIITGSRS  GG TT+ +ATV V G+GFI +GITFRNTAG  N QAV
Sbjct  270   ISNIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGNGFIARGITFRNTAGPKNGQAV  329

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ALRS SDLSVFY C FEGYQDT++V S RQFY+ C IYGT+DFIFGNAAVVFQNC I+ R
Sbjct  330   ALRSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHIYGTIDFIFGNAAVVFQNCIIFVR  389

Query  540   NP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P   + N ITAQGR DP QNTGISIHN ++TA+  LK V    +TYLGRPW+EYSRTV 
Sbjct  390   RPLVGQVNVITAQGRGDPFQNTGISIHNSRITASPSLKPVVRAFQTYLGRPWQEYSRTVV  449

Query  375   MKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             M+S +D LI+P+GWLPW + +FA  TLYYGE+ N G GAST NRVKW GYHVIT+  EAS
Sbjct  450   MRSYIDGLINPSGWLPWLNSDFAFKTLYYGEHGNWGPGASTRNRVKWPGYHVITNTNEAS  509

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             KFTV N I G SWLP+T VPFT+GL
Sbjct  510   KFTVANLIGGRSWLPSTGVPFTAGL  534



>emb|CDY18944.1| BnaC04g04060D [Brassica napus]
Length=442

 Score =   504 bits (1298),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 292/510 (57%), Positives = 356/510 (70%), Gaps = 71/510 (14%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ--IKDKSDFLKVAKNL  1474
             F  IFV++ V GY+  ++K+WC+QTP P+PCEY+L+    N GQ  IK +S+FLK++  L
Sbjct  2     FFCIFVASTVSGYNSKDVKAWCTQTPNPKPCEYFLTH---NSGQKPIKSESEFLKISVKL  58

Query  1473  ALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTW  1294
             AL+ A  AK +T +LG KCR   EKAAWEDCL+LY+  V KI+ T+DPN+KCS  DAQTW
Sbjct  59    ALERAILAKSHTSTLGPKCRDTREKAAWEDCLKLYDVTVSKINQTMDPNVKCSKTDAQTW  118

Query  1293  LSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyte  1114
             LSTALTNL+TC AGF++LGVT  +LP + SNNVS LI NTLAINK         T    +
Sbjct  119   LSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLICNTLAINK----VPFNDTPPEKD  173

Query  1113  GFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAG  934
             GFP WV+PGDRKLLQSS   + + VVA+DGSGN++T+ +AVNAA   SGSGR+VIYVK G
Sbjct  174   GFPSWVKPGDRKLLQSSTP-RDNAVVAKDGSGNFRTIKDAVNAA---SGSGRFVIYVKQG  229

Query  933   VYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFR  754
             VY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGF+ +GITFR
Sbjct  230   VYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITFR  287

Query  753   NTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAA  574
             NTAGA+N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIFGNA 
Sbjct  288   NTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAG  347

Query  573   VVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLGRPWKE  394
                Q    Y+R    KT   +     DP                           R W E
Sbjct  348   AALQ--YQYSRTVFMKT---SLDSLIDP---------------------------RGWLE  375

Query  393   YSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITS  214
                                   W+GNFAL+TL+Y E+ NTG GAST+ RVKW G+ V+ S
Sbjct  376   ----------------------WNGNFALSTLFYAEFQNTGPGASTSGRVKWPGFRVLRS  413

Query  213   ATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              +EAS+FTVG+FIAG SW+P++ VPFTSGL
Sbjct  414   TSEASRFTVGSFIAGSSWIPSS-VPFTSGL  442



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 267/503 (53%), Positives = 354/503 (70%), Gaps = 22/503 (4%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLG-TKCRSG  1408
             C++TPYP+ C +Y+  + +        S F  +A  + ++ A  A      +     +  
Sbjct  25    CNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFKDK  84

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
               K+AWEDCLELYE+ + ++  +++ N      D  TW S ++ N +TC  GF +  +  
Sbjct  85    RAKSAWEDCLELYEDTLYQLKRSMNSN---KLNDRLTWQSASIANHQTCQNGFTEFNLPS  141

Query  1227  --NILPAVTSNNVSYLISNTLAINKGFtttnneattgyt--------eGFPDWVRPGDRK  1078
               N  P++ SN  S L+SN+L+I+K    T   ++T  +        +GFP W+   DR+
Sbjct  142   HLNYFPSMLSN-FSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRR  200

Query  1077  LLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKL  898
             LLQ +   KAD+VVAQDGSGNYKT++E V AAAK SG GR V++VKAGVYK++++I   +
Sbjct  201   LLQETTP-KADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYKDSIDIKRTV  259

Query  897   KNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVA  718
             KN+M++GDG+G TI+TG+ +   G+TTF+SAT AV GDGFI + ITF NTAG   HQAVA
Sbjct  260   KNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVA  319

Query  717   LRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARN  538
             LRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT+DFIFG+A  V QNCNIY R 
Sbjct  320   LRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRK  379

Query  537   P-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFM  373
             P  N+ NT+TAQ R+DPN+NTGI IHNC++TAA DL  V    KT+LGRPW++YSRTV M
Sbjct  380   PMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVM  439

Query  372   KSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKF  193
             KS+LD LIDPAGW PW GNF L++LYY EY+NTGAGASTA RVKW G+ +I+S +EA KF
Sbjct  440   KSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFRLISS-SEAVKF  498

Query  192   TVGNFIAGGSWLPATNVPFTSGL  124
             TVGNF+AGGSW+  + VPF +GL
Sbjct  499   TVGNFLAGGSWISGSGVPFDAGL  521



>gb|KHN21590.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=527

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 361/505 (71%), Gaps = 24/505 (5%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKS-DFLKVAKNLALQYAKNAKDNTYSLG-TKCRS  1411
             C++TPYP+ C++Y+  + +        S  F  +A  + ++ A  A     ++     + 
Sbjct  29    CNETPYPRVCKHYIETTNTLSALDASPSYSFHDMALKVTMEQATEAYKLVSNMDLNNFKD  88

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
                K+AWEDCLELYEN + ++  +++ N   +  D  TW S ++ N +TC  GF D  + 
Sbjct  89    KRAKSAWEDCLELYENTLYQLKRSMNSN---NLNDRLTWQSASIANHQTCQNGFTDFNLP  145

Query  1230  G--NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG---------FPDWVRPGD  1084
                N  P++ SN  S L+SN+L+I+K  T T+  ++    +          FP W+   D
Sbjct  146   SHLNYFPSMLSN-FSELLSNSLSISKAMTLTSFSSSPSTKQSGGRRLLSDGFPYWLSRSD  204

Query  1083  RKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             R+LLQ +A SKAD+VVAQDGSGNYKT++E VNAA+  SG GR V++VKAGVYKEN++I  
Sbjct  205   RRLLQETA-SKADVVVAQDGSGNYKTISEGVNAASGLSGKGRVVVHVKAGVYKENIDIKR  263

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDGFI + ITF NTAG   HQA
Sbjct  264   TVKNLMIVGDGMGATIVTGNLNAQDGSTTFRSATFAVDGDGFIARDITFENTAGPQKHQA  323

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VA+RSG+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGT+DFIFG+A  V QNCNIY 
Sbjct  324   VAVRSGADQSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYV  383

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK V    +T+LGRPW++YSRTV
Sbjct  384   RKPMSNQLNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTV  443

Query  378   FMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             FMKS+LDSLI PAGW PW GNFAL+TLYY EY NTGAGA T  RVKW G+ VI+S TEA 
Sbjct  444   FMKSALDSLISPAGWFPWSGNFALSTLYYAEYGNTGAGAGTGGRVKWEGFRVISS-TEAV  502

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             KFTVG+F+AGGSW+P + VPF +GL
Sbjct  503   KFTVGSFLAGGSWIPGSGVPFDAGL  527



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   507 bits (1305),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 267/503 (53%), Positives = 354/503 (70%), Gaps = 22/503 (4%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLG-TKCRSG  1408
             C++TPYP+ C +Y+  + +        S F  +A  + ++ A  A      +     +  
Sbjct  25    CNETPYPRVCMHYIETTNTLSTLDASSSSFHDLALRVTMEQAIVAHKLVSKMDLNNFKDK  84

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
               K+AWEDCLELYE+ + ++  +++ N      D  TW S ++ N +TC  GF +  +  
Sbjct  85    RAKSAWEDCLELYEDTLYQLKRSMNSN---KLNDRLTWQSASIANHQTCQNGFTEFNLPS  141

Query  1227  --NILPAVTSNNVSYLISNTLAINKGFtttnneattgyt--------eGFPDWVRPGDRK  1078
               N  P++ SN  S L+SN+L+I+K    T   ++T  +        +GFP W+   DR+
Sbjct  142   HLNYFPSMLSN-FSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRR  200

Query  1077  LLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKL  898
             LLQ +   KAD+VVAQDGSGNYKT++E V AAAK SG GR V++VKAGVYK++++I   +
Sbjct  201   LLQETTP-KADVVVAQDGSGNYKTISEGVAAAAKLSGKGRVVVHVKAGVYKDSIDIKRTV  259

Query  897   KNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVA  718
             KN+M++GDG+G TI+TG+ +   G+TTF+SAT AV GDGFI + ITF NTAG   HQAVA
Sbjct  260   KNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDGFIARDITFENTAGPQQHQAVA  319

Query  717   LRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARN  538
             LRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT+DFIFG+A  V QNCNIY R 
Sbjct  320   LRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYVRK  379

Query  537   P-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFM  373
             P  N+ NT+TAQ R+DPN+NTGI IHNC++TAA DL  V    KT+LGRPW++YSRTV M
Sbjct  380   PMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAVQGSFKTFLGRPWQKYSRTVVM  439

Query  372   KSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKF  193
             KS+LD LIDPAGW PW GNF L++LYY EY+NTGAGASTA RVKW G+ +I+S +EA KF
Sbjct  440   KSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFRLISS-SEAVKF  498

Query  192   TVGNFIAGGSWLPATNVPFTSGL  124
             TVGNF+AGGSW+  + VPF +GL
Sbjct  499   TVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_006580437.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
isoform X1 [Glycine max]
Length=527

 Score =   506 bits (1304),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 361/505 (71%), Gaps = 24/505 (5%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKS-DFLKVAKNLALQYAKNAKDNTYSLG-TKCRS  1411
             C++TPYP+ C++Y+  + +        S  F  +A  + ++ A  A     ++     + 
Sbjct  29    CNETPYPRVCKHYIETTNTLSALDAPPSYSFHDMALKVTMEQATEAYKLVSNMDLNNFKD  88

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
                K+AWEDCLELYEN + ++  +++ N   +  D  TW S ++ N +TC  GF D  + 
Sbjct  89    KRAKSAWEDCLELYENTLYQLKRSMNSN---NLNDRLTWQSASIANHQTCQNGFTDFNLP  145

Query  1230  G--NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG---------FPDWVRPGD  1084
                N  P++ SN  S L+SN+L+I+K  T T+  ++    +          FP W+   D
Sbjct  146   SHLNYFPSMLSN-FSELLSNSLSISKAMTLTSFSSSPSTKQSGGRRLLSDGFPYWLSRSD  204

Query  1083  RKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             R+LLQ +A SKAD+VVAQDGSGNYKT++E VNAA+  SG GR V++VKAGVYKEN++I  
Sbjct  205   RRLLQETA-SKADVVVAQDGSGNYKTISEGVNAASGLSGKGRVVVHVKAGVYKENIDIKR  263

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDGFI + ITF NTAG   HQA
Sbjct  264   TVKNLMIVGDGMGATIVTGNLNAQDGSTTFRSATFAVDGDGFIARDITFENTAGPQKHQA  323

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VA+RSG+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGT+DFIFG+A  V QNCNIY 
Sbjct  324   VAVRSGADQSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGTIDFIFGDAVTVLQNCNIYV  383

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK V    +T+LGRPW++YSRTV
Sbjct  384   RKPMSNQLNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTV  443

Query  378   FMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             FMKS+LDSLI PAGW PW GNFAL+TLYY EY NTGAGA T  RVKW G+ VI+S TEA 
Sbjct  444   FMKSALDSLISPAGWFPWSGNFALSTLYYAEYGNTGAGAGTGGRVKWEGFRVISS-TEAV  502

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             KFTVG+F+AGGSW+P + VPF +GL
Sbjct  503   KFTVGSFLAGGSWIPGSGVPFDAGL  527



>ref|XP_010062172.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Eucalyptus grandis]
Length=543

 Score =   507 bits (1306),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 278/509 (55%), Positives = 355/509 (70%), Gaps = 16/509 (3%)
 Frame = -3

Query  1608  SPT-EIKSWCSQTPYPQPCEYYLSRSYSNGGQIK-DKSDFLKVAKNLALQYAKNAKDNTY  1435
             +PT +I  WC  TP+PQPC+Y++S +  N       +S F K+A ++A Q+A NA     
Sbjct  37    APTGDIDWWCDTTPHPQPCKYFVSHARGNHYNTSMPRSGFRKIAVDVATQHAFNAYKQIL  96

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNIKCSTADAQTWLSTALTNLE  1267
              L +   +  +++ W DCL+L++N + +++ T+      N  C+  D QTWLSTALTN+E
Sbjct  97    HLRSDLVNHRQRSVWVDCLKLHDNTLLQLNRTLQGLLGLNQTCTDFDIQTWLSTALTNIE  156

Query  1266  TCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPG  1087
             TC  G  DL V+ +I+   +S N+S L+SN+LAIN+G   ++   T      FP W    
Sbjct  157   TCRLGSQDLNVSDSIMMPTSSANLSQLLSNSLAINEGLLGSDQPRTEYEE--FPSWFTNH  214

Query  1086  DRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSG-SGRYVIYVKAGVYKENVE  913
             +RKLLQS S  ++A++VVA+DGSGN++TV EA+ AAAKRS  + R++IYVK GVY+EN+E
Sbjct  215   ERKLLQSTSLVTRANLVVAKDGSGNFRTVQEAIAAAAKRSSMNSRFIIYVKKGVYRENIE  274

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +G    NIMLVGD +  T+IT SRSVG G TT+ SAT  + G  FI + ITF NTAG   
Sbjct  275   VGINNNNIMLVGDSMRNTVITSSRSVGRGFTTYSSATAGIDGLRFIARDITFSNTAGPLR  334

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
              QAVALRS SDLSVFY+C+ +GYQDTL+V+S RQFYR+C IYGTVDFIFGNAAVVFQNC 
Sbjct  335   GQAVALRSASDLSVFYRCAIQGYQDTLFVHSQRQFYRQCYIYGTVDFIFGNAAVVFQNCM  394

Query  552   IYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYS  388
             IYAR P   + N ITAQGR+DP QNTGI I N +V AA+DL    +   TYLGRPW++YS
Sbjct  395   IYARRPLKGQANIITAQGRNDPFQNTGIVIQNSRVLAATDLLPVVRAFNTYLGRPWQQYS  454

Query  387   RTVFMKSSLDSLIDPAGWLPWDG-NFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSA  211
             RTVF+K+ L SL+ P GW  WDG NFA  TLYYGEY N G  +ST  RVKW GYHVITSA
Sbjct  455   RTVFLKTYLGSLVSPLGWSSWDGSNFAHGTLYYGEYQNFGPASSTRYRVKWPGYHVITSA  514

Query  210   TEASKFTVGNFIAGGSWLPATNVPFTSGL  124
               AS+FT+   IAG SWLPAT VPFT+GL
Sbjct  515   NVASQFTMSRLIAGQSWLPATGVPFTAGL  543



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   507 bits (1306),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 277/513 (54%), Positives = 356/513 (69%), Gaps = 36/513 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSD-----FLKVAKNLALQYAKNAKDNTYSLGTK  1420
             C+QTPYP+ C Y++      G ++  + D     F  VA  +A+  A  A +   S+   
Sbjct  50    CAQTPYPETCHYFI------GTEVLSELDRTEFSFRDVALKVAMSEALRAHELVSSMDPS  103

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
                   + AW DC+ELYE+ V+ ++ +V        +D+QTWLS A+TN  TC  GF + 
Sbjct  104   SFDERTRLAWSDCIELYEDSVRLLNRSVSSK---KPSDSQTWLSAAITNHRTCQNGFNEF  160

Query  1239  GVTGNI--LPAVTSNNVSYLISNTLAINKGFtttnneattgyteG------------FPD  1102
              +  ++   P + SN  S L+SN+LAINK  +++ + A   +++             FP 
Sbjct  161   NLASHLESFPLMLSN-FSKLLSNSLAINKVSSSSYSPARVSFSKQVRGRRLLGDHEKFPS  219

Query  1101  WVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR-YVIYVKAGVY  928
             WV   DRKLLQ++ A +KAD+VVA+DGSGNYKT++EAV A++ +      +VIYVKAGVY
Sbjct  220   WVSASDRKLLQTARAPAKADLVVAKDGSGNYKTISEAVAASSSKRSGSSRFVIYVKAGVY  279

Query  927   KENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNT  748
              ENVE+   +KN+M+VGDGI  TI+TG ++   G+TTF+SAT AV+GDGFI + ITF+NT
Sbjct  280   SENVEVKRSMKNLMIVGDGIDATIVTGDKNAQDGSTTFRSATFAVMGDGFIARDITFQNT  339

Query  747   AGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVV  568
             AG   HQAVALRSGSD SVFY CSF+GYQDTLYVY+ RQFYR+CDIYGT DFIFG+A  V
Sbjct  340   AGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYAQRQFYRDCDIYGTQDFIFGDAVTV  399

Query  567   FQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRP  403
              QNCNIY R P   + NT+TAQGRSDPN+NTGI +HN +VTA+SD+K V    K YLGRP
Sbjct  400   LQNCNIYIRKPISGQINTVTAQGRSDPNENTGIIVHNSRVTASSDMKPVQGSFKNYLGRP  459

Query  402   WKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHV  223
             W++YSRTVFM++ LDSLI P GW PW G+FAL+TLYYGEY NTG GA T  RV W GYH 
Sbjct  460   WQKYSRTVFMRTFLDSLIAPQGWYPWSGSFALSTLYYGEYMNTGGGAGTGGRVNWPGYHA  519

Query  222   ITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
               SATEA+KFTVGNF+AG SWLPAT VPF++GL
Sbjct  520   TMSATEAAKFTVGNFLAGNSWLPATGVPFSAGL  552



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   506 bits (1304),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 269/548 (49%), Positives = 369/548 (67%), Gaps = 32/548 (6%)
 Frame = -3

Query  1698  NLLITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGG  1519
             N+  +KM  L F    ++  +F    V G   +     C+QTPYP  C +Y+  + +   
Sbjct  3     NISFSKMDKLIFNSCIAYFLLFSLLFVHGKELS-----CNQTPYPHVCNHYIGTTTNKLS  57

Query  1518  QIKDKSDFLKVAKNLALQYAKNAKDNTYSLG-TKCRSGGEKAAWEDCLELYENMVQKIDT  1342
              +   S F  +   + L  A  A     ++     +    K+AWEDCLELYE+ + ++  
Sbjct  58    TLDSSSSFHDIVLKVTLDQAIEAHKLVSTMELNNFKDKHAKSAWEDCLELYEDTIYQLKR  117

Query  1341  TVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG--NILPAVTSNNVSYLISNTLA  1168
             +++ N   +  D  TW S ++TN +TC  GF+D  +    N  P++ SN  + L+SN+L+
Sbjct  118   SINSN---NLNDKLTWQSASITNHQTCQNGFIDFNLPSHLNYFPSMLSN-FTKLLSNSLS  173

Query  1167  INKGFtttnneattgyteG-----------FPDWVRPGDRKLLQSSAAS----KADIVVA  1033
             I+   T++ + +++  +             FP W+   DRKLLQ++  S    +ADIVVA
Sbjct  174   ISNTLTSSQSSSSSSSSTKQNGGRRLLSDGFPYWLSGSDRKLLQATPGSGIGPRADIVVA  233

Query  1032  QDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtii  853
             QDGSGNYKT++E V AAAK SG GR VI++KAG+YKENV+I   +KN+M+ GDG+  TI+
Sbjct  234   QDGSGNYKTISEGVAAAAKLSGKGRVVIHLKAGIYKENVDIKKTVKNLMIFGDGMDSTIV  293

Query  852   tgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSF  673
             TG+ +   G+TTF+SAT  V+GDGFI + +TF NTAG   HQAVALRSG+D SVFY+C+F
Sbjct  294   TGNHNAIDGSTTFRSATFGVMGDGFIAKDMTFENTAGPQKHQAVALRSGADHSVFYRCAF  353

Query  672   EGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRS  496
             +G+QDTLYVY++RQFYR+C+IYGT+DFIFGNA  V QNCNI+ R P  N+ NT+TAQGR+
Sbjct  354   KGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSNQKNTVTAQGRT  413

Query  495   DPNQNTGISIHNCKVTAASDLKG----VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLP  328
             DPN+NTGI IHNC++TA+SDLK     VKTYLGRPW++YSRTV MKS+LD LI+  GW P
Sbjct  414   DPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAP  473

Query  327   WDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPAT  148
             W G FAL+TLYYGEY N G GA+T  RVKW G+HVIT+ ++A KF+VGNF+AG SW+  +
Sbjct  474   WMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGS  533

Query  147   NVPFTSGL  124
              VPF +GL
Sbjct  534   GVPFDAGL  541



>ref|XP_004240801.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Solanum lycopersicum]
Length=531

 Score =   504 bits (1299),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 279/510 (55%), Positives = 348/510 (68%), Gaps = 26/510 (5%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYY-----LSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTY  1435
             +I  WCS TP+P+PC+Y+     L R+Y    + K K+DF  +   +AL+ A   ++++ 
Sbjct  30    DINWWCSTTPHPEPCKYFMADTTLQRTY----KPKCKADFRTMTTEVALEQALLVQNHSK  85

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNIKCSTADAQTWLSTALTNLE  1267
             S+G       +K  W DC +L ++ + +++ T+      +  C+  DAQTWLS +LTN+E
Sbjct  86    SMGQHFGGKRKKLVWMDCDKLIDDTIHQLNRTLHGIGSNSTSCTAFDAQTWLSASLTNIE  145

Query  1266  TCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPG  1087
             TC +G   L V+ N+L    S NVS LISN+LAIN     + N    G    FP WV   
Sbjct  146   TCLSGSNQLNVS-NVLHPTLSANVSQLISNSLAINGELVNSLNSTEIGG---FPSWVTSR  201

Query  1086  DRKLLQSSA---ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENV  916
             +RKLLQSS    AS+A  VVAQDGSGN++++  A+NA A +    R +IY+K GVY+ENV
Sbjct  202   ERKLLQSSTRSLASQAIYVVAQDGSGNFRSIQAAINATANKVSDERTIIYIKKGVYRENV  261

Query  915   EIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAA  736
              IG  + NIMLVG G+  TIITGSRS  GG TT+ +ATV V G GFI +GITFRNTAG  
Sbjct  262   GIGPSMTNIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGSGFIARGITFRNTAGPK  321

Query  735   NHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNC  556
               QAVALRS SDLSVFY C FEGYQDT++V S RQFY+ C +YGT+DFIFGNAAVVFQNC
Sbjct  322   KGQAVALRSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHVYGTIDFIFGNAAVVFQNC  381

Query  555   NIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEY  391
              IY R P   + N ITAQGR DP QNTGISIHN ++TAA DL  V    KTY+GRPW+EY
Sbjct  382   VIYVRRPLVGQVNVITAQGRGDPFQNTGISIHNSRITAAPDLAPVVQAFKTYMGRPWQEY  441

Query  390   SRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITS  214
             SRTV ++S +D L+ P+GWLPW + +FA  TLYYGEY N G GAST NRVKW GYHVIT 
Sbjct  442   SRTVILRSYIDRLVSPSGWLPWLNSDFAFKTLYYGEYGNFGPGASTINRVKWPGYHVITD  501

Query  213   ATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
               EASKFTV N + G SWLP+T VPFTSGL
Sbjct  502   VKEASKFTVANLVGGRSWLPSTGVPFTSGL  531



>ref|XP_003530788.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=526

 Score =   503 bits (1296),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 272/503 (54%), Positives = 352/503 (70%), Gaps = 21/503 (4%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLG-TKCRSG  1408
             C++TPYP  C++Y+  + +        S F  +A  + +  A  A     ++     +  
Sbjct  29    CNETPYPSVCKHYIETTKTLSALDASPSSFHDMALKVTMVQAMEAYKLVSNMDLNNFKDK  88

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
               K+AWEDCLELYEN + ++  +++ N   +  D  TW S ++ N +TC  GF D  +  
Sbjct  89    RAKSAWEDCLELYENTLYQLKRSMNSN---NLNDRMTWQSASIANHQTCQNGFTDFNLPS  145

Query  1227  --NILPAVTSNNVSYLI-------SNTL-AINKGFtttnneattgyteGFPDWVRPGDRK  1078
               N  P++ SN    L        + TL +++   TT  +      ++GFP W+   DRK
Sbjct  146   HLNYFPSMLSNLSGLLSNSLSISKAMTLRSLSSSPTTKQSGGRKLLSDGFPYWLSRSDRK  205

