BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g1_i3 len=982 path=[8445:0-298 2593:299-345 14670:346-447
2730:448-604 2887:605-628 49619:629-630 49621:631-644 48673:645-646
18704:647-675 43779:676-688 18746:689-726 48341:727-757
18815:758-981]

Length=982
                                                                      Score     E

ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        491   2e-168   Vitis vinifera
emb|CDP20872.1|  unnamed protein product                                489   1e-167   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   488   3e-167   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     485   9e-167   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   486   2e-166   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   486   2e-166   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   484   6e-166   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        482   2e-164   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   481   2e-164   
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        480   4e-164   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                     479   5e-164   Vitis vinifera
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   479   2e-163   
gb|AFW03479.1|  pectin methylesterase 5                                 477   5e-163   
gb|KHN35620.1|  Pectinesterase 2                                        471   5e-163   
gb|AFW03484.1|  pectin methylesterase 5                                 476   2e-162   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      476   2e-162   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     474   3e-162   Vitis vinifera
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   474   1e-161   Vitis vinifera
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    472   4e-161   Populus trichocarpa [western balsam poplar]
gb|AER38244.1|  PME5                                                    472   4e-161   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        473   5e-161   
emb|CBI24285.3|  unnamed protein product                                469   7e-161   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   471   1e-160   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        471   1e-160   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     470   3e-160   Vitis vinifera
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   470   3e-160   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        469   1e-159   Vitis vinifera
ref|XP_007052106.1|  Pectinesterase 2                                   468   2e-159   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        468   3e-159   
gb|KHN35617.1|  Pectinesterase 2                                        467   5e-159   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    467   6e-159   Populus trichocarpa [western balsam poplar]
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   463   9e-159   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   466   1e-158   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         466   2e-158   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   464   1e-157   
gb|KHN25547.1|  Pectinesterase 2                                        456   3e-157   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             458   1e-155   
gb|KHN35618.1|  Pectinesterase 2                                        452   2e-155   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 457   4e-155   
emb|CDP08022.1|  unnamed protein product                                457   5e-155   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               456   6e-155   Ricinus communis
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   456   1e-154   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             456   1e-154   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        455   1e-154   
emb|CBI38888.3|  unnamed protein product                                446   2e-154   
emb|CDO97717.1|  unnamed protein product                                445   4e-154   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   454   5e-154   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    454   6e-154   Citrus sinensis [apfelsine]
ref|NP_001275775.1|  pectinesterase 2 precursor                         454   6e-154   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   454   8e-154   
ref|XP_010098938.1|  Pectinesterase 2                                   453   1e-153   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   451   9e-153   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   451   1e-152   
emb|CBI24284.3|  unnamed protein product                                440   4e-152   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        448   1e-151   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   447   3e-151   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   436   7e-150   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   443   8e-150   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    442   2e-149   
gb|KHN35616.1|  Pectinesterase 2                                        436   3e-149   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    442   3e-149   
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        442   4e-149   
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 441   1e-148   
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   441   1e-148   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   446   3e-148   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             439   6e-148   
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        438   1e-147   
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   437   2e-147   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               432   3e-146   Ricinus communis
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    434   3e-146   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47891.1|  Pectinesterase 2                                        434   5e-146   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    434   5e-146   
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        433   2e-145   
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    432   3e-145   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             431   3e-145   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    432   4e-145   
emb|CDX74715.1|  BnaA05g04610D                                          428   7e-145   
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     431   9e-145   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   430   2e-144   
emb|CDP20891.1|  unnamed protein product                                430   2e-144   
emb|CDX83392.1|  BnaA03g21140D                                          427   2e-144   
gb|KHN47892.1|  Pectinesterase 2                                        429   2e-144   
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   429   2e-144   
emb|CDX95641.1|  BnaC03g25220D                                          427   3e-144   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    428   3e-144   
ref|XP_002882002.1|  predicted protein                                  429   4e-144   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    429   4e-144   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    429   4e-144   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    429   5e-144   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             428   6e-144   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    428   8e-144   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             429   9e-144   
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   429   1e-143   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    426   1e-143   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    427   2e-143   
ref|XP_002322401.1|  putative pectin methylesterase family protein      426   6e-143   Populus trichocarpa [western balsam poplar]
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   425   1e-142   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   425   2e-142   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   425   2e-142   
emb|CDO97716.1|  unnamed protein product                                424   2e-142   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             424   3e-142   
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         424   4e-142   
ref|XP_002318285.1|  putative pectin methylesterase family protein      423   7e-142   Populus trichocarpa [western balsam poplar]
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   423   1e-141   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    423   1e-141   
ref|XP_007038413.1|  Pectinesterase                                     423   1e-141   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     422   1e-141   
gb|KCW73024.1|  hypothetical protein EUGRSUZ_E01466                     421   4e-141   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   421   6e-141   
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg                420   7e-141   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    421   8e-141   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     421   1e-140   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   421   1e-140   
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   419   3e-140   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     419   3e-140   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       421   3e-140   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     419   4e-140   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   418   1e-139   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   416   1e-139   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   424   2e-139   
ref|XP_010058469.1|  PREDICTED: pectinesterase 2-like                   420   3e-139   
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   416   3e-139   
emb|CDY27388.1|  BnaC04g50170D                                          416   3e-139   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          416   4e-139   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               416   9e-139   Ricinus communis
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   415   1e-138   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     417   1e-138   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   415   2e-138   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   414   3e-138   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         415   4e-138   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     414   4e-138   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   413   9e-138   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   413   9e-138   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     412   1e-137   
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   412   1e-137   
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    412   2e-137   
ref|NP_001042866.1|  Os01g0312500                                       409   2e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     412   3e-137   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          412   4e-137   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   407   1e-136   
gb|KHN42767.1|  Pectinesterase 2                                        407   2e-136   
gb|EEC70505.1|  hypothetical protein OsI_01594                          409   7e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    408   9e-136   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          410   1e-135   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18942.1|  BnaC04g04080D                                          398   1e-135   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   406   4e-135   
gb|KHN16553.1|  Pectinesterase 2                                        402   5e-135   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   402   5e-135   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          406   3e-134   Sorghum bicolor [broomcorn]
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     404   5e-134   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     404   5e-134   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   399   9e-134   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             403   9e-134   Populus trichocarpa [western balsam poplar]
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    402   1e-133   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   402   2e-133   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   402   2e-133   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     403   2e-133   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     402   3e-133   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     402   3e-133   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     402   5e-133   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          401   5e-133   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                401   5e-133   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    401   6e-133   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                398   2e-132   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   399   2e-132   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             398   2e-132   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     397   5e-132   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    397   7e-132   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          398   1e-131   
emb|CBI24582.3|  unnamed protein product                                387   1e-131   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     396   5e-131   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          396   8e-131   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          396   1e-130   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                394   1e-130   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     395   2e-130   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     394   2e-130   Vitis vinifera
dbj|BAJ96804.1|  predicted protein                                      395   2e-130   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   383   2e-130   
emb|CDP00815.1|  unnamed protein product                                394   2e-130   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     394   3e-130   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          394   3e-130   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      392   9e-130   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    392   1e-129   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             395   1e-129   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             392   1e-129   
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     392   1e-129   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     391   2e-129   
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   391   3e-129   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     392   3e-129   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    392   3e-129   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    392   4e-129   
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          390   5e-129   
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          390   7e-129   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     390   8e-129   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     392   1e-128   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     391   1e-128   
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      389   1e-128   
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    389   2e-128   
gb|ABQ42392.1|  pectin methylesterase-like protein                      392   2e-128   Taiwania cryptomerioides
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          390   2e-128   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         386   2e-128   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     389   4e-128   
emb|CDP15270.1|  unnamed protein product                                390   4e-128   
ref|XP_010662407.1|  PREDICTED: probable pectinesterase/pectinest...    388   4e-128   
ref|NP_001146685.1|  pectinesterase precursor                           389   6e-128   Zea mays [maize]
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    389   1e-127   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     389   1e-127   
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    387   1e-127   
gb|AGG23325.1|  pectin methylesterase 1                                 388   2e-127   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    388   2e-127   
gb|ACQ85264.1|  pectin methylesterase                                   388   2e-127   Musa acuminata AAA Group [Cavendish banana]
gb|KEH21378.1|  pectinesterase                                          381   3e-127   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    387   3e-127   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     384   3e-127   
gb|KGN44975.1|  Pectinesterase                                          388   6e-127   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     386   8e-127   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     387   8e-127   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     384   1e-126   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     386   1e-126   
gb|EMT05022.1|  Pectinesterase 3                                        383   1e-126   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             384   1e-126   
ref|XP_002322399.1|  putative pectin methylesterase family protein      384   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     385   1e-126   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     385   2e-126   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     382   2e-126   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     385   2e-126   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   383   3e-126   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               385   3e-126   Ricinus communis
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     381   4e-126   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             385   4e-126   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          383   5e-126   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      382   1e-125   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             383   1e-125   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    383   2e-125   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     383   2e-125   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 382   2e-125   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    382   2e-125   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             382   3e-125   Populus trichocarpa [western balsam poplar]
ref|XP_010684347.1|  PREDICTED: pectinesterase                          382   8e-125   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    377   2e-124   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    379   2e-124   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 379   3e-124   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    378   4e-124   
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     378   1e-123   
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    378   1e-123   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     378   1e-123   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    377   2e-123   
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    377   2e-123   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     377   2e-123   
emb|CBI36882.3|  unnamed protein product                                377   4e-123   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     374   4e-123   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     376   6e-123   
ref|XP_002268492.2|  PREDICTED: probable pectinesterase/pectinest...    376   7e-123   Vitis vinifera
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    376   8e-123   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    377   1e-122   
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    374   2e-122   
ref|XP_007145536.1|  hypothetical protein PHAVU_007G246700g             375   2e-122   
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             375   2e-122   
gb|ABZ89800.1|  pectin methylesterase-like protein                      375   2e-122   Taiwania cryptomerioides
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          375   2e-122   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          374   3e-122   
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    374   4e-122   
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    374   4e-122   
gb|ACN40984.1|  unknown                                                 375   5e-122   Picea sitchensis
ref|XP_007199619.1|  hypothetical protein PRUPE_ppa024812mg             372   7e-122   
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    373   8e-122   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   367   2e-121   
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          371   2e-121   
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    364   2e-121   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009625476.1|  PREDICTED: pectinesterase-like                     372   3e-121   
ref|XP_010088299.1|  putative pectinesterase/pectinesterase inhib...    372   3e-121   
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    372   4e-121   
gb|KDP23441.1|  hypothetical protein JCGZ_23274                         372   4e-121   
gb|EPS62329.1|  pectinesterase                                          371   5e-121   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    372   7e-121   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          371   8e-121   
ref|XP_010088303.1|  putative pectinesterase/pectinesterase inhib...    371   9e-121   
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    370   1e-120   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    371   1e-120   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    370   1e-120   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             368   1e-120   
emb|CDP05321.1|  unnamed protein product                                367   2e-120   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               369   2e-120   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     369   2e-120   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           360   2e-120   
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     370   2e-120   
emb|CAA64217.1|  pectinmethylesterase                                   361   2e-120   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            369   3e-120   
ref|XP_008363719.1|  PREDICTED: probable pectinesterase/pectinest...    370   3e-120   
ref|XP_008235210.1|  PREDICTED: probable pectinesterase/pectinest...    369   3e-120   
ref|XP_003536881.1|  PREDICTED: probable pectinesterase/pectinest...    369   3e-120   
gb|AHB84678.1|  pectin methylesterase                                   369   4e-120   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     369   4e-120   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    360   4e-120   
emb|CDP17208.1|  unnamed protein product                                367   4e-120   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    369   4e-120   
emb|CAA96434.1|  pectin methylesterase                                  360   4e-120   
ref|NP_191930.1|  pectin methylesterase 38                              366   5e-120   
ref|XP_002872964.1|  predicted protein                                  366   5e-120   
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    369   5e-120   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     368   6e-120   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  360   6e-120   
emb|CAA96435.1|  pectin methylesterase                                  360   6e-120   
ref|XP_009799791.1|  PREDICTED: probable pectinesterase/pectinest...    368   7e-120   
ref|XP_003591498.1|  Pectinesterase                                     360   7e-120   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     368   8e-120   
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             368   9e-120   
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             368   9e-120   
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    368   1e-119   
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     368   1e-119   
gb|AGR44472.1|  pectin methylesterase 3                                 368   1e-119   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    368   1e-119   
ref|XP_011010962.1|  PREDICTED: probable pectinesterase/pectinest...    367   1e-119   
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             368   2e-119   
dbj|BAF42040.1|  pectin methylesterase 3                                367   2e-119   
ref|XP_004240801.1|  PREDICTED: probable pectinesterase/pectinest...    366   2e-119   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     365   3e-119   
ref|XP_010247589.1|  PREDICTED: probable pectinesterase/pectinest...    365   3e-119   
ref|XP_004299718.1|  PREDICTED: probable pectinesterase/pectinest...    367   3e-119   
ref|XP_002302726.1|  pectinesterase family protein                      367   3e-119   
ref|XP_003591482.1|  Pectinesterase                                     367   3e-119   
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    366   4e-119   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     366   4e-119   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 366   4e-119   
ref|XP_007031046.1|  Pectinesterase-2 precursor                         366   5e-119   
ref|XP_002320332.1|  pectinesterase family protein                      366   5e-119   
ref|XP_009609130.1|  PREDICTED: probable pectinesterase/pectinest...    365   5e-119   
ref|XP_006357927.1|  PREDICTED: probable pectinesterase/pectinest...    365   6e-119   
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               358   6e-119   
gb|KHN08673.1|  Putative pectinesterase/pectinesterase inhibitor 41     365   7e-119   
ref|XP_003518980.1|  PREDICTED: probable pectinesterase/pectinest...    365   8e-119   
ref|XP_006382446.1|  hypothetical protein POPTR_0005s02250g             362   8e-119   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     365   9e-119   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    365   9e-119   
ref|XP_011041973.1|  PREDICTED: probable pectinesterase/pectinest...    365   1e-118   
ref|XP_004513410.1|  PREDICTED: probable pectinesterase/pectinest...    365   1e-118   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     365   1e-118   
ref|XP_002527752.1|  Pectinesterase-2 precursor, putative               366   1e-118   
emb|CBI27741.3|  unnamed protein product                                358   1e-118   
ref|XP_009335753.1|  PREDICTED: probable pectinesterase/pectinest...    364   1e-118   
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     365   2e-118   
ref|XP_004494387.1|  PREDICTED: probable pectinesterase/pectinest...    365   2e-118   
emb|CDY68840.1|  BnaCnng60750D                                          360   2e-118   
ref|XP_009378757.1|  PREDICTED: probable pectinesterase/pectinest...    364   2e-118   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     365   2e-118   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    365   2e-118   
ref|XP_004967522.1|  PREDICTED: probable pectinesterase/pectinest...    364   2e-118   
ref|XP_006444394.1|  hypothetical protein CICLE_v10020108mg             361   2e-118   
ref|XP_003554529.1|  PREDICTED: probable pectinesterase/pectinest...    364   3e-118   
ref|XP_006289025.1|  hypothetical protein CARUB_v10002406mg             361   3e-118   
ref|NP_001275859.1|  pectinesterase 1 precursor                         365   4e-118   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    364   4e-118   
ref|XP_009782456.1|  PREDICTED: pectinesterase-like                     363   4e-118   
emb|CDX96216.1|  BnaC02g14350D                                          360   5e-118   
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     364   5e-118   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    363   5e-118   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    361   6e-118   
gb|EEC82670.1|  hypothetical protein OsI_27314                          364   6e-118   
ref|NP_001060620.1|  Os07g0675100                                       364   6e-118   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    361   7e-118   
ref|XP_006367817.1|  PREDICTED: probable pectinesterase/pectinest...    362   7e-118   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    363   8e-118   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    363   9e-118   
ref|XP_010088302.1|  putative pectinesterase/pectinesterase inhib...    363   9e-118   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 360   9e-118   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         362   1e-117   
gb|KHN43319.1|  Putative pectinesterase/pectinesterase inhibitor 7      355   1e-117   
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      361   1e-117   
gb|KDP28189.1|  hypothetical protein JCGZ_13960                         362   1e-117   
ref|XP_008369099.1|  PREDICTED: probable pectinesterase/pectinest...    362   1e-117   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    363   1e-117   
ref|XP_006444392.1|  hypothetical protein CICLE_v10023588mg             362   1e-117   
gb|KHN11656.1|  Putative pectinesterase/pectinesterase inhibitor 33     359   1e-117   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    363   1e-117   
ref|XP_007038414.1|  Plant invertase/pectin methylesterase inhibi...    361   2e-117   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    362   2e-117   
ref|XP_003521573.1|  PREDICTED: probable pectinesterase/pectinest...    362   2e-117   
ref|XP_010941122.1|  PREDICTED: pectinesterase                          360   3e-117   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          362   3e-117   
gb|KEH22545.1|  pectinesterase/pectinesterase inhibitor                 360   3e-117   
ref|XP_004234933.2|  PREDICTED: probable pectinesterase/pectinest...    361   3e-117   
ref|XP_003598230.1|  Pectinesterase                                     360   3e-117   
ref|XP_009611830.1|  PREDICTED: probable pectinesterase/pectinest...    360   3e-117   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    362   3e-117   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             361   4e-117   
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    361   4e-117   
ref|XP_003598225.1|  Pectinesterase                                     360   4e-117   
gb|ABK24761.1|  unknown                                                 361   4e-117   
ref|XP_003599460.1|  Pectinesterase                                     360   4e-117   
gb|AES69711.2|  pectinesterase/pectinesterase inhibitor                 360   5e-117   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     362   5e-117   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          363   5e-117   
ref|XP_010269594.1|  PREDICTED: probable pectinesterase/pectinest...    361   5e-117   
emb|CDY35644.1|  BnaC09g29660D                                          357   5e-117   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          361   5e-117   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     358   6e-117   
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         362   6e-117   
ref|XP_009799202.1|  PREDICTED: probable pectinesterase/pectinest...    361   6e-117   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    358   6e-117   
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             360   8e-117   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 358   9e-117   
ref|XP_004499656.1|  PREDICTED: probable pectinesterase/pectinest...    359   9e-117   
ref|XP_006479999.1|  PREDICTED: probable pectinesterase/pectinest...    360   1e-116   
ref|XP_003533518.1|  PREDICTED: probable pectinesterase/pectinest...    359   1e-116   
ref|XP_010917364.1|  PREDICTED: pectinesterase                          359   1e-116   
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          360   1e-116   
gb|KEH41800.1|  pectinesterase/pectinesterase inhibitor                 360   1e-116   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    357   1e-116   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    360   1e-116   
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    359   1e-116   
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    360   2e-116   
ref|XP_003598229.1|  Pectinesterase                                     358   2e-116   
emb|CDY14384.1|  BnaA10g06710D                                          356   2e-116   
ref|XP_006396440.1|  hypothetical protein EUTSA_v10028546mg             360   2e-116   
emb|CBI24581.3|  unnamed protein product                                349   2e-116   
ref|XP_006480114.1|  PREDICTED: probable pectinesterase/pectinest...    360   2e-116   
ref|XP_008466170.1|  PREDICTED: probable pectinesterase/pectinest...    359   2e-116   
ref|XP_009627971.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-116   
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    358   2e-116   
ref|XP_007148706.1|  hypothetical protein PHAVU_005G007800g             358   2e-116   
ref|XP_003540571.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-116   
gb|ABK94644.1|  unknown                                                 351   2e-116   
ref|XP_002890570.1|  predicted protein                                  359   2e-116   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         351   2e-116   
ref|NP_567227.1|  Probable pectinesterase/pectinesterase inhibito...    360   3e-116   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    360   3e-116   
ref|XP_008466169.1|  PREDICTED: probable pectinesterase/pectinest...    359   3e-116   
ref|XP_002523112.1|  Pectinesterase-2 precursor, putative               359   3e-116   
emb|CDY49170.1|  BnaA02g10290D                                          355   3e-116   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             360   3e-116   
ref|XP_008451544.1|  PREDICTED: probable pectinesterase/pectinest...    359   3e-116   
gb|KFK30820.1|  pectinesterase family protein                           359   4e-116   
ref|XP_009340595.1|  PREDICTED: probable pectinesterase/pectinest...    356   4e-116   
ref|XP_003591484.1|  Pectinesterase                                     350   4e-116   
emb|CDP21422.1|  unnamed protein product                                358   4e-116   
gb|ACN40878.1|  unknown                                                 362   4e-116   
ref|XP_007163133.1|  hypothetical protein PHAVU_001G209200g             358   4e-116   
emb|CDY21422.1|  BnaA09g30050D                                          358   4e-116   
gb|EAY73715.1|  hypothetical protein OsI_01593                          357   5e-116   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     353   5e-116   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   357   5e-116   
ref|XP_002317208.1|  pectin methylesterase family protein               358   5e-116   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   358   5e-116   
emb|CDY65637.1|  BnaAnng20820D                                          357   5e-116   
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             358   6e-116   
ref|XP_002874923.1|  pectinesterase family protein                      358   6e-116   
ref|XP_010456048.1|  PREDICTED: probable pectinesterase/pectinest...    359   7e-116   
ref|XP_010486017.1|  PREDICTED: pectinesterase-like                     358   7e-116   
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      357   7e-116   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          361   8e-116   
ref|XP_008812365.1|  PREDICTED: pectinesterase                          357   8e-116   
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    355   8e-116   
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    359   9e-116   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         358   9e-116   
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    358   9e-116   
ref|NP_001275846.1|  putative thermostable pectinesterase               360   1e-115   
ref|XP_004173650.1|  PREDICTED: probable pectinesterase/pectinest...    352   1e-115   
ref|NP_001042865.1|  Os01g0311800                                       357   1e-115   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             357   1e-115   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          357   1e-115   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             358   1e-115   
ref|XP_010422609.1|  PREDICTED: probable pectinesterase/pectinest...    358   1e-115   
ref|XP_006287360.1|  hypothetical protein CARUB_v10000558mg             358   1e-115   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     357   1e-115   
emb|CDX71786.1|  BnaC08g30880D                                          356   1e-115   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     356   1e-115   
ref|XP_006307093.1|  hypothetical protein CARUB_v10008680mg             358   2e-115   
ref|XP_010429512.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-115   
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    357   2e-115   
gb|EMS45437.1|  Pectinesterase                                          348   2e-115   
ref|NP_001274969.1|  pectin methyl esterase                             357   2e-115   
gb|AAL24278.1|  AT3g14310/MLN21_9                                       351   2e-115   
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    358   2e-115   
dbj|BAD95369.1|  pectin methylesterase like protein                     350   2e-115   
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               354   2e-115   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-115   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     356   3e-115   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   357   3e-115   
emb|CDY41145.1|  BnaA09g38700D                                          355   3e-115   
ref|XP_009417531.1|  PREDICTED: probable pectinesterase/pectinest...    359   3e-115   
ref|XP_010035022.1|  PREDICTED: probable pectinesterase/pectinest...    355   3e-115   
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             357   3e-115   
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    357   3e-115   
ref|XP_008234390.1|  PREDICTED: probable pectinesterase/pectinest...    355   3e-115   
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             356   3e-115   
ref|XP_004494388.1|  PREDICTED: probable pectinesterase/pectinest...    356   3e-115   
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    357   3e-115   
ref|XP_002512461.1|  Pectinesterase-2 precursor, putative               366   3e-115   
gb|AFB77929.1|  pectin methylesterase                                   357   4e-115   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            356   4e-115   
ref|XP_004511181.1|  PREDICTED: probable pectinesterase/pectinest...    357   5e-115   
emb|CAB95025.1|  pectin methylesterase                                  357   5e-115   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    357   5e-115   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    357   5e-115   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    357   6e-115   
gb|KEH24401.1|  pectinesterase/pectinesterase inhibitor, putative       356   6e-115   
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             357   6e-115   
ref|XP_010460102.1|  PREDICTED: probable pectinesterase/pectinest...    355   7e-115   
ref|XP_008376203.1|  PREDICTED: probable pectinesterase/pectinest...    355   7e-115   
ref|XP_006442946.1|  hypothetical protein CICLE_v10023535mg             356   7e-115   