Query  1077  LLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKL  898
             LLQ +A SKAD+VVAQDGSGNYKT++E V AA++ SG GR V++VKAGVYKEN++I   +
Sbjct  206   LLQETA-SKADVVVAQDGSGNYKTISEGVAAASRLSGKGRVVVHVKAGVYKENIDIKRTV  264

Query  897   KNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVA  718
             KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDGFI + ITF NTAG   HQAVA
Sbjct  265   KNLMIVGDGMGATIVTGNHNAIDGSTTFRSATFAVDGDGFIARDITFENTAGPQKHQAVA  324

Query  717   LRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARN  538
             LRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGTVDFIFG+A  V QNCNIY R 
Sbjct  325   LRSGADHSVFYRCSFRGYQDTLYVYANRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRK  384

Query  537   P-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFM  373
             P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK V    +T+LGRPW++YSRTV M
Sbjct  385   PMSNQQNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTVVM  444

Query  372   KSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKF  193
             KS+LD LI PAGW PW GNFAL+TLYY E++NTGAGAST  RV W G+ VI+S TEA KF
Sbjct  445   KSALDGLISPAGWFPWSGNFALSTLYYAEHANTGAGASTGGRVDWAGFRVISS-TEAVKF  503

Query  192   TVGNFIAGGSWLPATNVPFTSGL  124
             TVGNF+AGGSW+P + VPF  GL
Sbjct  504   TVGNFLAGGSWIPGSGVPFDEGL  526



>ref|XP_006469215.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Citrus sinensis]
Length=525

 Score =   503 bits (1296),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 279/524 (53%), Positives = 356/524 (68%), Gaps = 20/524 (4%)
 Frame = -3

Query  1647  FLAIFVSTAVFG--YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQI-KDKSDFLKVAKN  1477
              + +F+   +F   ++  E+ + CSQTPYP+ C +Y + ++ +  ++ + +  F  +   
Sbjct  6     LIQLFIHFLIFSLNFAHGELITSCSQTPYPEICNHYTATNFLSNLELGQTQFSFRDLNLK  65

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQT  1297
             + +  A +A     ++     +   K A  DC +LY++ V  ++ ++  +   +  D+ T
Sbjct  66    VTIDQAIHAHKLISTMDLSSFNKLAKLALVDCKDLYDDTVNHLNRSMSSS---NPIDSVT  122

Query  1296  WLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKG--------Ftt  1147
             WLS A+ N ETC  GF D  +  ++  LP + S N S L+SN+LAI K         +  
Sbjct  123   WLSAAIANQETCKNGFTDFNLHSHLQSLPFM-SGNFSKLLSNSLAITKSTVSSSSIPYAY  181

Query  1146  tnneattgyteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNAAAKRS  970
               N        GFP WV   DR+LLQSS    KAD+VVAQDGSGNYKT++E V AA K  
Sbjct  182   KRNGGRRLLVNGFPTWVSAADRRLLQSSGVGPKADVVVAQDGSGNYKTISEGVAAAVKLG  241

Query  969   G-SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAV  793
             G S R VIYVK GVY+ENVEI   +KN+ML+GDGI  TI+T +++  GGTTTF++AT AV
Sbjct  242   GGSKRVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDATIVTSNKNGKGGTTTFRTATFAV  301

Query  792   VGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECD  613
              G GFI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR CD
Sbjct  302   SGQGFIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCD  361

Query  612   IYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASD  436
             IYGT DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +HN +VTA S 
Sbjct  362   IYGTQDFIFGDAAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVHNSRVTAESG  421

Query  435   LKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  256
                 K+YLGRPWK+YSRTVFMK ++D +IDPAGWLPW G+FAL+TLYYGEY N G GAST
Sbjct  422   QGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGAST  481

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             + RVKW GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  482   SGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>gb|KHG13344.1| Uncharacterized protein F383_18528 [Gossypium arboreum]
Length=522

 Score =   503 bits (1295),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 285/530 (54%), Positives = 356/530 (67%), Gaps = 25/530 (5%)
 Frame = -3

Query  1668  QFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSR----SYSNGGQIKDKS  1501
             + + I   ++ F +    G +   I S C+QTPYP  C +++      + S+    + + 
Sbjct  3     KLLAIPFLISYFFTCVPLGNAAATITS-CTQTPYPDVCNHFMGNGVNVATSSLALDQTRY  61

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F  +A  + L  A  A     ++     +   K AW DCLELY++ +  ++ +   N  
Sbjct  62    SFRDLAIQVTLNQAVQAHHLVSTMDLTSFNERAKLAWNDCLELYQDTISHLNQSKSTN--  119

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINK---G  1156
              S  DAQTWLS A+TN +TC  GF+D  +  ++  LP + +N  S LISN+LAINK    
Sbjct  120   -SPLDAQTWLSAAITNHQTCQNGFIDFNLASHLQTLPLMLTN-FSKLISNSLAINKPTVS  177

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQ-SSAASKADIVVAQDGSGNYKTVTEAVNAAA  979
              T            GFP W+   DRKLLQ +SA   ADIVVAQDGSGN+KT++EAV  AA
Sbjct  178   VTANQVGNRRLLVNGFPTWLSGADRKLLQKTSAPLNADIVVAQDGSGNFKTISEAV--AA  235

Query  978   KRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATV  799
               SG  R VI+VKAGVY ENV+I    KNIML+GDGIG T+ITG+++    TT  ++AT 
Sbjct  236   IESGK-RTVIHVKAGVYNENVDIQRSAKNIMLIGDGIGATVITGNKNAQTTTTF-RTATF  293

Query  798   AVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRE  619
             AVVGDGFI + ITF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+
Sbjct  294   AVVGDGFIARDITFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRD  353

Query  618   CDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAA  442
             CDIYGTVDFIFG+A  VFQNCNIY R P + + NT+TAQ R+DPN+NTGI IHN +V AA
Sbjct  354   CDIYGTVDFIFGDAIAVFQNCNIYIRRPMSGQMNTVTAQARTDPNENTGIIIHNSRVMAA  413

Query  441   SDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNT  274
             SDL+ V    K YLGRPW++YSRTVFMK+ LD LID  GWLPW GNFAL++LYY E+ NT
Sbjct  414   SDLRAVQGSFKNYLGRPWQKYSRTVFMKTGLDGLIDAEGWLPWSGNFALSSLYYAEHMNT  473

Query  273   GAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G GAST  RVKWGGY VI  ATEA KFTVGNF+ G +W+P + VPF +GL
Sbjct  474   GTGASTGGRVKWGGYRVI-DATEAGKFTVGNFLTGNAWIPESGVPFDAGL  522



>gb|EYU24929.1| hypothetical protein MIMGU_mgv1a025888mg, partial [Erythranthe 
guttata]
Length=486

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 260/439 (59%), Positives = 327/439 (74%), Gaps = 21/439 (5%)
 Frame = -3

Query  1401  KAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI  1222
             K+A  DCL+LYE+ + +++ +    I  S  DAQTWLS+++ N + C  GF+D  ++   
Sbjct  56    KSASVDCLDLYEDTIYQLNRS----IFGSKNDAQTWLSSSIANEQACRNGFLDFNLSFPT  111

Query  1221  LPAVTSNNVSYLISNTLAINKGFt-----------ttnneattgyteGFPDWVRPGDRKL  1075
             +  +TS++ S  +SN+LAINK                        T  FP+WV  GDR+L
Sbjct  112   M--LTSDDFSKYLSNSLAINKATASASASASSYATKQKRNRRLLSTVDFPEWVSHGDRRL  169

Query  1074  LQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKL  898
             LQSS  +K DIVVAQDGSGN+KT+ EA+ AA K RSG+ R+VIYVK GVYKENVE+   +
Sbjct  170   LQSS--TKGDIVVAQDGSGNFKTINEALAAAEKQRSGTRRFVIYVKKGVYKENVEVKRSM  227

Query  897   KNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVA  718
             KN+M +GDGI  T++TGS++V  G+TTF+SAT AV GDGFI + +TF NTAG   HQAVA
Sbjct  228   KNLMFIGDGIDATVVTGSKNVQDGSTTFRSATFAVTGDGFIARDMTFENTAGPQKHQAVA  287

Query  717   LRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARN  538
             LRSGSD SVFY+CSF+GYQDTLYVYS RQFYR CDIYGT+DFIFG++  V QN NIY R 
Sbjct  288   LRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTIDFIFGDSVSVIQNSNIYIRK  347

Query  537   P-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKTYLGRPWKEYSRTVFMKSSL  361
             P  N+ NT+TAQGR DPN+NTGI IHN +VT+AS      +YLGRPW++YSRTVFMK ++
Sbjct  348   PMSNQKNTVTAQGRKDPNENTGIVIHNSRVTSASGSGPGPSYLGRPWQQYSRTVFMKCAI  407

Query  360   DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGN  181
             D +I+PAGWLPW G+FAL+TLYYGEY NTG+GAST  RVKW G+HVITSA EA KF+VGN
Sbjct  408   DGIIEPAGWLPWSGSFALSTLYYGEYMNTGSGASTGGRVKWPGFHVITSAAEAGKFSVGN  467

Query  180   FIAGGSWLPATNVPFTSGL  124
             F+AGGSW+PAT VP+TSG+
Sbjct  468   FLAGGSWIPATGVPYTSGV  486



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   503 bits (1295),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 271/517 (52%), Positives = 347/517 (67%), Gaps = 34/517 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSY---SNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCR  1414
             C+QTPYPQ C   ++      S    ++ ++ FL    N+ L +A+       S+     
Sbjct  25    CNQTPYPQLCNSLITSKVLVSSQESNLEVRNIFL----NITLDHAQKVHTLISSMDISSF  80

Query  1413  SGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST-ADAQTWLSTALTNLETCHAGFVDLG  1237
                 K AWEDCLELYE+ + +++ T+  +   +T  D QT+LS A TN ETC  GFVDL 
Sbjct  81    QDLAKFAWEDCLELYEDTIYQLNQTILLSKDFTTIQDIQTYLSAATTNYETCKNGFVDLN  140

Query  1236  VTGNI-LPAVTSNNVSYLISNTLAINKGFtttn------------------neattgyte  1114
             ++ N+     TS+  S  ++N LAIN+  +TT+                  +        
Sbjct  141   ISTNLEFFTFTSSKFSQFLTNALAINQAISTTSFKPYTRERGGGGIGGRGGSGGRRLLAN  200

Query  1113  GFPDWVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIYVK  940
             G P W+   D KLLQ+S   +KAD+VVA+DG+GNYKT++EA+ AA   R G+ R++IYVK
Sbjct  201   GLPSWMFKADHKLLQTSMPTTKADLVVAKDGTGNYKTISEAITAAKNLRIGTKRFIIYVK  260

Query  939   AGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGIT  760
             AG+YKENV I +K+KN+ML+GDGI  TI+T +++V  G+TTF+SAT A+ GDGFI + IT
Sbjct  261   AGIYKENVVITNKMKNLMLIGDGIDATIVTCNKNVQDGSTTFRSATFAISGDGFIAKDIT  320

Query  759   FRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  580
             F NTAG   HQAVALRSGSD S+FY+CSF+GYQDTLYVYS RQFY+ECDIYGT+DFIFGN
Sbjct  321   FENTAGPQKHQAVALRSGSDYSIFYRCSFKGYQDTLYVYSKRQFYKECDIYGTIDFIFGN  380

Query  579   AAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTY  415
             AA + Q+CNIY R P  N+ NTITAQGRSDPN+NTGI IH+  + AA DLK V    +T+
Sbjct  381   AAAILQSCNIYVRKPMNNQMNTITAQGRSDPNENTGIVIHDSIIKAAQDLKPVQGSFQTF  440

Query  414   LGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWG  235
             LGRPW+ YSRT+ MKS +D L+D AGW PW G+FAL TLYYGEY N G GA T  RVKW 
Sbjct  441   LGRPWRMYSRTMIMKSHIDGLVDIAGWAPWSGDFALKTLYYGEYMNYGPGADTHGRVKWP  500

Query  234   GYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GYH I S  +A KFTV NF+ G  W+P T VPFTSGL
Sbjct  501   GYHAIKSPVDAEKFTVRNFLTGDEWIPGTGVPFTSGL  537



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   502 bits (1293),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 269/500 (54%), Positives = 361/500 (72%), Gaps = 23/500 (5%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSY-SNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             C++TPYP+ C++Y+  +  ++     D +  LKV+ N A++  K   +   +     RS 
Sbjct  28    CNETPYPRLCKHYVDTTMDASSSSFHDMT--LKVSLNQAMEVYKLVSNMDLNNFKDKRS-  84

Query  1407  GEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
               K+AWEDCLELYE+ + ++  +++ N   +  D  TW S ++ N +TC  GF +  +  
Sbjct  85    --KSAWEDCLELYEDTLYQLKRSLNSN---NLNDRLTWQSASIANHQTCQNGFTEFNLPS  139

Query  1227  NI--LPAVTSN-----NVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ  1069
             ++   P++ +N     + S  +S  +++    +T  N      ++GFP W+   DRKLLQ
Sbjct  140   HLNHFPSMLTNFSKLLSNSLSLSKAMSLASLSSTKQNGGRRLLSDGFPSWMSHSDRKLLQ  199

Query  1068  SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNI  889
              +A SKAD+VVAQDGSGNYKT++E V AA+K SG GR V++VKAGVYKE+++I   +KN+
Sbjct  200   ETA-SKADVVVAQDGSGNYKTISEGVAAASKLSGKGRVVVHVKAGVYKESIDIKRTVKNL  258

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             M++GDG+G TI+TGS +   G+TTF+SAT AV GD FI + ITF NTAG   HQAVALRS
Sbjct  259   MIIGDGMGATIVTGSNNAQDGSTTFRSATFAVSGDNFIARDITFENTAGPQKHQAVALRS  318

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-P  532
             G+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGTVDFIFG+A  V QNCNIY R P  
Sbjct  319   GADHSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGTVDFIFGDAVSVLQNCNIYVRKPMS  378

Query  531   NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
             N+ N++TAQGR+DPN+NTGI IHNC +TAA DLK V    +TYLGRPW++YSRTV MKS+
Sbjct  379   NQQNSVTAQGRTDPNENTGIIIHNCVITAAGDLKAVQGSFRTYLGRPWQKYSRTVVMKSA  438

Query  363   LDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVG  184
             LD LI+PAGW  W GNFAL+TLYYGEY+NTGAGAST  RVKWGG+ V++S ++A KFTVG
Sbjct  439   LDGLINPAGWSEWSGNFALSTLYYGEYANTGAGASTGGRVKWGGFRVMSS-SDAVKFTVG  497

Query  183   NFIAGGSWLPATNVPFTSGL  124
              F+AGGSW+P + VPF +GL
Sbjct  498   EFLAGGSWIPGSGVPFDAGL  517



>ref|XP_009351517.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 276/538 (51%), Positives = 353/538 (66%), Gaps = 29/538 (5%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
             F   FL  F    +  YS   I + CSQTPYPQ C +Y++ +  +      +  F  +  
Sbjct  3     FNAYFLVFFSLLFMLQYSSCRITAPCSQTPYPQVCRHYINTNLLSTLDRHQRFAFRDLVL  62

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGE---KAAWEDCLELYENMVQKIDTTVDPNIKCSTA  1309
              +++  A  A     SL      G     K AW DCLELYE+ V K++ ++      +T 
Sbjct  63    KVSMDQAIEAHQLVLSLNLNSLDGDHTRAKGAWNDCLELYEDTVDKLNRSIG---STNTL  119

Query  1308  DAQTWLSTALTNLETCHAGFVDLGVTGNILPAV---------------TSNNVSYLISNT  1174
             D  TWLS +LTN +TC  GF +L +  + L +                 S ++  + +++
Sbjct  120   DVSTWLSASLTNQQTCQNGFTNLNIPSSHLQSFPNYVTLSTNLSKLLSNSLSIHKVSTSS  179

Query  1173  LAINKGFtttnneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTE  997
              A++               +GFP WV   DRKLLQS S+   AD+VVAQDGSGNYK+++E
Sbjct  180   SALHFSKQIRGRRRHLLSDDGFPGWVSAADRKLLQSISSGPNADMVVAQDGSGNYKSISE  239

Query  996   AVNAAAKRSG--SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggt  823
             AV+AA K  G  + R+VI+VKAGVY+EN+EI   +KNIM +GDGI  TI+TG+++V  G+
Sbjct  240   AVDAAYKLQGGATKRFVIHVKAGVYRENIEIKKTMKNIMFIGDGIDATIVTGNKNVPDGS  299

Query  822   tTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVY  643
             TT++SAT    GDGFI Q +TF NTAG   +QAVALRSGSD SVFY+CSF+GYQDTLYVY
Sbjct  300   TTYRSATFGATGDGFIAQDMTFENTAGPQKYQAVALRSGSDHSVFYRCSFKGYQDTLYVY  359

Query  642   SDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISI  466
             S RQFYR+CD+YGT+DFI G+A VV QNCNIYAR P  N+ NT+TAQ R+DPN+NTGI I
Sbjct  360   SQRQFYRDCDVYGTIDFICGDATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVI  419

Query  465   HNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTL  298
             HN ++TAA DL+ V    KTYLGRPW++YSRTV MKS+LD LI PAGW PW G+ AL+TL
Sbjct  420   HNSRITAAQDLRPVQGSFKTYLGRPWEKYSRTVIMKSNLDGLITPAGWYPWSGSLALSTL  479

Query  297   YYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YYGEY N+GAGA T  RV W GY VIT A EA KFTVGNF+AG SW+  T VPFT+GL
Sbjct  480   YYGEYMNSGAGAGTGGRVNWPGYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>ref|XP_006448208.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
 gb|ESR61448.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
Length=525

 Score =   501 bits (1291),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 356/529 (67%), Gaps = 30/529 (6%)
 Frame = -3

Query  1647  FLAIFVSTAVFG--YSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDF------L  1492
              + +F+   +F   ++  E+ + CSQTPYP+ C +Y + ++ +  ++ D++ F      L
Sbjct  6     LIQLFIHFLIFSLNFAHGELITSCSQTPYPEICNHYTATNFLSNLEL-DQTQFSFRDLNL  64

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST  1312
             KV  + A+   K       S   K      K A  DC +LY++ V  ++ ++  +   + 
Sbjct  65    KVTIDQAIHAHKLISTMDLSSFNKL----AKLALVDCKDLYDDTVNHLNRSMSSS---NP  117

Query  1311  ADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKG------  1156
              D+ TWLS A+ N ETC  GF D  +  ++  LP + S N S L+SN+LAI K       
Sbjct  118   IDSVTWLSAAIANQETCKNGFTDFNLHSHLQSLPFM-SGNFSKLLSNSLAITKSTVSSSS  176

Query  1155  --FtttnneattgyteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNA  985
               +    N        GFP WV   DR+LLQSS    KAD+VVAQDGSGNYKT++E V A
Sbjct  177   IPYAYKRNGGRRLLVNGFPTWVSAADRRLLQSSGVGPKADVVVAQDGSGNYKTISEGVAA  236

Query  984   AAKRSG-SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKS  808
             A K  G S R VIYVK GVY+ENVEI   +KN+ML+GDGI  TI+T +++  GGTTTF++
Sbjct  237   AVKLGGGSKRVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDATIVTSNKNGKGGTTTFRT  296

Query  807   ATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQF  628
             AT AV G GFI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS RQF
Sbjct  297   ATFAVSGQGFIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQF  356

Query  627   YRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKV  451
             YR CDIYGT DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +HN +V
Sbjct  357   YRNCDIYGTQDFIFGDAAVVLQSCNIYIRKPIGGQKNTVTAQGRKDPNENTGIIVHNSRV  416

Query  450   TAASDLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTG  271
             TA S     K+YLGRPWK+YSRTVFMK ++D +IDPAGWLPW G+FAL+TLYY EY N G
Sbjct  417   TAESGQGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYAEYMNIG  476

Query  270   AGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              GAST+ RVKW GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  477   TGASTSGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   500 bits (1288),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 280/538 (52%), Positives = 345/538 (64%), Gaps = 50/538 (9%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             M  L   F+ ++  +     V G +P    S CSQTPYP+ C Y+        G  + + 
Sbjct  1     MARLLLHFLSAYFVVLYVRVVDG-API---SSCSQTPYPEVCNYFXGNYXPTAGIDEIQF  56

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIK  1321
              F      + +  AK       ++         K A  DCLELYEN +            
Sbjct  57    PFRDRVLGVTMNQAKRLHLLVSAMDLSSSDERTKLAXADCLELYENTI------------  104

Query  1320  CSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPA-----VTSNNVSYLISNTLAINKG  1156
                            +L+TC  GF+D   + +   +     ++++N S L+SN+LAINK 
Sbjct  105   ---------------DLQTCLDGFIDFNPSSDQFQSFPSMSISTSNFSKLLSNSLAINKA  149

Query  1155  -------FtttnneattgyteGFPDWVRPGDRKLLQSS-AASKADIVVAQDGSGNYKTVT  1000
                     +          + GFP WV   DRKLLQSS AAS+ADIVVA DGSGNYKT++
Sbjct  150   AVSATSILSNNQAGGRRLLSNGFPTWVSAADRKLLQSSGAASRADIVVAHDGSGNYKTIS  209

Query  999   EAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggt  823
             EAV A+ K RSG+ R+VIYVKAGVY+ENVEI  K+KNIM++GDG   TI+TG+++V  G+
Sbjct  210   EAVAASVKLRSGTKRFVIYVKAGVYRENVEIKRKMKNIMIIGDGKDATIVTGNKNVQDGS  269

Query  822   tTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVY  643
             TTF+SAT AV G+GFI + +TF NTAG   HQAVALRS SD SVFY CSF+GYQDTLYV+
Sbjct  270   TTFRSATFAVSGNGFIARDMTFENTAGPQKHQAVALRSSSDGSVFYGCSFKGYQDTLYVH  329

Query  642   SDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISI  466
             + RQFYR CD+YGTVDFIFG+A  V QNCNIY R P  N+ N ITAQGRSD N+NTGISI
Sbjct  330   TQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSNQPNVITAQGRSDQNENTGISI  389

Query  465   HNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTL  298
             HN +V AA DL+ V    KTYLGRPW++YSRTVFMK+SLD LI P GW PW G+F L+TL
Sbjct  390   HNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTL  449

Query  297   YYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YYGEY NTG+GAST  RVKW GYHVITSA EA KFTVG F+ G SW+P T VP+ SGL
Sbjct  450   YYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  507



>ref|XP_009400700.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=525

 Score =   501 bits (1289),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 269/502 (54%), Positives = 346/502 (69%), Gaps = 20/502 (4%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +I+ WCS TP+P+PC YYL+R+  +G   KDK  F K++  LAL     A+ +    G  
Sbjct  34    DIEFWCSNTPHPEPCRYYLARNPYHGTP-KDKDQFYKLSLRLALDLTLRAQSHLKRRGPA  92

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTV--DPNIKCSTADAQTWLSTALTNLETCHAGFV  1246
             CR   EK AW DC +LY N V +++ T+   P   C+  D+QTWLS ALTN++TC  GF 
Sbjct  93    CRRSPEKTAWLDCWKLYANTVLQLNRTLAPPPGAGCTAFDSQTWLSAALTNIQTCPKGFR  152

Query  1245  DLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS  1066
             +   +  ++  V   NVS L+SN LAIN+        A   Y   F  W   G+R+LLQ 
Sbjct  153   ETRTSSELIGPVVRYNVSDLVSNCLAINR------PAAADAYRGRFSSWTMFGNRRLLQL  206

Query  1065  SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR---YVIYVKAGVYKENVEIGSKLK  895
             S A  AD+VVA+DGSGN++T+ EA++AA+KR    R   +VI + AGVY E +++ S L 
Sbjct  207   STA--ADLVVAKDGSGNFRTIKEALDAASKRMQGRRGSKFVIRITAGVYNEYLQVVSSLS  264

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             N+++VGDGIGKTIITGSRSV  G TT   AT +V GDGF+  GITFRNT G  + QAVAL
Sbjct  265   NLVMVGDGIGKTIITGSRSVANGYTTLSCATFSVFGDGFVASGITFRNTFGPGS-QAVAL  323

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
              S SD SVFY+CS EGYQDTL+VY+ RQFYRECDIYGT+DFIFGNAA V Q CNIYAR P
Sbjct  324   LSASDRSVFYRCSIEGYQDTLFVYTQRQFYRECDIYGTIDFIFGNAAAVLQRCNIYARRP  383

Query  534   PN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSRTVFMK  370
              + ++N ITAQGRSDPNQNTGI I +  +  A++L    + V++YLGRPW +YSRT++++
Sbjct  384   RHGESNVITAQGRSDPNQNTGIVIQSSNIKPATELLPVRRTVRSYLGRPWMQYSRTLYLQ  443

Query  369   SSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFT  190
             + +DS+ID AGWLP+ G+FAL+TLYY E+ NTG GA  + RVKW GYHVI  A+    FT
Sbjct  444   NYIDSIIDHAGWLPFRGSFALSTLYYAEFENTGPGARMSRRVKWPGYHVIRRASIVRPFT  503

Query  189   VGNFIAGGSWLPATNVPFTSGL  124
             VG FIAGGSW+P+T VPF   L
Sbjct  504   VGRFIAGGSWIPSTGVPFNPSL  525



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 339/471 (72%), Gaps = 18/471 (4%)
 Frame = -3

Query  1509  DKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV--  1336
             ++S    V+  +AL +A  A+     LG       E+AAW +C+ELYE  V +++ T+  
Sbjct  11    EESHIHHVSIKVALDHAVQARARAIRLGLMYLDKNEQAAWSNCIELYEATVHQLNLTLKL  70

Query  1335  DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGN-ILPAVTSNNVSYLISNTLAINK  1159
              P    S  D  +WL  ALTNL+TC   F ++ V+G+ I P +T  +VS LISN+LAI +
Sbjct  71    QPLHPNSHFDEFSWLGAALTNLDTCRTSFAEVNVSGSGIEPLLT--HVSELISNSLAITR  128

Query  1158  GFtttnneattgyteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNAA  982
                         Y    PDWV P DRKLL+ S    KAD+VVA+DG+G++ ++++AV+ A
Sbjct  129   -----VGHQEDSYNRRLPDWVLPKDRKLLEVSEREVKADLVVAKDGTGDFSSISKAVDEA  183

Query  981   AKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSAT  802
             +K SG+ R+VIYVK GVYKE V +G  ++N+MLVGDGIGKT+ITGSRS GGG+TT+ SAT
Sbjct  184   SKGSGNKRFVIYVKKGVYKEYVNVG--MRNLMLVGDGIGKTVITGSRSAGGGSTTYNSAT  241

Query  801   VAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYR  622
              AV G+ FI +GITFRNTAG A HQAVALRS SDLSVFYQCSF+GYQDTLY +S RQFYR
Sbjct  242   FAVTGERFIARGITFRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLYAHSLRQFYR  301

Query  621   ECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTA  445
             EC IYGTVDFIFGNAAVVFQNCNIY R P   + NTITAQGR+DPNQNTGISI NC+VTA
Sbjct  302   ECKIYGTVDFIFGNAAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQNCRVTA  361

Query  444   ASDLKGVK----TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSN  277
             A DL+ V+    T+LGRP KEYSRTV+M++ +D LI PAGWL W G+FAL TL+YGE+ N
Sbjct  362   AKDLRPVRSSFQTFLGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALETLFYGEFRN  421

Query  276   TGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             TG G++T+ RVKWGGYH+IT  + A +FT    IAG  WLP++ +PF   L
Sbjct  422   TGPGSNTSKRVKWGGYHIITDPSTALEFTARILIAGEMWLPSSGLPFKLDL  472



>gb|KDO64577.1| hypothetical protein CISIN_1g047288mg [Citrus sinensis]
Length=508

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 272/533 (51%), Positives = 339/533 (64%), Gaps = 39/533 (7%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQI-KDK  1504
             M  L  I +     IF    V G    E+ + CSQTPYP+ C +Y + ++ +  ++ + +
Sbjct  1     MDKLVLIQLFIHFLIFSLNFVHG----ELITSCSQTPYPEICNHYTATNFLSNLELGQTQ  56

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI  1324
               F  +   + +  A +A     ++     +   K A  DC +LY++ V  ++ ++  + 
Sbjct  57    FSFRDLNLKVTIDQAIHAHKLISTMDLSSFNKLAKLALVDCKDLYDDTVNHLNRSMSSS-  115

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKG--  1156
               +  D+ TWLS A+ N ETC  GF D  +  ++  LP + S N S L+SN+LAI K   
Sbjct  116   --NPIDSVTWLSAAIANQETCKNGFTDFNLHSHLQSLPFM-SGNFSKLLSNSLAITKSTV  172

Query  1155  ------FtttnneattgyteGFPDWVRPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTE  997
                   +    N        GFP WV   DR+LLQSS    KAD+VVAQDGSGNYKT++E
Sbjct  173   SSSSIPYAYKRNGGRRLLVNGFPTWVSAADRRLLQSSGVGPKADVVVAQDGSGNYKTISE  232

Query  996   AVNAAAKRSG-SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggtt  820
              V AA K  G S R VIYVK GVY+ENVEI   +KN+ML+GDGI                
Sbjct  233   GVAAAVKLGGGSKRVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDA--------------  278

Query  819   TFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYS  640
                +    V G GFI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS
Sbjct  279   ---TIVTTVSGQGFIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYS  335

Query  639   DRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIH  463
              RQFYR CDIYGT DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +H
Sbjct  336   QRQFYRNCDIYGTQDFIFGDAAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVH  395

Query  462   NCKVTAASDLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEY  283
             N +VTA S     K+YLGRPWK+YSRTVFMK ++D +IDPAGWLPW G+FAL+TLYYGEY
Sbjct  396   NSRVTAESGQGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEY  455

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G GAST+ RVKW GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  456   MNIGTGASTSGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  508



>ref|XP_008354203.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Malus domestica]
Length=534

 Score =   499 bits (1286),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 285/521 (55%), Positives = 354/521 (68%), Gaps = 17/521 (3%)
 Frame = -3

Query  1647  FLAIFVSTAV---FGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKN  1477
             F+++F  T +        + I++WC +TP+P+ C Y LS S       K  S+F K+   
Sbjct  18    FISLFFHTTLXRXHHRHXSRIRTWCRKTPHPESCNYCLSNSIHRFPP-KHTSEFRKMLVQ  76

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTAD  1306
             +AL+ A +A   T+  G  CR+  EK+AW DCL L+EN V +++ T++      KCS  D
Sbjct  77    VALERALDAITYTFQYGQNCRNNNEKSAWADCLXLFENTVNQLNVTLEGLGNKRKCSNFD  136

Query  1305  AQTWLSTALTNLETCHAGFVDLGVTGNILPAV-TSNNVSYLISNTLAINKGFtttnneat  1129
             AQTWLS ALTN+ TC  G ++L VT  I P   +SNNVS LISN+LAI  G      E +
Sbjct  137   AQTWLSAALTNIHTCRVGSLELNVTDFITPIYRSSNNVSELISNSLAI--GSQLLGTEES  194

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVI  949
                +E FP+WV   DR+LLQ+S   +A++VVA+DGSG + TV  A++AAA+R    +++I
Sbjct  195   YNESEKFPNWVSKHDRRLLQASNI-RANLVVAKDGSGXFSTVQAALDAAARRRVKSKFII  253

Query  948   YVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQ  769
             YVK GVY EN+++ +    IMLVG GI  TIIT SRSV  G TT+ SAT  + G GFI +
Sbjct  254   YVKKGVYXENIQVSNTNSKIMLVGAGIRYTIITSSRSVSEGYTTYNSATAGINGXGFIAR  313

Query  768   GITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFI  589
             GITF NTAG    QAVALRS SDLSVFY+C+F+GYQDTL VYS RQFYREC I+GT+DFI
Sbjct  314   GITFSNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVYSQRQFYRECYIFGTIDFI  373

Query  588   FGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----  424
             FGNAA VFQNC IY R P   + N ITAQGR+DP QNT ISIHN +V AA+DLK V    
Sbjct  374   FGNAAAVFQNCMIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSQVRAAADLKPVAGSY  433

Query  423   KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEYSNTGAGASTANR  247
             KTYLGRPW +YSR VFMK  LD+L++PAGWL W   NFAL+TLYYGEY N G G+ T  R
Sbjct  434   KTYLGRPWMQYSRVVFMKCYLDNLVNPAGWLRWQRSNFALSTLYYGEYQNFGPGSCTRYR  493

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             VKW G+H ITS   AS FT G+ IAG SWLP T VPFT GL
Sbjct  494   VKWPGFHAITSPNVASMFTAGSLIAGWSWLPTTGVPFTMGL  534



>ref|XP_011101124.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Sesamum indicum]
Length=527

 Score =   498 bits (1281),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 277/531 (52%), Positives = 352/531 (66%), Gaps = 18/531 (3%)
 Frame = -3

Query  1680  MTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKS  1501
             +  +   F  SFL  +   A    +   I  WCS TP+P PC Y++++        K + 
Sbjct  3     IITIHIFFFVSFLCFYSLLADVETTNNGIDWWCSTTPHPAPCTYFMAQLTP-----KSRE  57

Query  1500  DFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTT---VDP  1330
             +F  +    AL  A +A     ++G++CRS  +     DC  L EN + +++TT   +  
Sbjct  58    EFRTMTIQAALDRAVHAHTQANNVGSRCRSKRKTIVNRDCNNLIENTILQLNTTLQSIQT  117

Query  1329  NIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFt  1150
             N   +  DAQTWLSTALTN+E C +G +DL VT    P + S NVS LISN+LA N G  
Sbjct  118   NASFTNFDAQTWLSTALTNIEICRSGSLDLNVTKFSSP-ILSGNVSELISNSLATNGGLL  176

Query  1149  ttnneattgyteG-FPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVN-AAA  979
               ++ +     E  +P WV   DR+LLQ    AS+A+++VA+DGSG+++++  A+N A A
Sbjct  177   DNSSSSYHSSDENGYPAWVSGRDRELLQDLELASRANVIVAKDGSGHFRSIQAAINYATA  236

Query  978   KRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATV  799
             +R G+GR V+YVK GVY+EN+ I   +  +MLVGDG+  T+ITGSRSV  G TT+ SATV
Sbjct  237   RRVGNGRVVVYVKRGVYRENILISRTMNKVMLVGDGLRYTVITGSRSVSTGFTTYSSATV  296

Query  798   AVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRE  619
              + G GFI +GITFRNTAG    QAVALRS SDLSVFY C FEGYQDTL+V++ RQFY+ 
Sbjct  297   GIDGIGFIARGITFRNTAGPQKGQAVALRSASDLSVFYACGFEGYQDTLFVHAQRQFYKA  356

Query  618   CDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAA  442
             C IYGT+DFIFGNAAVVFQNC IY R P   + N ITAQGR DP QNTGISIHN +V  A
Sbjct  357   CYIYGTIDFIFGNAAVVFQNCIIYVRRPLVGQANVITAQGRGDPFQNTGISIHNSRVMPA  416

Query  441   SDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSN  277
              DL+ V    KTYLGRPW++YSRTV MKS LDSL+ P GW  W D +FAL+TLYYGEY N
Sbjct  417   PDLRPVVRSFKTYLGRPWQQYSRTVIMKSYLDSLVSPEGWSRWEDSDFALSTLYYGEYQN  476

Query  276   TGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              G G ST NRVKW GYH I S   A++FTV N IAG +WLP+T VPFT+GL
Sbjct  477   FGPGGSTRNRVKWPGYHAIRSPNVANRFTVANLIAGRAWLPSTGVPFTAGL  527



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   497 bits (1279),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 275/516 (53%), Positives = 350/516 (68%), Gaps = 37/516 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSY-SNGGQIKDKSDF----LKVAKNLALQYAKNAKDNTYSLGTK  1420
             CSQTPYPQ C ++++ +  S     + +S F    LKV  + A+   +     + +    
Sbjct  13    CSQTPYPQVCNHFINTNLLSTLDDHEQRSTFRDLTLKVTMDQAIGAHQLVSSLSLNSLED  72

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
              R+   K AW DCLEL+E+ V KI+ ++  N   +  DA TWLS ++ N +TC  GF +L
Sbjct  73    ERA---KLAWNDCLELHEDTVDKINCSIRSN---NALDANTWLSASIANQQTCQNGFTNL  126

Query  1239  GVTGNILPAV-----------------TSNNVSYLISNTLAINKGFtttnneattgyteG  1111
              +  + L +                   S + +    + L  +K      +   +   +G
Sbjct  127   KIPDSYLQSFPNYVTLTSNLSKLLSNSLSLHKASTSPSALHFSKQVRGKRHLLLSESDDG  186

Query  1110  FPDWVRPGDRKLLQSSAA-SKADIVVAQDGSGNYKTVTEAVNAAAKRSGS-GRYVIYVKA  937
             FP+WV   DRKLL S+   +KADI+VAQDGSGNYKT++EAV  A  RSGS  R+VI+VKA
Sbjct  187   FPEWVSFADRKLLHSTGGGAKADILVAQDGSGNYKTISEAV--ANLRSGSTERFVIHVKA  244

Query  936   GVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITF  757
             GVYKENVEI   +KNIM +GDGI  TI+TG+R+   G+TT+ SAT  V G+GFI QG+TF
Sbjct  245   GVYKENVEIKKTMKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVQGEGFIAQGMTF  304

Query  756   RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNA  577
              NTAG   HQAVALRSG+D SVFY+CSF+GYQDTLYVY+ RQFYRECD+YGTVDFI G+A
Sbjct  305   ENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYAQRQFYRECDVYGTVDFICGDA  364

Query  576   AVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYL  412
               V QNCN+Y R P  N+ NT+TAQ R+D N+NTGI IH+ +VTAA DL+ V    +TYL
Sbjct  365   TAVLQNCNMYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAVQGSFRTYL  424

Query  411   GRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGG  232
             GRPW++YSRTV MKS LD LIDPAGW PW+GNFAL+TLYYGEY N+GAGA+T  RVKW G
Sbjct  425   GRPWQKYSRTVIMKSDLDGLIDPAGWFPWNGNFALSTLYYGEYMNSGAGAATGGRVKWPG  484

Query  231   YHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             Y VITSA EA KFTVGN +AG SW+PAT VPF++GL
Sbjct  485   YRVITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  520



>ref|XP_006357927.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Solanum tuberosum]
Length=534

 Score =   497 bits (1280),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 281/510 (55%), Positives = 352/510 (69%), Gaps = 26/510 (5%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLS-----RSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTY  1435
             +I  WCS TP+P+PC+Y++S     R+Y    + K K+DF  +   +AL+ A   ++++ 
Sbjct  33    DINWWCSTTPHPEPCKYFMSDATLQRTY----KPKCKADFRIMTTEVALEQALLVQNHSK  88

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNIKCSTADAQTWLSTALTNLE  1267
             ++G   R   +K  W DC +L ++ + +++ T+      +  C+  DAQTWLS +LTN+E
Sbjct  89    NIGQHFRGKRKKLVWMDCDKLIDDTIHQLNRTLHGIGSNSTSCTEFDAQTWLSASLTNIE  148

Query  1266  TCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPG  1087
             TC +G   L V+ N+L    S NVS LISN+LAIN     + N    G    FP+WV   
Sbjct  149   TCLSGSNQLNVS-NVLHPTLSANVSQLISNSLAINGELVNSQNSTEIGG---FPNWVTSR  204

Query  1086  DRKLLQSSA---ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENV  916
             +RKLLQSS    ASKA  VVAQDGSGN++++  AVNAAA +    R +IY+K GVY+ENV
Sbjct  205   ERKLLQSSTRSLASKAIYVVAQDGSGNFRSIQAAVNAAANKVSDERTIIYIKKGVYRENV  264

Query  915   EIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAA  736
              IG  +  IMLVG G+  TIITGSRS  GG TT+ +ATV V G GFI +GITFRNTAG  
Sbjct  265   AIGPSMSKIMLVGAGLRYTIITGSRSAAGGFTTYSTATVGVDGSGFIARGITFRNTAGPK  324

Query  735   NHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNC  556
             N QAVALRS SDLSVFY C FEGYQDT++V S RQFY+ C +YGT+DFIFGNAAVVFQNC
Sbjct  325   NGQAVALRSASDLSVFYACGFEGYQDTIFVQSQRQFYKTCHVYGTIDFIFGNAAVVFQNC  384

Query  555   NIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEY  391
              IY R P   + N ITAQGR DP QNTGISIHN ++TAA DL    +  KTY+GRPW+EY
Sbjct  385   VIYVRRPLVGQVNVITAQGRGDPFQNTGISIHNSRITAAPDLAPVVRAFKTYMGRPWQEY  444

Query  390   SRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITS  214
             SRTV ++S +D L+ P+GWLPW + +FA  TLYYGEY N G GAST  RVKW GYHVIT 
Sbjct  445   SRTVILRSYIDRLVSPSGWLPWLNSDFAFKTLYYGEYGNFGPGASTRYRVKWPGYHVITD  504

Query  213   ATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             A EASKFTV N + G SWLP+T VPFTSGL
Sbjct  505   AKEASKFTVANLVGGRSWLPSTGVPFTSGL  534



>ref|XP_007131333.1| hypothetical protein PHAVU_011G005000g [Phaseolus vulgaris]
 gb|ESW03327.1| hypothetical protein PHAVU_011G005000g [Phaseolus vulgaris]
Length=530

 Score =   496 bits (1278),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 271/501 (54%), Positives = 336/501 (67%), Gaps = 12/501 (2%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I  WCSQTPYP PC+YY+ +   +  ++K KS+F  +  +LAL  A   +      G K 
Sbjct  32    IDWWCSQTPYPDPCKYYMKQQSHHHHKLKHKSEFRAILIHLALNRAMIMRRKAREFGHKG  91

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTADAQTWLSTALTNLETCHAGFV  1246
              +  +K+ + DCL+LY+N V  ++ T++       CS  DAQTWLSTA TN+ETC  G +
Sbjct  92    ITKKQKSVFRDCLKLYDNTVFHLNRTIEGLHQKKSCSPFDAQTWLSTARTNIETCQNGAL  151

Query  1245  DLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnnea-ttgyteGFPDWVRPGDRKLLQ  1069
             +LGV   + P     NV+ +ISN L +N  F        T      FP W    +RKLLQ
Sbjct  152   ELGVQDFMAP-TERCNVTEIISNGLFVNWAFLKYEKVHYTEDAEAEFPSWFSTHERKLLQ  210

Query  1068  SSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNI  889
             SS+  +A +VVA+DGSG++K+V  A+NAAAKR    R++I+VK+GVY+EN+E+     NI
Sbjct  211   SSSV-RAHLVVAKDGSGHFKSVQAAINAAAKRRLKSRFIIHVKSGVYRENIEVDKTNDNI  269

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             ML GDG+  TIIT  RSV  G TT+ SAT  + G  FI + ITFRNTAG    QAVALRS
Sbjct  270   MLFGDGMRNTIITSGRSVNAGFTTYSSATAGIDGLHFIARDITFRNTAGPLKGQAVALRS  329

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  529
              SDLSVFY+C+ EGYQDTL V++ RQFYR C IYGTVDFIFGNAAVVFQNC I  R P N
Sbjct  330   ASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFIFGNAAVVFQNCVILVRRPLN  389

Query  528   -KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
              + N ITAQGR DP QNTG SIHN ++ AA DL+ V     T+LGRPW+ YSR V MKS 
Sbjct  390   GQANMITAQGRDDPFQNTGFSIHNSQIRAAPDLRPVVGKFNTFLGRPWQRYSRVVVMKSF  449

Query  363   LDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
             LDS++ P GW PW D NFAL+TLYYGEY N G G+ST NRV W G+H I S  EAS+FTV
Sbjct  450   LDSMVSPMGWSPWGDSNFALDTLYYGEYKNFGPGSSTRNRVLWPGFHSIKSPNEASRFTV  509

Query  186   GNFIAGGSWLPATNVPFTSGL  124
              N +AG +WLPAT VPFTSGL
Sbjct  510   ANLLAGRTWLPATGVPFTSGL  530



>ref|XP_011070723.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase [Sesamum indicum]
Length=511

 Score =   494 bits (1273),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 262/500 (52%), Positives = 342/500 (68%), Gaps = 16/500 (3%)
 Frame = -3

Query  1590  SWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRS  1411
             S C QTPYP+ C   ++ +       +D+ +   ++    L  A+NA      +      
Sbjct  17    SICIQTPYPELCNSLIT-TIPQTTLDRDQFNLRDISLRETLAQARNANKLISDMDLTSFD  75

Query  1410  GGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
                K+AW DCLELYE+ + +++ +          DAQTWLS A+ N +TC  GF+D+ + 
Sbjct  76    ELGKSAWADCLELYEDTIDQLNRSSGRG--TGAVDAQTWLSAAIANEKTCKTGFLDMKLF  133

Query  1230  GNILP---AVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLL--QS  1066
               +      ++ ++    + N+LAI K          +     FPDWV  G+RK+L   S
Sbjct  134   SQLKSFNLMLSDDDFPKFLRNSLAIIKAMNVRERRLLSDERN-FPDWVSAGNRKILVETS  192

Query  1065  SAASKADIVVAQDGSGNYKTVTEAVNAAAK-RSGSGRYVIYVKAGVYKENVEIGSKLKNI  889
               + KADIVVA+DGSG+Y+T+++A+ AAAK R+G+ R+VIYVK GVYKENVE+   +KN+
Sbjct  193   GGSIKADIVVAEDGSGDYRTISDALAAAAKQRNGTKRFVIYVKRGVYKENVEVKKSMKNL  252

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             M VGDGI  TI+TGS++V  G+TTF+SAT A+ GDGFI + +TF NTAGA  HQAVALRS
Sbjct  253   MFVGDGIDATIVTGSKNVQDGSTTFRSATFAISGDGFIARDMTFENTAGAHKHQAVALRS  312

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-P  532
              SD S+FY+CSF+GYQDTLYV+S RQFYR+CDIYGT+DFIFG+A  V QNCNIY R P P
Sbjct  313   SSDFSIFYRCSFKGYQDTLYVHSQRQFYRDCDIYGTIDFIFGDAVAVLQNCNIYVRKPMP  372

Query  531   NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMKSS  364
             N+ NT+TAQGRSDPN+NTGI IHN  V A SDL+ V    ++YLGRPW++YSRTVFMK +
Sbjct  373   NQKNTVTAQGRSDPNENTGIIIHNSHVRAFSDLRPVQDSYRSYLGRPWRKYSRTVFMKCT  432

Query  363   LDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVG  184
             ++ LIDPAGWLPW G F L+TLYYGEY NTG+GA T  RVKW G+HVITS  EA KF+ G
Sbjct  433   IEGLIDPAGWLPWSGAFGLSTLYYGEYMNTGSGARTNGRVKWPGFHVITSPAEAGKFSAG  492

Query  183   NFIAGGSWLPATNVPFTSGL  124
              F+A G  + A  VPFT+GL
Sbjct  493   KFLA-GEXITAAGVPFTAGL  511



>ref|XP_003599460.1| Pectinesterase [Medicago truncatula]
Length=528

 Score =   495 bits (1274),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 272/524 (52%), Positives = 346/524 (66%), Gaps = 16/524 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
               F+ S  +I  S    G S + I  WC+ TP+P+PC++Y ++  +N  +IK + +F ++
Sbjct  11    LFFLSSIFSIVSSRK--GPSSSNIDWWCNLTPHPKPCKHYTTQ-MNNHFKIKHRIEFREM  67

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNIKC  1318
                LAL  A   +   +    +  S   K    DCL+LYEN +  ++ T++     +  C
Sbjct  68    LVQLALNQALTMQKEAHENSQQQNSSVHKTVHGDCLKLYENTIFHLNRTLEGLNNASKNC  127

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             S  DAQTWL+T+LTN+ETC +G ++L         +   NV+ +I N LAIN  F     
Sbjct  128   SPNDAQTWLTTSLTNIETCKSGALELNAQD--FNFIMQANVTEMIRNILAINMHFLNHKT  185

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
             E         P+W    +RKLLQS +  K ++VVA+DGSG YKTV  A+NAAAKR    R
Sbjct  186   ETEIEEGS-LPNWFSVHERKLLQSKSPMKFNLVVAKDGSGQYKTVQAALNAAAKRKYKTR  244

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             YVI+VK GVYKEN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  + G  F
Sbjct  245   YVIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHF  304

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C IYGTV
Sbjct  305   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCTISGYQDTLMAHAQRQFYRQCFIYGTV  364

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV-  424
             DFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC++ AASDLK V 
Sbjct  365   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIRAASDLKPVV  424

Query  423   ---KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGAST  256
                KT+LGRPW++YSR + MK+ +D+L+ P GW PW D +FA +TLYYGEY N G G+ST
Sbjct  425   DKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGSST  484

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NRV W GYHVIT+  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  485   TNRVNWPGYHVITNPKEASKFTVAGLLAGPTWLAKTTVPFTSGL  528



>gb|AES69711.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=526

 Score =   494 bits (1272),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 273/524 (52%), Positives = 347/524 (66%), Gaps = 18/524 (3%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
               F+ S  +I  S    G S + I  WC+ TP+P+PC++Y ++  +N  +IK + +F ++
Sbjct  11    LFFLSSIFSIVSSRK--GPSSSNIDWWCNLTPHPKPCKHYTTQ-MNNHFKIKHRIEFREM  67

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNIKC  1318
                LAL  A   +   +    +  S   K    DCL+LYEN +  ++ T++     +  C
Sbjct  68    LVQLALNQALTMQKEAHENSQQQNSSVHKTVHGDCLKLYENTIFHLNRTLEGLNNASKNC  127