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   491 bits (1263),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/283 (87%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y EN+EIG+KLKNIML+GDGIGKTIITGS+SVGGG+TTF SATVA VGDG
Sbjct  231  RYVIYVKAGTYNENIEIGAKLKNIMLLGDGIGKTIITGSKSVGGGSTTFNSATVAAVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FIG+G+T RNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  291  FIGRGLTIRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  351  VDFIFGNAAVVLQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVFMKT LDSLI+PAGW+ W GNFAL TLYYGEY NTG G+ST+
Sbjct  411  SSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTS  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV WAGYHVITS++EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  471  NRVNWAGYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  513



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   489 bits (1259),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/283 (88%), Positives = 262/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI+VKAG YKENVEIG+KLKNIMLVGDGIGKTIITGS SV GGTTTFKSATVAVVGDG
Sbjct  236  RYVIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIITGSNSVDGGTTTFKSATVAVVGDG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY ECD+YGT
Sbjct  296  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQNCN+Y+RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK   
Sbjct  356  VDYIFGNAAVVFQNCNLYSRNPPNKINTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQ  415

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQQYSRTVFMKT LD LIDPAGWLPW GNFAL+TLYYGEY+NTG G+STA
Sbjct  416  SSVKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGPGSSTA  475

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYH+ITSATEASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  476  NRVSWKGYHLITSATEASKFTVGNFIAGNSWLPATNVPFTSGL  518



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   488 bits (1256),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 242/283 (86%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y EN+E+GSKL NIM VGDGIGKTIITGS+SVGGG+TTFKSATVAVVGDG
Sbjct  233  RYIIYIKAGTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ Q ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  293  FVAQDITFRNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  353  VDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSIQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSL++ AGW+ WDGNFAL+TLYYGEY NTG G+STA
Sbjct  413  SSVKTYLGRPWKQYSRTVFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVITSATEA+KFTVG+F+ GGSWLPAT VP+TSGL
Sbjct  473  NRVKWVGYHVITSATEAAKFTVGSFLVGGSWLPATGVPYTSGL  515



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   485 bits (1249),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y ENVE+GSKL+NIM VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  198  RYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  257

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  258  FIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGT  317

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  318  VDFIFGNAAVVLQNCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  377

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFMKT LDSLI+ AGW+ WDGNFAL+TLYYGEY NTG G+STA
Sbjct  378  SSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTA  437

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV WAGYHVITSATEASKFTVG+FIAGGSWLPAT VP+TSGL
Sbjct  438  SRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  480



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   486 bits (1250),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y ENVE+GSKL+NIM VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  293  FIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  353  VDFIFGNAAVVLQNCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFMKT LDSLI+ AGW+ WDGNFAL+TLYYGEY NTG G+STA
Sbjct  413  SSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV WAGYHVITSATEASKFTVG+FIAGGSWLPAT VP+TSGL
Sbjct  473  SRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   486 bits (1250),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y ENVE+GSKL+NIM VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  293  FIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  353  VDFIFGNAAVVLQNCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFMKT LDSLI+ AGW+ WDGNFAL+TLYYGEY NTG G+STA
Sbjct  413  SSVKTYLGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV WAGYHVITSATEASKFTVG+FIAGGSWLPAT VP+TSGL
Sbjct  473  SRVTWAGYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   484 bits (1247),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y EN+E+GSKL NIM +GDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RYIIYIKAGTYNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  293  FIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  353  VDFIFGNAAVVFQNCNIYARNPPNKVNTLTAQGRTDPNQNTGISIHNCKVTAASDLKSIQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRT+FMKT LDSL++ AGW+ WDGNFAL+TLYYGEY NTG G+ST 
Sbjct  413  SSVKTYLGRPWKQYSRTIFMKTYLDSLVNSAGWMEWDGNFALDTLYYGEYVNTGPGSSTT  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKWAGYHVITSATEA+KFTVG+F+AGGSWLPAT VP+TSGL
Sbjct  473  NRVKWAGYHVITSATEAAKFTVGSFLAGGSWLPATGVPYTSGL  515



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   482 bits (1241),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 259/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG+Y ENV++GSKLKNIMLVGDGIGKTIITGS+SVGGG+TTFKSATVAVVGDG
Sbjct  267  RFVIYVKAGIYSENVDLGSKLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDG  326

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GIT RNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+SDRQFYRECDIYGT
Sbjct  327  FICRGITIRNTAGPTNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDIYGT  386

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR+PPNKTNT+TAQGRSDPNQNTGISIHNC+VTAASDLK S 
Sbjct  387  VDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRSDPNQNTGISIHNCRVTAASDLKASK  446

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTV MKT LDSLI P GW+PW G FAL TLYYGEY NTG G+STA
Sbjct  447  NSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGSSTA  506

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITSA EASKFT  NFIAG SWLPATNVPFTSGL
Sbjct  507  NRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  549



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   481 bits (1237),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKEN+E+GSKLKNIM VGDGIGKTIITGSRSVGGG+TTFKSATVAVVGDG
Sbjct  233  RYVIYVKAGTYKENIEVGSKLKNIMFVGDGIGKTIITGSRSVGGGSTTFKSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  293  FIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNC+VTAAS+LK   
Sbjct  353  VDFIFGNAAVVFQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVFMKT LDSLI+PAGW+ W+GNFAL TLYYGEY NTG G+ST 
Sbjct  413  SSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTK  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITSA+EASKFTVG+ IAG SWLPAT VPFTSGL
Sbjct  473  NRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  515



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   480 bits (1235),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TTFKSATVAVVGDG
Sbjct  230  RYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGT
Sbjct  290  FIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   
Sbjct  350  VDFIFGNAAVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQ  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+
Sbjct  410  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKWAGYHVITS+TEA+KFT GNFI+G SWLP+TNVPFTSGL
Sbjct  470  GRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL  512



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   479 bits (1234),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TTFKSATVAVVGDG
Sbjct  230  RYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGT
Sbjct  290  FIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   
Sbjct  350  VDFIFGNAAVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQ  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+
Sbjct  410  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKWAGYHVITS+TEA+KFT GNFI+G SWLP+TNVPFTSGL
Sbjct  470  GRVKWAGYHVITSSTEAAKFTAGNFISGNSWLPSTNVPFTSGL  512



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   479 bits (1232),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 241/283 (85%), Positives = 258/283 (91%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG+Y ENVE+GSKLKNIM VGDGIGKTIITGS+SVGGG+TTFKSATVAVVGDG
Sbjct  243  RFVIYVKAGIYSENVELGSKLKNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDG  302

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GIT RNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+SDRQFYRECD+YGT
Sbjct  303  FICRGITIRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSDRQFYRECDVYGT  362

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR+PPNKTNT+TAQGR+DPNQNTGISIHNC++TAASDLK S 
Sbjct  363  VDFIFGNAAVVLQNCNIFARDPPNKTNTVTAQGRTDPNQNTGISIHNCRITAASDLKASK  422

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTV MKT LDSLI P GW+PW G FAL TLYYGEY NTG G+STA
Sbjct  423  NSVKTYLGRPWKQYSRTVVMKTFLDSLIQPDGWMPWSGTFALKTLYYGEYLNTGPGSSTA  482

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITSA EASKFT  NFIAG SWLPATNVPFTSGL
Sbjct  483  NRVKWGGYRVITSAAEASKFTPANFIAGNSWLPATNVPFTSGL  525



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   477 bits (1228),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 261/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  237  RYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  297  FIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK   
Sbjct  357  VDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQ  416

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ WDG+FAL TLYY EY NTG G+ST+
Sbjct  417  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTS  476

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  477  NRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>gb|KHN35620.1| Pectinesterase 2 [Glycine soja]
Length=355

 Score =   471 bits (1212),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 245/283 (87%), Positives = 256/283 (90%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDG
Sbjct  79   RYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDG  136

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  137  FITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGT  196

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL G  
Sbjct  197  VDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG--  254

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              V+TYLGRPWQQYSRTVFMKT LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STA
Sbjct  255  --VRTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTA  312

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+EASKFTVGNFIAG SWLPAT+VPFTSGL
Sbjct  313  NRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  355



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  237  RYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  297  FIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK   
Sbjct  357  VDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQ  416

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PA W+ WDGNFAL TLYY EY NTG G+ST+
Sbjct  417  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPADWMEWDGNFALKTLYYAEYMNTGPGSSTS  476

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  477  NRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   476 bits (1224),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/283 (84%), Positives = 261/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  237  RYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  297  FIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQ+CNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK   
Sbjct  357  VDWIFGNAAVVFQDCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQ  416

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ WDG+FAL TLYY EY NTG G+ST+
Sbjct  417  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTS  476

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  477  NRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   474 bits (1221),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 261/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TTF SATVAVVGDG
Sbjct  215  RYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDG  274

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGT
Sbjct  275  FIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGT  334

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY RNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   
Sbjct  335  VDFIFGNAAVVFQNCNIYXRNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQ  394

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGW+ W G+FAL TLYYGEY NTG G+ST+
Sbjct  395  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTS  454

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV WAGYHVITS+TEA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  455  GRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  497



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   474 bits (1219),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 261/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TTF SATVAVVGDG
Sbjct  230  RYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTFNSATVAVVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLY YS+RQFYRECDIYGT
Sbjct  290  FIARGMTFRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRECDIYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY RNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   
Sbjct  350  VDFIFGNAAVVFQNCNIYVRNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQ  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGW+ W G+FAL TLYYGEY NTG G+ST+
Sbjct  410  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV WAGYHVITS+TEA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  470  GRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  512



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   472 bits (1215),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/283 (84%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENVE+G K+KN+M+VGDGIGKTI+TGS+SVGGGTTTFKSAT AVVGD 
Sbjct  232  RYVIYVKAGTYNENVEVGQKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDN  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYREC+IYGT
Sbjct  292  FIARDMTFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECNIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  352  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFMKT LDSLI+ AGW+PW GNFAL+TLYYGEY NTG G+STA
Sbjct  412  SSVKTYLGRPWQKYSRTVFMKTDLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+ AS+FTV +FI+G +WLPATNVPFT+GL
Sbjct  472  NRVNWKGYHVITSASVASQFTVASFISGNNWLPATNVPFTAGL  514



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   472 bits (1215),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 238/283 (84%), Positives = 259/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENVEIGSKLKNIM+VGDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  237  RYVIYVKAGTYKENVEIGSKLKNIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  297  FIARGITFRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGI IHN +VTAASDLK   
Sbjct  357  VDWIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQ  416

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ WD +FA  TLYY EY NTG G+ST+
Sbjct  417  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWDDDFAPKTLYYAEYMNTGPGSSTS  476

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+ SA+E SKFTVGNF+AG SWLP+T VPFTSGL
Sbjct  477  NRVKWGGYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   473 bits (1216),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 238/283 (84%), Positives = 261/283 (92%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK G Y+ENV I +K  NIML+GDGIGKTIITGSRSVGGG+TTFKSATVA VGDG
Sbjct  251  RFVIHVKQGTYRENVNIAAK--NIMLLGDGIGKTIITGSRSVGGGSTTFKSATVAAVGDG  308

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA NHQAVA RSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  309  FIARGITFRNTAGAQNHQAVAFRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGT  368

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY RNPPNKTNT+TAQGR+DPNQNTGISIHNC+VTAA DL+   
Sbjct  369  VDFIFGNAAVVFQNCNIYPRNPPNKTNTLTAQGRTDPNQNTGISIHNCRVTAAPDLRPVQ  428

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSVKTYLGRPWQ+YSRTVFMKT LDSLI+PAGW+PW GNFAL+TLYYGEY+NTG G+STA
Sbjct  429  GSVKTYLGRPWQKYSRTVFMKTFLDSLINPAGWMPWSGNFALDTLYYGEYANTGPGSSTA  488

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVITSA+EAS+FT G+FIA  SW+PATNVPFTSGL
Sbjct  489  NRVKWKGYHVITSASEASRFTPGSFIAANSWIPATNVPFTSGL  531