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             S  DAQTWL+T+LTN+ETC +G ++L         +   NV+ +I N LAIN  F     
Sbjct  128   SPNDAQTWLTTSLTNIETCKSGALELNAQD--FNFIMQANVTEMIRNILAINMHFLNHKT  185

Query  1137  eattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGR  958
             E   G     P+W    +RKLLQS +  K ++VVA+DGSG YKTV  A+NAAAKR    R
Sbjct  186   EIEEGS---LPNWFSVHERKLLQSKSPMKFNLVVAKDGSGQYKTVQAALNAAAKRKYKTR  242

Query  957   YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  778
             YVI+VK GVYKEN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  + G  F
Sbjct  243   YVIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGLHF  302

Query  777   IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  598
             I + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C IYGTV
Sbjct  303   IARDITFQNTAGPHKGQAVALRSASDLSVFYRCTISGYQDTLMAHAQRQFYRQCFIYGTV  362

Query  597   DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV-  424
             DFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC++ AASDLK V 
Sbjct  363   DFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIRAASDLKPVV  422

Query  423   ---KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGAST  256
                KT+LGRPW++YSR + MK+ +D+L+ P GW PW D +FA +TLYYGEY N G G+ST
Sbjct  423   DKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGSST  482

Query  255   ANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              NRV W GYHVIT+  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  483   TNRVNWPGYHVITNPKEASKFTVAGLLAGPTWLAKTTVPFTSGL  526



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   491 bits (1265),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 336/462 (73%), Gaps = 15/462 (3%)
 Frame = -3

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV--DPNIKCSTAD  1306
              +AL +A  A+     LG       E++AW DC+ELYE  VQ++D T+  +P    S +D
Sbjct  4     QVALDHAVQARARAIGLGLMNLDKHEQSAWSDCIELYEATVQQLDLTLRLNPLNPRSHSD  63

Query  1305  AQTWLSTALTNLETCHAGFVDLGVT-GNILPAVTSNNVSYLISNTLAINKGFtttnneat  1129
               +WLS ALTNL TC   F ++ V+   I P +T  NVS LISN+LAI +  +  +    
Sbjct  64    ECSWLSAALTNLNTCRTSFSEVNVSVSTIEPLLT--NVSKLISNSLAIIR-LSRRHAHGP  120

Query  1128  tgyteGFPDWVRPGDRKLLQSSAASK--ADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRY  955
               +  GFPDW+   DRKLL+ S   +  AD+VVA+DG+G++ +V +AV+ A+K  G+ R 
Sbjct  121   GSHNRGFPDWLLAEDRKLLEVSEREEMEADLVVAKDGTGDFTSVGKAVDEASKGGGNKRI  180

Query  954   VIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFI  775
             VIYVK GVY+ENV +  +++N+MLVGDGIGK++ITGS+S GGG+TT+ SA  AV G+ F+
Sbjct  181   VIYVKKGVYEENVNV--EMRNLMLVGDGIGKSVITGSKSAGGGSTTYNSAAFAVTGEKFM  238

Query  774   GQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVD  595
              +GITFRNTAG A HQAVALRS SDLSVF+QCSFEGYQDTLYV+S RQFYREC++YGTVD
Sbjct  239   ARGITFRNTAGPAKHQAVALRSNSDLSVFHQCSFEGYQDTLYVHSLRQFYRECEVYGTVD  298

Query  594   FIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----  430
             FIFGNAAVVFQ+CNIY R P   + NTITAQGR+DPNQNTGISI  C+V AA DL+    
Sbjct  299   FIFGNAAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQYCRVRAAKDLRPAQS  358

Query  429   GVKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTAN  250
               +T+LGRPWKE SRTV+M++ +D LI PAGWL W G FAL TL+YGE+ NTG G++T+ 
Sbjct  359   SFETFLGRPWKENSRTVYMETYMDDLISPAGWLEWSGGFALETLFYGEFRNTGPGSNTSK  418

Query  249   RVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             RVKWGGYHVIT  + AS+FT  N IAG  WLP+T VPFT  L
Sbjct  419   RVKWGGYHVITDPSAASEFTARNLIAGEMWLPSTGVPFTLDL  460



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   493 bits (1270),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 284/521 (55%), Positives = 370/521 (71%), Gaps = 18/521 (3%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
              I +F A+ +  A+   +   I S CS+TPYP  C   ++ S     Q K +S F  +A 
Sbjct  4     LIANFFALSLIMAINVATSNPILS-CSETPYPYVCSSVVNTS-PLIAQAKTQSGFRNLAL  61

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQ  1300
               AL  A  A +   ++         KAAW DCLE+ ++ +  +++++      S  DAQ
Sbjct  62    LAALDRAVRAHELASAMDISSLDEPLKAAWADCLEVCQDTIGNLNSSM---SSSSYDDAQ  118

Query  1299  TWLSTALTNLETCHAGFVDLGVTGNI--LPAVTSNNVSYLISNTLAINKGFtttnneatt  1126
             TWLS A+ N +TC  GF++LG +  +  LP + S+N+S L+SN+LAINK      +    
Sbjct  119   TWLSAAMANQQTCRNGFIELGSSFPLDSLPFM-SHNISELLSNSLAINKAMAPAKSGGNR  177

Query  1125  gyteG-FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGRYV  952
             G     FP+W+   DRK LQSSA + AD+VVA+DGSG+Y T++ A+ AA+K+S G+ R+V
Sbjct  178   GLLLDGFPNWLSASDRKFLQSSAIN-ADLVVAKDGSGDYDTISAAIAAASKQSNGTSRFV  236

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             I+VKAGVY EN++  + +KN+ ++GDGI  TI+TGS++V  G+TTF+SAT AV GDGFI 
Sbjct  237   IHVKAGVYNENID--TSMKNLTIIGDGINATIVTGSKNVKDGSTTFRSATFAVTGDGFIA  294

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +G+TF+NTAG   +QAVA RS SDLSV+YQCSFEGYQDTLYV+S +QFYR C+IYGT+DF
Sbjct  295   RGMTFQNTAGPEKYQAVAFRSSSDLSVYYQCSFEGYQDTLYVHSKQQFYRNCNIYGTIDF  354

Query  591   IFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK--  421
             IFG+A VVFQNCNIY R P   + NT+TAQGR+D   +TGISIH+  VTAA DLK V+  
Sbjct  355   IFGDATVVFQNCNIYVRKPMTGQKNTVTAQGRTDERTDTGISIHDSVVTAAPDLKPVQSS  414

Query  420   --TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANR  247
               TYLGRPWK+YSRTV+MK+ LDSLIDPAGWL WDG+FAL TLYYGEY NTGAGA T+ R
Sbjct  415   FQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGAGADTSQR  474

Query  246   VKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             V W GYHVITSA EAS+FTVGNF++G SW+PAT VP+T GL
Sbjct  475   VTWPGYHVITSAAEASQFTVGNFLSGNSWIPATGVPYTPGL  515



>ref|XP_007148706.1| hypothetical protein PHAVU_005G007800g [Phaseolus vulgaris]
 gb|ESW20700.1| hypothetical protein PHAVU_005G007800g [Phaseolus vulgaris]
Length=535

 Score =   494 bits (1271),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 279/536 (52%), Positives = 358/536 (67%), Gaps = 17/536 (3%)
 Frame = -3

Query  1692  LITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ-  1516
             LI K T    +F+ SF ++  S+     S + I  WC+ TP+P+PC+YY++ + +     
Sbjct  4     LIAK-TCFTLLFMSSFFSL-ASSRRGPASSSNIDWWCNLTPHPEPCKYYITTNQTKSHHF  61

Query  1515  --IKDKSDFLKVAKNLALQYAK-NAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKID  1345
               IK ++ F  +    AL  A    K+   S  +   +   +    DCL+LY   +  ++
Sbjct  62    TLIKHRTIFRGMLAEHALNQALIMQKEALESEQSNMPTKNHRTVHGDCLKLYGKTIFHLN  121

Query  1344  TTVD---PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNT  1174
              T++    N  CS+ DAQTWLSTALTN++TC  G V+LGV     P    NNV+ ++ N+
Sbjct  122   RTLECFHGNQNCSSVDAQTWLSTALTNIQTCQDGTVELGVEDFKAPN-NKNNVTEMLRNS  180

Query  1173  LAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEA  994
             LAIN  F   +++A     E FP W    +RKLLQS A  KA  VVA+DGSGN+++V +A
Sbjct  181   LAINMDFMKHDHQAQKADEEAFPSWFSKPERKLLQS-ATIKAHAVVAKDGSGNFRSVQDA  239

Query  993   VNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTF  814
             +NAAAKR    R+VI+VK GVYKEN+E+     NIMLVGDGI  TIIT SRSV  G TT+
Sbjct  240   LNAAAKRKVKTRFVIHVKKGVYKENIEVAVHNDNIMLVGDGISNTIITSSRSVQQGYTTY  299

Query  813   KSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDR  634
              SAT  + G  FI + +TF+NTAGA   QAVALRS SDLSVFY+C+  G+QDTL  ++ R
Sbjct  300   SSATAGIDGLHFIARDMTFQNTAGAQKGQAVALRSASDLSVFYRCAVMGFQDTLMAHAQR  359

Query  633   QFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNC  457
             QFYR+C IYGT+DFIFGNAAVVFQNC IYAR P   + N ITAQGR DP QNTGISIHN 
Sbjct  360   QFYRQCYIYGTIDFIFGNAAVVFQNCYIYARKPLEGQANMITAQGRGDPFQNTGISIHNS  419

Query  456   KVTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYY  292
             ++ AA DLK V    KT+LGRPW++YSR V MK+ +D+L+ P GW PW D NFA +TLYY
Sbjct  420   QIRAAPDLKPVVDKYKTFLGRPWQQYSRVVVMKTFMDTLVSPLGWSPWDDSNFAQDTLYY  479

Query  291   GEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             GEY N G GAST++RVKW G+HVITS TEAS+FTV   +AG +WL +T VPFTSGL
Sbjct  480   GEYQNYGPGASTSSRVKWPGFHVITSPTEASQFTVTRLLAGPTWLGSTTVPFTSGL  535



>ref|XP_003533518.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
Length=534

 Score =   493 bits (1269),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 344/505 (68%), Gaps = 14/505 (3%)
 Frame = -3

Query  1602  TEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGT  1423
             + I  WC+QTPYP+PC YY+  S+    Q+K KS+F  +  +LAL+ A   +     LG 
Sbjct  32    SNIDWWCNQTPYPEPCRYYIKHSHYQHKQLKHKSEFRTILVHLALERAVIMRRKARELGG  91

Query  1422  KCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTADAQTWLSTALTNLETCHAG  1252
                +  +K+ + DCL+LY+N V  ++ T++       CS  DAQTWLSTA TN+ETC   
Sbjct  92    NGVTKKQKSVFRDCLKLYDNTVFHLNRTLEGLHVKTSCSPFDAQTWLSTARTNIETCQNW  151

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGF---tttnneattgyteGFPDWVRPGDR  1081
              ++LG+  +++PA   N ++ +ISN L +N  F      +  A       FP W    +R
Sbjct  152   ALELGIRDSMVPAERCN-LTEIISNGLFVNWAFLKYREAHYTADAEEDALFPRWFSMHER  210

Query  1080  KLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             KLLQSS+  +A +VVA+DGSG++++V  A+NAAA+R    R++I+VK GVY+EN+E+   
Sbjct  211   KLLQSSSI-RAHLVVAKDGSGHFRSVQAAINAAARRRLKSRFIIHVKRGVYRENIEVDKT  269

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               N+MLVGDG+  TIIT +RSV  G TT+ SAT  + G  FI + ITFRNTAG    QAV
Sbjct  270   NDNVMLVGDGMRNTIITSARSVQAGYTTYSSATAGIDGLHFIARDITFRNTAGPLRGQAV  329

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ALRS SDLSVFY+C+ EGYQDTL V++ RQFYR C IYGTVDFIFGNAAVVFQNC I  R
Sbjct  330   ALRSASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFIFGNAAVVFQNCVILVR  389

Query  540   NPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P N + N ITAQGR DP QNTG SIHN ++ AA DL+ +     T+LGRPW+ YSR V 
Sbjct  390   KPLNGQANMITAQGRDDPFQNTGFSIHNSQIRAAPDLRPIVGKFNTFLGRPWQRYSRVVV  449

Query  375   MKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             MKS LDSL+ P GW PW D NFALNTLYYGEY N G G+ST NRV+W G+H I+S  EAS
Sbjct  450   MKSFLDSLVSPRGWSPWGDSNFALNTLYYGEYRNFGPGSSTRNRVRWPGFHRISSPAEAS  509

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             +FTV N +AG +WLPAT VPFTSGL
Sbjct  510   RFTVANLLAGRTWLPATGVPFTSGL  534



>ref|XP_004234933.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Solanum lycopersicum]
Length=533

 Score =   493 bits (1269),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 276/509 (54%), Positives = 354/509 (70%), Gaps = 22/509 (4%)
 Frame = -3

Query  1608  SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSL  1429
             S  +I  WCS+TP+P PC +++S   S   Q K+KS+F  +   +A+ +    +++  ++
Sbjct  33    SAHDINWWCSKTPHPDPCNHFMS---SGDVQPKNKSEFRTMTVQVAMDHVIQVQNHAKNV  89

Query  1428  GTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA---DAQTWLSTALTNLETCH  1258
               KCR   +K  W DC +L ++ + ++  ++D  IK +++   DAQTWLS +LTN+ETC 
Sbjct  90    SQKCRGKRKKLVWMDCEKLMDDTILQLSRSLD-GIKSNSSSDFDAQTWLSASLTNIETCL  148

Query  1257  AGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRK  1078
             +G  DL V+ NIL    S NVS LISN LA+N  F    N    G    FP+W+   +RK
Sbjct  149   SGSNDLNVS-NILQPNLSTNVSQLISNCLAVNGEFMDAENTTQVGG---FPNWLSNRERK  204

Query  1077  LLQSSA----ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYVIYVKAGVYKENVE  913
             LLQ+S+    A+KA+ VVA+D SG ++++  A+N AA+KR G+ R VIY+K GVYKEN+ 
Sbjct  205   LLQTSSIDLMATKANYVVAKDKSGRFRSIQAAINYAASKRVGNERIVIYIKRGVYKENIL  264

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +G  +  IMLVGDG+  TIITGSRSV  G TT+ +ATV V G GFI +GITFRNTAG  N
Sbjct  265   VGPTMGKIMLVGDGLRYTIITGSRSVAAGFTTYSTATVGVDGIGFIARGITFRNTAGPQN  324

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
              QAVALRS SDLSVFY C FEGYQDTL+V S RQFY+ C IYGT+DFIFGNAAVVFQNC 
Sbjct  325   GQAVALRSASDLSVFYACGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCM  384

Query  552   IYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYS  388
             IY R P   + N ITAQGR+DP QNT ISIHN ++ AA DL+ V    +TYLGRPW++YS
Sbjct  385   IYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSRIMAAPDLRPVIGSFQTYLGRPWQQYS  444

Query  387   RTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSA  211
             RTV MK+ LD+LI+ AGWL W D NFAL+TLYY EY N G  +ST  RVKW GYHVI + 
Sbjct  445   RTVIMKTYLDTLINRAGWLTWLDSNFALSTLYYAEYGNIGPASSTRFRVKWPGYHVIKNG  504

Query  210   TEASKFTVGNFIAGGSWLPATNVPFTSGL  124
               ASK+TV + IAG +WLP+T VPFT GL
Sbjct  505   NVASKYTVASLIAGRAWLPSTGVPFTGGL  533



>ref|XP_003523880.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
Length=531

 Score =   493 bits (1269),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 272/509 (53%), Positives = 348/509 (68%), Gaps = 21/509 (4%)
 Frame = -3

Query  1608  SPTEIKSWCSQTPYPQPCEYYLS-RSYSNGGQIKDKSDF----LKVAKNLALQYAKNAKD  1444
             S + I  WC+ TP+P+ C+ +LS +  S+  QIK K+ F    L+ A N AL   K A D
Sbjct  30    SSSNIDWWCNLTPHPEQCKQHLSTQMKSHHFQIKHKTIFREMLLQNALNQALIMQKEAND  89

Query  1443  NTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTADAQTWLSTALTN  1273
             N  +      +   +    DCL+LY   +  ++ T++       CS+ DAQTWLST+LTN
Sbjct  90    NDQN---NMLTKNHRTVHGDCLKLYGKTIFHLNRTLECFHGKHNCSSVDAQTWLSTSLTN  146

Query  1272  LETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVR  1093
             ++TC  G V+LGV    +P   +NNVS +I N+LAIN  F   ++       + FP W  
Sbjct  147   IQTCQDGTVELGVEDFKVP---NNNVSEMIRNSLAINMDFMKHHDHMEEKPEDAFPSWFS  203

Query  1092  PGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVE  913
               +RKLLQSS+  KA +VVA+DGSGN+KTV +A+NAAAKR    R+VI+VK GVY+EN+E
Sbjct  204   KHERKLLQSSSI-KAHVVVAKDGSGNFKTVQDALNAAAKRKVKTRFVIHVKKGVYRENIE  262

Query  912   IGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAAN  733
             +     NIMLVGDG+  TIIT +RSV  G TT+ SAT  + G  FI + ITF+NTAG   
Sbjct  263   VSVHNDNIMLVGDGLRNTIITSARSVQDGYTTYSSATAGIDGLHFIARDITFQNTAGVHK  322

Query  732   HQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCN  553
              QAVALRS SDLSVFY+C+F GYQDTL  ++ RQFYR+C IYGTVDFIFGNAAVVFQNC 
Sbjct  323   GQAVALRSASDLSVFYRCAFMGYQDTLMAHAQRQFYRQCYIYGTVDFIFGNAAVVFQNCY  382

Query  552   IYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYS  388
             I+AR P   + N ITAQGR DP QNTGISIHN ++ AA DL+ V     T+LGRPW++YS
Sbjct  383   IFARRPLEGQANMITAQGRGDPFQNTGISIHNSQIRAAPDLRPVVDKYNTFLGRPWQQYS  442

Query  387   RTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSA  211
             R + MK+ +D+L++P GW PW D +FA +TLYYGEY N G GAST NRVKW G+HVI S 
Sbjct  443   RVMVMKTFMDTLVNPLGWSPWGDSDFAQDTLYYGEYQNYGPGASTTNRVKWPGFHVINSP  502

Query  210   TEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             TEAS+FTV + +AG +WL +T VPFTSGL
Sbjct  503   TEASQFTVTHLLAGPTWLGSTTVPFTSGL  531



>ref|XP_011010932.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Populus euphratica]
Length=524

 Score =   492 bits (1266),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 272/527 (52%), Positives = 353/527 (67%), Gaps = 21/527 (4%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVFGYSPT---EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFL  1492
             I + + L +F S   F  S +    I  WC+QTP+P  C+Y++S S+ +   +K +S+F 
Sbjct  5     IRLLATLIVFSSIFSFAASKSTKSNITWWCNQTPHPSTCKYFMSHSHHHFA-LKHRSEFR  63

Query  1491  KVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV----DPNI  1324
              ++  LAL+ A  A+     LG       ++  W DCL+L+ N + +++ T+       +
Sbjct  64    LMSVKLALKKALIAQRQVSQLGQNYEHQQQRVVWTDCLKLHSNTILQLNRTLRGIRKKRL  123

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
             +C+  DAQTWLSTALTN++TC  G +DL V+   +PA+ S N+S LISNTLAIN      
Sbjct  124   RCTDLDAQTWLSTALTNIQTCRTGSLDLNVSDFTMPAM-SKNLSELISNTLAIN-----G  177

Query  1143  nneattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSG  967
                      + FP W    +R+LLQS S  + A++VVA+DGSG +++V  A+NAA+KR  
Sbjct  178   VLLQDNNTVQEFPRWFSRPNRRLLQSASITAMANLVVAKDGSGKFRSVQAAINAASKRRY  237

Query  966   SGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVG  787
               R +I+VK GVYKEN+ +G    NI LVGDG+  TIIT SRSVGGG TT+ SAT  + G
Sbjct  238   KTRLIIHVKRGVYKENIAVGVNNNNIWLVGDGMRNTIITSSRSVGGGYTTYSSATAGIDG  297

Query  786   DGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIY  607
               F+ +GITF NTAG    QAVALRS SDLSVFY+CSF+GYQDTL+V+S RQFYREC IY
Sbjct  298   LRFVARGITFSNTAGPLKGQAVALRSASDLSVFYRCSFQGYQDTLFVHSQRQFYRECYIY  357

Query  606   GTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK  430
             GT+DFIFGNAAVVFQN  I  R P   + N ITAQGR+DP QNTGISIHN ++  A DLK
Sbjct  358   GTIDFIFGNAAVVFQNSIILVRRPLKGQANMITAQGRNDPFQNTGISIHNSRILPAPDLK  417

Query  429   GV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAG  265
              V    +TYLGRPW  YSRTV +++ +D  I+PAGW PW + +FA +TLYYGEY N G G
Sbjct  418   PVAGAFETYLGRPWMRYSRTVILQTYIDGFINPAGWSPWLNRDFAQDTLYYGEYKNFGPG  477

Query  264   ASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +ST  RV W G+HVITS   AS+FTV + IAG SWLPAT +PFTS L
Sbjct  478   SSTRRRVAWKGFHVITSPYVASRFTVRSLIAGQSWLPATKIPFTSDL  524



>ref|XP_010932734.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   491 bits (1263),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 275/520 (53%), Positives = 350/520 (67%), Gaps = 16/520 (3%)
 Frame = -3

Query  1659  FICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAK  1480
             F+  FL + +S A    +   I S CSQTPYP  C   +S S     Q K +S F  +  
Sbjct  4     FVAYFLVLSLSMAFRVATSDPILS-CSQTPYPHVCSSMVSTS-RQVAQAKTQSGFRSMVL  61

Query  1479  NLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQ  1300
             + A+  A  A +    + T       KAAW DCL+  ++ +++I+ ++      S  D Q
Sbjct  62    HAAMDLAVQAHEVALIIDTSSLDMKAKAAWADCLKFSKDTIKQINRSMG---STSKDDVQ  118

Query  1299  TWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgy  1120
             TWLS A+TN +TC  GF DLG +  +     S N+S L+SN LAINK  T   +     +
Sbjct  119   TWLSAAMTNQQTCRNGFNDLGSSFPLGSPFLSYNISELLSNCLAINKAMTPKKSGGNPRF  178

Query  1119  teG-FPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRS-GSGRYVIY  946
                 FP W+   +RKLLQSS  + AD+VVA+DGSG+Y T++EA+ AA  RS G+ R+VI+
Sbjct  179   LSDGFPKWMSTTERKLLQSSN-TNADLVVAKDGSGDYTTISEAIAAATIRSNGTSRFVIH  237

Query  945   VKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQG  766
             VKAG+Y E VE  + + N+M+ GDGIG TIITG+++   G  T ++AT AV GDGFI + 
Sbjct  238   VKAGIYNETVE--TSMNNLMITGDGIGATIITGNKNFHDGFPTAQTATFAVSGDGFIARD  295

Query  765   ITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIF  586
             +TF+NTAG    QAVA  S SD SV YQCSFEGYQDTL   + RQFYR CDIYGT+DFIF
Sbjct  296   MTFQNTAGPEKEQAVAFLSSSDRSVLYQCSFEGYQDTLCALTQRQFYRNCDIYGTIDFIF  355

Query  585   GNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----K  421
             G+AA VFQ CNIY R P   + NT+TAQGR+ P++NTGI IH+  VTAA DLK V    +
Sbjct  356   GDAAAVFQQCNIYVRKPMTGQANTVTAQGRATPDENTGIIIHDSVVTAAPDLKPVQGSFQ  415

Query  420   TYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWDGN-FALNTLYYGEYSNTGAGASTANRV  244
             TYLGRPW+EYSRTVFMK+SLDS+IDPAGWL W+ + F L+TLYYGEY NTGAGA+T  RV
Sbjct  416   TYLGRPWREYSRTVFMKTSLDSVIDPAGWLQWNASGFYLSTLYYGEYMNTGAGANTGGRV  475

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             KW GYHVITSA+EAS FTVG+F+ G SW+PAT VP+ SGL
Sbjct  476   KWPGYHVITSASEASNFTVGSFLGGDSWIPATGVPYISGL  515



>ref|XP_002872964.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49223.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=474

 Score =   488 bits (1257),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 268/493 (54%), Positives = 325/493 (66%), Gaps = 32/493 (6%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGG  1405
             C +TP+P  C+  L         I+    FL+V+    L  A  AK +TYSLG +    G
Sbjct  8     CDETPHPSECKTLLIEHKP----IRSTKQFLQVSVERTLDGAVKAKSDTYSLGPQF---G  60

Query  1404  EKAAWEDCLELYENMVQKIDTTVD-PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
              K AWEDC++LYE  + +++ +V  P   CS +D Q WLSTALTNL+TC     +LGV+ 
Sbjct  61    SKQAWEDCMDLYEQTIHRLNQSVLCPKNACSRSDVQAWLSTALTNLDTCQEEMSELGVSS  120

Query  1227  NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS--SAAS  1054
             + L ++T +     + NTLAINK                 P+    G  K+     S   
Sbjct  121   HSLESITID-----VINTLAINK--------------RTEPNGKVFGVSKVTMKIPSIGK  161

Query  1053  KADIVVAQDGSGNYKTVTEAVNAAAKR-SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
             K D+VVAQDGSG+YKT+ EAVN A +R  GS RYVI+VK G+Y+E V IG K  NIM+VG
Sbjct  162   KVDVVVAQDGSGDYKTIQEAVNGAGERPKGSPRYVIHVKQGIYEEYVNIGIKSNNIMIVG  221

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DG+GKTIITG +S G G +TFKSAT    GDGF+G+ IT RNTAG  NHQAVALRS SD+
Sbjct  222   DGMGKTIITGDKSKGRGFSTFKSATFVAEGDGFVGRDITIRNTAGPENHQAVALRSDSDM  281

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNT  517
             SVFY+CS EGYQDTLYV+S RQF+RECDIYGTVDFIFGNAA  FQNC I+ARNPPN  NT
Sbjct  282   SVFYRCSIEGYQDTLYVHSGRQFFRECDIYGTVDFIFGNAAAFFQNCLIFARNPPNGVNT  341

Query  516   ITAQGRSDPNQNTGISIHNCKVTAAS--DLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDP  343
             ITAQ R +PNQ TGI IHN  V  A    L GVKTYLGRPW+ Y+RTV M + LD+LI+P
Sbjct  342   ITAQSRFNPNQTTGIVIHNSVVKGAPGVQLGGVKTYLGRPWRSYARTVVMGTHLDTLIEP  401

Query  342   AGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGS  163
              GW+ W    AL+TLYYGEY N G G+ T NRV W G+HVI+   EA +FT+  FI   S
Sbjct  402   KGWIDWGNVTALSTLYYGEYQNLGPGSGTENRVDWAGFHVISDINEARQFTLPKFIDAAS  461

Query  162   WLPATNVPFTSGL  124
             WLP T VPFT  L
Sbjct  462   WLPPTKVPFTINL  474



>ref|XP_006367817.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59-like 
[Solanum tuberosum]
Length=533

 Score =   490 bits (1262),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 274/511 (54%), Positives = 354/511 (69%), Gaps = 26/511 (5%)
 Frame = -3

Query  1608  SPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK--SDFLKVAKNLALQYAKNAKDNTY  1435
             S  +I  WCS+TP+P PC +++S      G IK K  S+F  +   +A+ +    + +  
Sbjct  33    SDHDINWWCSKTPHPDPCNHFMS-----SGDIKPKNNSEFRTMTVQVAMDHVIQVQSHAK  87

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA---DAQTWLSTALTNLET  1264
             ++   CR   +K  W DC +L ++ + ++  ++D  IK +++   DAQTWLS +LTN+ET
Sbjct  88    NVSQNCRGKRKKLVWMDCEKLMDDTILQLSRSLD-GIKSNSSSDFDAQTWLSASLTNIET  146

Query  1263  CHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGD  1084
             C +G +DL V+ NIL    S NVS LISN LA+N  F    N    G    FP+W+   +
Sbjct  147   CLSGSIDLNVS-NILQPNLSTNVSQLISNCLAVNGEFMDAENTTQVGG---FPNWLTNTE  202

Query  1083  RKLLQSSA----ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYVIYVKAGVYKEN  919
             RKLLQ+S+    A+KA+ VVA+D SG ++++  A+N AA+KR G+ R VIY+K GVYKEN
Sbjct  203   RKLLQTSSIDLMATKANYVVAKDKSGRFRSIQTAINYAASKRVGNERIVIYIKRGVYKEN  262

Query  918   VEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGA  739
             + +G  +  IMLVGDG+  TIITGSRSV  G TT+ +ATV V G GF+ +GITFRNTAG 
Sbjct  263   ILVGPTMGKIMLVGDGLRYTIITGSRSVAAGFTTYSTATVGVDGIGFVARGITFRNTAGP  322

Query  738   ANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQN  559
              N QAVALRS SDLSVFY C FEGYQDTL+V S RQFY+ C IYGT+DFIFGNAAVVFQN
Sbjct  323   QNGQAVALRSASDLSVFYACGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQN  382

Query  558   CNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKE  394
             C IY R P   + N ITAQGR+DP QNT ISIHN ++ AA DL+ V    +TYLGRPW++
Sbjct  383   CMIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSRIMAAPDLRPVIGSFQTYLGRPWQQ  442

Query  393   YSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVIT  217
             YSRTV MK+ LD+L++ AGWL W D NFAL+TLYY EY N G  +ST  RVKW GYHVIT
Sbjct  443   YSRTVIMKTYLDTLVNRAGWLTWLDSNFALSTLYYAEYGNIGPASSTRFRVKWPGYHVIT  502

Query  216   SATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             +   ASK+TV + IAG +WLP+T VPFT+GL
Sbjct  503   NGNVASKYTVASLIAGRAWLPSTGVPFTAGL  533



>ref|XP_008812365.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=521

 Score =   490 bits (1261),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 269/500 (54%), Positives = 348/500 (70%), Gaps = 17/500 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             I+ WC  TP+P  C YYL+ S S   Q KD+  F K+   L       A+ +   LG +C
Sbjct  30    IEWWCRSTPHPHACRYYLAHSKSPE-QPKDEHQFYKLHLQLTYDLTARAEGHLGRLGRRC  88

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA-DAQTWLSTALTNLETCHAGFVDL  1240
             R+  E  AW DC +L+ N V +++ T+ P     TA D QTWLS +LTNLETC  GF DL
Sbjct  89    RTAPESKAWFDCWKLFGNTVLQLNRTLHPQKPTFTALDFQTWLSASLTNLETCRKGFADL  148

Query  1239  GVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSA  1060
             G +  I+  V   N+S LISN LAIN+     N    T      P +    +RKLLQ SA
Sbjct  149   GASAEIIHPVMHYNISDLISNCLAINQ----PNGTTNTTAAVDVPSFTSVANRKLLQLSA  204

Query  1059  ASKADIVVAQDGSGNYKTVTEAVNAAA---KRSGSGRYVIYVKAGVYKENVEIGSKLKNI  889
               + + +VA+DGSGN++T+  A++AAA    R+ SG+ VI VKAGVY E++++ S L ++
Sbjct  205   --RPNFIVAKDGSGNFRTIQAALDAAAALRSRTQSGKIVIRVKAGVYVEHLQVVSSLSDL  262

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
              +VGDG GKTIITGSRSV  G+TTF S T +V GDGFI   ITFRNT G  + QAVAL S
Sbjct  263   TMVGDGKGKTIITGSRSVATGSTTFSSPTFSVFGDGFIASDITFRNTFGPGS-QAVALLS  321

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-P  532
             GSD S+FY+CSFEGYQDTL V++ RQFYRECDIYGTVDFIFGN AVV QNCNI+AR P P
Sbjct  322   GSDRSIFYRCSFEGYQDTLCVFTQRQFYRECDIYGTVDFIFGNGAVVLQNCNIFARRPRP  381

Query  531   NKTNTITAQGRSDPNQNTGISIHNCKVTAASDL---KG-VKTYLGRPWKEYSRTVFMKSS  364
              ++N ITAQGR+DPNQNTGI IH+  +  A++L   +G V++YLGRPW++YSRTV+++SS
Sbjct  382   GESNVITAQGRTDPNQNTGIVIHSSAILPAAELLPVRGTVRSYLGRPWQQYSRTVYLRSS  441

Query  363   LDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVG  184
             +D++IDPAGWLP++GNFALNTLYY E+ NTG G++ + RV W GYHVI   +   +F+VG
Sbjct  442   MDAIIDPAGWLPFNGNFALNTLYYAEFGNTGPGSALSRRVTWPGYHVIKRPSLVRQFSVG  501

Query  183   NFIAGGSWLPATNVPFTSGL  124
              FIAG +W+P+T VPF + L
Sbjct  502   RFIAGRTWIPSTGVPFNAVL  521



>ref|XP_003540571.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Glycine max]
 gb|KHN32446.1| Putative pectinesterase/pectinesterase inhibitor 33 [Glycine 
soja]
Length=531

 Score =   490 bits (1261),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 270/503 (54%), Positives = 348/503 (69%), Gaps = 12/503 (2%)
 Frame = -3

Query  1602  TEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGT  1423
             + I  WC+QTPYP+ C+YY+  S+ +  ++K KS+F  +  +LAL+ A   +     LG 
Sbjct  31    SNIDWWCNQTPYPETCKYYVKHSHYHY-KLKHKSEFRTILVHLALERAVIMRRKARELGR  89

Query  1422  KCRSGGEKAAWEDCLELYENMVQKIDTTVD-PNIK--CSTADAQTWLSTALTNLETCHAG  1252
                +  +K+ + DCL+LY+N V  ++ T++  ++K  CS  DAQTWLSTA TN+ETC  G
Sbjct  90    NGVTKKQKSVFRDCLKLYDNTVFHLNRTLEGLHVKRSCSPFDAQTWLSTARTNIETCQNG  149

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG-FPDWVRPGDRKL  1075
              ++LGV  +++P    N ++ +ISN L +N  F        T   E  FP W    +RKL
Sbjct  150   ALELGVRDSMVPTERCN-LTEIISNGLFVNWAFLKYKEAHYTADAEDGFPRWFSMHERKL  208

Query  1074  LQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             LQSS++ +A +VVA+DGSG+++++  A+NAAA+R    R++I+VK GVY+EN+E+     
Sbjct  209   LQSSSSIRAHLVVAKDGSGHFRSIQAAINAAARRRFKSRFIIHVKRGVYRENIEVDKTND  268

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             N+MLVGDG+  TIIT  RSV  G TT+ SAT  + G  FI + ITFRNTAG    QAVAL
Sbjct  269   NVMLVGDGMRNTIITSGRSVRAGYTTYSSATAGIDGLHFIARDITFRNTAGPLKGQAVAL  328

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RS SDLSVFY+C+ EGYQDTL V++ RQFYR C IYGTVDFIFGNAAVVFQNC I  R P
Sbjct  329   RSASDLSVFYRCAIEGYQDTLMVHAQRQFYRGCYIYGTVDFIFGNAAVVFQNCVILVRRP  388

Query  534   PN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMK  370
              N + N ITAQGR DP QNTG SIHN ++ AA DL+ V     T+LGRPW+ YSR V MK
Sbjct  389   LNGQANMITAQGRDDPFQNTGFSIHNSQIRAAPDLRPVVGKFNTFLGRPWQRYSRVVVMK  448

Query  369   SSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKF  193
             S LDSL+ P GW PW D NFALNTLYYGEY N G G+ST NRV+W G+H I+S  EAS+F
Sbjct  449   SFLDSLVSPRGWSPWGDSNFALNTLYYGEYRNFGPGSSTRNRVRWPGFHRISSPAEASRF  508

Query  192   TVGNFIAGGSWLPATNVPFTSGL  124
             TV N +AG +WLPAT VPFTSGL
Sbjct  509   TVANILAGRTWLPATGVPFTSGL  531



>ref|XP_011029954.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Populus euphratica]
Length=533

 Score =   490 bits (1261),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 274/526 (52%), Positives = 347/526 (66%), Gaps = 21/526 (4%)
 Frame = -3

Query  1665  FIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKV  1486
              IF  S L+   S +    +   I  WC+ TP+P  C  Y      +   +K +S F  +
Sbjct  17    LIFFSSMLSFAASKS----TEANITWWCNHTPHPSTC-MYHMSHSHHHFSLKHRSQFRIM  71

Query  1485  AKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV----DPNIKC  1318
             +  LALQ A  A+         C +  +KA W DCL+L+ N + +++ T+         C
Sbjct  72    SIQLALQSALIAQCQVSQFEQNCENQNQKAVWSDCLKLHSNTILQLNRTLIGLEKKRPPC  131

Query  1317  STADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnn  1138
             +  DAQTWLSTALTN++TC  G +DL VT   +PA  S N+S LISNTLAIN     +  
Sbjct  132   TDLDAQTWLSTALTNIQTCRTGSLDLKVTDFTMPAA-SKNLSELISNTLAIN---GVSLA  187

Query  1137  eattgyteGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSG  961
                      FP W    +R+LLQS S A+KA++VV+++G GN++T+  A++AA+KR    
Sbjct  188   TEDNNTQGYFPSWFSGQNRRLLQSTSIAAKANLVVSKNGFGNFRTIQAAIDAASKRMSRT  247

Query  960   RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  781
             R++IYVK GVY+EN+E+     NI LVGDG+ +TIIT SRSVG G TT+ SAT  + G  
Sbjct  248   RFIIYVKRGVYRENIEVRVNSNNIWLVGDGLRRTIITSSRSVGAGYTTYSSATAGIDGLR  307

Query  780   FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  601
             F+ +GITF NTAG    QAVALRS SDLSVFY+CSF+GYQDTL+V+S RQFYREC I+GT
Sbjct  308   FVARGITFVNTAGPLKGQAVALRSASDLSVFYRCSFQGYQDTLFVHSQRQFYRECYIFGT  367

Query  600   VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV  424
             +DFIFGNAAVVFQN  IY R P   + N ITAQGR+DP QNTGISIHN ++  A DLK V
Sbjct  368   IDFIFGNAAVVFQNSIIYVRKPLKGQANMITAQGRNDPFQNTGISIHNSQILPARDLKPV  427

Query  423   ----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGA  262
                 +TYLGRPW +YSRTV +++ +DS I+P+GW PW    NFA +TLYYGEY N G G+
Sbjct  428   VQAFQTYLGRPWMQYSRTVILQTYIDSFINPSGWSPWLRTSNFAQDTLYYGEYKNFGPGS  487

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             ST  RV W GYHVITS   AS+FTV N IAG SWLPAT VPFTSGL
Sbjct  488   STKRRVAWKGYHVITSPGVASRFTVRNLIAGDSWLPATKVPFTSGL  533



>ref|XP_007220716.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
 gb|EMJ21915.1| hypothetical protein PRUPE_ppa022308mg [Prunus persica]
Length=479

 Score =   488 bits (1255),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 266/473 (56%), Positives = 331/473 (70%), Gaps = 14/473 (3%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K  S+F K+   +AL+ A NAK      G  C++  +KAAW DCL+L+E+ V +++ T++
Sbjct  11    KHTSEFRKMMVQVALERALNAKSYASQFGQNCQNNQQKAAWADCLKLFEDTVHQLNITLE  70

Query  1332  ---PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNN-VSYLISNTLAI  1165
                    CS  DAQTWLS ALTN+ TC  G ++L V+  I P  TSNN VS LISN LAI
Sbjct  71    GLGTKRNCSNFDAQTWLSAALTNIHTCQVGSMELNVSDFIAPIYTSNNNVSELISNGLAI  130

Query  1164  NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNA  985
                   T           +P+WV   +R+LLQ+S   KA++VVA+DGSG+++TV  A++A
Sbjct  131   GSQLLGTEENYADEE---YPNWVSKHERRLLQASKI-KANLVVAKDGSGHFRTVQAAIDA  186

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             AAKR  + R++I+VK GVY+EN+E+ +   NIML+G  +  TIIT SRSV GG+TT+ SA
Sbjct  187   AAKRKITSRFIIHVKKGVYRENIEVSNTNNNIMLIGASMRYTIITASRSVNGGSTTYNSA  246

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T  + G GFI +GITF NTAG    QAVALRS SDLSVFY+C+F+GYQDTL V+S RQFY
Sbjct  247   TAGIDGPGFIARGITFSNTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFY  306

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVT  448
             REC IYGT+DFIFGNAA VFQ+C IY R P   + N ITAQ R+DP QNT ISIHN +V 
Sbjct  307   RECYIYGTIDFIFGNAAAVFQSCIIYVRRPLKGQVNVITAQARNDPYQNTAISIHNSQVR  366

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEY  283
             AA+DLK V    KTYLGRPW +YSR VFMK  LDSL++P GWL W   NFAL+TLYY EY
Sbjct  367   AAADLKPVVSAFKTYLGRPWMQYSRVVFMKCYLDSLVNPVGWLEWQRSNFALSTLYYAEY  426

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G  +ST  RVKW G+HVITSA  ASKFTV + I G SWLPAT VP+T+GL
Sbjct  427   KNFGPASSTRYRVKWPGFHVITSANVASKFTVSSLITGRSWLPATGVPYTAGL  479



>ref|XP_003598225.1| Pectinesterase [Medicago truncatula]
 gb|AES68476.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   489 bits (1259),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 274/526 (52%), Positives = 358/526 (68%), Gaps = 19/526 (4%)
 Frame = -3

Query  1662  IFICSFLA-IF-VSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
             +F+  FL+ IF ++++  G S + I  WC+ TP+P+PC++Y ++  +N  +IK + +F +
Sbjct  8     LFMLFFLSSIFSIASSRKGPSSSNIDWWCNLTPHPKPCKHYTTQ-MNNHFKIKHRVEFRE  66

Query  1488  VAKNLALQYAKNA-KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNI  1324
             +   LAL+ A    K+   +   +  S   K    DCL+L+EN +  ++ T++     + 
Sbjct  67    MLVQLALKQALTMQKEAQENSQQQQNSFVHKTVHGDCLKLFENTIFHLNRTLEGLNNASK  126

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
              CS  DAQTWL+T+LTN+ETC +G ++L         +   NV+ +I N LAIN  F   
Sbjct  127   NCSPNDAQTWLTTSLTNIETCKSGALELNAQD--FDFIMQTNVTEMIRNILAINMHFLKH  184

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
             + E   G    FP+W    +RKLLQS    K ++VVA+DGSG YKTV  A+NAAAKR   
Sbjct  185   SKETEEGS---FPNWFSVHERKLLQSKGPVKYNLVVAKDGSGQYKTVQAALNAAAKRKYK  241

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VI+VK GVY+EN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  + G 
Sbjct  242   TRFVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGL  301

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
              FI + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C IYG
Sbjct  302   HFIARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYG  361

Query  603   TVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  427
             TVDFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC++ AASDLK 
Sbjct  362   TVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIRAASDLKP  421

Query  426   V----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGA  262
             V    KT+LGRPW++YSR + MK+ +D+L+ P GW PW D +FA +TLYYGEY N G G+
Sbjct  422   VVDKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGS  481

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             STANRVKW GYHVI++  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  482   STANRVKWPGYHVISNPNEASKFTVAGLLAGPTWLATTTVPFTSGL  527



>ref|XP_003598230.1| Pectinesterase [Medicago truncatula]
 gb|AES68481.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   489 bits (1259),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 274/526 (52%), Positives = 355/526 (67%), Gaps = 19/526 (4%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVF--GYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
             +F+  FL+   STA    G S + I  WC+ TP+P+PC++Y ++  +N  +IK + +F +
Sbjct  8     LFMLFFLSSIFSTASSRKGPSSSNIDWWCNLTPHPKPCKHYTTQ-MNNHFKIKHRVEFRE  66

Query  1488  VAKNLALQYAKNA-KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNI  1324
             +   LAL+ A    K+   +   +  S   K    DCL+L+EN +  ++ T++     + 
Sbjct  67    MLVQLALKQALTMQKEAQANSQQQQNSLVHKTVHGDCLKLFENTIFHLNRTLEGLNNASK  126

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
              CS  DAQTWL+T+LTN+ETC +G ++L         +   NV+ +I N LAIN  F   
Sbjct  127   NCSPNDAQTWLTTSLTNIETCKSGALELNAQD--FDFIMQTNVTEMIRNILAINMHFLKH  184

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
             + E   G    F +W    +RKLLQS +  K ++VVA+DGSG YKTV  A+NAAAKR   
Sbjct  185   SKETEEGS---FSNWFSVHERKLLQSKSPVKYNLVVAKDGSGQYKTVQAALNAAAKRKYK  241

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VI+VK GVY+EN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  + G 
Sbjct  242   TRFVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGYTTYSSATAGIDGL  301

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
              FI + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C IYG
Sbjct  302   HFIARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYG  361

Query  603   TVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  427
             TVDFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC++ AASDLK 
Sbjct  362   TVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIRAASDLKP  421

Query  426   V----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGA  262
             V    KT+LGRPW++YSR + MK+ +D+L+ P GW PW D +FA +TLYYGEY N G G+
Sbjct  422   VVDKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGS  481

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             STANRVKW GYHVI++  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  482   STANRVKWPGYHVISNPKEASKFTVAGLLAGPTWLATTTVPFTSGL  527



>ref|XP_003537030.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60-like 
[Glycine max]
 ref|XP_006582811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 60-like 
[Glycine max]
Length=531

 Score =   489 bits (1258),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 272/506 (54%), Positives = 345/506 (68%), Gaps = 23/506 (5%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYY-LSRSYSNGGQIKDKSDF----LKVAKNLALQYAKNAKD-NTY  1435
             I  WC+ TP+P PC++Y +++  S+  QIK K+ F    L+ A N AL   K A + +  
Sbjct  34    IDWWCNLTPHPVPCKHYTITQMKSHHFQIKHKTVFREMLLQHALNQALIMQKEAHESHQN  93

Query  1434  SLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---PNIKCSTADAQTWLSTALTNLET  1264
             S+ TK      +   EDCL+LY   +  ++ T++       CS+ DAQTWLST+LTN++T
Sbjct  94    SMATK----NHRTVNEDCLKLYGKTIFHLNRTLECFHGKQNCSSVDAQTWLSTSLTNIQT  149

Query  1263  CHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGD  1084
             C  G V+L V    +P   +NNVS +I N+LAIN  F   ++       + FP W    +
Sbjct  150   CQDGTVELAVEDFEVP---NNNVSEMIRNSLAINMDFMNHHHHMEEKPGDAFPRWFSKHE  206

Query  1083  RKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             RKLLQSS   KA IVVA+DGSGN+KTV +A+NAAAKR    R+VI+VK GVY+EN+E+  
Sbjct  207   RKLLQSSMI-KARIVVAKDGSGNFKTVQDALNAAAKRKEKTRFVIHVKKGVYRENIEVAL  265

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
                NIMLVGDG+  TIIT +RSV  G TT+ SAT  + G  FI + ITF+N+AG    QA
Sbjct  266   HNDNIMLVGDGLRNTIITSARSVQDGYTTYSSATAGIDGLHFIARDITFQNSAGVHKGQA  325

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY+C   GYQDTL  ++ RQFYR+C IYGTVDFIFGNAAVVFQNC I+A
Sbjct  326   VALRSASDLSVFYRCGIMGYQDTLMAHAQRQFYRQCYIYGTVDFIFGNAAVVFQNCYIFA  385

Query  543   RNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P   + N ITAQGR DP QNTGISIHN ++ AA DLK V     T+LGRPW++YSR V
Sbjct  386   RRPLEGQANMITAQGRGDPFQNTGISIHNSQIRAAPDLKPVVDKYNTFLGRPWQQYSRVV  445

Query  378   FMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
              MK+ +D+L++P GW PW D +FA +T+YYGEY N G  AST NRVKW G+HVITS TEA
Sbjct  446   VMKTFMDTLVNPLGWSPWGDSDFAQDTVYYGEYQNYGPRASTTNRVKWPGFHVITSPTEA  505

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S+FTV   +AG +WL +T VPFTSGL
Sbjct  506   SQFTVTRLLAGPTWLGSTTVPFTSGL  531



>ref|XP_009340595.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   486 bits (1252),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 335/473 (71%), Gaps = 13/473 (3%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K  S+F K+   +AL+ A +A   T   G  C++  EKAAW DCL+L+ N V +++ T++
Sbjct  11    KHTSEFRKMLVQVALERALSAITYTSQYGQNCQNDKEKAAWADCLKLFHNTVSQLNVTLE  70

Query  1332  ---PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNN-VSYLISNTLAI  1165
                  + CS  DAQTWLS ALTN+ETC  G ++L VT  I P  TSNN VS LISN+LAI
Sbjct  71    GLGTKLNCSNFDAQTWLSAALTNIETCRVGSLELNVTNFITPIYTSNNNVSELISNSLAI  130

Query  1164  NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNA  985
               G      E +   +E FP+WV   DR+LLQS A  +A++VVA+DGSGN++TV  A++A
Sbjct  131   --GSQLLGTEESFNESEKFPNWVSKHDRRLLQS-ANIRANLVVAKDGSGNFRTVQAALDA  187

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             AA+R    +++IYVK GVY EN+++ +    IMLVG GI  T+IT SRSV GG TT+ SA
Sbjct  188   AARRRVRSKFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVSGGYTTYNSA  247

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T  + G GFI +GITFRNTAG    QAVAL S SDLSVFY+C+F+GYQDTL V+S RQFY
Sbjct  248   TAGINGPGFIARGITFRNTAGPLKGQAVALMSASDLSVFYRCAFQGYQDTLMVHSQRQFY  307

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVT  448
             REC I+GT+DFIFGNAA VFQNC IY R P   + N ITAQGR+DP QNT ISIHN +V 
Sbjct  308   RECYIFGTIDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSQVL  367