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   469 bits (1207),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNI L+GDGIGKTI+TGSRSVGGG+TT+ SATVAVVGDG
Sbjct  162  RYVIYVKAGTYSENVQIGSGLKNITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDG  221

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+T RNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  222  FIARGMTIRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGT  281

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQ CNIYARNPPNK NT+TAQGR+DPNQNTGISIH+C+VTAASDLK   
Sbjct  282  VDFIFGNAAVVFQKCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQ  341

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+
Sbjct  342  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTS  401

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W GYHVITS+TEA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  402  GRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  444



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   471 bits (1212),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 245/283 (87%), Positives = 256/283 (90%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDG
Sbjct  235  RYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  293  FITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL G  
Sbjct  353  VDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG--  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              V+TYLGRPWQQYSRTVFMKT LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STA
Sbjct  411  --VRTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTA  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+EASKFTVGNFIAG SWLPAT+VPFTSGL
Sbjct  469  NRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  511



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   471 bits (1212),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/283 (84%), Positives = 258/283 (91%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENVEI  K+KN+M+VGDGIGKTI+TGS+SVGGGTTTFKSAT AVVGD 
Sbjct  232  RYVIYVKAGTYNENVEIARKVKNVMVVGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDN  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  292  FIARDMTFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNKTNT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  352  VDFIFGNAAVVFQNCNIYARNPPNKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFMKT LDSLI+ AGW+PW GNFAL+TLYYGEY NTG G+STA
Sbjct  412  SSVKTYLGRPWQKYSRTVFMKTYLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+ AS+FTV NFI+G +WLPAT VPFT+GL
Sbjct  472  NRVNWKGYHVITSASVASQFTVANFISGNNWLPATKVPFTAGL  514



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   470 bits (1210),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNIML+GDGIGKTI+TGS+SVGGG+TT+ SATVAVVGDG
Sbjct  231  RYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVTGSKSVGGGSTTYNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA+NHQAVALRSGSDLSVFYQCSFEGYQDTLY YS+RQFYRECDIYGT
Sbjct  291  FIARGMTFRNTAGASNHQAVALRSGSDLSVFYQCSFEGYQDTLYTYSERQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   
Sbjct  351  VDFIFGNAAVVFQNCNIYARNPPNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQ  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK YLGRPW++YSRTVF+KT LDSLI+ AGW+ W G+FAL TLYYGEY NTG G+ST+
Sbjct  411  SSVKIYLGRPWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTS  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV WAGYHVITS+TEA+KFTVGNFI+G SWLP+T VPFTSGL
Sbjct  471  GRVDWAGYHVITSSTEAAKFTVGNFISGNSWLPSTKVPFTSGL  513



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   470 bits (1209),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/283 (87%), Positives = 256/283 (90%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDG
Sbjct  230  RYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDG  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  288  FITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL G  
Sbjct  348  VDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG--  405

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              V+TYLGRPWQQYSRTVFMKT LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STA
Sbjct  406  --VRTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTA  463

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+EASKFTVGNFIAG SWLPAT+VPFTSGL
Sbjct  464  NRVNWLGYHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  506



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   469 bits (1206),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENV+IGS LKNI L+GDGIGKTI+TGSRSVGGG+TT+ SATVAVVGDG
Sbjct  231  RYVIYVKAGTYSENVQIGSGLKNITLLGDGIGKTIVTGSRSVGGGSTTYNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+T RNTAGA+NHQAVALRSGSDLSV+YQCSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  291  FIARGMTIRNTAGASNHQAVALRSGSDLSVYYQCSFEGYQDTLYVYSDRQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQ CNIYARNPPNK NT+TAQGR+DPNQNTGISIH+C+VTAASDLK   
Sbjct  351  VDFIFGNAAVVFQKCNIYARNPPNKVNTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQ  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVF+KT LDSLI+ AGWL W G+FALNTLYYGEY NTG G+ST+
Sbjct  411  SSVKTYLGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTS  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W GYHVITS+TEA+KFTVGNFI+G SWLP+TNVPFTSGL
Sbjct  471  GRVNWTGYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  513



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   468 bits (1204),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 254/283 (90%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENVEI SKLKNIMLVGDGIGKTIITGS+SVG G+TTF SATVA VGDG
Sbjct  235  RYVIYVKAGTYKENVEIRSKLKNIMLVGDGIGKTIITGSKSVGQGSTTFNSATVAAVGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + IT RNTAG  NHQAV+LRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  295  FIARDITIRNTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD IFGNAAVV QNCNIYAR PPNKTNT+TAQ R+DPNQNTGI IHN +VTAASDLK   
Sbjct  355  VDVIFGNAAVVLQNCNIYARRPPNKTNTVTAQSRTDPNQNTGIIIHNSRVTAASDLKPVQ  414

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ WDGNFALNTLYY EY NTG G+ST+
Sbjct  415  SSVKTYLGRPWKQYSRTVFMKTFLDSLINPAGWMEWDGNFALNTLYYAEYMNTGTGSSTS  474

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TSA+EASKFTV NF+AG SWLPAT VPFTSGL
Sbjct  475  NRVKWRGYHVLTSASEASKFTVSNFLAGNSWLPATGVPFTSGL  517



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   468 bits (1203),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 258/283 (91%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENVE+G K+KN+M VGDGIGKTI+TGS+S GGGTTTF+SAT A VGD 
Sbjct  232  RYVIYVKAGTYNENVEVGKKVKNVMFVGDGIGKTIVTGSKSAGGGTTTFRSATFAAVGDN  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAGA NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  292  FIARDMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY R+PPNKTNTITAQGR+DPNQNTGISIHNC+VTAASDLK   
Sbjct  352  VDFIFGNAAVVFQNCNIYPRSPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASDLKPVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSVKTYLGRPW++YSRTVFMKT LDSLI+PAGWLPW+GNFAL+TLYYGEY NTG G+STA
Sbjct  412  GSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITS+T AS+FTVG+FI+G +WLPATNVPFT+GL
Sbjct  472  NRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>gb|KHN35617.1| Pectinesterase 2 [Glycine soja]
Length=511

 Score =   467 bits (1201),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 255/283 (90%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VEI  K  NIMLVGDGIGKTIIT S+SVGGGTTTF+SATVAVVGDG
Sbjct  235  RYVIYVKGGIYDEQVEI--KANNIMLVGDGIGKTIITSSKSVGGGTTTFRSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYRECDIYGT
Sbjct  293  FITQDITFRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYARNPPNK NTITAQGR+DPNQNTGISIHN KVTAASDL G  
Sbjct  353  VDFIFGNAAVVFQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG--  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              V+TYLGRPWQQYSRTVFMKT LDSLI+P GWL W GNFAL+TLYYGEY NTG G+STA
Sbjct  411  --VRTYLGRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTA  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+EASKFTVGNFIAG SWL AT+VPFTSGL
Sbjct  469  NRVNWLGYHVITSASEASKFTVGNFIAGNSWLLATSVPFTSGL  511



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   467 bits (1201),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 257/283 (91%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG Y ENVE+G K+KN+M VGDGIGKTI+TGS+S GGGTTTFKSAT AVVGD 
Sbjct  232  RYVIYVKAGTYNENVEVGKKVKNVMFVGDGIGKTIVTGSKSAGGGTTTFKSATFAVVGDN  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAGA NHQAVALRSGSD SVFY+CSFEGYQDTLYVYS RQFYRECDIYGT
Sbjct  292  FIARDMTFRNTAGAKNHQAVALRSGSDFSVFYKCSFEGYQDTLYVYSQRQFYRECDIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIYAR+PPNK  TITAQGR+DPNQNTGISIHNC+VTAASDLK   
Sbjct  352  VDFIFGNAAVVFQNCNIYARSPPNKIITITAQGRTDPNQNTGISIHNCRVTAASDLKPVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW PW+GNFAL+TLYYGEY NTG G+STA
Sbjct  412  GSVKTYLGRPWKQYSRTVFMKTFLDSLINPAGWSPWNGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITS+T AS+FTVG+FI+G +WLPATNVPFT+GL
Sbjct  472  NRVNWKGYRVITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   463 bits (1192),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 232/283 (82%), Positives = 255/283 (90%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y E V +G+ L NIML+GDGIGKTIIT S+SV GG+TTF SA VAVVGDG
Sbjct  156  RYIIYIKAGTYNEIVRVGTNLVNIMLMGDGIGKTIITESKSVDGGSTTFNSARVAVVGDG  215

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRNTAGAANHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  216  FIARDITFRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  275

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY RNPPNKTNTITAQGR+DPNQNTGISIHNC+VTAAS+LK   
Sbjct  276  VDFIFGNAAVVFQNCNIYPRNPPNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQ  335

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVFMKT LDSLI+PAGW+ W+GNFAL TLYYGEY NTG G+ST 
Sbjct  336  SSVKTYLGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTK  395

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITSA+EASKFTVG+ IAG SWLPAT VPFTSGL
Sbjct  396  NRVKWGGYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  438



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score =   466 bits (1199),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/283 (84%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IY+KAG Y ENV +G+ L NIM VGDGIGKTIITGS+SVGGG+TTF SATVA+VGDG
Sbjct  226  RYIIYIKAGTYNENVGVGTNLVNIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAIVGDG  285

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVALRSGSDLS+FYQC FEGYQDTLYVYS RQFY+ECDIYGT
Sbjct  286  FIAQDITFRNTAGAANHQAVALRSGSDLSIFYQCGFEGYQDTLYVYSARQFYKECDIYGT  345

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYARNPPNK NTITAQGR+DPNQNTGISIHNCKVTAASDL    
Sbjct  346  VDFIFGNAAVVLQNCNIYARNPPNKVNTITAQGRTDPNQNTGISIHNCKVTAASDLTSVQ  405

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVF+KT LDSLID AGWL W+G+FAL TL YGEY NTG G+ST 
Sbjct  406  SSVKTYLGRPWQKYSRTVFLKTYLDSLIDSAGWLEWNGSFALTTLNYGEYMNTGPGSSTT  465

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVITSATEASKFTVGNFIAGGSWLPAT VP+ S L
Sbjct  466  NRVKWIGYHVITSATEASKFTVGNFIAGGSWLPATGVPYISSL  508



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   466 bits (1198),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 254/283 (90%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RY+IYVK+G YKENV+IG  LKNIM VGDGIGKTI+TGS+SVGGG TTF SAT AVVGDG
Sbjct  232  RYIIYVKSGTYKENVQIGKSLKNIMFVGDGIGKTIVTGSKSVGGGATTFNSATFAVVGDG  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAG  NHQAVALRSG+DLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  292  FIARDMTFRNTAGPQNHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIY RNPPNKTNT+TAQGR+DPNQNTGISIHN +VTAASDL    
Sbjct  352  VDFIFGNAAVVLQNCNIYPRNPPNKTNTLTAQGRTDPNQNTGISIHNSRVTAASDLTPVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSV+TYLGRPW+QYSRTVFMKT LDSLI+PAGW+ W GNFAL+TLYYGEY NTG G+STA
Sbjct  412  GSVRTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITS TEAS+FTVGNFI+G SWLP TNVPFTSGL
Sbjct  472  NRVNWKGYHVITSPTEASQFTVGNFISGNSWLPGTNVPFTSGL  514



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   464 bits (1193),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/283 (85%), Positives = 256/283 (90%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI+VK GVY E VEI  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  235  RYVIHVKTGVYNEQVEI--KANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+SDRQFY+EC+IYGT
Sbjct  293  FIAQDITFRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSDRQFYKECNIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA VFQNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK   
Sbjct  353  VDFIFGNAAAVFQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKTSLDSLI PAGWL W GNFAL+TLYYGEY NTG G+ST 
Sbjct  413  NSVKTYLGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALSTLYYGEYMNTGLGSSTR  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVIT A+EASKFTVGNFIAG SWLP+T+VPFTS L
Sbjct  473  NRVKWQGYHVITRASEASKFTVGNFIAGNSWLPSTSVPFTSTL  515



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   456 bits (1174),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 255/283 (90%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY E VE+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  79   RYVIYVKGGVYDEQVEV--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  136

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  137  FIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  196

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+   
Sbjct  197  VDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQ  256

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPW+QYSRTVFMKT LD LI+PAGW+ W GNFAL+TLYYGEY NTG G+STA
Sbjct  257  NSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTA  316

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW+GY VITSA+EASKF+V NFIAG +WLP+T VPFT  L
Sbjct  317  RRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  359



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   458 bits (1179),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/283 (85%), Positives = 255/283 (90%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENV+I  K KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RYVIYVKAGTYKENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITF+NTAG  + QAVALRSGSDLSVFY+C FEG QDTLYVYSDRQFYRECDIYGT
Sbjct  291  FIAQDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVYSDRQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCNIY  N  +KTNTITAQGRSDPNQNTGISIHNC+VTAASDLK   
Sbjct  351  VDFIFGNAAVVFQNCNIYVHN--HKTNTITAQGRSDPNQNTGISIHNCRVTAASDLKSVQ  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVFMKT LDSLIDPAGW+ W GNFAL TLYYGEY NTG G+ST+
Sbjct  409  SSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKWAGYHVITSA+EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  469  NRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/283 (81%), Positives = 252/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VE+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  79   RYVIYVKGGIYNEQVEV--KSKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  136

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  137  FIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  196

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+   
Sbjct  197  VDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQ  256

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPW+QYSRTVFMKT LD LI+P+GW+ W GNFALNTLYYGEY NTG G+ST 
Sbjct  257  NSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYGEYMNTGPGSSTG  316

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW GY VIT A+EASKF+V NFIAG +WLPAT VP+T  L
Sbjct  317  RRVKWPGYRVITRASEASKFSVANFIAGNAWLPATKVPYTPSL  359



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   457 bits (1176),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 254/283 (90%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI+VKAGVY E VEI  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  233  RYVIHVKAGVYNEQVEI--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAG  NHQAVALRSGSDLSVFY+CSFEG+QDTLYV+SDRQFY++C+IYGT
Sbjct  291  FIAQDITFRNTAGGKNHQAVALRSGSDLSVFYRCSFEGFQDTLYVHSDRQFYKQCNIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA VFQNCNI+ RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK   
Sbjct  351  VDFIFGNAAAVFQNCNIFPRNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQ  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSR VFMKTSLDSLI P+GWL W GNFAL+TLYYGEY NTG G+ST 
Sbjct  411  NSVKTYLGRPWKQYSRAVFMKTSLDSLIHPSGWLEWSGNFALSTLYYGEYMNTGLGSSTR  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW G+HVITSA+EASKFTV NFIAG +WLPAT VPFTS L
Sbjct  471  NRVKWQGFHVITSASEASKFTVSNFIAGNAWLPATKVPFTSTL  513



>emb|CDP08022.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   457 bits (1177),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 233/270 (86%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI+VKAG YKENVEIG+KLKNIMLVGDGIGKTII GS SVGGGTTTFKSATVAVVGDG
Sbjct  236  RYVIHVKAGTYKENVEIGTKLKNIMLVGDGIGKTIIMGSNSVGGGTTTFKSATVAVVGDG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY ECD+YGT
Sbjct  296  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VD+IFGNAAVVFQNCN+Y+RNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDLK   
Sbjct  356  VDYIFGNAAVVFQNCNLYSRNPPNKINTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQ  415

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQQYSRTVFMKT LD LIDPAGWLPW GNFAL+TLYYGEY+NTG G+STA
Sbjct  416  SSVKTYLGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGPGSSTA  475

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGS  173
            NRV W GYH+ITSATEASKFTVGNFI  G+
Sbjct  476  NRVSWKGYHLITSATEASKFTVGNFIPVGA  505



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   456 bits (1174),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 227/283 (80%), Positives = 254/283 (90%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IYVKAGVY ENVEIG+KLKN+M VGDGIGKTI+TGS+SVGGG TTF+SAT AVVG+G
Sbjct  232  RFIIYVKAGVYNENVEIGTKLKNLMFVGDGIGKTIVTGSKSVGGGATTFRSATFAVVGEG  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TFRNTAG  NHQAVALRSG+DLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  292  FIARDMTFRNTAGPENHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPN+TNT+TAQGR+DPNQNTGISIHN +VTAASDL    
Sbjct  352  VDFIFGNAAVVLQNCNIFARNPPNRTNTLTAQGRTDPNQNTGISIHNSRVTAASDLSPVQ  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPW++YSRTVFMKT LDSLI+PAGW+ W GNFAL+TLYYGEY NTG G+STA
Sbjct  412  SSVRTYLGRPWKEYSRTVFMKTFLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTA  471

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITSA EAS+FTV NFI+G SWLP TNVPFT GL
Sbjct  472  NRVTWKGYRVITSAAEASQFTVQNFISGNSWLPGTNVPFTPGL  514



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   456 bits (1173),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 255/283 (90%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY E VE+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  235  RYVIYVKGGVYDEQVEV--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  293  FIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+   
Sbjct  353  VDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPW+QYSRTVFMKT LD LI+PAGW+ W GNFAL+TLYYGEY NTG G+STA
Sbjct  413  NSVRTYLGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW+GY VITSA+EASKF+V NFIAG +WLP+T VPFT  L
Sbjct  473  RRVKWSGYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  515



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   456 bits (1172),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 229/283 (81%), Positives = 253/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD 
Sbjct  230  RYVIYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  288  FIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQNTGI IHNC+VTAASDLK   
Sbjct  348  VDFIFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQ  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKT+LGRPW+QYSRTV++KT LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STA
Sbjct  408  SSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTA  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  468  NRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   455 bits (1171),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/283 (84%), Positives = 254/283 (90%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENV+I  K KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RYVIYVKAGTYKENVQI--KSKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITF+NTAG  + QAVALRSGSDLSVFY+C FEG QDTLYV+SDRQFYRECDIYGT
Sbjct  291  FIAQDITFQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVHSDRQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIY  N  +KTNT+TAQGRSDPNQNTGISIHNCKVTAASDLK   
Sbjct  351  VDFIFGNAAVVLQNCNIYVHN--HKTNTVTAQGRSDPNQNTGISIHNCKVTAASDLKSVQ  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTVFMKT LDSLIDPAGW+ W GNFAL TLYYGEY NTG G+ST+
Sbjct  409  SSVKTYLGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKWAGYHVITSA+EASKFTVGNFIAG SWLPATNVPFTSGL
Sbjct  469  NRVKWAGYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   446 bits (1146),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/259 (87%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -1