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEY  283
             AA+DLK V    KTYLGRPW +YSR VFMK  LDSLI+PAGWL W   NFAL+TLYYGEY
Sbjct  368   AAADLKPVASSYKTYLGRPWMQYSRVVFMKCYLDSLINPAGWLQWQRSNFALSTLYYGEY  427

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G  +ST  RVKW G+H ITS   AS FT GN IAG SWLPAT VPFT+GL
Sbjct  428   KNFGPASSTRYRVKWPGFHAITSPNVASMFTAGNLIAGQSWLPATGVPFTTGL  480



>ref|XP_004516727.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Cicer arietinum]
Length=539

 Score =   488 bits (1257),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 346/505 (69%), Gaps = 16/505 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRS-YSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             I  WC+QTP+P+ C++Y  ++ Y++   IK KS F ++  +LAL+ A   ++    LG  
Sbjct  37    IDWWCNQTPHPEACKFYTKQTHYNDNKNIKHKSKFREILIHLALERAVIMRNIARDLGQN  96

Query  1419  --CRSGGEKAAWEDCLELYENMVQKIDTTV-DPNIK--CSTADAQTWLSTALTNLETCHA  1255
                 +  +K+   DCL+LY+N V  ++ T  + +IK  CS+ DAQTWLSTA TN+ETC  
Sbjct  97    NWLTTKKKKSVSRDCLKLYDNTVFHLNRTFHNLHIKKTCSSFDAQTWLSTAYTNIETCRN  156

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg--yteGFPDWVRPGDR  1081
             G ++L +   +LP +   N++ +ISN L +N  F    N   T     E FP W+   +R
Sbjct  157   GALELNIPDFVLP-IMKKNMTEIISNGLFVNWEFVKHENVHHTDDDIKEAFPRWLSTRER  215

Query  1080  KLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             +LL+SS+  KA +VVA+DGSG++K++  A+NAA KR    R+VI VK GVY+EN+ IG  
Sbjct  216   RLLESSSL-KAHLVVAKDGSGHFKSIQSAINAAGKRRVKTRFVIRVKRGVYRENILIGKM  274

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVGDG+  TIIT  R+V  G TT+ SAT  + G  FI + ITF NTAG    QAV
Sbjct  275   NDNIMLVGDGMRFTIITSDRNVQAGFTTYSSATAGIDGLHFIARDITFENTAGPRRGQAV  334

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ALRS SDLSVFY+C+F+GYQDTL V++ RQFYREC IYGTVDFIFGNAAVVFQNC I  R
Sbjct  335   ALRSASDLSVFYRCAFKGYQDTLMVHAQRQFYRECYIYGTVDFIFGNAAVVFQNCMILVR  394

Query  540   NPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P N + N ITAQGR DP QNTGISI N ++ AA D K V     T++GRPW+ YSR V 
Sbjct  395   RPLNGQANMITAQGRDDPFQNTGISIQNSQIRAAPDFKPVVSKFNTFIGRPWQRYSRVVV  454

Query  375   MKSSLDSLIDPAGWLPWDG-NFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             MKS +D+L+ P GW PW G NFA NTL+YGEY N G G+ST NRV+W GYHV+ S T+AS
Sbjct  455   MKSFMDNLVSPLGWSPWGGTNFAQNTLFYGEYKNFGPGSSTRNRVRWPGYHVMNSPTQAS  514

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             +FTV N +AGGSWLPAT VPFTSGL
Sbjct  515   QFTVANLLAGGSWLPATGVPFTSGL  539



>gb|KEH22545.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   488 bits (1255),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 275/526 (52%), Positives = 353/526 (67%), Gaps = 19/526 (4%)
 Frame = -3

Query  1662  IFICSFLA-IF-VSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLK  1489
             +F+  FL+ IF ++++  G S + I  WC+ TP+P+PC++Y ++  +N  +IK + +F +
Sbjct  8     LFMLFFLSSIFSIASSRKGPSSSNIDWWCNLTPHPKPCKHYTTQ-MNNHFKIKHRVEFRE  66

Query  1488  VAKNLALQYAKNA-KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD----PNI  1324
             +   LAL  A    K+   +   +  S   K    DC +L+EN +  ++ T++     + 
Sbjct  67    MLVKLALNQALTMQKEAQDNSQQQQNSSVHKTVHADCFKLFENTIFHLNHTLEGLNNASK  126

Query  1323  KCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt  1144
              CS  D QTWL+T+LTN+ETC +G ++L         +   NV  +I N LAIN  F   
Sbjct  127   NCSPNDVQTWLTTSLTNIETCKSGALELNAQD--FNFIMQTNVIEMIRNILAINMHFLKH  184

Query  1143  nneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGS  964
             N E   G    FP+W    +RKLLQS +  K +IVVA+DGSG YKTV  A+NAAAKR   
Sbjct  185   NKETEEGS---FPNWFSMHERKLLQSKSPVKYNIVVAKDGSGQYKTVQAALNAAAKRKYK  241

Query  963   GRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  784
              R+VI+VK GVYKEN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  + G 
Sbjct  242   TRFVIHVKKGVYKENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYSSATAGIDGL  301

Query  783   GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  604
              FI + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C IYG
Sbjct  302   HFIARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCFIYG  361

Query  603   TVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  427
             TVDFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC++ AASDLK 
Sbjct  362   TVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQIMAASDLKP  421

Query  426   V----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGA  262
             V    KT+LGRPW++YSR + MK+ +D+L+ P GW PW D +FA +TLYYGEY N G G+
Sbjct  422   VVDKYKTFLGRPWQQYSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGS  481

Query  261   STANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             STANRVKW GYH IT+  EASKFTV   I G +WL  T VPFTSGL
Sbjct  482   STANRVKWPGYHAITNPKEASKFTVAGLITGPTWLATTTVPFTSGL  527



>ref|XP_006289025.1| hypothetical protein CARUB_v10002406mg [Capsella rubella]
 gb|EOA21923.1| hypothetical protein CARUB_v10002406mg [Capsella rubella]
Length=476

 Score =   486 bits (1250),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 265/492 (54%), Positives = 326/492 (66%), Gaps = 27/492 (5%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             +C +TP+P  C+  L         IK  + FL+V+    L  A  AK +TYSLG +    
Sbjct  8     FCDETPHPGECKTLLIEHKP----IKSTTQFLQVSVEQTLYGAVKAKSDTYSLGPQF---  60

Query  1407  GEKAAWEDCLELYENMVQKIDTTVD-PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
             G K AWE+CL+LY+  + +++ ++  P   CS +D QTWLSTALTNL+TC     + GV+
Sbjct  61    GSKQAWENCLDLYDQTIHRLNQSLLCPKNACSRSDVQTWLSTALTNLDTCQEEMSEAGVS  120

Query  1230  GNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASK  1051
                + ++TSN     + N LAINK   T  N            + R        S    K
Sbjct  121   SRSMQSITSN-----VINALAINKRMETHGNA-----------FRRRKVEVETPSMIGGK  164

Query  1050  ADIVVAQDGSGNYKTVTEAVNAAAKR-SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGD  874
              D+VVAQDGSG+YK++ EAVN A  R  GS RYVI+VK GVY+E V + SK  N+M++GD
Sbjct  165   VDVVVAQDGSGDYKSIQEAVNGAGARPKGSPRYVIHVKQGVYEEYVNVRSKFTNVMIIGD  224

Query  873   GIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLS  694
             GIGKTIITG +S G G +TFKSAT    GDGF+G+ +T RNTAG  NHQAVALRS SD+S
Sbjct  225   GIGKTIITGDKSKGRGISTFKSATFVATGDGFVGRDMTIRNTAGPENHQAVALRSDSDMS  284

Query  693   VFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTI  514
             VFY+CS EGYQDTLYV++ RQF+RECDIYGTVDFIFGNAA  FQNC IYAR+PPN  NTI
Sbjct  285   VFYRCSIEGYQDTLYVHTGRQFFRECDIYGTVDFIFGNAAAFFQNCRIYARSPPNGVNTI  344

Query  513   TAQGRSDPNQNTGISIHNCKVTAA--SDLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDPA  340
             TAQ R +PNQ TGI IHN  V  A  + L+GVKTYLGRPW+ Y+RTV M + LD LI+P 
Sbjct  345   TAQSRVNPNQTTGIVIHNSVVRGAPGTQLEGVKTYLGRPWRSYARTVVMGTFLDQLIEPK  404

Query  339   GWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSW  160
             GWL WD   AL+TLYYGE  NTG G+ T NRV W G+HVI+S  EA +FT+  FI    W
Sbjct  405   GWLEWDNVTALSTLYYGESQNTGPGSGTENRVDWPGFHVISSNEEARQFTLLQFIDAALW  464

Query  159   LPATNVPFTSGL  124
             LP T VPFT  L
Sbjct  465   LPPTKVPFTINL  476



>ref|XP_004499656.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33-like 
[Cicer arietinum]
Length=524

 Score =   487 bits (1253),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 271/530 (51%), Positives = 356/530 (67%), Gaps = 25/530 (5%)
 Frame = -3

Query  1662  IFICSFLAIFVSTAVF-------GYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDK  1504
             IF  +F  + + +++F       G S + I  WC+QTP+P+PC++Y ++  +N  +IK K
Sbjct  3     IFEKTFFILLLLSSIFSIVSSRKGPSSSNIDWWCNQTPHPKPCKHYTTQ-MNNHFKIKHK  61

Query  1503  SDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD---  1333
             S+F  +   LAL+ A   +    S  ++  S   +   +DCL+L+ N +  ++ T +   
Sbjct  62    SEFRGMLVQLALKQALIMQKE--SQNSQQNSSVHQTVHDDCLKLFRNTIFHLNRTFEGLN  119

Query  1332  -PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKG  1156
               +  CS  DAQTWL+T+LTN+ETC  G  +L         +   NV  +I N+LAIN  
Sbjct  120   NASKNCSPDDAQTWLTTSLTNIETCKNGAFELNAKD--FNFIVQTNVIEMIRNSLAINMY  177

Query  1155  FtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAK  976
             F   N E   G+   +P+W    +RKLL +++  KA++VVA+DGSGN+KTV  A++A+AK
Sbjct  178   FMKHNRETKEGF---YPNWFSRHERKLLNANSIVKANLVVAKDGSGNFKTVQAALDASAK  234

Query  975   RSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVA  796
             R    R+VI++K GVY+EN+E+     NIMLVGDG+  TIIT SRSV GG TT+ SAT  
Sbjct  235   RKYKTRFVIHIKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGYTTYSSATAG  294

Query  795   VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  616
             + G  FI + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQFYR+C
Sbjct  295   IDGLHFIARDITFQNTAGPQKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQC  354

Query  615   DIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAAS  439
              IYGTVDFIFGNAAVVFQNCNI+ R P + + N ITAQGR DP QNTGIS HNCK+ AAS
Sbjct  355   YIYGTVDFIFGNAAVVFQNCNIFVRKPLDGQANMITAQGRGDPFQNTGISFHNCKIRAAS  414

Query  438   DLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNT  274
             DLK V     T+LGRPW++YSR V MK+ +D+L+ P GW PW D +FA +TLYYGEY N 
Sbjct  415   DLKPVIDKYNTFLGRPWQQYSRVVVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENY  474

Query  273   GAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             G G+STA+RVKW GYHVITS  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  475   GPGSSTAHRVKWPGYHVITSPNEASKFTVTGLLAGPTWLATTTVPFTSGL  524



>ref|XP_003598229.1| Pectinesterase [Medicago truncatula]
 gb|AES68480.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   486 bits (1250),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 274/535 (51%), Positives = 353/535 (66%), Gaps = 19/535 (4%)
 Frame = -3

Query  1695  LLITKMTNLQFIFICSFLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQ  1516
             + I   T    +F+ S  +I  S    G S ++I  WC+ TP+P+PC++Y ++  +N  +
Sbjct  1     MAIIGKTLFMLVFVSSIFSIASSRK--GPSSSKIDWWCNLTPHPKPCKHYTTQ-MNNHFK  57

Query  1515  IKDKSDFLKVAKNLALQYAKNA-KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTT  1339
             IK + +F ++   LAL+ A    K+   +   +  S   K    DCL+L EN +  ++ T
Sbjct  58    IKHRVEFREMLVQLALKQALTMQKEAQDNSQQQQNSSVHKTVHGDCLKLVENTIFHLNRT  117

Query  1338  VD----PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTL  1171
             ++     +  CS  D QTWL+T+LTN+ETC +G ++L         +   NV  +I N L
Sbjct  118   LEGLNNASKNCSPNDVQTWLTTSLTNIETCKSGALELNAQD--FNFIMQTNVIEMIRNIL  175

Query  1170  AINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAV  991
             AIN  F   N E   G    FP+W    +RKLLQS    K ++VVA+DGSG YKTV  A+
Sbjct  176   AINMHFLKHNKETEEGS---FPNWFSVHERKLLQSKGPVKYNLVVAKDGSGQYKTVQAAL  232

Query  990   NAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFK  811
             NAAAKR    R+VI+VK GVY+EN+E+     NIMLVGDG+  TIIT SRSV GG TT+ 
Sbjct  233   NAAAKRKYKTRFVIHVKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGFTTYS  292

Query  810   SATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQ  631
             SAT  + G  FI + ITF+NTAG    QAVALRS SDLSVFY+C+  GYQDTL  ++ RQ
Sbjct  293   SATAGIDGLHFIARDITFQNTAGPHKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQ  352

Query  630   FYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCK  454
             FYR+C IYGTVDFIFGNAAVVFQNCNI+AR P + + N ITAQGR DP QNTGIS HNC+
Sbjct  353   FYRQCFIYGTVDFIFGNAAVVFQNCNIFARKPLDGQANMITAQGRGDPFQNTGISFHNCQ  412

Query  453   VTAASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYG  289
             + AASDLK V    KT+LGRPW+++SR + MK+ +D+L+ P GW PW D +FA +TLYYG
Sbjct  413   IRAASDLKPVVDKYKTFLGRPWQQFSRVMVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYG  472

Query  288   EYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             EY N G G+ST NRVKW GYHVIT+  EASKFTV   +AG +WL  T VPFTSGL
Sbjct  473   EYENYGPGSSTTNRVKWPGYHVITNRKEASKFTVAGLLAGPTWLATTTVPFTSGL  527



>emb|CDP05321.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   483 bits (1243),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 334/462 (72%), Gaps = 17/462 (4%)
 Frame = -3

Query  1476  LALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNI--KCSTADA  1303
             +AL+   +A+ +  +L  +CRS  +KA W DC +L  N V +++ T++  +  + S  DA
Sbjct  5     VALEQVHSARKHAKNLRRECRSKRKKAVWRDCNKLLSNTVLQLNRTIEGFLANQTSDVDA  64

Query  1302  QTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattg  1123
             QTWLSTALTNLE C +G +DL VT  I P +TSN +S+LISN LA+N             
Sbjct  65    QTWLSTALTNLEICRSGSLDLNVTELISPILTSN-MSHLISNCLAVN-----GVLMEHQD  118

Query  1122  yteGFPDWVRPGDRKLLQSSA--ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYV  952
             Y +GFP WV  G+RKLLQSS   +  A+ VVA DGSG+++++  A+N AA++R G+ R V
Sbjct  119   YKDGFPGWVTAGERKLLQSSVTLSRTANAVVAMDGSGHFRSIQAAINYAASRRVGNARVV  178

Query  951   IYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIG  772
             IYVK GVY+EN+ I S +  + L+GDG+  TIITGSRSV GG TT+ SAT+ V G GF+ 
Sbjct  179   IYVKRGVYRENIAISSTMNKVTLIGDGLRYTIITGSRSVAGGYTTYSSATLGVDGIGFMA  238

Query  771   QGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDF  592
             +GITFRNTAG    QAVALRS SDLSVFY C FEGYQDTL+V++ RQFY+ C IYGT+DF
Sbjct  239   RGITFRNTAGPQRGQAVALRSASDLSVFYACGFEGYQDTLFVHAQRQFYKNCYIYGTIDF  298

Query  591   IFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLK----G  427
             IFGNAAVVFQNC IY R P   + N ITAQGR+DP QNTGISIHN ++ AA DL+     
Sbjct  299   IFGNAAVVFQNCIIYVRKPLWGQVNVITAQGRADPFQNTGISIHNSRIVAARDLRPAVGS  358

Query  426   VKTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTAN  250
               TYLGRPW+ YSRTVF+K+ +D LI+PAGWLPW + NF  NT+YYGEY+N G GAST +
Sbjct  359   FNTYLGRPWQLYSRTVFLKTYMDGLINPAGWLPWVNTNFGQNTVYYGEYNNFGPGASTRS  418

Query  249   RVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             RV+W GYHVITSA  AS+FTV N IAG +WLP+T VPF +GL
Sbjct  419   RVRWRGYHVITSANVASRFTVANLIAGRTWLPSTGVPFIAGL  460



>ref|XP_010919483.1| PREDICTED: pectinesterase 2-like [Elaeis guineensis]
Length=522

 Score =   484 bits (1247),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 266/497 (54%), Positives = 343/497 (69%), Gaps = 18/497 (4%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             ++ WC  TP+P  C YYL+       Q KD+  F K+   +       A  +  SLG +C
Sbjct  30    VEWWCHNTPHPGACRYYLAYP-KPPEQPKDEDQFFKLHLQVTYDLTARAVSHLGSLGRRC  88

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVD-PNIKCSTADAQTWLSTALTNLETCHAGFVDL  1240
              +  EK AW DC +LY N V +++ T+  P    +  D+QTWLS +LTNLETC  GF DL
Sbjct  89    GTKPEKKAWVDCWKLYGNTVLQLNRTLHHPKSTFTALDSQTWLSASLTNLETCRKGFSDL  148

Query  1239  GVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSA  1060
             G +  I+  V   N+S LISN LAIN+     N    +  T   P +    +RKLLQ S 
Sbjct  149   GASTEIIHPVMHYNLSDLISNCLAINQ----PNATTKSTATLDAPSFTTTANRKLLQLS-  203

Query  1059  ASKADIVVAQDGSGNYKTVTEAVNAA-AKRSGS---GRYVIYVKAGVYKENVEIGSKLKN  892
              S+ + +VAQDGSGN++T+  A++AA A RS +   GR VI VKAGVY E++++ S L +
Sbjct  204   -SRPNFIVAQDGSGNFRTIQGALDAATALRSSTTSGGRIVIQVKAGVYNEHLQVLSSLSD  262

Query  891   IMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALR  712
             + +VGDG GKTIITGSRSV  G TTF SAT +V GDGFI + ITFRNT G  + QAVAL 
Sbjct  263   LTMVGDGKGKTIITGSRSVASGFTTFSSATFSVFGDGFIARDITFRNTFGPGS-QAVALL  321

Query  711   SGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPP  532
             SGSD SVFY+CS EGYQDTL V++ RQFYRECDIYGTVDFIFGNAAVV QNCNI+AR P 
Sbjct  322   SGSDRSVFYRCSIEGYQDTLCVFTQRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARRPR  381

Query  531   N-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK----TYLGRPWKEYSRTVFMKS  367
               + N ITAQGR+DPNQNTGI IH+  ++ A++L  V+    +YLGRPW++YSRTV++++
Sbjct  382   QGEANVITAQGRTDPNQNTGIVIHSSTISPAAELLAVRGTVSSYLGRPWQQYSRTVYLRN  441

Query  366   SLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTV  187
             S+DS+IDPAGWLP++GNFALNTLYY E+ NTG G++ + RV+W GYHVI+      +F+V
Sbjct  442   SIDSIIDPAGWLPFNGNFALNTLYYAEFGNTGPGSTLSGRVRWLGYHVISRPALVRQFSV  501

Query  186   GNFIAGGSWLPATNVPF  136
             G FIAG  W+P+T VPF
Sbjct  502   GRFIAGRQWIPSTGVPF  518



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 260/452 (58%), Positives = 319/452 (71%), Gaps = 30/452 (7%)
 Frame = -3

Query  1401  KAAWEDCLELYENMVQKIDTTVDPNIKCSTA-DAQTWLSTALTNLETCHAGFVDLGVTGN  1225
             K AW DCLEL+E+ V KI+ +    I+ S A DA TWLS ++ N +TC  GF +L +  +
Sbjct  25    KLAWNDCLELHEDTVDKINRS----IRSSNALDANTWLSASIANQQTCQNGFTNLKIPNS  80

Query  1224  ILPAV-----------------TSNNVSYLISNTLAINKGFtttnneattgyteGFPDWV  1096
              L +                   S + +    + L  +K          +   +GFP+WV
Sbjct  81    YLQSFPNYVTLTTNLSKLLSNSLSLHKASTSPSALHFSKQVRGKRRLLLSESDDGFPEWV  140

Query  1095  RPGDRKLLQSSAAS-KADIVVAQDGSGNYKTVTEAVNAAAK-RSGS-GRYVIYVKAGVYK  925
                DRKLL+S+    KAD+VVAQDGSGNY+T++EAV AA   RSGS  R+VI+VKAGVYK
Sbjct  141   SFADRKLLRSTGGGPKADMVVAQDGSGNYETISEAVGAAQNLRSGSTERFVIHVKAGVYK  200

Query  924   ENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTA  745
             ENVEI   LKNIM +GDGI  TI+TG+R+   G+TT+ SAT  V G+GFI QG+TF NTA
Sbjct  201   ENVEIKKTLKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVTGEGFIAQGMTFENTA  260

Query  744   GAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVF  565
             G   HQAVALRSG+D SVFY+CSF+GYQDTLYVYS RQFYRECD+YGT+DFI G+A  V 
Sbjct  261   GPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYSQRQFYRECDVYGTIDFICGDATAVL  320

Query  564   QNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPW  400
             QNCN+Y R P  N+ NT+TAQ R+D N+NTGI IH+ +VTAA DL+ V    +TYLGRPW
Sbjct  321   QNCNVYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAVQGSFRTYLGRPW  380

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             K+YSRTV MKS LD LIDPAGW PW G+FAL+TLYYGEY N+GAG +T  RVKW GY VI
Sbjct  381   KKYSRTVIMKSDLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGGATGGRVKWPGYRVI  440

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             TSA EA KFTVGN +AG SW+PAT VPF++GL
Sbjct  441   TSAVEAGKFTVGNILAGESWIPATGVPFSAGL  472



>ref|NP_191930.1| pectin methylesterase 38 [Arabidopsis thaliana]
 sp|O81320.1|PME38_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
38; Includes: RecName: Full=Pectinesterase inhibitor 38; AltName: 
Full=Pectin methylesterase inhibitor 38; Includes: RecName: 
Full=Pectinesterase 38; Short=PE 38; AltName: Full=Pectin 
methylesterase 38; Short=AtPME38 [Arabidopsis thaliana]
 gb|AAC19295.1| contains similarity to pectinesterase [Arabidopsis thaliana]
 emb|CAB80777.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE81836.1| pectin methylesterase 38 [Arabidopsis thaliana]
Length=474

 Score =   481 bits (1239),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 264/493 (54%), Positives = 325/493 (66%), Gaps = 32/493 (6%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGG  1405
             C +TP+P  C+  L +       I+  + FL+V+    L  A  AK +TY L  +    G
Sbjct  8     CDETPHPGECKTLLIKHKP----IRSTTQFLQVSVERTLDGAVKAKSDTYFLEPQF---G  60

Query  1404  EKAAWEDCLELYENMVQKIDTTVD-PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTG  1228
              K AWE+C++LYE  + +++ +V  P   CS +D Q WLSTALTNL+TC     +LGV+ 
Sbjct  61    SKQAWEECMDLYEQTIHRLNESVLCPKNVCSRSDVQAWLSTALTNLDTCQEEMSELGVSS  120

Query  1227  NILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQS--SAAS  1054
             + L ++T +     + NTLAINK       E               G  K+     S   
Sbjct  121   HSLESITID-----VINTLAINKRMEQNGKEF--------------GISKITMKTLSIGE  161

Query  1053  KADIVVAQDGSGNYKTVTEAVNAAAKR-SGSGRYVIYVKAGVYKENVEIGSKLKNIMLVG  877
             K D+VVAQDGSG+YKT+ EAVN A +R  GS RYVI+VK GVY+E V +G K  NIM+ G
Sbjct  162   KVDVVVAQDGSGDYKTIQEAVNGAGERLKGSPRYVIHVKQGVYEEYVNVGIKSNNIMITG  221

Query  876   DGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDL  697
             DGIGKTIITG +S G G +T+KSAT    GDGF+G+ IT RNTAG  NHQAVALRS SD+
Sbjct  222   DGIGKTIITGDKSKGRGFSTYKSATFVAEGDGFVGRDITIRNTAGPENHQAVALRSNSDM  281

Query  696   SVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNT  517
             SVFY+CS EGYQDTLYV+S RQF+RECDIYGTVDFIFGNAA V QNC I+ARNPPN  NT
Sbjct  282   SVFYRCSIEGYQDTLYVHSGRQFFRECDIYGTVDFIFGNAAAVLQNCRIFARNPPNGVNT  341