Query  910  MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  731
            ML+GDGIGKTIITGS+SVGGG+TTF SATVA VGDGFIG+G+T RNTAGAANHQAVALRS
Sbjct  1    MLLGDGIGKTIITGSKSVGGGSTTFNSATVAAVGDGFIGRGLTIRNTAGAANHQAVALRS  60

Query  730  GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  551
            GSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNAAVV QNCNIY RNPPN
Sbjct  61   GSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRNPPN  120

Query  550  KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSLGSVKTYLGRPWQQYSRTVFMKTSL  371
            KTNTITAQGR+DPNQNTGISIHNCKVTAASDLK    SVKTYLGRPW++YSRTVFMKT L
Sbjct  121  KTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYL  180

Query  370  DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWAGYHVITSATEASKFTVGN  191
            DSLI+PAGW+ W GNFAL TLYYGEY NTG G+ST+NRV WAGYHVITS++EASKFTVGN
Sbjct  181  DSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGN  240

Query  190  FIAGGSWLPATNVPFTSGL  134
            FIAG SWLPATNVPFTSGL
Sbjct  241  FIAGNSWLPATNVPFTSGL  259



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   445 bits (1144),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -1

Query  910  MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  731
            MLVGDGIGKTIITGS+SV GG+TTFKSATVAVVGDGFI +GI+FRNTAGA NHQAVALRS
Sbjct  1    MLVGDGIGKTIITGSKSVDGGSTTFKSATVAVVGDGFIARGISFRNTAGAQNHQAVALRS  60

Query  730  GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  551
            GSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGTVDFIFGNAAVVFQ+CNIYARNPPN
Sbjct  61   GSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQSCNIYARNPPN  120

Query  550  KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSLGSVKTYLGRPWQQYSRTVFMKTSL  371
            KTNTITAQGR+DPNQNTGISI N +VTAASDLK    SVKTYLGRPW++YSRTVFMKT L
Sbjct  121  KTNTITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFL  180

Query  370  DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWAGYHVITSATEASKFTVGN  191
            D LI+PAGW+PW GNFALNTLYYGEY+NTG G+STA RV W GYHVITSATEASKFTVGN
Sbjct  181  DGLINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGN  240

Query  190  FIAGGSWLPATNVPFTSGL  134
            FIAG SWLPATNVPFTSGL
Sbjct  241  FIAGSSWLPATNVPFTSGL  259



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   454 bits (1168),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 228/283 (81%), Positives = 253/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD 
Sbjct  230  RYVIYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  288  FIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQ+TGI IHNC+VTAASDLK   
Sbjct  348  VDFIFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQ  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKT+LGRPW+QYSRTV++KT LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STA
Sbjct  408  SSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTA  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  468  NRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   454 bits (1168),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 228/283 (81%), Positives = 253/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD 
Sbjct  230  RYVIYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  288  FIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQ+TGI IHNC+VTAASDLK   
Sbjct  348  VDFIFGNAAVVLQNCNIFARKPPNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQ  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKT+LGRPW+QYSRTV++KT LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STA
Sbjct  408  SSVKTFLGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTA  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  468  NRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   454 bits (1167),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 229/283 (81%), Positives = 252/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y EN+E+  KLKNIM VGDGIGKTIITGS+SVGGG TTFKSATVAVVGD 
Sbjct  230  RYVIYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + IT RNTAG  NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S RQFYRECDIYGT
Sbjct  288  FIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR PPN+TNT+TAQGR+DPNQNTGI IHNC+VTAASDLK   
Sbjct  348  VDFIFGNAAVVLQNCNIFARXPPNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQ  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKT+LGRPW+QYSRTV +KT LDSLI+PAGW+ W G+FALNTLYY EY NTG G+STA
Sbjct  408  SSVKTFLGRPWKQYSRTVXIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTA  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TS ++ S+FTVGNFIAG SWLPATNVPFTSGL
Sbjct  468  NRVKWRGYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   454 bits (1167),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 229/283 (81%), Positives = 255/283 (90%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG YKEN++IG+KL NIML+GDGIGKT+ITGS+SVGGG+TTF SATVAV+GDG
Sbjct  234  RFVIYVKAGTYKENLQIGNKLNNIMLIGDGIGKTVITGSKSVGGGSTTFNSATVAVLGDG  293

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRN+AG AN QAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  294  FIARDITFRNSAGPANGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSNRQFYRECDIYGT  353

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQNCN++AR P N   T+TAQGRSDPNQNTGI IHN ++TAASDLK   
Sbjct  354  VDFIFGNAAVVFQNCNMFARKPKNSIVTVTAQGRSDPNQNTGIVIHNSRITAASDLKPVQ  413

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTV +KT LDSLI PAGWLPW G+FAL+TLYYGEY NTG G+STA
Sbjct  414  SSVKTYLGRPWRQYSRTVVLKTFLDSLIQPAGWLPWSGSFALSTLYYGEYQNTGPGSSTA  473

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVITS TEASKFTVG+FI GG+WLPATNVPFTSGL
Sbjct  474  NRVKWGGYHVITSVTEASKFTVGSFIVGGAWLPATNVPFTSGL  516



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 258/283 (91%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG Y ENVEI  K+KN+ML+GDGIGKTIITGS+SVGGG+TTF+SATVAVVGDG
Sbjct  242  RFVIYVKAGTYNENVEI--KVKNVMLLGDGIGKTIITGSKSVGGGSTTFQSATVAVVGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGA+NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  300  FIAQDITFRNTAGASNHQAVALRSGSDQSVFYKCSFEGYQDTLYVHSERQFYRECDIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYAR+PPNKTNTITAQGR+D NQNTGISIHNC+VTAAS L    
Sbjct  360  VDFIFGNAAVVLQNCNIYARDPPNKTNTITAQGRTDSNQNTGISIHNCRVTAASSLS---  416

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW++YSRTV MKT+L SLI+PAGWL W GNFAL TLYY EY+NTG G+ST+
Sbjct  417  SSVKTYLGRPWKEYSRTVVMKTNLGSLINPAGWLEWSGNFALKTLYYAEYANTGPGSSTS  476

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVI  A+EASKFTVGNFIAGGSWLPATNVP+TSGL
Sbjct  477  NRVKWTGYHVI-GASEASKFTVGNFIAGGSWLPATNVPYTSGL  518



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   451 bits (1159),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 239/283 (84%), Positives = 254/283 (90%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENV+I  KL NIML+GDGIGKTIITGS+SVGGGTTTF SATVAVVGDG
Sbjct  232  RYVIYVKAGSYKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITF NTAG  + QAVALRSGSDLSVFY+CSFEG QDTLYV+S+RQFYRECDIYGT
Sbjct  290  FIAQGITFENTAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QN NIY  N  +KTNTITAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  350  VDFIFGNAAVVIQNSNIYVHN--HKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKPVQ  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ W G+FAL TLYYGEY NTG GAST 
Sbjct  408  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTK  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV WAGYHVITSA+EASKF+VGNFIAGGSWLPATNVPFTSGL
Sbjct  468  NRVSWAGYHVITSASEASKFSVGNFIAGGSWLPATNVPFTSGL  510



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   451 bits (1160),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/283 (82%), Positives = 247/283 (87%), Gaps = 0/283 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYV  G+Y ENVEIG  LKNIMLVGDGIGKTIITGS+SVGGG+TTFKSATVAV GDG
Sbjct  240  RFVIYVNVGIYNENVEIGINLKNIMLVGDGIGKTIITGSKSVGGGSTTFKSATVAVDGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAG  N QAVALRSGSDLSVFYQCSFEGYQDTL  +S RQFYR+CDIYGT
Sbjct  300  FIAQGITFRNTAGPKNGQAVALRSGSDLSVFYQCSFEGYQDTLCAHSQRQFYRDCDIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPP++ NT+TAQGRSDPNQNTGISIHNC+VT +SDLK   
Sbjct  360  VDFIFGNAAVVLQNCNIFARNPPSRINTVTAQGRSDPNQNTGISIHNCRVTPSSDLKPYQ  419

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQQYSRTV MKT LDSLIDPAGW+PW G FAL TLYYGEY N+G+G+STA
Sbjct  420  NSVKTYLGRPWQQYSRTVIMKTFLDSLIDPAGWMPWTGTFALKTLYYGEYLNSGSGSSTA  479

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VI SA EASKFT  NFIAG SWLPATNVPF S L
Sbjct  480  NRVNWPGYRVIYSAAEASKFTPANFIAGNSWLPATNVPFKSNL  522



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   440 bits (1131),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 222/259 (86%), Positives = 244/259 (94%), Gaps = 0/259 (0%)
 Frame = -1

Query  910  MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  731
            MLVGDGIGKTI+TGS+SVGGG+TTFKSATVAVVGDGFI +G+TFRNTAGA+NHQ+VALRS
Sbjct  1    MLVGDGIGKTIVTGSKSVGGGSTTFKSATVAVVGDGFIARGMTFRNTAGASNHQSVALRS  60

Query  730  GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  551
            GSDLSV+YQCSFEGYQDTLY YS+RQFYR CDIYGTVDFIFGNAAVVFQNCNIYARNPPN
Sbjct  61   GSDLSVYYQCSFEGYQDTLYTYSERQFYRGCDIYGTVDFIFGNAAVVFQNCNIYARNPPN  120

Query  550  KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSLGSVKTYLGRPWQQYSRTVFMKTSL  371
            K NT+TAQGR+DPNQNTGISIH+CKVTAASDLK   GSVKTYLGRPW++YSRTVF+KT L
Sbjct  121  KINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQGSVKTYLGRPWKEYSRTVFLKTYL  180

Query  370  DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWAGYHVITSATEASKFTVGN  191
            DSLI+ AGWL W GNFALNTLYYGEY NTG G+ST+ RVKWAGYHVITS+TEA+KFTVGN
Sbjct  181  DSLINSAGWLEWSGNFALNTLYYGEYMNTGDGSSTSGRVKWAGYHVITSSTEAAKFTVGN  240

Query  190  FIAGGSWLPATNVPFTSGL  134
            FI+G SWLP+TNVPFTSGL
Sbjct  241  FISGNSWLPSTNVPFTSGL  259



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   448 bits (1153),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/283 (84%), Positives = 254/283 (90%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENV+I  KL NIML+GDGIGKTIITGS+SVGGGTTTF SATVAVVGDG
Sbjct  233  RYVIYVKAGSYKENVQI--KLNNIMLLGDGIGKTIITGSKSVGGGTTTFNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITF NTAG  + QAVALRSGSDLSVFY+CSFEG QDTLYV+S+RQFYRECDIYGT
Sbjct  291  FIAQGITFENTAGLTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QN NIY  N  +KTNT+TAQGR+DPNQNTGISIHNCKVTAASDLK   
Sbjct  351  VDFIFGNAAVVIQNSNIYVHN--HKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKPVQ  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPW+QYSRTVFMKT LDSLI+PAGW+ W G+FAL TLYYGEY NTG GAST 
Sbjct  409  SSVKTYLGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTK  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV WAGYHVITSA+EAS+F+VGNFIAGGSWLPATNVPFTSGL
Sbjct  469  NRVSWAGYHVITSASEASEFSVGNFIAGGSWLPATNVPFTSGL  511



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   447 bits (1150),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/283 (81%), Positives = 251/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK G+Y E VE+ SK  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVAVVGDG
Sbjct  237  RYVIYVKGGIYNEQVEVKSK--NIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAVVGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAGA NHQAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  295  FIAQGITFRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPNK NTITAQGR+DPNQNTGISIHN +VTAASDL+   
Sbjct  355  VDFIFGNAAVVLQNCNIFARNPPNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQ  414

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPW+QYSRTVFMKT LD LI+P+GW+ W GNFALNTLYY EY NTG G+ST 
Sbjct  415  NSVRTYLGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYREYMNTGPGSSTG  474

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW GY V+T A+EASKF+V NFIAG +WLPAT VP+T  L
Sbjct  475  RRVKWPGYRVMTRASEASKFSVANFIAGNAWLPATKVPYTPSL  517



>ref|XP_006576427.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=299

 Score =   436 bits (1120),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDG
Sbjct  21   RYVIYVKGGVYNEQVEV--KANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  78

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFYRECDIYGT
Sbjct  79   FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYRECDIYGT  138

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  139  VDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  197

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  198  -SVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  256

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA+EAS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  257  NRVTWKGYHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  299



>ref|XP_004514850.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=511

 Score =   443 bits (1140),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 229/283 (81%), Positives = 254/283 (90%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK+GVY E V+I  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATV+ VGDG
Sbjct  233  RYVIYVKSGVYNEQVDI--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVSAVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  291  FMAQDITFRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPP KT T+TAQGR+DPNQNTGI IHN KV+ ASDL  S 
Sbjct  351  VDFIFGNAAVVLQNCNIFARNPPQKTITVTAQGRTDPNQNTGIIIHNSKVSPASDLNPS-  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFM T LDS I+PAGWL WDGNFAL+TLYY EY+NTG+G+ST+
Sbjct  410  -SVKSYLGRPWQKYSRTVFMDTVLDSFINPAGWLEWDGNFALDTLYYAEYANTGSGSSTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHV+TSA++AS FTVGNFIAG SWLP T VPFTSGL
Sbjct  469  NRVKWKGYHVLTSASQASPFTVGNFIAGNSWLPKTGVPFTSGL  511



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   442 bits (1137),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 253/283 (89%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAG YKENV I SK  NIML+GDGIGKTIITGS+SVGGG+TTF SATVAV GDG
Sbjct  232  RYVIYVKAGTYKENVVITSK--NIMLMGDGIGKTIITGSKSVGGGSTTFNSATVAVTGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG +N+QAVALRSGSDLSVFY+CSFEGYQDTLYVYSDRQFYREC+IYGT
Sbjct  290  FIARDITFQNTAGVSNNQAVALRSGSDLSVFYKCSFEGYQDTLYVYSDRQFYRECNIYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIY  N  +KTNT+TAQGRSDPNQNTGISIHNCKVTAASDL   L
Sbjct  350  VDFIFGNAAVVLQNCNIYVHN--HKTNTVTAQGRSDPNQNTGISIHNCKVTAASDL--VL  405

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             S KTYLGRPW++YSRT+FMKT LDSLI+ AGWL WDG FAL TLYYGEY NTG G+ST+
Sbjct  406  SSTKTYLGRPWREYSRTIFMKTYLDSLINSAGWLEWDGTFALETLYYGEYMNTGPGSSTS  465

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW GYHVITS++EASKFTVGNFIAG SWLPATNVPFT+GL
Sbjct  466  GRVKWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  508



>gb|KHN35616.1| Pectinesterase 2 [Glycine soja]
Length=358

 Score =   436 bits (1122),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDG
Sbjct  80   RYVIYVKGGVYNEQVEV--KANNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  137

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFYRECDIYGT
Sbjct  138  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYRECDIYGT  197

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  198  VDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  256

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  257  -SVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  315

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA+EAS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  316  NRVTWKGYHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  358



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   442 bits (1136),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 227/283 (80%), Positives = 252/283 (89%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  K KNIML GDGIGKTIITGS+SVGGG TTF SATVAVVGDG
Sbjct  233  RFVIYVKQGVYNENIEI--KAKNIMLRGDGIGKTIITGSKSVGGGATTFNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG +N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  291  FIARGITFRNTAGPSNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA VFQNCNI+AR P NKTNT+TAQGRSDPNQNTGI IHN +VTA SDL+  L
Sbjct  351  VDFIFGNAAAVFQNCNIFARRPRNKTNTVTAQGRSDPNQNTGIVIHNSRVTAGSDLQPVL  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSVKTYLGRPW+QYSRTVFMKT LD LIDP GWL W+GNFAL+TL+Y EY NTG G+ST+
Sbjct  411  GSVKTYLGRPWRQYSRTVFMKTFLDGLIDPRGWLEWNGNFALSTLFYAEYQNTGPGSSTS  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+T+A++AS+FTVG+FIAG SW+PATNVPFTSGL
Sbjct  471  GRVTWPGFRVLTAASDASRFTVGSFIAGNSWIPATNVPFTSGL  513



>ref|XP_010325628.1| PREDICTED: pectinesterase 2 [Solanum lycopersicum]
Length=524

 Score =   442 bits (1137),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 245/283 (87%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG Y ENVEIG K+KN+ML+GDGIGKTIITGS+SVGGG+TTF+SATV   GDG
Sbjct  246  RFVIYVKAGTYNENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTFRSATVGASGDG  305

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGIT RNTAG   HQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY+ECDIYGT
Sbjct  306  FIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYKECDIYGT  365

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR+PPNK NT+TAQGR+DPNQNTGISIHNC++T A    GS 
Sbjct  366  VDFIFGNAAVVLQNCNIFARDPPNKINTVTAQGRTDPNQNTGISIHNCRITGA----GSS  421

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             S +TYLGRPWQ+YSRTV MKT LD LI   GWLPW GNFALNTLYYGEY NTG G+ST 
Sbjct  422  KSARTYLGRPWQKYSRTVVMKTFLDGLISSEGWLPWSGNFALNTLYYGEYLNTGPGSSTG  481

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITS+ EASKFT  NFIAG SW+PATNVPFTSGL
Sbjct  482  NRVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL  524



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   441 bits (1133),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/283 (81%), Positives = 252/283 (89%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVKAGVY E VEI  K KN+MLVGDGIGKTIITGS+SVGGGTTTF+SATVA  GDG
Sbjct  231  RYVIYVKAGVYNEQVEI--KAKNVMLVGDGIGKTIITGSKSVGGGTTTFRSATVAATGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  289  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPP KT T+TAQGR+DPNQNTGI IHN +V+A SDL  S 
Sbjct  349  VDFIFGNAAVVLQNCNIFARNPPAKTITVTAQGRTDPNQNTGIIIHNSRVSAQSDLNPS-  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LD  I+PAGWLPWDGNFAL+TLYY EY+NTG+G+ST+
Sbjct  408  -SVKSYLGRPWQKYSRTVFMKTVLDGFINPAGWLPWDGNFALDTLYYAEYANTGSGSSTS  466

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA++AS FTVGNFIAG SW+  T VPFTSGL
Sbjct  467  NRVTWKGYHVLTSASQASPFTVGNFIAGNSWIGNTGVPFTSGL  509



>ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=516

 Score =   441 bits (1133),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 246/283 (87%), Gaps = 5/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG+Y ENVEIG K+KN+ML+GDGIGKTIITGS+SVGGG+TT +SATV V GDG
Sbjct  239  RFVIYVKAGIYSENVEIGEKVKNVMLIGDGIGKTIITGSKSVGGGSTTLRSATVGVSGDG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGIT RNTAG   HQAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY+ECDIYGT
Sbjct  299  FIAQGITIRNTAGPQKHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYKECDIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+AR+PPNK NT+TAQGR+DPNQNTGISIHNC++T A       
Sbjct  359  VDFIFGNAAVVLQNCNIFARDPPNKINTVTAQGRTDPNQNTGISIHNCRITGA-----GA  413

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPWQ+YSRTV MKT LD LI+  GWLPW GNFALNTLYYGEY NTG G+ST 
Sbjct  414  KSVRTYLGRPWQKYSRTVVMKTFLDGLINSEGWLPWSGNFALNTLYYGEYLNTGPGSSTG  473

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITS+ EASKFT  NFIAG SW+PATNVPFTSGL
Sbjct  474  NRVNWGGYRVITSSAEASKFTPANFIAGNSWIPATNVPFTSGL  516



>ref|XP_010058468.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=720

 Score =   446 bits (1148),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 226/282 (80%), Positives = 247/282 (88%), Gaps = 0/282 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R +IY+KAG Y+EN+E+GSKL+NI+ VGDGIG TIITGSRSVG G TTF SATVAV GDG
Sbjct  233  RCIIYIKAGTYEENIEVGSKLENIVFVGDGIGMTIITGSRSVGEGFTTFNSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAAN QAVALRS SDLSVFY+CSFEGYQDTL+V+S+RQFY+ECDIYGT
Sbjct  293  FIAQDITFRNTAGAANGQAVALRSSSDLSVFYRCSFEGYQDTLFVHSERQFYKECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            +DFIFGNAAVVFQNCNIYARNPPNK N ITAQGR+DPNQNTGISIHNCKVTAASDL    
Sbjct  353  IDFIFGNAAVVFQNCNIYARNPPNKVNIITAQGRTDPNQNTGISIHNCKVTAASDLLSVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
               KTYLGRPWQ+YSRTVFM T LDSLID AGWL WDG+FAL+TLYYGEY N G G+ST 
Sbjct  413  SFAKTYLGRPWQEYSRTVFMTTYLDSLIDSAGWLEWDGDFALSTLYYGEYMNIGPGSSTT  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSG  137
            NRV WAGYHVITS  EASKFT+GNFI GGSWL AT +P+TSG
Sbjct  473  NRVTWAGYHVITSTIEASKFTIGNFIPGGSWLFATGIPYTSG  514



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   439 bits (1128),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 252/283 (89%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK+GVY E VEI  K KNIMLVGDGIGKTIITGS+SVGGG+TTF+SATVA VGDG
Sbjct  242  RYVIYVKSGVYNEQVEI--KSKNIMLVGDGIGKTIITGSKSVGGGSTTFRSATVAAVGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEGYQDTLYV+S+RQFYRECD+YGT
Sbjct  300  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDVYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  360  VDFIFGNAAVVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  418

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT+LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  419  -SVKSYLGRPWQKYSRTVFMKTNLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  477

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYH +T+A++A+ FTV NFIAG SW+P+T+VPFTSGL
Sbjct  478  NRVTWKGYHALTAASQATPFTVANFIAGNSWIPSTSVPFTSGL  520



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   438 bits (1126),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 250/283 (88%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK+GVY EN++I  K KN+M+VGDGIGKTIITGSRSVGGG+TTF+SATVAV GDG
Sbjct  235  RFVIYVKSGVYNENLDI--KAKNVMMVGDGIGKTIITGSRSVGGGSTTFRSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRNTAGA NHQAVALRSGSDLSVFY+C FEGYQDTLYVY++RQFY++CDIYGT
Sbjct  293  FIARDITFRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQCDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV Q+CNI AR+PPNKT T+TAQGRSDPNQNTGISIHNC++T+A    G L
Sbjct  353  VDFIFGNAAVVLQDCNIIARDPPNKTITVTAQGRSDPNQNTGISIHNCRITSA----GGL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              VK YLGRPW+QYSRTV MK+S+   I PAGW+PW GNFALNTLYYGEY NTG GASTA
Sbjct  409  SGVKAYLGRPWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYGEYMNTGPGASTA  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GY VITSA EASKFTVGNFIAGGSWLP+T VPFTSGL
Sbjct  469  NRVNWKGYRVITSAAEASKFTVGNFIAGGSWLPSTGVPFTSGL  511



>ref|XP_004133929.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN56617.1| hypothetical protein Csa_3G126810 [Cucumis sativus]
Length=509

 Score =   437 bits (1125),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 251/283 (89%), Gaps = 6/283 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+GVY EN++I  K KN+M+VGDGIGKTIITGSRSVGGG+TTF+SATVAV GDG
Sbjct  233  RFVIYIKSGVYNENLDI--KAKNVMMVGDGIGKTIITGSRSVGGGSTTFRSATVAVDGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRNTAGA NHQAVALRSGSDLSVFY+C FEGYQDTLYVY++RQFY++CDIYGT
Sbjct  291  FIARDITFRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQCDIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV Q+CNI AR+PPNKT T+TAQGRSDPNQNTGISIHNC++T++    G L
Sbjct  351  VDFIFGNAAVVLQDCNIIARDPPNKTITLTAQGRSDPNQNTGISIHNCRITSS----GGL  406

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
              VK YLGRPW+QYSRTV MK+S+   I PAGW+PW GNFALNTLYY EY NTG GASTA
Sbjct  407  SGVKAYLGRPWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGPGASTA  466

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHVITSA+EASKFTVGNFIAGGSWLP+T VPFTSGL
Sbjct  467  NRVNWKGYHVITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  509



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/284 (78%), Positives = 248/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K+G+Y+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G+G
Sbjct  172  RFVIRIKSGIYRENLEIGNKMKNIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGEG  231

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI  GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLY++S RQFY+EC IYGT
Sbjct  232  FIASGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGT  291

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V AASDLK  
Sbjct  292  VDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPV  351

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW+QYSRTVF++T LDSL+DPAGWL WDGNFALNTLYYGEY N G  +ST
Sbjct  352  LSSFKTFLGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASST  411

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEAS+FTV NFIAG SWLPAT VPF+SGL
Sbjct  412  SGRVKWRGYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|NP_566038.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
 sp|O22149.2|PME17_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
17; Includes: RecName: Full=Pectinesterase inhibitor 17; AltName: 
Full=Pectin methylesterase inhibitor 17; Includes: RecName: 
Full=Pectinesterase 17; Short=PE 17; AltName: Full=Pectin 
methylesterase 17; Short=AtPME17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32841.1|AF361829_1 At2g45220/F4L23.27 [Arabidopsis thaliana]
 gb|AAB82640.2| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10527.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
Length=511

 Score =   434 bits (1116),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 250/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDGIGKTIITGS+SVGGGTTTF SATVA VGDG
Sbjct  232  RFVIYVKQGVYSENLEI--RKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA+N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYR+CD+YGT
Sbjct  290  FIARGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  350  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  410  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALKTLFYAEFQNTGPGASTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG F+AGGSW+P++ VPFTSGL
Sbjct  470  GRVTWPGFRVLGSASEASKFTVGTFLAGGSWIPSS-VPFTSGL  511



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   434 bits (1115),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY E VE+  K KNIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDG
Sbjct  235  RYVIYVKGGVYDEQVEV--KAKNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGT
Sbjct  293  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  353  VDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  411

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  412  -SVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA+EAS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  471  NRVTWKGYHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  513



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   434 bits (1115),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 247/283 (87%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KNIML GDGIGKTIITGS+SVGGG+TTF SATVAVVGDG
Sbjct  233  RFVIYVKQGVYNENIEI--RAKNIMLRGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYREC+IYGT
Sbjct  291  FIARGITFRNTAGPNNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECNIYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA VFQNCNI+AR P NKTNT+TAQGRSDPNQNTGI IHN ++TA SDL+  L
Sbjct  351  VDFIFGNAAAVFQNCNIFARRPQNKTNTVTAQGRSDPNQNTGIVIHNSRITAGSDLRPVL  410

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GSVKTYLGRPW+QYSRTV MKT LD LIDP GWL W+GNFAL TL+Y EY NTG  +ST 
Sbjct  411  GSVKTYLGRPWRQYSRTVVMKTFLDGLIDPRGWLEWNGNFALRTLFYAEYQNTGPSSSTG  470

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ +A+EAS+FTVGNFIAG SW+PATNVPFTSGL
Sbjct  471  GRVTWPGFRVLRTASEASRFTVGNFIAGNSWIPATNVPFTSGL  513



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   433 bits (1113),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 252/283 (89%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K G+YKEN+EI  KLKNIML+GDGIG+TIITGS+SVGGG+TTF+SATVAV+G G
Sbjct  249  RFVIYIKKGIYKENLEIEDKLKNIMLLGDGIGRTIITGSKSVGGGSTTFRSATVAVMGSG  308

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ QGITFRNTAG +NHQAVALRS SDLSVFY+CSFEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  309  FMAQGITFRNTAGPSNHQAVALRSNSDLSVFYKCSFEGYQDTLYVFSNRQFYRECDIYGT  368

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR  P++T  ITAQGRSDPN+NTGISIHN +V+A+ DLKGS 
Sbjct  369  VDFIFGNAAAVIQNCNIYARFGPSRTVAITAQGRSDPNENTGISIHNSRVSASEDLKGS-  427

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
               KTYLGRPW++YSRTVFMKT L  ++DP GWL W+G+FAL+TLYYGEY+NTG G+ST+
Sbjct  428  ---KTYLGRPWKKYSRTVFMKTYLSGIVDPKGWLEWNGDFALSTLYYGEYANTGPGSSTS  484

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW+GYHVITS+ EA KF VGNFIAG +WLP+T VPF SGL
Sbjct  485  NRVKWSGYHVITSSAEAGKFNVGNFIAGNNWLPSTGVPFKSGL  527



>gb|KFK37315.1| hypothetical protein AALP_AA4G241100 [Arabis alpina]
Length=509

 Score =   432 bits (1110),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/283 (80%), Positives = 249/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KNIML GDGIGKTIITGSRSVGGGTTTF SATVA VGDG
Sbjct  230  RFVIYVKQGVYAENLEI--RKKNIMLRGDGIGKTIITGSRSVGGGTTTFNSATVAAVGDG  287

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYRECD+YGT
Sbjct  288  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRECDVYGT  347

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P + TNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  348  VDFIFGNAAAVLQNCNIFARRPRSSTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  407

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFALNTL+Y E+ NTG GAST+
Sbjct  408  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALNTLFYAEFQNTGPGASTS  467

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG+F+AG SW+P++ VPFTSGL
Sbjct  468  GRVTWKGFQVLGSASEASKFTVGSFLAGSSWIPSS-VPFTSGL  509



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   431 bits (1107),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 221/284 (78%), Positives = 249/284 (88%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EI  KLKNIML+GDG+  TIITGSRSV GG+TTF SATVAV GDG
Sbjct  201  RFVIHVKRGVYKENLEI--KLKNIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGDG  258

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+EC +YGT
Sbjct  259  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGT  318

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + NTITAQGR+DPNQNTGISIH+ +V A SDLK  
Sbjct  319  VDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPV  378

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L SVKTYLGRPW++YSRTVF+++ LD+L+DPAGWL WDGNFAL TLYYGEY NTG G+ST
Sbjct  379  LSSVKTYLGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSST  438

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GYHVITS++EASKFTVGNFIAG SWLPATNVPFT+GL
Sbjct  439  SGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  482



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   432 bits (1110),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/284 (77%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++I+VK GVY+EN+EIGSK+KNIMLVGDG+  TIITGSRSV GG+TTFKSATVAV G+G
Sbjct  238  RFIIHVKRGVYRENLEIGSKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEG  297

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSD SVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  298  FIARGITFRNTAGPQNHQAVALRSGSDQSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  357

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+  
Sbjct  358  VDFIFGNAAVVLQNCMIFARQPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPV  417

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L + KTYLGRPW+QYSRTVFMKT LDSL+DPAGWL WDGNFALNTLYYGEY N+GAGAST
Sbjct  418  LNTFKTYLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGAGAST  477

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV+W GY VIT++ EA+KF+V NFIAG SWLPATNVPF +GL
Sbjct  478  SRRVRWRGYRVITNSNEAAKFSVENFIAGRSWLPATNVPFRAGL  521



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score =   428 bits (1101),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 251/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDG
Sbjct  166  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDG  223

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITFRNTAGA+N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGT
Sbjct  224  FMARGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGT  283

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSD NQNTGI IHN +VTAASDL+  L
Sbjct  284  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPIL  343

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL W+GNFAL+TL+Y E+ NTG GAST+
Sbjct  344  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTS  403

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW G+ V+ SA+EAS+FTVG+FIAG SW+P++ VPFTSGL
Sbjct  404  GRVKWPGFRVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  445



>gb|KCW73025.1| hypothetical protein EUGRSUZ_E01468, partial [Eucalyptus grandis]
Length=513

 Score =   431 bits (1107),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 217/278 (78%), Positives = 238/278 (86%), Gaps = 0/278 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IY+KAG Y+ENVE+GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDG
Sbjct  233  RFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFNSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAG+ANHQAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY+ECDIYGT
Sbjct  293  FIAQDITFRNTAGSANHQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYKECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
             DFIFGNAAVVF NCNIY RNPPNK NTITAQGR+DPNQNTGISI NCKV A S+L    
Sbjct  353  TDFIFGNAAVVFHNCNIYVRNPPNKVNTITAQGRTDPNQNTGISILNCKVIADSELILVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFM T LD LID AGWL WDG+FAL+TLYYGEY NTG  +ST 
Sbjct  413  SSVKTYLGRPWQKYSRTVFMMTYLDGLIDSAGWLEWDGDFALDTLYYGEYMNTGPRSSTT  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVP  149
            NRV WAGYHVITS TEASKFT+GN I GG+WL AT +P
Sbjct  473  NRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMP  510



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   430 bits (1106),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/284 (79%), Positives = 246/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV G+G
Sbjct  237  RYVIHVKKGVYKENIEIGNKMKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFY+EC IYGT
Sbjct  297  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA+DLK  
Sbjct  357  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPV  416

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KTYLGRPW++YSRTV++ T LD+L+D AGWL WDGNFALNTLYYGEY N G G+ST
Sbjct  417  LSSFKTYLGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSST  476

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEASKF+V NFIAG SWLPAT VPF SGL
Sbjct  477  SGRVKWRGYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  520



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   430 bits (1106),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/284 (78%), Positives = 247/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK G Y+EN+EIG+K+KNIML+G G+  TIITGSRSVGGG+TTF SATVAV GDG
Sbjct  240  RFVIQVKRGTYRENLEIGNKMKNIMLLGAGMRDTIITGSRSVGGGSTTFDSATVAVTGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAG  NHQAVALRSGSDLSVF++C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  300  FIAQGITFRNTAGPQNHQAVALRSGSDLSVFHRCGFEGYQDTLYVHSQRQFYKECYIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V AASDL+  
Sbjct  360  VDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLRPV  419

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KTYLGRPW+QYSRTVF++T LDSL+DPAGWL WDGNFA NTLYYGEY N+G G+ST
Sbjct  420  LSSFKTYLGRPWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGPGSST  479

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVIT+ TEAS+FTV NFIAG SWLPATNVPF +GL
Sbjct  480  SRRVKWRGYHVITNPTEASRFTVANFIAGRSWLPATNVPFAAGL  523



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 250/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDG
Sbjct  166  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDG  223

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  224  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  283

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  284  VDFIFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  343

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL+TL+Y E+ NTG GAST+
Sbjct  344  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTS  403

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  404  GRVTWPGFRVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  445



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK+GVY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDG
Sbjct  229  RYVIYVKSGVYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  286

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGT
Sbjct  287  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGT  346

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  347  VDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  405

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  406  -SVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  464

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA++AS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  465  NRVTWKGYHVLTSASQASPFTVGNFIAGNNWIPSSGVPFTSGL  507



>ref|XP_003517028.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK+GVY E VE+  K  NIMLVGDGIGKTIITGS+SVGGGTTTF+SATVA VGDG
Sbjct  237  RYVIYVKSGVYNEQVEV--KGNNIMLVGDGIGKTIITGSKSVGGGTTTFRSATVAAVGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAGAANHQAVA RSGSDLSVFY+CSFEG+QDTLYV+S+RQFY+ CDIYGT
Sbjct  295  FIAQDITFRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNIYAR PP +T T+TAQGR+DPNQNTGI IHN KVT AS    S 
Sbjct  355  VDFIFGNAAAVLQNCNIYARTPPQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPS-  413

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK+YLGRPWQ+YSRTVFMKT LDSLI+PAGW+ WDGNFAL+TLYY EY+NTG G++TA
Sbjct  414  -SVKSYLGRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYHV+TSA++AS FTVGNFIAG +W+P++ VPFTSGL
Sbjct  473  NRVTWKGYHVLTSASQASPFTVGNFIAGNNWIPSSGVPFTSGL  515



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 249/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDG
Sbjct  166  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDG  223

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  224  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  283

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  284  VDFIFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  343

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  344  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTS  403

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  404  GRVTWPGFRVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  445