Query  516   ITAQGRSDPNQNTGISIHNCKVTAAS--DLKGVKTYLGRPWKEYSRTVFMKSSLDSLIDP  343
             ITAQ R +PNQ TGI IHN  V  A    L GVKTYLGRPW+ Y+RTV + + LD+LI+P
Sbjct  342   ITAQSRFNPNQTTGIVIHNSVVKGAPGVQLGGVKTYLGRPWRSYARTVVIGTYLDTLIEP  401

Query  342   AGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGS  163
              GW+ WD   AL+TLYYGEY N+G G+ T NRV W G+HVI+   EA +FT+  FI   S
Sbjct  402   NGWIDWDNVTALSTLYYGEYQNSGPGSGTENRVDWAGFHVISDIQEAREFTLPKFIDSAS  461

Query  162   WLPATNVPFTSGL  124
             WLP T VPFT  L
Sbjct  462   WLPPTKVPFTINL  474



>ref|XP_010101979.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90903.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=463

 Score =   481 bits (1238),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 258/442 (58%), Positives = 318/442 (72%), Gaps = 18/442 (4%)
 Frame = -3

Query  1401  KAAWEDCLELYENMVQKIDTTVDPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNI  1222
             K+AW+DCLELY++ V  ++ +V+ N K +  D  TWLS +L N  TC  GF D  +  + 
Sbjct  24    KSAWQDCLELYKDTVDLLNRSVNSNNK-NPLDTHTWLSASLANQHTCRNGFTDFQIPSHY  82

Query  1221  --LPAVTSNNVSYLISNTLAINKGFtttnneattgyteG-------FPDWVRPGDRKLLQ  1069
                P++ SN  S L+SN+LAINK    +   + +            FP+WV   DRKLLQ
Sbjct  83    DSFPSMLSN-FSKLLSNSLAINKATIPSTATSFSKQVRSRRLLSDGFPEWVSTADRKLLQ  141

Query  1068  SS-AASKADIVVAQDGSGNYKTVTEAVNAAAKRSG-SGRYVIYVKAGVYKENVEIGSKLK  895
             S  AA+KADIVVAQDGSG +KT++EAV AA    G S R V+YVKAGVY ENVEI + +K
Sbjct  142   SGGAAAKADIVVAQDGSGGFKTISEAVEAAKNLGGGSKRIVVYVKAGVYNENVEIKNDIK  201

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             N+M VGDGI  TI+TG+R+   G+TTF+SAT  V GD FI Q +TF NTAG A +QAVAL
Sbjct  202   NLMFVGDGIDATIVTGNRNNVDGSTTFQSATFGVSGDRFIAQDMTFENTAGPAKYQAVAL  261

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RSGSD SVFY+CSF+GYQDTLYVYS RQFYR+C++YGTVDFIFG+A  + QNCNI  R P
Sbjct  262   RSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCNVYGTVDFIFGDAVAILQNCNILVRKP  321

Query  534   -PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVK----TYLGRPWKEYSRTVFMK  370
                + N +T Q R+DPN+NTGI I N ++TA+SDL+ V+    TYLGRP ++YSRTV M 
Sbjct  322   ISGQENVVTCQTRTDPNENTGIIIQNSRITASSDLRPVQGSFETYLGRPLQKYSRTVIMT  381

Query  369   SSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFT  190
             SSLD LIDP GWLP  GNFAL+TLYY EY N+GAGA+T  RV W GYHV+TSA EA KFT
Sbjct  382   SSLDGLIDPKGWLPGSGNFALSTLYYAEYMNSGAGAATGGRVSWPGYHVLTSAAEAGKFT  441

Query  189   VGNFIAGGSWLPATNVPFTSGL  124
             VGNF+ G SW+PAT VPF +GL
Sbjct  442   VGNFLGGDSWIPATGVPFAAGL  463



>ref|XP_009627971.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Nicotiana tomentosiformis]
Length=530

 Score =   483 bits (1244),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 357/516 (69%), Gaps = 22/516 (4%)
 Frame = -3

Query  1629  STAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNA  1450
             S A+   +  +I  WCS+TP+P+PC+Y++S    +  + ++KS+F  +   +AL +    
Sbjct  23    SLAIDEETSNDINWWCSKTPHPEPCKYFMS---GDSFKPQNKSEFRTMTVQVALDHVIQV  79

Query  1449  KDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA---DAQTWLSTAL  1279
             + +  ++   CR   ++  W DC +L ++ V +++ ++D  IK +++   DAQTWLS ++
Sbjct  80    QAHAKNVSQYCRGKRKQLVWMDCDKLMDDTVLQLNRSLD-GIKSNSSSDFDAQTWLSASM  138

Query  1278  TNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDW  1099
             TN+ETC +G  DL V+ NIL    S NVS LISN LA+N  F    N    G    FP+W
Sbjct  139   TNIETCLSGSNDLNVS-NILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGG---FPNW  194

Query  1098  VRPGDRKLLQSSA----ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYVIYVKAG  934
             +   +R LL SS+    A+KA+ VVA+D SG+++++  A+N A ++R G+ R VIY+K G
Sbjct  195   LTASERVLLHSSSIDLMATKANYVVAKDRSGHFRSIQSAINYATSRRVGNQRIVIYIKRG  254

Query  933   VYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFR  754
             VY+EN+ IG  +  IMLVGDG+  T+ITGSRSV  G TT+ +AT+ V G GFI +GITFR
Sbjct  255   VYRENILIGPTMGKIMLVGDGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGITFR  314

Query  753   NTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAA  574
             NTAG  N QAVALRS SDLSVFY C FEGYQDTL+V S RQFY+ C IYGT+DFIFGNAA
Sbjct  315   NTAGPQNGQAVALRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAA  374

Query  573   VVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLG  409
             VVFQNC IY R P   + N ITAQGR+DP QNT ISIHN ++ AA DL+ V    +TYLG
Sbjct  375   VVFQNCMIYVRRPLWGQVNVITAQGRNDPFQNTAISIHNSRIMAAPDLRPVVQSFQTYLG  434

Query  408   RPWKEYSRTVFMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGG  232
             RPW++YSRT+ MK+ +DSL++ AGWL W D NFAL+TLYY EY N G  AST  RVKW G
Sbjct  435   RPWQQYSRTIIMKTYIDSLVNRAGWLTWLDSNFALSTLYYAEYGNIGPAASTRYRVKWPG  494

Query  231   YHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             YHVI S   ASK+TV + IAG +WLP+T VPFT+GL
Sbjct  495   YHVIKSGNVASKYTVASLIAGRAWLPSTGVPFTAGL  530



>ref|XP_010672014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   483 bits (1244),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 255/505 (50%), Positives = 340/505 (67%), Gaps = 13/505 (3%)
 Frame = -3

Query  1605  PTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLG  1426
             P +I  WC   P+P+ C+Y+++R+     + K+K+DF ++   +AL  A  A+ + +  G
Sbjct  33    PDDISKWCDGVPHPKACKYFMART-PGVFEPKEKADFRRMLVEVALDRAMAAQGHLWMWG  91

Query  1425  TKCRSGGEKAAWEDCLELYENMVQKIDTTV---DPNIKCSTADAQTWLSTALTNLETCHA  1255
              KC +  E+AAW DC+ LY + + +++ T+     N   +  DAQTWLS++LTNLETC +
Sbjct  92    QKCETHSERAAWADCIRLYSHTIIQLNYTLYGLTSNSSFTDFDAQTWLSSSLTNLETCMS  151

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             G  D+ VT  I P V + NVS LISN LA+N+G       +T+  T  +P WV   +RKL
Sbjct  152   GSQDMNVTSFIWPHV-AYNVSDLISNGLAVNEGLIEEFINSTSLNTTKYPSWVSHDERKL  210

Query  1074  LQSS---AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             LQ S   AAS+A  VVA+DGS  Y+TV  A++AAA+    GR VI+V+ GVY+EN+ +G 
Sbjct  211   LQVSRKLAASRAAFVVAKDGSSPYRTVQSAIDAAARSRIRGRKVIHVRRGVYRENIYVGP  270

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
                +IMLVGDG+  TI+T SRS   G TT+ SAT  + G  F+ + ITF+N AGA   QA
Sbjct  271   YNNDIMLVGDGMRYTIVTSSRSARSGYTTYSSATAGIDGLRFMARDITFQNAAGAQMGQA  330

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY+C+F GYQDTL+V+S RQFY+ C I+GT+D IFGNAAVVFQNC IYA
Sbjct  331   VALRSSSDLSVFYRCAFLGYQDTLFVHSQRQFYKMCYIFGTIDIIFGNAAVVFQNCMIYA  390

Query  543   RNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDL----KGVKTYLGRPWKEYSRTV  379
             R P   + N ITAQGR DPNQNTGI +H C++ A  DL    + V+TYLGRPW+ YSRT+
Sbjct  391   RLPVFGQANVITAQGRVDPNQNTGIVMHGCRIMADHDLSRKIRTVQTYLGRPWQRYSRTI  450

Query  378   FMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
              M+S +  L++PAGW+PW  +  L+TLYY EY N G GA    RV+W GYH+IT     S
Sbjct  451   IMRSYMGPLVNPAGWMPWKSSGFLSTLYYAEYGNFGPGARLHRRVRWPGYHIITRPNAVS  510

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
             +F+V  FIAG  WLPAT VPF+ G+
Sbjct  511   QFSVERFIAGRKWLPATGVPFSPGV  535



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   484 bits (1245),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 280/552 (51%), Positives = 361/552 (65%), Gaps = 30/552 (5%)
 Frame = -3

Query  1701  TNLLITKMTNLQFIFICSFLAIFV---STAVFGYSPTEI-KSWCSQTPYPQPCEYYLSRS  1534
             T  ++ + T +Q + +   + +F+   S+++      +I  S C  T YP+ C   LS S
Sbjct  35    TMFIMRRRTKIQLLVLTISITLFLVQASSSIPVLHHLQIAHSACEGTLYPELCVSTLS-S  93

Query  1533  YSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSL--GTKCRSGGEKAAWEDCLELYENM  1360
             + +    K  S  +    N  ++  + +  N   +    K +   E+ A +DCLEL++  
Sbjct  94    FPDLTS-KTISQMISSTVNYTVKEVEISASNCTDIRKNLKAQDPLEQRALDDCLELFDET  152

Query  1359  VQKIDTTV-DPNIKCSTA----DAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSN--  1201
             + ++ T + D + K S +    D QT LS A+TN  TC  G + LG    I   +  N  
Sbjct  153   ISELQTALSDLSPKSSPSKHYNDLQTLLSAAMTNQYTCLDG-LSLGNEQVIREEIKQNLN  211

Query  1200  NVSYLISNTLAINKGFtttnneattg-------yteGFPDWVRPGDRKLLQSSAAS-KAD  1045
             N+S+L+SN+LA+        +                FP WV P DRKLLQ+S  + K D
Sbjct  212   NISHLVSNSLAMLTKMPKAADTLKDEVFPEYGKMAGRFPGWVSPKDRKLLQASTNTMKFD  271

Query  1044  IVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIG  865
             +VVA+DGSGN++T+ EAV AAA  S + R+VIY+KAG Y ENV++G K   +M VGDGIG
Sbjct  272   LVVAKDGSGNFRTIGEAV-AAAPNSSATRFVIYIKAGTYFENVDVGKKKTMLMFVGDGIG  330

Query  864   KtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFY  685
             KT++  SR+V  G TTF+SATVAVVG+GFI + +T  N AG + HQAVALRSGSDLS FY
Sbjct  331   KTVVKASRNVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKHQAVALRSGSDLSAFY  390

Query  684   QCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNTITA  508
             +CSF GYQDTLYV+S RQFYRECDIYGTVDFIFGNAAVVFQNCN+YAR P  N+ N  TA
Sbjct  391   RCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLYARRPNANQKNIFTA  450

Query  507   QGRSDPNQNTGISIHNCKVTAASDLKGVK----TYLGRPWKEYSRTVFMKSSLDSLIDPA  340
             QGR DPNQNTGISI NCKVT A+DL  VK    TYLGRPWKEYSRTVF+ S LD LI+PA
Sbjct  451   QGREDPNQNTGISILNCKVTLAADLSPVKSSFHTYLGRPWKEYSRTVFIGSYLDDLINPA  510

Query  339   GWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSW  160
             GWL W GNF L+TLYYGEY N G G+ T NRVKW GY VI S+TEA++FTV +FI GG W
Sbjct  511   GWLEWSGNFGLSTLYYGEYMNKGPGSDTTNRVKWPGYRVINSSTEATQFTVASFIQGGGW  570

Query  159   LPATNVPFTSGL  124
             L +T +P+++GL
Sbjct  571   LSSTGIPYSAGL  582



>ref|XP_009374496.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   479 bits (1234),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 274/473 (58%), Positives = 333/473 (70%), Gaps = 13/473 (3%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K  S+F K+   +AL+ A +A   T   G  C++  EKAAW DCL+L+ N V +++ T++
Sbjct  11    KHTSEFRKMLVQVALERALSAITYTSQYGQNCQNDKEKAAWADCLKLFHNTVSQLNVTLE  70

Query  1332  ---PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAVTSNN-VSYLISNTLAI  1165
                  + CS  DAQTWLS ALTN+ETC  G ++L VT  I P  TSNN VS LISN+LAI
Sbjct  71    GLGTKLNCSNFDAQTWLSAALTNIETCRVGSLELNVTNFITPIYTSNNNVSELISNSLAI  130

Query  1164  NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNA  985
               G      E +   +E FP+WV   DR+LLQ+ A  +A++VVA+DGSGN++TV  A++A
Sbjct  131   --GSQLLGTEESHNESEKFPNWVSKHDRRLLQN-ANIRANLVVAKDGSGNFRTVQAALDA  187

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             AA+R    +++IYVK GVY EN+++ +    IMLVG GI  T+IT SRSV GG TT+ SA
Sbjct  188   AARRRVQSKFIIYVKKGVYTENIQVSNTNSKIMLVGAGIRYTVITSSRSVSGGYTTYNSA  247

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T  + G GFI +GITFRNTAG    QAVAL S SDLSVFY+C+F+GYQDT  V S RQFY
Sbjct  248   TAGINGPGFIARGITFRNTAGPLKGQAVALMSASDLSVFYRCAFQGYQDTHMVPSQRQFY  307

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVT  448
             REC I+GT+DFIFGNAA VFQNC IY R P   + N ITAQGR+DP QNT ISIHN +V 
Sbjct  308   RECYIFGTIDFIFGNAAAVFQNCIIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSQVR  367

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEY  283
             AA+DLK V    KTYLGRPW +YSR VFMK  LDSLI+PAGWL W   NFAL+TLYYGEY
Sbjct  368   AAADLKPVASSYKTYLGRPWMQYSRVVFMKCYLDSLINPAGWLQWQRSNFALSTLYYGEY  427

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G  +ST  RVKW G+H ITS   AS FT GN IAG SWLPAT VPFT+GL
Sbjct  428   KNFGPASSTRYRVKWPGFHAITSPNVASMFTAGNLIAGRSWLPATGVPFTTGL  480



>ref|XP_009149919.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Brassica rapa]
Length=594

 Score =   483 bits (1244),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 257/506 (51%), Positives = 339/506 (67%), Gaps = 18/506 (4%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNG--GQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCR  1414
             WC++TP+ + C YY  RS  N      + +S+FL++   +AL  A      T   G  C 
Sbjct  89    WCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVITHAQTVKFGPSCT  148

Query  1413  SGGEKAAWEDCLELYENMVQKIDTTV-------DPNIKCSTADAQTWLSTALTNLETCHA  1255
             +   KAAW DC++L+EN V +++ T+         ++KCS  DAQTWLSTA TN+ETC +
Sbjct  149   NNQRKAAWSDCVKLFENTVAQLNLTLKGLNPAASSDVKCSNFDAQTWLSTAQTNIETCRS  208

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             G  DL V+  ++PA+++ N+S LI N LA+N      +N  T  + E FP WV   +R+L
Sbjct  209   GSEDLKVSDFVMPAISNKNLSDLIGNCLAVNGVLMKQHNHTTANHKEYFPSWVSRHERRL  268

Query  1074  LQSS--AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             L S+  A S+  +VV+QD SG+++++  A+N A +R    R++IYVK GVY+EN+E+G+ 
Sbjct  269   LVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYVKKGVYRENIEVGND  328

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVGDG  KTIIT  RSV  G TT+ SAT    G  F+ + +TF NTAG    QAV
Sbjct  329   NHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDMTFINTAGPLRGQAV  388

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ++RS SDLSVFY+    G+QDTLY++S RQF+REC I GT+DFIFGNAAVVFQNC I  R
Sbjct  389   SVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNAAVVFQNCMILVR  448

Query  540   NPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P   + N ITAQGR DP QNTGI+IH+ ++ AASDL+ V    KTYLGRPW+ YSR   
Sbjct  449   RPLRGQANVITAQGRGDPFQNTGITIHSSRIIAASDLRPVIGAYKTYLGRPWQAYSRVTI  508

Query  375   MKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             MK+ +D+ I P GW PW    NFALNT++YGEY N G G+ST  RV+W G+H ITSA  A
Sbjct  509   MKTYIDNSISPLGWSPWLRGSNFALNTVFYGEYKNFGPGSSTRWRVRWKGFHAITSAAVA  568

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S+FTVG+ IAGGSWLP+T VPF +GL
Sbjct  569   SRFTVGSLIAGGSWLPSTGVPFKTGL  594



>gb|KEH29375.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=539

 Score =   481 bits (1238),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 264/505 (52%), Positives = 341/505 (68%), Gaps = 15/505 (3%)
 Frame = -3

Query  1596  IKSWCSQTPYPQPCEYYLSRS-YSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             I  WC+QTP+P+ C+YY  ++ Y +   IK K+ F ++  +LAL+ A   ++  ++ G  
Sbjct  36    IDWWCNQTPHPETCKYYTKQTHYYHNKSIKHKTKFREILIHLALERAVVMRNMAHNFGQN  95

Query  1419  C-RSGGEKAAWEDCLELYENMVQKIDTT-VDPNIK--CSTADAQTWLSTALTNLETCHAG  1252
                +  +K+   DCL+L++N V  ++ T +D + K  CS+ DAQTWLSTA TN+ETC  G
Sbjct  96    SWITQKKKSVSRDCLKLFDNTVFHLNRTFLDLHKKKSCSSFDAQTWLSTAYTNIETCRNG  155

Query  1251  FVDLGVTGNILPAVTSNNVSYLISNTLAINKGFttt---nneattgyteGFPDWVRPGDR  1081
              ++L +   I+P +   N++ +ISN L +N  F               EGFP W    +R
Sbjct  156   ALELNIPKFIVP-IMKVNMTQIISNGLFVNWEFVKRDGRVRYTNDVTEEGFPRWFSVRER  214

Query  1080  KLLQSSAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             KLL+SS A KA I+VA+DGSG++K V +A+NAA +R    R+VI VK GVY+EN+ +G  
Sbjct  215   KLLESSRAIKAHIIVAKDGSGHFKRVQDAINAAGRRRFKTRFVIRVKKGVYRENIVVGKM  274

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVGDG   T+IT +R+V  G TT+ SAT  + G  FI + ITF NTAG    QAV
Sbjct  275   NDNIMLVGDGSRNTVITSNRNVQAGFTTYSSATAGIDGLHFIARDITFENTAGPRRGQAV  334

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ALRS SDLSVFY+CSF+GYQDTL V++ RQFYREC IYGTVDFIFGNAAVVFQNC I  R
Sbjct  335   ALRSASDLSVFYRCSFKGYQDTLMVHAQRQFYRECYIYGTVDFIFGNAAVVFQNCMILVR  394

Query  540   NPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P N + N ITAQGR DP QNTGISIHN ++ AA D K V     T+LGRPW+ YSR V 
Sbjct  395   RPLNGQANMITAQGRDDPFQNTGISIHNSQIRAAPDFKPVVGKFNTFLGRPWQRYSRVVV  454

Query  375   MKSSLDSLIDPAGWLPWDG-NFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEAS  199
             MKS +D+L+ P GW PW G NFA +TL+YGEY N G G+ST NRV+W GYHV+ S  +AS
Sbjct  455   MKSFMDNLVSPMGWSPWGGTNFAQSTLFYGEYKNFGPGSSTRNRVRWPGYHVMKSPAQAS  514

Query  198   KFTVGNFIAGGSWLPATNVPFTSGL  124
              FTV   +AG +WLPAT VPFTSG+
Sbjct  515   PFTVATLLAGTTWLPATGVPFTSGI  539



>emb|CDX99055.1| BnaA06g17460D [Brassica napus]
Length=594

 Score =   483 bits (1243),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 257/506 (51%), Positives = 339/506 (67%), Gaps = 18/506 (4%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNG--GQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCR  1414
             WC++TP+ + C YY  RS  N      + +S+FL++   +AL  A      T   G  C 
Sbjct  89    WCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVITHAQTVKFGPSCT  148

Query  1413  SGGEKAAWEDCLELYENMVQKIDTTV-------DPNIKCSTADAQTWLSTALTNLETCHA  1255
             +   KAAW DC++L+EN V +++ T+         ++KCS  DAQTWLSTA TN+ETC +
Sbjct  149   NNQRKAAWSDCVKLFENTVAQLNLTLKGLNPGASSDVKCSNFDAQTWLSTAQTNIETCRS  208

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             G  DL V+  ++PA+++ N+S LI N LA+N      +N  T  + E FP WV   +R+L
Sbjct  209   GSEDLKVSDFVMPAISNKNLSDLIGNCLAVNGVLMKQHNHTTANHEEYFPSWVSRHERRL  268

Query  1074  LQSS--AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             L S+  A S+  +VV+QD SG+++++  A+N A +R    R++IYVK GVY+EN+E+G+ 
Sbjct  269   LVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYVKKGVYRENIEVGND  328

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVGDG  KTIIT  RSV  G TT+ SAT    G  F+ + +TF NTAG    QAV
Sbjct  329   NHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDMTFINTAGPLRGQAV  388

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ++RS SDLSVFY+    G+QDTLY++S RQF+REC I GT+DFIFGNAAVVFQNC I  R
Sbjct  389   SVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNAAVVFQNCMILVR  448

Query  540   NPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P   + N ITAQGR DP QNTGI+IH+ ++ AASDL+ V    KTYLGRPW+ YSR   
Sbjct  449   RPLRGQANVITAQGRGDPFQNTGITIHSSRIIAASDLRPVIGAYKTYLGRPWQAYSRVTI  508

Query  375   MKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             MK+ +D+ I P GW PW    NFALNT++YGEY N G G+ST  RV+W G+H ITSA  A
Sbjct  509   MKTYIDNSISPLGWSPWLRGSNFALNTVFYGEYKNFGPGSSTRWRVRWKGFHAITSAAVA  568

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S+FTVG+ IAGGSWLP+T VPF +GL
Sbjct  569   SRFTVGSLIAGGSWLPSTGVPFKTGL  594



>emb|CDY55029.1| BnaC03g75510D [Brassica napus]
Length=585

 Score =   482 bits (1240),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 256/506 (51%), Positives = 339/506 (67%), Gaps = 18/506 (4%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNG--GQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCR  1414
             WC++TP+ + C YY  RS  N      + +S+FL++   +AL  A      T   G  C 
Sbjct  80    WCNKTPHAETCNYYFQRSPHNNINRPPRFRSEFLRLLVQVALDQAVITHAQTVKFGPSCT  139

Query  1413  SGGEKAAWEDCLELYENMVQKIDTTV-------DPNIKCSTADAQTWLSTALTNLETCHA  1255
             +   KAAW DC++L+EN V +++ T+         ++KCS  DAQTWLSTA TN+ETC +
Sbjct  140   NNQRKAAWSDCVKLFENTVAQLNLTLKGLNPGASSDVKCSNFDAQTWLSTAQTNIETCRS  199

Query  1254  GFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKL  1075
             G  DL V+  ++PA+++ N+S  I N LA+N      +N  T  + E FP WV   +R+L
Sbjct  200   GSEDLKVSDFVMPAISNKNLSDFIGNCLAVNGVLMKQHNHTTANHEEYFPSWVSRHERRL  259

Query  1074  LQSS--AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSK  901
             L S+  A S+  +VV+QD SG+++++  A+N A +R    R++IYVK GVY+EN+E+G+ 
Sbjct  260   LVSASLAKSRPHLVVSQDRSGHFRSIQSAINFAGRRRIKSRFIIYVKKGVYRENIEVGND  319

Query  900   LKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAV  721
               NIMLVGDG  KTIIT  RSV  G TT+ SAT    G  F+ + +TF NTAG    QAV
Sbjct  320   NHNIMLVGDGARKTIITSGRSVKNGYTTYNSATAGFGGQRFVAKDMTFINTAGPLRGQAV  379

Query  720   ALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYAR  541
             ++RS SDLSVFY+    G+QDTLY++S RQF+REC I GT+DFIFGNAAVVFQNC I  R
Sbjct  380   SVRSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNAAVVFQNCMILVR  439

Query  540   NP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVF  376
              P   + N ITAQGR DP QNTGI+IH+ ++ AASDL+ V    KTYLGRPW+ YSR   
Sbjct  440   RPLRGQANVITAQGRGDPFQNTGITIHSSRIIAASDLRPVIRAYKTYLGRPWQAYSRVTI  499

Query  375   MKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
             MK+ +D+ I P GW PW    NFALNT++YGEY N G G+ST  RV+W G+H ITSA+ A
Sbjct  500   MKTYIDNSISPLGWSPWLRGSNFALNTVFYGEYKNFGPGSSTRWRVRWKGFHAITSASVA  559

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             S+FTVG+ IAGGSWLP+T VPF +GL
Sbjct  560   SRFTVGSLIAGGSWLPSTGVPFKTGL  585



>ref|XP_002318284.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE96504.2| pectinesterase family protein [Populus trichocarpa]
Length=533

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 267/520 (51%), Positives = 341/520 (66%), Gaps = 17/520 (3%)
 Frame = -3

Query  1647  FLAIFVSTAVFGYSPTEIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLAL  1468
             F +  +S A    +   I  WC+ TP+P  C  Y      +   +K +S F  ++  LAL
Sbjct  19    FFSSMLSFAASKSTEANITWWCNHTPHPSTC-MYHMSHSHHHFSLKHRSQFRIMSIQLAL  77

Query  1467  QYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTV----DPNIKCSTADAQ  1300
             + A  A+         C +  ++A W DCL+L+ N + +++ T+       + C+  DAQ
Sbjct  78    ESALIAQGQVSQFEQNCENQNQRAVWSDCLKLHSNTILQLNRTLIGLEKKRLPCTDLDAQ  137

Query  1299  TWLSTALTNLETCHAGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgy  1120
             TWLSTALTN++TC  G +DL VT   +PA  S N+S LISNTLAIN     +        
Sbjct  138   TWLSTALTNIQTCRTGSLDLNVTDFTMPAA-SKNLSELISNTLAIN---GVSLATEDNNT  193

Query  1119  teGFPDWVRPGDRKLLQS-SAASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYV  943
                FP W    +R+LLQS S A+KA++VV++ G GN++T+  A++AA+KR    R++IYV
Sbjct  194   QGYFPSWFSGQNRRLLQSTSIAAKANLVVSKSGLGNFRTIQAAIDAASKRIFRTRFIIYV  253

Query  942   KAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGI  763
             K GVY+EN+ +     NI LVGDG+  TIIT SRSVG G TT+ SAT  + G  F+ +GI
Sbjct  254   KRGVYRENIVVRVNSNNIWLVGDGLRDTIITSSRSVGAGYTTYSSATAGIDGLRFVARGI  313

Query  762   TFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFG  583
             TF NTAG    QAVALRS SDLSVFY+CS +GYQDTL+V+S RQFYREC I+GT+DFIFG
Sbjct  314   TFINTAGPLKGQAVALRSASDLSVFYRCSIQGYQDTLFVHSQRQFYRECYIFGTIDFIFG  373

Query  582   NAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KT  418
             NAAVVFQN  IY R P   + N ITAQGR+DP QNTGISIHN ++  A DLK V    +T
Sbjct  374   NAAVVFQNSIIYVRRPLKGQANMITAQGRNDPFQNTGISIHNSRILPAPDLKPVVGAFET  433

Query  417   YLGRPWKEYSRTVFMKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRV  244
             YLGRPW +YSRTV +++ +DS I+P+GW PW    NFA +TLYYGEY N G G+ST  RV
Sbjct  434   YLGRPWMQYSRTVILRTYIDSFINPSGWSPWLRTSNFAQDTLYYGEYKNFGPGSSTKRRV  493

Query  243   KWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              W GYHVITS   AS+FTV N IAG SWLPAT VPFTS L
Sbjct  494   AWKGYHVITSPGVASRFTVRNLIAGDSWLPATKVPFTSDL  533



>ref|XP_010426712.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 38 
[Camelina sativa]
Length=472

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 263/497 (53%), Positives = 322/497 (65%), Gaps = 36/497 (7%)
 Frame = -3

Query  1584  CSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGG  1405
             C +TP+P  C   L         I+  + FL+ A    L  A  AKD+TYSLG +    G
Sbjct  2     CDETPHPGECNTLLIEHKP----IRSTTQFLQAAVERTLDGAVRAKDDTYSLGPQF---G  54

Query  1404  EKAAWEDCLELYENMVQKIDTTV--DPNIKCSTADAQTWLSTALTNLETCHAGFVDLGVT  1231
              K AWEDC++LYE  + +++ ++    N   S  D Q WLSTALTNL+TC     +LGV+
Sbjct  55    SKQAWEDCMDLYEQTIYRLNQSLLCPKNAYSSRWDVQAWLSTALTNLDTCQEEISELGVS  114

Query  1230  GNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQSSAAS-  1054
              + L ++T +     + N LAINK   T               W   G  K+   +A S 
Sbjct  115   SHSLDSITID-----VINALAINKRLETK--------------WKEFGTSKVEMKTAPSI  155

Query  1053  ----KADIVVAQDGSGNYKTVTEAVNAAAKR-SGSGRYVIYVKAGVYKENVEIGSKLKNI  889
                 K D+VVAQDGSG+YKT+ EAVN A KR  GS RYVI+VK GVY+E V +G K  N+
Sbjct  156   TIGEKVDVVVAQDGSGDYKTIQEAVNGAGKRPKGSPRYVIHVKQGVYEEYVTVGIKSNNM  215

Query  888   MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  709
             M++GDGIGKTIITG +S G G +TFKSAT    GDGF+G+ +T RNTAG   HQAVALRS
Sbjct  216   MIIGDGIGKTIITGDKSKGRGFSTFKSATFVAEGDGFVGRDMTIRNTAGPEKHQAVALRS  275

Query  708   GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  529
              SD+SVFY+CS EGYQDTLYV+S RQF+RECD+YGTVDFIFGNAA  FQNC IYARNPP+
Sbjct  276   DSDMSVFYRCSIEGYQDTLYVHSGRQFFRECDVYGTVDFIFGNAAAFFQNCRIYARNPPS  335

Query  528   KTNTITAQGRSDPNQNTGISIHNCKVTAA--SDLKGVKTYLGRPWKEYSRTVFMKSSLDS  355
               NTITAQ R +PNQ TGI IHN  V  A    L+GVKTYLGRPW+ Y+RTV M + LD 
Sbjct  336   GVNTITAQSRVNPNQTTGIVIHNSVVRGAPGEQLEGVKTYLGRPWRPYARTVVMGTYLDQ  395

Query  354   LIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASKFTVGNFI  175
             LI+P GW+ W    A +TLYYGEY N+G G+ T NRV W G+HVI+   EA +FT+  FI
Sbjct  396   LIEPKGWMDWGNVTARSTLYYGEYQNSGPGSGTENRVDWPGFHVISDLEEARQFTLPKFI  455

Query  174   AGGSWLPATNVPFTSGL  124
                 WLP T VPFT  L
Sbjct  456   DAALWLPPTKVPFTINL  472



>ref|XP_009773841.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X2 [Nicotiana sylvestris]
Length=530

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 265/506 (52%), Positives = 352/506 (70%), Gaps = 22/506 (4%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +I  WCS+TP+P+PC+Y++S    +  + ++KS+F  +   +AL +    + +  ++   
Sbjct  33    DINWWCSKTPHPEPCKYFMS---GDSFKPQNKSEFRTMTVQVALDHVIQVQAHAKNVSQH  89

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA---DAQTWLSTALTNLETCHAGF  1249
             CR   ++  W DC +L ++ V +++ ++D  IK +++   DAQTWLS ++TN+ETC +G 
Sbjct  90    CRGKRKQLVWMDCDKLMDDTVLQLNRSLD-GIKSNSSSDFDAQTWLSASMTNIETCLSGS  148

Query  1248  VDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ  1069
              DL V+ NIL    S NVS LISN LA+N  F    N    G    FP+W+   +R LL 
Sbjct  149   NDLNVS-NILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGG---FPNWLTASERVLLH  204

Query  1068  SSA----ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             SS+    A++A+ VVA+D SG+++++  A+N A ++R G+ R VIY+K GVY+EN+ IG 
Sbjct  205   SSSIDLMATRANYVVAKDRSGHFRSIQAAINYATSRRVGNQRIVIYIKRGVYRENILIGP  264

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +  IMLVG G+  T+ITGSRSV  G TT+ +AT+ V G GFI +G+TFRNTAG  N QA
Sbjct  265   TMGKIMLVGAGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGMTFRNTAGPQNGQA  324

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY C FEGYQDTL+V S RQFY+ C IYGT+DFIFGNAAVVFQNC IY 
Sbjct  325   VALRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYV  384

Query  543   RNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P   + N ITAQGR+DP QNT ISIHN ++ AA DL+ V    +TYLGRPW++YSRTV
Sbjct  385   RRPLWGQVNVITAQGRNDPFQNTAISIHNSRIMAAPDLRPVVRSFQTYLGRPWQQYSRTV  444

Query  378   FMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
              MK+ +DSL++ AGWL W D NFAL+TLYY EY N G  AST  RVKW GYHVI S   A
Sbjct  445   IMKTYIDSLVNRAGWLTWLDSNFALSTLYYAEYGNIGPAASTRYRVKWPGYHVIKSGNVA  504

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             SK+TV + IAG +WLP+T VPFT+GL
Sbjct  505   SKYTVASLIAGRAWLPSTGVPFTAGL  530



>gb|KFK34037.1| hypothetical protein AALP_AA5G093700 [Arabis alpina]
Length=589

 Score =   481 bits (1238),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 340/504 (67%), Gaps = 17/504 (3%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSG  1408
             WC++TP+ + C YY  +S  N    + +S+FL++   +AL  A      T   G  C + 
Sbjct  87    WCNKTPHAETCNYYFQQSPHNRPP-RFRSEFLRMLVKIALDQAVITHAQTVKFGPSCTNN  145

Query  1407  GEKAAWEDCLELYENMVQKIDTTV---DP----NIKCSTADAQTWLSTALTNLETCHAGF  1249
               KAAW DC+ L++N V +++ T+   +P    ++KCS  DAQTWLSTA TN+ETC +G 
Sbjct  146   QRKAAWSDCVNLFQNTVAQLNRTLKGLNPSASDDVKCSDFDAQTWLSTAQTNIETCRSGS  205

Query  1248  VDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ  1069
              DL V   ++PA+ + N+S LI N LA+N      +N  T  + E FP WV   +R+LL 
Sbjct  206   EDLNVADFVMPAIANKNLSDLIGNCLAVNGVLMKQHNHTTANHKEYFPSWVSRHERRLLI  265

Query  1068  SS--AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIGSKLK  895
             S+  A S++ +VVAQD SG+++++  A+N AA+R    R+VIYV+ GVY+EN+++G+   
Sbjct  266   SASLAKSRSHLVVAQDRSGHFRSIQAAINFAARRRIKSRFVIYVRKGVYRENIDVGNDNH  325

Query  894   NIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVAL  715
             NIMLVGDG  KTIIT  RSV  G TT+ SAT    G  F+ + +TF N AG    QAVA+
Sbjct  326   NIMLVGDGERKTIITSGRSVQHGYTTYNSATAGFGGQRFVAKDMTFINMAGPLRGQAVAV  385

Query  714   RSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP  535
             RS SDLSVFY+    G+QDTLY++S RQF+REC I GT+DFIFGNAAVVFQNC I  R P
Sbjct  386   RSSSDLSVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNAAVVFQNCMILVRKP  445

Query  534   PN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTVFMK  370
                + N ITAQGR DP QNTGI+IH+ ++ AASDLK V    KTYLGRPW+ YSR   +K
Sbjct  446   LRGQANVITAQGRGDPFQNTGITIHSSRIIAASDLKPVIRAYKTYLGRPWQAYSRVTILK  505

Query  369   SSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEASK  196
             + +D+ I P GW PW    NFALNT++YGEY N G G+ST  RV+W G+H ITSAT AS+
Sbjct  506   TYIDNSISPLGWSPWLRGSNFALNTVFYGEYKNFGPGSSTRWRVRWKGFHAITSATVASR  565

Query  195   FTVGNFIAGGSWLPATNVPFTSGL  124
             FTVG+ IAGGSWLP+T VPF +GL
Sbjct  566   FTVGSLIAGGSWLPSTGVPFKTGL  589



>ref|XP_002875838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52097.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=594

 Score =   481 bits (1237),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 260/508 (51%), Positives = 341/508 (67%), Gaps = 20/508 (4%)
 Frame = -3

Query  1587  WCSQTPYPQPCEYYLSRSYSNGGQIKD---KSDFLKVAKNLALQYAKNAKDNTYSLGTKC  1417
             WC++TP+ + C YY  +S  N   I+    +S+FL++   +AL  A      T   G  C
Sbjct  87    WCNKTPHAETCNYYFRKSSQNNINIRPPRFRSEFLRMLVRIALDQAVITHSQTVKFGPSC  146

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTV---DP----NIKCSTADAQTWLSTALTNLETCH  1258
              +   KAAW DC++L++N V +++ T+   +P    ++KC+  DAQTWLSTA TN+ETC 
Sbjct  147   TNNQRKAAWSDCVKLFQNTVTQLNRTLKGLNPAAKDDVKCTDFDAQTWLSTAQTNIETCR  206

Query  1257  AGFVDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteG-FPDWVRPGDR  1081
             +G  DL V+  ++PA+++ N+S LI N LA+N      +N  T    +  FP WV   +R
Sbjct  207   SGSEDLNVSDFVMPAISNKNLSDLIGNCLAVNGVLMKQHNHTTAANHKEYFPSWVSRHER  266

Query  1080  KLLQSS--AASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYKENVEIG  907
             KLL S+  A S   +VVAQD SG+++++  A+N AA+R    R+VIYVK GVY+EN+++G
Sbjct  267   KLLVSATLAKSMPHLVVAQDRSGHFRSIQAAINFAARRRFKSRFVIYVKKGVYRENIDVG  326

Query  906   SKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQ  727
             +   NIMLVGDG  KTIIT  RSV  G TT+ SAT    G  F+ + +TF NTAG    Q
Sbjct  327   NDNHNIMLVGDGERKTIITSGRSVQHGYTTYNSATAGFGGQRFVAKDMTFINTAGPLRGQ  386

Query  726   AVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIY  547
             AVA+RS SDL+VFY+    G+QDTLY++S RQF+REC I GT+DFIFGNAAVVFQNC I 
Sbjct  387   AVAVRSSSDLAVFYRVGIHGFQDTLYIHSQRQFFRECYISGTIDFIFGNAAVVFQNCMIL  446

Query  546   ARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRT  382
              R P + + N ITAQGR DP QNTGI+IH+ ++ AASDLK V    KTYLGRPW+ YSR 
Sbjct  447   VRRPLHGQANIITAQGRGDPFQNTGITIHSSRIIAASDLKPVIRAYKTYLGRPWQAYSRV  506

Query  381   VFMKSSLDSLIDPAGWLPW--DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSAT  208
               MK+ +D+ I P GW PW    NFALNT++YGEY N G G+ST  RV+W G+H ITS  
Sbjct  507   TIMKTYIDNSISPLGWSPWLRGSNFALNTVFYGEYKNFGPGSSTRWRVRWKGFHAITSTA  566

Query  207   EASKFTVGNFIAGGSWLPATNVPFTSGL  124
              AS+FTVG+ IAGGSWLPAT VPF SGL
Sbjct  567   VASRFTVGSLIAGGSWLPATGVPFKSGL  594



>ref|XP_009773839.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
isoform X1 [Nicotiana sylvestris]
Length=530

 Score =   478 bits (1230),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 352/506 (70%), Gaps = 22/506 (4%)
 Frame = -3

Query  1599  EIKSWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTK  1420
             +I  WCS+TP+P+PC+Y++S    +  + ++KS+F  +   +AL +    + +  ++   
Sbjct  33    DINWWCSKTPHPEPCKYFMS---GDSFKPQNKSEFRTMTVQVALDHVIQVQAHAKNVSQH  89

Query  1419  CRSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCSTA---DAQTWLSTALTNLETCHAGF  1249
             CR   ++  W DC +L ++ V +++ ++D  IK +++   DAQTWLS ++TN+ETC +G 
Sbjct  90    CRGKRKQLVWMDCDKLMDDTVLQLNRSLD-GIKSNSSSDFDAQTWLSASMTNIETCLSGS  148

Query  1248  VDLGVTGNILPAVTSNNVSYLISNTLAINKGFtttnneattgyteGFPDWVRPGDRKLLQ  1069
              DL V+ NIL    S NVS LISN LA+N  F    N    G    FP+W+   +R LL 
Sbjct  149   NDLNVS-NILQPNLSTNVSQLISNCLAMNGEFVDWENTTQVGG---FPNWLTASERVLLH  204

Query  1068  SSA----ASKADIVVAQDGSGNYKTVTEAVN-AAAKRSGSGRYVIYVKAGVYKENVEIGS  904
             SS+    A++A+ VVA+D SG+++++  A+N A ++R G+ R VIY+K GVY+EN+ IG 
Sbjct  205   SSSIDLMATRANYVVAKDRSGHFRSIQAAINYATSRRVGNQRIVIYIKRGVYRENILIGP  264

Query  903   KLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQA  724
              +  IMLVG G+  T+ITGSRSV  G TT+ +AT+ V G GFI +G+TFRNTAG  N QA
Sbjct  265   TMGKIMLVGAGLRYTVITGSRSVAAGYTTYSTATLGVDGIGFIARGMTFRNTAGPQNGQA  324

Query  723   VALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYA  544
             VALRS SDLSVFY C FEGYQDTL+V S RQFY+ C IYGT+DFIFGNAAVVFQNC IY 
Sbjct  325   VALRSASDLSVFYGCGFEGYQDTLFVQSQRQFYKSCYIYGTIDFIFGNAAVVFQNCMIYV  384

Query  543   RNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGV----KTYLGRPWKEYSRTV  379
             R P   + N ITAQGR+DP QNT ISIHN ++ AA DL+ V    +TYLGRPW++YSRTV
Sbjct  385   RRPLWGQVNVITAQGRNDPFQNTAISIHNSRIMAAPDLRPVVRSFQTYLGRPWQQYSRTV  444

Query  378   FMKSSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVITSATEA  202
              MK+ +DSL++ AGWL W D NFAL+TLYY EY N G  +ST  RVKW GYHVI S   A
Sbjct  445   IMKTYIDSLVNRAGWLTWLDSNFALSTLYYAEYGNIGPASSTRYRVKWPGYHVIKSGNVA  504

Query  201   SKFTVGNFIAGGSWLPATNVPFTSGL  124
             SK+TV + IAG +WLP+T VPFT+GL
Sbjct  505   SKYTVASLIAGRAWLPSTGVPFTAGL  530



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   479 bits (1234),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 274/512 (54%), Positives = 344/512 (67%), Gaps = 29/512 (6%)
 Frame = -3

Query  1590  SWCSQTPYPQPCEYYLSRSYSNGGQIKDKSDFLKVAKNLALQYAKNAKDNTYSLGTKC--  1417
             S C  T YP  C   L+ S+ +    K   + ++   N  +     +  N  SL  K   
Sbjct  95    STCEGTLYPDLCVSTLT-SFPDLTS-KTVPEMIRSVVNHTIYEVTLSSSNCSSLRKKLPG  152

Query  1416  RSGGEKAAWEDCLELYENMVQKIDTTVDPNIKCST------ADAQTWLSTALTNLETCHA  1255
              +  EK A +DCL L++  V+++ TTV  ++  ST       D+QT+LS A+TNL TC  
Sbjct  153   LNKLEKRALDDCLNLFDETVEELKTTVK-DLSQSTIGSKRYHDSQTFLSGAMTNLYTCLD  211

Query  1254  GFVDLGVTGNILPAVTSN--NVSYLISNTLAINKGFtttnneattgyteG-------FPD  1102
             GF      GN+   +      +S+L+SN+LA+ K       ++              FP 
Sbjct  212   GFA--YSKGNVRDRIEEGVLEISHLVSNSLAMLKKVPEKKKQSKNEVFPEYGKMKDGFPS  269

Query  1101  WVRPGDRKLLQSSA-ASKADIVVAQDGSGNYKTVTEAVNAAAKRSGSGRYVIYVKAGVYK  925
             WV P DRKLLQ++   +K D+VVA+DGSGN+ T+  AV AAA  S + R+VI++KAG Y 
Sbjct  270   WVSPNDRKLLQAAVNETKFDLVVAKDGSGNFTTIGAAV-AAAPNSSATRFVIHIKAGAYF  328

Query  924   ENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTA  745
             ENVE+  K  N+M VGDGIGKT++  SR+V  G TTF+SATVAVVGDGFI +GITF N+A
Sbjct  329   ENVEVIRKKSNLMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFENSA  388

Query  744   GAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVF  565
             G + HQAVALRSG+DLS FYQCSF  YQDTLYV+S RQFYRECD+YGTVDFIFGNAA V 
Sbjct  389   GPSKHQAVALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVL  448

Query  564   QNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGVKT----YLGRPW  400
             QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL  VK+    YLGRPW
Sbjct  449   QNCNLYARKPNPNQKNLFTAQGREDPNQNTGISIINCKVAAAADLIPVKSEFKNYLGRPW  508

Query  399   KEYSRTVFMKSSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWGGYHVI  220
             K+YSRTV++ S ++ LIDPAGWL WDGNFAL+TLYYGEY+N G GA+T+ RV W GY VI
Sbjct  509   KKYSRTVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANTSRRVTWPGYRVI  568

Query  219   TSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
             T++TEAS+FTV NFI G  WL +  +PF SGL
Sbjct  569   TNSTEASQFTVANFIQGNEWLTSLGIPFFSGL  600



>ref|XP_009374495.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 33 
[Pyrus x bretschneideri]
Length=480

 Score =   475 bits (1222),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 263/473 (56%), Positives = 328/473 (69%), Gaps = 13/473 (3%)
 Frame = -3

Query  1512  KDKSDFLKVAKNLALQYAKNAKDNTYSLGTKCRSGGEKAAWEDCLELYENMVQKIDTTVD  1333
             K  S+F K+   +AL+ A +    T   G  C++  EKAAW DCL+L++N V +++ T++
Sbjct  11    KHISEFRKMLVEVALERALDVITYTSQYGQNCQNDNEKAAWADCLKLFDNTVNQLNVTLE  70

Query  1332  ---PNIKCSTADAQTWLSTALTNLETCHAGFVDLGVTGNILPAV-TSNNVSYLISNTLAI  1165
                   KCS  DAQTWLS ALTN+ TC  G ++L VT  I P   +SNNVS LISN+LAI
Sbjct  71    GLGNKRKCSNFDAQTWLSAALTNIHTCRVGSLELNVTDFITPIYRSSNNVSELISNSLAI  130

Query  1164  NKGFtttnneattgyteGFPDWVRPGDRKLLQSSAASKADIVVAQDGSGNYKTVTEAVNA  985
               G      E +   +E FP+WV   DR+LLQ+S   +A+++VA+DGSG++ TV  A++ 
Sbjct  131   --GSQLLGTEESYNESEKFPNWVSKHDRRLLQASNI-RANLLVAKDGSGHFSTVQAALDE  187

Query  984   AAKRSGSGRYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSA  805
             AA+R    +++IYVK GVY EN+++ +    IMLVG GI  TIIT SRSV  G TT+ SA
Sbjct  188   AARRRVKSKFIIYVKKGVYTENIQVSNINSKIMLVGAGIRYTIITSSRSVSEGYTTYNSA  247

Query  804   TVAVVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFY  625
             T  + G GF+ +GI+F NTAG    QAVALRS SDLSVFY+C+F+GYQDTL V+S RQFY
Sbjct  248   TAGINGQGFVARGISFINTAGPLKGQAVALRSASDLSVFYRCAFQGYQDTLMVHSQRQFY  307

Query  624   RECDIYGTVDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVT  448
             REC I+GT+DFIFGNAA VFQNC IY R P   + N ITAQGR+DP QNT ISIHN +V 
Sbjct  308   RECYIFGTIDFIFGNAAAVFQNCMIYVRKPLWGQVNVITAQGRNDPFQNTAISIHNSQVR  367

Query  447   AASDLKGV----KTYLGRPWKEYSRTVFMKSSLDSLIDPAGWLPWD-GNFALNTLYYGEY  283
             AA+DLK V    KTYLGRPW +YSR VFMK  LD+L++PAGWL W   NFAL+TLYYGEY
Sbjct  368   AAADLKPVASSYKTYLGRPWMQYSRVVFMKCYLDNLVNPAGWLRWQRSNFALSTLYYGEY  427

Query  282   SNTGAGASTANRVKWGGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  124
              N G G+ T  RV W G+H ITS   AS FT G+ IAG SWLP T VPFT GL
Sbjct  428   QNFGPGSCTRYRVTWPGFHAITSPNVASMFTAGSLIAGWSWLPTTGVPFTMGL  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5168388588226