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   428 bits (1100),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVY+EN+EIGSKL+NIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G+G
Sbjct  192  RFVIHVKRGVYRENLEIGSKLRNIMLVGDGMKYTIITGSRSVGGGSTTFNSATVAVTGEG  251

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC ++GT
Sbjct  252  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYVFGT  311

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V A++DL   
Sbjct  312  VDFIFGNAAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASADLVPV  371

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LGS +++LGRPW++YSRTVFM+T LDSL+DPAGWL WDGNFALNTLYYGEY NTG G+ST
Sbjct  372  LGSFRSFLGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSST  431

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV+W GY VITSA EA +FTV NFIAG SWLPAT VPFT+GL
Sbjct  432  SRRVRWRGYRVITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>ref|XP_002882002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58261.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 248/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDGIGKTIITGS+SVGGGTTTF SATVA VGDG
Sbjct  232  RFVIYVKQGVYSENLEI--RKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFE YQDTLYV+S+RQFYR+CD+YGT
Sbjct  290  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  350  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL W+GNFAL TL+Y E+ NTG GAST+
Sbjct  410  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG F+AG SW+P+T VPFTSGL
Sbjct  470  GRVTWPGFRVLGSASEASKFTVGTFLAGSSWIPST-VPFTSGL  511



>ref|XP_010508199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 248/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  289  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  469  GRVTWPGFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_009143104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 252/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITFRNTAGA+N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGT
Sbjct  289  FMARGITFRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSD NQNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPIL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL W+GNFAL+TL+Y E+ NTG+GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGSGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW G+ V+ SA+EAS+FTVG+FIAG SW+P++ VPFTSGL
Sbjct  469  GRVKWPGFRVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  510



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score =   429 bits (1102),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 248/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  289  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  469  ARVTWPGFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score =   428 bits (1101),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 249/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KNIML GDG G+TIITGSRSVGGGTTTF SATVA VGDG
Sbjct  232  RFVIYVKQGVYSENLEI--RKKNIMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDG  289

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  290  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  349

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  350  VDFIFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPIL  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKT LD LIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  410  GSTKTYLGRPWRQYSRTVFMKTFLDGLIDPRGWLEWDGNFALRTLFYAEFQNTGRGASTS  469

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RVKW G+ V+ SA+EAS+FTVGNF+AGGSW+P++ +PFTSGL
Sbjct  470  GRVKWPGFRVLRSASEASRFTVGNFLAGGSWIPSS-IPFTSGL  511



>ref|XP_010506460.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   428 bits (1100),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 248/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGGTTTF SATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGTTTFNSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  289  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL TL+Y E+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V+ SA+EASKFTVG F+AG SW+P++ VPFTSGL
Sbjct  469  GRVTWPGFRVLGSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_006293950.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
 gb|EOA26848.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
Length=546

 Score =   429 bits (1103),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 249/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG GKTIITGSRSVGGGTTTF SATVA VGD 
Sbjct  267  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGKTIITGSRSVGGGTTTFNSATVAAVGDA  324

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CDIYGT
Sbjct  325  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGT  384

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P +KTNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  385  VDFIFGNAAAVLQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  444

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL W+GNFAL TL+Y E+ NTG GAST+
Sbjct  445  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTS  504

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV W G+ V+ SA+EASKFTVG F+AGGSW+P++ VPFTSGL
Sbjct  505  SRVTWPGFRVLGSASEASKFTVGTFLAGGSWIPSS-VPFTSGL  546



>ref|XP_010058471.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=565

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/290 (76%), Positives = 242/290 (83%), Gaps = 9/290 (3%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IY+KAG Y+ENVE+GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDG
Sbjct  233  RFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFNSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAG+ANHQAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY+ECDIYGT
Sbjct  293  FIAQDITFRNTAGSANHQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYKECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
             DFIFGNAAVVF NCNIY RNPPNK NTITAQGR+DPNQNTGISI NCKV A S+L    
Sbjct  353  TDFIFGNAAVVFHNCNIYVRNPPNKVNTITAQGRTDPNQNTGISILNCKVIADSELILVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFM T LD LID AGWL WDG+FAL+TLYYGEY NTG  +ST 
Sbjct  413  SSVKTYLGRPWQKYSRTVFMMTYLDGLIDSAGWLEWDGDFALDTLYYGEYMNTGPRSSTT  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPAT---------NVPFTS  140
            NRV WAGYHVITS TEASKFT+GN I GG+WL AT         NVP+TS
Sbjct  473  NRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGYNVPYTS  522



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   426 bits (1096),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 249/284 (88%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVY+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF S TV V G+G
Sbjct  191  RFVIHVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVVVTGEG  250

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  251  FIAQGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  310

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+  
Sbjct  311  VDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPV  370

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LG+ KT+LGRPW+QYSRTVFMKT LDSL+DPAGWL WDG+FAL+TLYYGEY N G GAST
Sbjct  371  LGTFKTFLGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALSTLYYGEYRNAGPGAST  430

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ++RVKW+GY VIT++ EA++F+V NFIAG SWLPATNVPF +GL
Sbjct  431  SSRVKWSGYRVITNSNEAARFSVENFIAGRSWLPATNVPFRAGL  474



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 250/283 (88%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  + KN+ML GDG G+TIITGSRSVGGG+TTF SATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--RKKNVMLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGT
Sbjct  289  FIARGITFRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V QNCNI+AR P ++TNTITAQGRSDPNQNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAVLQNCNIFARRPRSRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL WDGNFAL+TL+Y E+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W G+ V++S +EAS+FTVG+F+AG SW+P+ +VPFTSGL
Sbjct  469  GRVTWPGFRVLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  510



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   426 bits (1095),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 245/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K+GVY+EN++IG KLKNIMLVGDG+  TIITGSRSVGGG TTF SATVAV G+G
Sbjct  234  RFVIRIKSGVYRENLDIGKKLKNIMLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEG  293

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  294  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  353

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAV+ QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+SDL+  
Sbjct  354  VDFIFGNAAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPV  413

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KTYLGRPW++YSRTVF++T LDSL+DPAGWL WDGNFALNTLYYGEY N+G GAST
Sbjct  414  LSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGAST  473

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VITS+TEAS+FTV NFIAG SWLPAT VPF  GL
Sbjct  474  RGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 246/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K+GVY+EN++IG  LKNIMLVGDG+  TIITGSRSVGGG+TTFKSATVAV G G
Sbjct  236  RFVIRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFKSATVAVTGGG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+ECDIYGT
Sbjct  296  FIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+SDL+  
Sbjct  356  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPV  415

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW+ YSRTVF++T LDSL+D AGWL WDGNFALNTLYYGEY N+G GAST
Sbjct  416  LSSFKTFLGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGAST  475

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEAS+FT  NFIAG SWLPAT VPF+SGL
Sbjct  476  SGRVKWRGYRVITSATEASRFTAANFIAGRSWLPATGVPFSSGL  519



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/284 (77%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDG
Sbjct  235  RFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  295  FIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL   
Sbjct  355  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPV  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L   KT+LGRPW++YSRTV+M+T LDSL+DPAGWL W GNFALNTL+YGEY N G  AST
Sbjct  415  LSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAAST  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEASKFTVG+FIAG SWLPAT VPF SGL
Sbjct  475  SGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/284 (77%), Positives = 246/284 (87%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EI   LKNIML+GDG+  TIITGSRSV GG+TTF SATVAV GDG
Sbjct  236  RFVIHVKRGVYKENLEI--TLKNIMLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGDG  293

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+EC +YGT
Sbjct  294  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGT  353

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + NTITAQGR+DPNQNTGISIH+ +V A SDLK  
Sbjct  354  VDFIFGNAAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPV  413

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L SVKTYLGRPW++YSRTVF+++ LD+L+D AGWL WDGNFAL TLYYGEY NTG G+ST
Sbjct  414  LSSVKTYLGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSST  473

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GYHVITS++EASKFTVGNFIAG SWLPATNVPFT+GL
Sbjct  474  RGRVNWGGYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 221/284 (78%), Positives = 246/284 (87%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvggg-ttTFKSATVAVVGD  806
            R+VIYVKAG Y E V IGSK  NIMLVGDGIGKTIITG +SVGGG +TT+ SATV + GD
Sbjct  234  RFVIYVKAGTYSETVSIGSK--NIMLVGDGIGKTIITGRKSVGGGGSTTYSSATVGITGD  291

Query  805  GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  626
            GF+ +GITFRNTAGA + QAVA RS SDLS +YQCSFEGYQDTLYV+S RQFY ECDIYG
Sbjct  292  GFLARGITFRNTAGAKSQQAVAFRSASDLSAYYQCSFEGYQDTLYVFSQRQFYSECDIYG  351

Query  625  TVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            TVDFIFGNAAVVFQNC+++ARN P  TNT+TAQGR+DPNQNTGISI+NCKVTA SDLK  
Sbjct  352  TVDFIFGNAAVVFQNCSLFARNTPTHTNTLTAQGRTDPNQNTGISIYNCKVTADSDLKPV  411

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              SVKTYLGRPW+QYSRTVFMKT LDSLI PAGWLPW G+FAL TLYYGEY NTG G+ST
Sbjct  412  QSSVKTYLGRPWKQYSRTVFMKTFLDSLIAPAGWLPWSGSFALTTLYYGEYMNTGPGSST  471

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GYHV+++A +ASKFTV NFI+G SW+PATNVPFTS L
Sbjct  472  ANRVKWPGYHVMSTA-DASKFTVRNFISGNSWIPATNVPFTSNL  514



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/284 (77%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDG
Sbjct  235  RFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  295  FIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL   
Sbjct  355  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPV  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L   KT+LGRPW++YSRTV+M+T LDSL+DPAGWL W GNFALNTL+YGEY N G  AST
Sbjct  415  LSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAAST  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEASKFTVG+FIAG SWLPAT VPF SGL
Sbjct  475  SGRVKWRGYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   424 bits (1090),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 215/284 (76%), Positives = 247/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++K+G+Y+EN+EIG+ + NIMLVGDG+  TIITGSRSVGGG+TTF SATVAV GDG
Sbjct  240  RFVIHIKSGIYRENLEIGNDMINIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  300  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V A+ DLK  
Sbjct  360  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPV  419

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KTYLGRPW+QYSRTV+++T LDSL+DPAGWL WDG+FALNTLYYGEY N G  AST
Sbjct  420  LSSFKTYLGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSAST  479

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VITS+TEA++FTV NFIAGGSWLPA++VPFTSGL
Sbjct  480  SGRVTWRGYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   423 bits (1088),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 246/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K+GVY+EN++IG  LKNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G G
Sbjct  237  RFVIRIKSGVYRENLDIGKNLKNIMLVGDGLKNTIITGSRSVGGGSTTFNSATVAVTGGG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+ECDIYGT
Sbjct  297  FIARGITFRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+D NQNTGISIHN +V A+SDL+  
Sbjct  357  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSDLRPV  416

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW++YSRTVF++T LDSL+D AGWL WDGNFALNTLYYGEY N+G GAST
Sbjct  417  LSSFKTFLGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGAST  476

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEAS+FTV NFIAG SWLPAT VPF+SGL
Sbjct  477  SGRVKWRGYRVITSATEASRFTVANFIAGRSWLPATGVPFSSGL  520



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/284 (77%), Positives = 242/284 (85%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV GDG
Sbjct  235  RFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALR+GSDLSVFYQC FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  295  FIARGITFRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA DL   
Sbjct  355  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPV  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L   KT+LGRPW++YSRTV+M+T LDSL+DPAGWL W GNFALNTL+YGEY N G  AST
Sbjct  415  LSKFKTFLGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAAST  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSATEASKFTVG+FI G SWLPAT VPF SGL
Sbjct  475  SGRVKWRGYRVITSATEASKFTVGSFITGNSWLPATGVPFRSGL  518



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 246/284 (87%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVY+EN+EIG+K+KNIMLVGDG+  TIITGSRSVGGG+TTF S TV V G+G
Sbjct  240  RFVIRVKRGVYRENLEIGNKMKNIMLVGDGMKYTIITGSRSVGGGSTTFNSGTVVVTGEG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  300  FIAQGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+  
Sbjct  360  VDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPV  419

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +G+ KTYLGRPW+QYSRTV MKT LDSL+DPAGWL WDG+FALNTLYYGEY N G GAST
Sbjct  420  VGTFKTYLGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGPGAST  479

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ++RVKW GY VIT++ EA++F+V N IAGGSWLPATNVPF +GL
Sbjct  480  SSRVKWPGYRVITNSNEAARFSVENLIAGGSWLPATNVPFRAGL  523



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/284 (77%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EIG+KLKNIMLVGDG+  TIITGSRSVGGG+TTF SATVAV G+G
Sbjct  233  RFVIHVKRGVYKENLEIGNKLKNIMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGEG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  293  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNTGISIHN +V AA+DL   
Sbjct  353  VDFIFGNAAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPV  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW++YSRTVFM+T LDSL+DPAGW  WDG+FALNTLYYGEY N G  A T
Sbjct  413  LSSFKTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPT  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VITSATEASKFTV NFIAG SWLP T +PFTSGL
Sbjct  473  SRRVTWKGYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 242/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVY ENV+  + +KN+M++GDG+  T++TGS++V  G+TTF+SAT AV GDG
Sbjct  235  RFVIHVKTGVYDENVQ--TSMKNLMIIGDGMDATVVTGSKNVKDGSTTFRSATFAVTGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG    QAVALRSGSDLSVFYQCSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  293  FIARDMTFENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+AAVV QNCN++ R P + + NT+TAQGR+DPN+NTGISIH+  VTAASDLK  
Sbjct  353  VDFIFGDAAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPV  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSRTVFMKTSLDSLIDPAGWL W GNFAL+TLYYGEY NTG GA T
Sbjct  413  QGSFETYLGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADT  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVITSA EASKFTVGNF++G SW+PAT VPFTSGL
Sbjct  473  SQRVKWPGYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>gb|KCW73024.1| hypothetical protein EUGRSUZ_E01466, partial [Eucalyptus grandis]
Length=523

 Score =   421 bits (1083),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/290 (75%), Positives = 241/290 (83%), Gaps = 9/290 (3%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IY+KAG Y+ENVE+GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDG
Sbjct  233  RFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFHSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAG+AN+QAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY  CDIYGT
Sbjct  293  FIAQDITFRNTAGSANNQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYNGCDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
             DFIFGNAAVVF NCNIY RN PNK NTITAQGR++PNQNTGISI NCKV A S+L    
Sbjct  353  TDFIFGNAAVVFHNCNIYVRNSPNKVNTITAQGRTNPNQNTGISILNCKVIADSELILVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFM+T  DSLID AGWL WD +FAL+TLYYGEY NTG G+STA
Sbjct  413  SSVKTYLGRPWQKYSRTVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPAT---------NVPFTS  140
            NRV WAGYHVITS TEASKFT+GN I GG+WL AT         NVP+TS
Sbjct  473  NRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGYNVPYTS  522



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   421 bits (1083),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 245/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++I+VK G Y+EN+EIG+K+KNIMLVGDG+  TIITGSRSV GG+TTFKSATVAV G+G
Sbjct  241  RFIIHVKRGAYRENLEIGNKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEG  300

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSD SVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  301  FIARGITFRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  360

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTN-TITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I+AR P +K   TITAQGR+DPNQNTGISIHN +V AASDL+  
Sbjct  361  VDFIFGNAAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPV  420

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L + KT+LGRPW+QYSRTVFMKT L SL+DPAGWL WDGNFALNTLYYGEY N+G GAST
Sbjct  421  LSTFKTFLGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGAST  480

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV+W GY VIT++ EA+KF+V NFI G SWLPATNVPF +GL
Sbjct  481  SRRVRWRGYRVITNSNEAAKFSVENFIGGRSWLPATNVPFRAGL  524



>gb|EYU31969.1| hypothetical protein MIMGU_mgv1a005025mg [Erythranthe guttata]
Length=500

 Score =   420 bits (1080),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 214/283 (76%), Positives = 241/283 (85%), Gaps = 23/283 (8%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIYVK GVY ENV+IG  LKNIML+GDGIGKTIITGSRSV GG+TTFKSAT +VVG G
Sbjct  241  RYVIYVKQGVYSENVDIGKGLKNIMLLGDGIGKTIITGSRSVDGGSTTFKSATFSVVGSG  300

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TFRNTAGA NHQAVALRSGSDLSVFYQCSFEGYQDTLYV+S RQFYR+CDIYGT
Sbjct  301  FIARGVTFRNTAGARNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYRDCDIYGT  360

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI+ARNPPN+TNT+TAQGR+DPNQNTGISIHNC+           
Sbjct  361  VDFIFGNAAVVLQNCNIFARNPPNRTNTLTAQGRTDPNQNTGISIHNCR-----------  409

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
                        +YSRTVFMKT++DSL++PAGW+PW G+FAL+TLYYGEY+NTG G+STA
Sbjct  410  ------------KYSRTVFMKTTMDSLVNPAGWMPWSGSFALDTLYYGEYANTGPGSSTA  457

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITSA EA++F  G+FIA GSW+PATNVPFTSGL
Sbjct  458  NRVKWKGYRVITSAAEAARFAPGSFIAAGSWIPATNVPFTSGL  500



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   421 bits (1081),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 213/285 (75%), Positives = 238/285 (84%), Gaps = 2/285 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIG-KtiitgsrsvgggttTFKSATVAVVGD  806
            R++I+VK GVY EN+EIG+KLKNIMLVGDG+    I       GGG TTF SATVAV G+
Sbjct  239  RFIIHVKRGVYNENLEIGNKLKNIMLVGDGLRYTIITGSRSVGGGGYTTFNSATVAVTGE  298

Query  805  GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  626
            GFI QGITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLYV+S RQFY+EC IYG
Sbjct  299  GFIAQGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYG  358

Query  625  TVDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  449
            TVDFIFGNAA V QNC IYAR P +K  NTITAQGR+DPNQNTGISIHN +V AA+DLK 
Sbjct  359  TVDFIFGNAAAVLQNCMIYARRPMSKQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKP  418

Query  448  SLGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAS  269
             L S KTYLGRPW+QYSRTVFM+T LDSL+DPAGWL WDG+FALNTLYYGEY N G  AS
Sbjct  419  VLSSFKTYLGRPWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAAS  478

Query  268  TANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            T+ RVKW+GY VITS++EAS+FTV NFIAG SWLPAT V FT+GL
Sbjct  479  TSRRVKWSGYRVITSSSEASQFTVANFIAGQSWLPATGVRFTAGL  523



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 242/284 (85%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGS++V  G+TTF+SATVAV G G
Sbjct  249  RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGG  306

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF+NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  307  FIARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  366

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P + + NT+TAQGR DPN+NTGISIHN +VTAASDL+  
Sbjct  367  VDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNENTGISIHNSRVTAASDLRPV  426

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLIDPAGWL W GNFAL+TLYYGEY NTGAGAST
Sbjct  427  QGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGAGAST  486

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW G+HV+ SA++A KFTVGNF+ GGSW+ A  VPFTSGL
Sbjct  487  SRRVKWPGFHVM-SASDAGKFTVGNFLGGGSWIAAAGVPFTSGL  529



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVY+EN+EIGSK+KNIML+GDG+  T ITG+RSVGGG+TTF SATVAV G+G
Sbjct  243  RFVIQVKRGVYRENLEIGSKMKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEG  302

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C+FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  303  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGT  362

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + N +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  363  VDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  422

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +VKTYLGRPW++YSRTVFMKT +DSL+DPAGWL WDG+FALNTLYYGEY+N G G+  
Sbjct  423  ESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPI  482

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVIT+ TEAS+FTV NFIAG SWLP T VPFT GL
Sbjct  483  SQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPFTPGL  526



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 240/284 (85%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K GVY+EN++IG  LKNIMLVGDG+  T ITGSRSVGGG TTF SATVAV G+G
Sbjct  234  RFVIRIKRGVYRENLDIGKNLKNIMLVGDGLRNTSITGSRSVGGGFTTFNSATVAVTGEG  293

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  294  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGT  353

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P +K  N +TAQGR+DPNQNT ISIHN +V A+SDL+  
Sbjct  354  VDFIFGNAAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTPISIHNSRVMASSDLRPV  413

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KTYLGRPW++YSRTVF++T LDSL+DPAGWL WDGNFALNTLYYGEY N G GAST
Sbjct  414  LSSFKTYLGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGPGAST  473

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VITS+TEAS+FTV NFIAG SWLPAT VPF  GL
Sbjct  474  RGRVKWRGYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 244/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY ENV+  + +KN+M+VGDG+  T++TGSR+V  G+TTF+SAT AV GDG
Sbjct  234  RFVIHVKAGVYNENVQ--TPMKNLMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDG  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF+NTAG   HQAVALRSGSDLSVFY+CSFEGYQDTLY+YS RQFYR CD+YGT
Sbjct  292  FIARDMTFQNTAGPHKHQAVALRSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+AAVV QNC++Y R P + + NT+TAQGR+DPN+NTGISIH+  VTAAS+LK  
Sbjct  352  VDFIFGDAAVVLQNCSMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASELKPV  411

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPW++YSRTVFMKTSLD LIDPAGWL W GNFAL+TLYYGEY NTGAGA T
Sbjct  412  QGSFKTYLGRPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGADT  471

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVITSATEASKFTV NF++G SW+PAT V FTSGL
Sbjct  472  SQRVKWPGYHVITSATEASKFTVANFLSGNSWIPATGVAFTSGL  515



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVY+EN+EIGSK+KNIML+GDG+  T ITG+RSVGGG+TTF SATVAV G+G
Sbjct  288  RFVIQVKRGVYRENLEIGSKMKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEG  347

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C+FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  348  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGT  407

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + N +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  408  VDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  467

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +VKTYLGRPW++YSRTVFMKT +DSL+DPAGWL WDG+FALNTLYYGEY+N G G+  
Sbjct  468  ESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPI  527

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVIT+ TEAS+FTV NFIAG SWLP T VPFT GL
Sbjct  528  SQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPFTPGL  571



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 244/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY+EN+ IGS L NIM+VGDG+  T+ITGSRSVGGG+TTF SATVAV GDG
Sbjct  236  RFVIYVKRGVYQENLVIGSGLDNIMMVGDGLRFTVITGSRSVGGGSTTFNSATVAVTGDG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFY+EC IYGT
Sbjct  296  FIARGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYKECYIYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIHN +V AA DLK  
Sbjct  356  VDFIFGNAAVVLQNCMIYARRPMSGQKNTITAQGRTDPNQNTGISIHNSRVMAAPDLKPV  415

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S K+YLGRPW+QYSRTV+++T LD+LIDPAGWL WDGNFAL+TLYYGEY N G  A T
Sbjct  416  LSSFKSYLGRPWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGPAAWT  475

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITS++EASKFTV NFIAG SWLP+T VPFT GL
Sbjct  476  SGRVKWPGYRVITSSSEASKFTVANFIAGQSWLPSTGVPFTPGL  519



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 244/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++I+VKAGVY+EN+EIG+ +KNIMLVGDG+  TIITGSRSVGGG TTF SATVAV G+G
Sbjct  245  RFIIHVKAGVYRENLEIGNGMKNIMLVGDGMRSTIITGSRSVGGGFTTFNSATVAVTGEG  304

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI  GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  305  FIAMGITFRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGT  364

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I  R P + ++N +TAQGR+DPNQNTGISIHNC+V A+SDLK  
Sbjct  365  VDFIFGNAAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRVMASSDLKPV  424

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KT+LGRPW++YSRTV+++T LD+L+DPAGW+ W GNFALNTLYYGEY N G  +ST
Sbjct  425  QSSFKTFLGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASST  484

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RVKW GY VIT+ +EAS+FTVGNFI+GGSWLPAT VPF SGL
Sbjct  485  ARRVKWRGYRVITNPSEASRFTVGNFISGGSWLPATGVPFNSGL  528



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   416 bits (1068),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 243/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK+GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTF SATVAV GDG
Sbjct  178  RFVIRVKSGVYKENLEI--KLKNIYLLGDGLRSTIITGSRSVVGGSTTFNSATVAVTGDG  235

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+CSFEGYQDTLY +S RQFY+EC IYGT
Sbjct  236  FIARGITFRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYGT  295

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ ++ AA+DL   
Sbjct  296  VDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAPV  355

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            + SVKT+LGRPW+ YSRTVF+++ LDSL+DPAGWL WDGNFAL TLYYGEY N G G+ T
Sbjct  356  IKSVKTFLGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGT  415

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITS++EASKFTVGN IAG SWLPAT VPFTSGL
Sbjct  416  SGRVKWGGYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  459



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   424 bits (1091),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVY+EN+EIGSK+KNIML+GDG+  T ITG+RSVGGG+TTF SATVAV G+G
Sbjct  459  RFVIQVKRGVYRENLEIGSKMKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEG  518

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C+FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  519  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGT  578

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + N +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  579  VDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  638

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +VKTYLGRPW++YSRTVFMKT +DSL+DPAGWL WDG+FALNTLYYGEY+N G G+  
Sbjct  639  ESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPI  698

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVIT+ TEAS+FTV NFIAG SWLP T VPFT GL
Sbjct  699  SQRVKWKGYHVITNLTEASEFTVQNFIAGQSWLPDTEVPFTPGL  742



>ref|XP_010058469.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=607

 Score =   420 bits (1079),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 218/290 (75%), Positives = 241/290 (83%), Gaps = 9/290 (3%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IY+KAG Y+ENVE+GSKL+NI  VGDGIGKTIITGS+S  GG TTF SATVAV GDG
Sbjct  233  RFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGSKSNAGGFTTFHSATVAVDGDG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q ITFRNTAG+AN+QAVALRS SDLSVFY+C FEGYQDTL+V+S RQFY  CDIYGT
Sbjct  293  FIAQDITFRNTAGSANNQAVALRSSSDLSVFYRCGFEGYQDTLFVHSKRQFYNGCDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
             DFIFGNAAVVF NCNIY RN PNK NTITAQGR++PNQNTGISI NCKV A S+L    
Sbjct  353  TDFIFGNAAVVFHNCNIYVRNSPNKVNTITAQGRTNPNQNTGISILNCKVIADSELILVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVKTYLGRPWQ+YSRTVFM+T  DSLID AGWL WD +FAL+TLYYGEY NTG G+STA
Sbjct  413  SSVKTYLGRPWQKYSRTVFMRTYFDSLIDSAGWLEWDDDFALDTLYYGEYMNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPAT---------NVPFTS  140
            NRV WAGYHVITS TEASKFT+GN I GG+WL AT         NVP+TS
Sbjct  473  NRVTWAGYHVITSTTEASKFTIGNLIPGGTWLLATGMPNPSVGYNVPYTS  522



>ref|XP_010259196.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=515

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/283 (76%), Positives = 240/283 (85%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R +IYVKAG Y+ENV+IG KLKNIML+GDG+GKTIITGS+SV GG+TTF SATVAV GDG
Sbjct  235  RLLIYVKAGTYRENVQIGKKLKNIMLIGDGMGKTIITGSKSVRGGSTTFSSATVAVSGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  N QAVALRSGSDLSVFY+C FEGYQDTLYV+S+RQFYRECDIYGT
Sbjct  295  FIARDITFQNTAGPENGQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVVFQ CNIYAR   +   T+TAQGR+DPNQN+GI IHN +V AASDLK   
Sbjct  355  VDFIFGNAAVVFQKCNIYARR--HSIITVTAQGRNDPNQNSGIVIHNSRVMAASDLKPVQ  412

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK YLGRPW+QYSRTV++KT LDSLI P GWL W+ N ALN LYYGEY NTG G+STA
Sbjct  413  SSVKAYLGRPWRQYSRTVYLKTFLDSLIHPGGWLEWNENSALNKLYYGEYQNTGPGSSTA  472

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYH+IT+ +EAS FTV NF+AG SWLP T VPFTSGL
Sbjct  473  NRVKWGGYHIITTLSEASTFTVENFLAGDSWLPVTGVPFTSGL  515



>emb|CDY27388.1| BnaC04g50170D [Brassica napus]
Length=510

 Score =   416 bits (1069),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 246/283 (87%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  +  N+ML GDG G+TIITGSRSVGGG+TTFKSATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--QKDNVMLRGDGKGRTIITGSRSVGGGSTTFKSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY +CD+YGT
Sbjct  289  FIARGITFRNTAGANNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYSDCDVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA +FQNCNI+AR PP +TNTITAQGRS P+QNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAIFQNCNIFARRPPGRTNTITAQGRSYPDQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSR VFMKTSLDSLIDP GWL W+GNFAL TL+YGE+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRAVFMKTSLDSLIDPRGWLEWNGNFALTTLFYGEFQNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV W G+ VI SATEA +FTV +FIAG SW+P+  VPFTSGL
Sbjct  469  SRVTWPGFRVIGSATEALQFTVDSFIAGSSWIPSY-VPFTSGL  510



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   416 bits (1069),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 240/284 (85%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK G YKEN+EI   +KN+M VGDGI KTIITGSR+V  G+TTF+SAT AV  DG
Sbjct  233  RFVIYVKEGTYKENIEIKKSMKNLMFVGDGIDKTIITGSRNVQDGSTTFRSATFAVAADG  292

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVA RSGSDLSV Y+CSF+GYQDTLY YS RQFYRECDIYGT
Sbjct  293  FIAKDLTFENTAGPQKHQAVAFRSGSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGT  352

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAA V QNCNIY R P  ++ NTITAQGR+DPNQNTG+SIH+ KV+A+SDLK  
Sbjct  353  VDFIFGNAAAVLQNCNIYVRKPMSSQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAV  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTVFMKT+LD+LIDP+GWL W GNFAL TLYYGEY N+GAGA T
Sbjct  413  QNSFKTYLGRPWKEYSRTVFMKTALDNLIDPSGWLQWSGNFALRTLYYGEYMNSGAGAVT  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             +RVKW+G+HV+ SA+EA+KFTVG+FI+GGSW+P T +P+TSGL
Sbjct  473  KSRVKWSGFHVM-SASEAAKFTVGSFISGGSWIPNTGLPYTSGL  515



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   416 bits (1068),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK G+YKEN+EI   +KN+M VGDGI  TI+TGS++   G+TTF+SAT AV G G
Sbjct  246  RLVIYVKKGIYKENIEIKKSMKNLMFVGDGIDATIVTGSKNAKDGSTTFRSATFAVSGQG  305

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  306  FIAKGMTFENTAGPQKHQAVALRSGSDFSVFYGCSFKGYQDTLYVYSQRQFYRDCDIYGT  365

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P N + NT+TAQGR DPN+NTGI IHN  V A SD++  
Sbjct  366  IDFIFGDAVAVLQNCNIYVRRPMNGQKNTVTAQGRKDPNENTGIVIHNSNVMATSDMRPV  425

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRT+FMK++LD LIDPAGWLPW GNFAL+TLYYGEY NTG+GAST
Sbjct  426  QGSFKTYLGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFALSTLYYGEYMNTGSGAST  485

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RV W GYHVIT AT+A KFTVGNF+AG SW+P T VPF SGL
Sbjct  486  ARRVNWPGYHVITKATDAGKFTVGNFLAGDSWIPGTGVPFDSGL  529



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 244/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN++I  KLKN+ L+GDG+  TIITGSRSV GG+TTF SATVAV G+G
Sbjct  238  RFVIHVKRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY CSFEGYQDTLY +S RQFY++C +YGT
Sbjct  296  FIARGITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D K S
Sbjct  356  VDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSS  415

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +GSVKT+LGRPW++YSRTVFM++ LD+L+DPAGWL W GNFAL TLYYGEY N G GA T
Sbjct  416  VGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPT  475

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITS++EASKFTV NFIAG SWLPATNVPFT+GL
Sbjct  476  SRRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 243/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVY+EN+EIGSK+KNIML+GDG+  T ITG+RSVGGG+TTF SATVAV G+G
Sbjct  288  RFVIQVKRGVYRENLEIGSKMKNIMLIGDGMRFTFITGNRSVGGGSTTFNSATVAVTGEG  347

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF+NTAG  NHQAVALRSG+DLSVFY+C+FEGYQDTLYV+S RQFY+EC IYGT
Sbjct  348  FIARGITFQNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGT  407

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P N + N +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  408  VDFIFGNAAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  467

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +VKTYLGRPW++YSRTVFMKT +DSL+DP GWL WDG+FALNTLYYGEY+N G G+  
Sbjct  468  ESTVKTYLGRPWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALNTLYYGEYNNIGPGSPI  527

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVI+++TEAS+FTV NFIAG SWLP T VPFT GL
Sbjct  528  SQRVKWKGYHVISNSTEASEFTVQNFIAGQSWLPNTEVPFTPGL  571



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   415 bits (1066),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 244/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN++I  KLKN+ L+GDG+  TIITGSRSV GG+TTF SATVAV G+G
Sbjct  238  RFVIHVKRGVYKENLDI--KLKNVFLLGDGLRYTIITGSRSVVGGSTTFNSATVAVTGEG  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY CSFEGYQDTLY +S RQFY++C +YGT
Sbjct  296  FIARGITFRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D K S
Sbjct  356  VDFIFGNAAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSS  415

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +GSVKT+LGRPW++YSRTVFM++ LD+L+DPAGWL W GNFAL TLYYGEY N G GA T
Sbjct  416  VGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPT  475

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITS++EASKFTV NFIAG SWLPATNVPFT+GL
Sbjct  476  SGRVKWGGYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 215/283 (76%), Positives = 237/283 (84%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VKAG Y E++ IGS   N+MLVGDGIG T+ITGS SVGGG+TTF SATVAVVGDG
Sbjct  237  RFVIQVKAGTYAEHLHIGSP--NLMLVGDGIGNTVITGSMSVGGGSTTFNSATVAVVGDG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITFRNTAG    QAVALRSGSDLSVFY+CSFEGYQDTLYV+S+RQFYREC IYGT
Sbjct  295  FIARDITFRNTAGPGKGQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECAIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAAVV QNCNI++R P N   T+TAQGR DPNQNTGI IH  ++TAASDLK   
Sbjct  355  VDFIFGNAAVVLQNCNIFSRKPINGVVTVTAQGRIDPNQNTGIVIHTSQITAASDLKPVQ  414

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SVK YLGRPW+QYSRTV +K+ LD+LI P GWL W G+F LNTLYYGEY NTG G+STA
Sbjct  415  SSVKAYLGRPWRQYSRTVILKSFLDNLIQPVGWLEWSGSFGLNTLYYGEYQNTGPGSSTA  474

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GY VITS  EASKFTVGNFIAG SWLPA+NVPFTSGL
Sbjct  475  NRVKWGGYRVITSVAEASKFTVGNFIAGSSWLPASNVPFTSGL  517



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   415 bits (1066),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 237/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKE VEI + + N+ML+GDGI  TI+TG+++   G+TTF+SAT AV G+G
Sbjct  260  RFVIYVKKGVYKEYVEIKNSMNNLMLIGDGIDATIVTGNKNNQDGSTTFRSATFAVSGEG  319

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  320  FIAKDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGT  379

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNA VVFQNCNIY R P + + NT+TAQ R+DPN+NTGI IHN +VTAASDL+  
Sbjct  380  VDFIFGNAVVVFQNCNIYVRKPMSGQKNTVTAQARTDPNENTGIIIHNSRVTAASDLRPV  439

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPWQ+YSRTV +K++LD LIDPAGWLPW GNFAL+TLYY EY N+G+GAST
Sbjct  440  QGSFKSYLGRPWQEYSRTVILKSNLDGLIDPAGWLPWSGNFALSTLYYAEYMNSGSGAST  499

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             +RVKW GYHVIT  T+A KFTVGNF+AG SW+PAT VPF SGL
Sbjct  500  GDRVKWPGYHVITKVTDAGKFTVGNFLAGDSWIPATGVPFDSGL  543



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   414 bits (1064),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 240/284 (85%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGSR+V  G+TTF+SATVAV G G
Sbjct  249  RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGG  306

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSDLSVFY+CS +GYQDTLYVYS RQFYR+CDIYGT
Sbjct  307  FIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGT  366

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VTAASDL+  
Sbjct  367  VDFIFGDAVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAV  426

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLIDPAGWL W G+FAL+TLYYGEY NTGAGAST
Sbjct  427  QGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEYMNTGAGAST  486

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKWAGYHV+ SA +A KFTVG+F+ GGSW+ +  VPFTSGL
Sbjct  487  GGRVKWAGYHVM-SAADAGKFTVGSFLGGGSWIGSAGVPFTSGL  529



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   413 bits (1061),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 243/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTFKSATVAV G+G
Sbjct  237  RFVIHVKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGT
Sbjct  295  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D + S
Sbjct  355  VDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESS  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +GSVKT+LGRPW++YSRTVFM++ LD+L+DPAGWL W G+FAL TLYYGEY N G GA T
Sbjct  415  VGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPT  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY +ITS++EASKFTV NFIAG SWLPATNV F +GL
Sbjct  475  TGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   413 bits (1061),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 243/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EI  KLKNI L+GDG+  TIITGSRSV GG+TTFKSATVAV G+G
Sbjct  237  RFVIHVKRGVYKENLEI--KLKNIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGT
Sbjct  295  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA D + S
Sbjct  355  VDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESS  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +GSVKT+LGRPW++YSRTVFM++ LD+L+DPAGWL W G+FAL TLYYGEY N G GA T
Sbjct  415  VGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPT  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY +ITS++EASKFTV NFIAG SWLPATNV F +GL
Sbjct  475  TGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 244/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY ENV  G+ +KN+M++GDGI  T++TGS++V  G+TTF SAT AV GDG
Sbjct  234  RFVIHVKAGVYNENV--GTSIKNLMIIGDGIDATVVTGSKNVQDGSTTFSSATFAVTGDG  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TF+NTAG   +QAVA RS SDLS +YQCSFEGYQDTLYVYS RQFYR+C+IYGT
Sbjct  292  FIARGMTFQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTLYVYSQRQFYRDCNIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+AAVVFQNC++Y R P + + NT+TAQGR+DPN+NTGISIH+  VTAASDLK  
Sbjct  352  VDFIFGDAAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPV  411

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSRTV+MKTSLDSLIDPAGWL W+G+FAL+TLYYGEY NTGAGA T
Sbjct  412  QGSFQTYLGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGAGADT  471

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GYHVITSA  AS+FTVGNF++GGSW+PAT VP+TS L
Sbjct  472  SRRVNWPGYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTSDL  515



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 243/284 (86%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VK GVYKEN+EI  KLK I L+GDG+  TIITGSRSV GG+TTFKSATVAV G+G
Sbjct  237  RFVIHVKRGVYKENLEI--KLKXIYLLGDGLRYTIITGSRSVVGGSTTFKSATVAVTGEG  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVFY+C FEGYQDTLY +S RQFYREC +YGT
Sbjct  295  FIARGITFRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNC IYAR P + + NTITAQGR+DPNQNTGISIH+ +V AA DL+ S
Sbjct  355  VDFIFGNAAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDLESS  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            +GSVKT+LGRPW++YSRTVFM++ LD+L+DPAGWL W G+FAL TLYYGEY N G GA T
Sbjct  415  VGSVKTFLGRPWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFALKTLYYGEYKNIGPGAPT  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY +ITS++EASKFTV NFIAG SWLPATN PFT+ L
Sbjct  475  TGRVKWGGYRIITSSSEASKFTVDNFIAGSSWLPATNXPFTAXL  518



>ref|XP_009142324.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 215/283 (76%), Positives = 244/283 (86%), Gaps = 3/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY EN+EI  +  N+ML GDG G+TIITGSRSV GG+TTFKSATVA VGDG
Sbjct  231  RFVIYVKQGVYSENLEI--QKDNVMLRGDGKGRTIITGSRSVRGGSTTFKSATVAAVGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAGA N QAVALRSGSDLSVFYQCSFEGYQDTLYV+S+RQFY +C++YGT
Sbjct  289  FIARGITFRNTAGANNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYSDCNVYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA +FQNCNI+AR PP +TNTITAQGRS  +QNTGI IHN +VTAASDL+  L
Sbjct  349  VDFIFGNAAAIFQNCNIFARRPPGRTNTITAQGRSYQDQNTGIIIHNSRVTAASDLRPVL  408

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS KTYLGRPW+QYSRTVFMKTSLDSLIDP GWL W+GNF L TL+YGE+ NTG GAST+
Sbjct  409  GSTKTYLGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFGLTTLFYGEFHNTGPGASTS  468

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV W G+ VI SATEA +FTV +FIAG SW+P+  VPFTSGL
Sbjct  469  SRVTWPGFRVIRSATEALQFTVDSFIAGSSWIPSY-VPFTSGL  510



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 235/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI++KAG Y ENVE+G   KN+M +GDGIGKT+I  SR+V  G+TTF+SATVAVVG+ 
Sbjct  143  RYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNN  202

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  203  FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT  262

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGN+AVVFQ+CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AASDL   
Sbjct  263  IDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAV  322

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVFM++ LDS+++PAGWL W GNFAL+TLYYGEY NTG GAST
Sbjct  323  QSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGAST  382

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +NRVKW GY VITSA+EAS FTVGNFI G  WL  T+VPFT GL
Sbjct  383  SNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  426



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/284 (73%), Positives = 240/284 (85%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVY+ENVEI +   NIML+GDGI  T +TGS++V  G+TTF++ATVAV GDG
Sbjct  249  RFVIYVKRGVYRENVEITAS--NIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDG  306

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAV+LRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  307  FIARDMTFENTAGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  366

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VTAASDL+  
Sbjct  367  VDFIFGDAVAVLQNCNIYVRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTAASDLRPV  426

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSL+DPAGWL W GNFAL+TLYYGEY N G GAST
Sbjct  427  QGSFKTYLGRPWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMNIGGGAST  486

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW G+HV+ SA++A KFTV NF+ GGSW+ AT VPFTSGL
Sbjct  487  SRRVKWPGFHVM-SASDAGKFTVENFLGGGSWIAATGVPFTSGL  529



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   412 bits (1058),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 240/284 (85%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+TGS++V  G+TTF+SATVAV  D 
Sbjct  251  RFVIYVKRGVYKENVEI--KASNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDR  308

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +TF NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  309  FMARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  368

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VTAASDL+  
Sbjct  369  VDFIFGDAVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNENTGISIHNSRVTAASDLRPL  428

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLIDP GWL W G+FAL+TLYYGEY NTG GAST
Sbjct  429  QGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGVGAST  488

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW G+HV+ SA++A KFTVGNF+ G +W+PAT VPFTSG+
Sbjct  489  SQRVKWPGFHVM-SASDAGKFTVGNFLGGDTWIPATGVPFTSGM  531



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 238/284 (84%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENV++G K  N+M VGDGIGKT+I GSR+V  G+TTF+SATVA+VG+ 
Sbjct  145  RYVIYIKAGAYIENVDVGKKHVNLMFVGDGIGKTVIKGSRNVIDGSTTFRSATVALVGNN  204

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+G+ +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+R+CDIYGT
Sbjct  205  FLGRDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGT  264

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQ+CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AASDL G 
Sbjct  265  IDFIFGNAAVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASDLAGQ  324

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVF+++ LDSLIDPAGWL W+G+FAL+TLYYGEY NTGAGA T
Sbjct  325  ESSTKTYLGRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGT  384

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RVKW GY VITSA EAS FTVG+FI G  WL  T++PFT+GL
Sbjct  385  AGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  428



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   407 bits (1046),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 236/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK G+Y EN+EIG+ +KNIML GDG   TII+GSRSVGGG+TTF SATVAV GDG
Sbjct  159  RFVIYVKRGIYNENIEIGNSMKNIMLYGDGTRLTIISGSRSVGGGSTTFNSATVAVTGDG  218

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALR G+DLSVFY+C+FEGYQDTLYV+S RQFY+EC+IYGT
Sbjct  219  FIARGITFRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGT  278

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQ+CNIYAR P  K  N ITAQGR+DPNQNTGI I N +V AA DL   
Sbjct  279  VDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPV  338

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW++YSRTVF++T LD L+DPAGWL W G+FAL+TLYYGEY N G   ST
Sbjct  339  LSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGST  398

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH ITSATEASKFTV NFIAG SWLPAT +PF  GL
Sbjct  399  RGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATGIPFLFGL  442



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   409 bits (1052),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 235/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI++KAG Y ENVE+G   KN+M +GDGIGKT+I  SR+V  G+TTF+SATVAVVG+ 
Sbjct  282  RYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNN  341

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  342  FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT  401

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGN+AVVFQ+CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AASDL   
Sbjct  402  IDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAV  461

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVFM++ LDS+++PAGWL W GNFAL+TLYYGEY NTG GAST
Sbjct  462  QSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGAST  521

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +NRVKW GY VITSA+EAS FTVGNFI G  WL  T+VPFT GL
Sbjct  522  SNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  565



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   408 bits (1048),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 236/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK G+Y EN+EIG+ +KNIML GDG   TII+GSRSVGGG+TTF SATVAV GDG
Sbjct  243  RFVIYVKRGIYNENIEIGNSMKNIMLYGDGTRLTIISGSRSVGGGSTTFNSATVAVTGDG  302

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALR G+DLSVFY+C+FEGYQDTLYV+S RQFY+EC+IYGT
Sbjct  303  FIARGITFRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGT  362

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQ+CNIYAR P  K  N ITAQGR+DPNQNTGI I N +V AA DL   
Sbjct  363  VDFIFGNAAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPV  422

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW++YSRTVF++T LD L+DPAGWL W G+FAL+TLYYGEY N G   ST
Sbjct  423  LSSFKTFLGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGST  482

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH ITSATEASKFTV NFIAG SWLPAT +PF  GL
Sbjct  483  RGRVKWGGYHAITSATEASKFTVENFIAGKSWLPATGIPFLFGL  526



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 235/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVI++KAG Y ENVE+G   KN+M +GDGIGKT+I  SR+V  G+TTF+SATVAVVG+ 
Sbjct  301  RYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNN  360

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  361  FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT  420

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGN+AVVFQ+CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AASDL   
Sbjct  421  IDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAV  480

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVFM++ LDS+++PAGWL W GNFAL+TLYYGEY NTG GAST
Sbjct  481  QSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGAST  540

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +NRVKW GY VITSA+EAS FTVGNFI G  WL  T+VPFT GL
Sbjct  541  SNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  584



>emb|CDY18942.1| BnaC04g04080D [Brassica napus]
Length=258

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 232/259 (90%), Gaps = 1/259 (0%)
 Frame = -1

Query  910  MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  731
            ML GDG G+TIITGSRSVGGG+TTF SATVA VGDGF+ +GITFRNTAGA+N QAVALRS
Sbjct  1    MLRGDGKGRTIITGSRSVGGGSTTFNSATVAAVGDGFMARGITFRNTAGASNEQAVALRS  60

Query  730  GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  551
            GSDLSVFYQCSFEGYQDTLYV+S+RQFYR+CD+YGTVDFIFGNAA V QNCNI+AR P +
Sbjct  61   GSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAVLQNCNIFARRPRS  120

Query  550  KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSLGSVKTYLGRPWQQYSRTVFMKTSL  371
            KTNTITAQGRSD NQNTGI IHN +VTAASDL+  LGS KTYLGRPW+QYSRTVFMKTSL
Sbjct  121  KTNTITAQGRSDRNQNTGIIIHNSRVTAASDLRPILGSTKTYLGRPWRQYSRTVFMKTSL  180

Query  370  DSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWAGYHVITSATEASKFTVGN  191
            DSLIDP GWL W+GNFAL+TL+Y E+ NTG GAST+ RVKW G+ V+ SA+EAS+FTVG+
Sbjct  181  DSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWPGFRVLRSASEASRFTVGS  240

Query  190  FIAGGSWLPATNVPFTSGL  134
            FIAG SW+P++ VPFTSGL
Sbjct  241  FIAGSSWIPSS-VPFTSGL  258



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   406 bits (1044),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 238/284 (84%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK G Y EN+EIGS L+NIMLVGDG+  TIITG+RSVGGG+TTF SATVAV G G
Sbjct  244  RFVIYVKKGAYIENLEIGSSLQNIMLVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQG  303

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI  GITFRNTAG  NHQAVALRSGSDLSVFY+C FEGYQDTLYV+S RQ Y+EC IYGT
Sbjct  304  FIAMGITFRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGT  363

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNC I+AR P  N+ N +TAQGR+DPNQNTGISIHN ++ A+SDL   
Sbjct  364  VDFIFGNAAVVLQNCMIFARRPMDNQNNVVTAQGRTDPNQNTGISIHNSRIMASSDLVPV  423

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S KT+LGRPW+QYSRTV++ + +D+L+DPAGW+ W GNFAL+TLYYGEY N G G+ST
Sbjct  424  LSSFKTFLGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGSST  483

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRV W GY VIT ++EAS+FTVG FI+G SWLPAT VPF SGL
Sbjct  484  ANRVNWGGYRVITKSSEASQFTVGKFISGDSWLPATGVPFKSGL  527



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   402 bits (1033),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 235/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYKEN++I   +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  133  RVVVHVKAGVYKENIDIKRTVKNLMIVGDGMGATIVTGNHNAIDGSTTFRSATFAVDGDG  192

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT
Sbjct  193  FIARDITFENTAGPQKHQAVALRSGADHSVFYRCSFRGYQDTLYVYANRQFYRDCDIYGT  252

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK  
Sbjct  253  VDFIFGDAVAVLQNCNIYVRKPMSNQQNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAV  312

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +T+LGRPWQ+YSRTV MK++LD LI PAGW PW GNFAL+TLYY E++NTGAGAST
Sbjct  313  QGSFRTFLGRPWQKYSRTVVMKSALDGLISPAGWFPWSGNFALSTLYYAEHANTGAGAST  372

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV WAG+ VI+S TEA KFTVGNF+AGGSW+P + VPF  GL
Sbjct  373  GGRVDWAGFRVISS-TEAVKFTVGNFLAGGSWIPGSGVPFDEGL  415



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 235/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENV++G    N+M +GDGIGKT+I  SR+V  G+TTF+SATVAVVG+ 
Sbjct  123  RYVIYIKAGAYMENVDVGKAKTNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNN  182

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS F++CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  183  FLARDLTIENSAGPSKHQAVALRVGADLSAFHRCSFVGYQDTLYVHSLRQFFRECDIYGT  242

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGN+AVVFQ+CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AASDL   
Sbjct  243  VDFIFGNSAVVFQSCNLYARRPLPNQSNAYTAQGREDPNQNTGISIQKCKVAAASDLAAV  302

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVFM++ LDS+++PAGWL W+GNFAL+TLYYGEY NTG GAST
Sbjct  303  QSSFKTYLGRPWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGDGAST  362

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VITS++EAS FTVG+FI G  WL  T+VPF+ GL
Sbjct  363  ANRVKWKGYRVITSSSEASTFTVGSFIDGDVWLAGTSVPFSVGL  406



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   406 bits (1043),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENVE+G K  N+M VGDGIGKT+I  SR+V  G TTF+SATVAVVG+ 
Sbjct  293  RYVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNN  352

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+R+CDIYGT
Sbjct  353  FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGT  412

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DF+FGNAAVV Q CN+YAR P PN++N  TAQGR DPNQNTGISIH CKV AA+DL  S
Sbjct  413  IDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNTGISIHRCKVAAAADLLQS  472

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVF+++ LDSLI PAGWL WDGNFAL+TLYYGEY NTG GA T
Sbjct  473  SSSTKTYLGRPWKQYSRTVFLQSELDSLIAPAGWLEWDGNFALDTLYYGEYMNTGPGAGT  532

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EAS FTVG+FI G  WL  T++PFT+GL
Sbjct  533  SGRVKWKGYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  576



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   404 bits (1037),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 238/284 (84%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK+G+Y ENV I + +KNIM++GDG+  T++TGS++V  G+TTF+SAT AV G G
Sbjct  239  RFVILVKSGIYNENVVITNSMKNIMMIGDGMDATVVTGSKNVQDGSTTFRSATFAVSGGG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF+NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  299  FIARDMTFQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A VVFQ+CNIY R P + + NT+TAQGR+D N+NTGISIHN  VTAASDL+  
Sbjct  359  VDFIFGDAVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTGISIHNSIVTAASDLRPV  418

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLI+PAGWL W G+F L+TLYY EY NTGAGA T
Sbjct  419  QGSFKTYLGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGADT  478

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GYHVI S++EASKFTVG F++G SW+PAT VPF+ GL
Sbjct  479  SKRVNWPGYHVIASSSEASKFTVGGFLSGDSWIPATGVPFSFGL  522



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   404 bits (1037),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 233/284 (82%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI  K  NIML+GDGI  TI+T S++   G+TTF++ATV V GDG
Sbjct  246  RFVIYVKKGVYKENVEI--KASNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDG  303

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +TF NTAG   HQAVALRSGSDLSVFY CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  304  FMARDMTFENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGT  363

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN +VTAASDL+  
Sbjct  364  VDFIFGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAV  423

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSL+D AGWL W G FAL++LYYGEY NTG GAST
Sbjct  424  QGSFKTYLGRPWQKYSRTVFMKTSLDSLVDRAGWLEWSGKFALSSLYYGEYMNTGPGAST  483

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W G+HV+ SA +A KFTVG+F+ GGSW+ A  VPFT GL
Sbjct  484  SGRVNWEGFHVM-SADDAGKFTVGSFLGGGSWIAAAGVPFTPGL  526



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 242/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVYKENV I  K+KN+MLVGDG+  TIITGSRSVGGG+TTF SATVAV G+ 
Sbjct  150  RFVIRVKKGVYKENVVI--KVKNLMLVGDGLKYTIITGSRSVGGGSTTFNSATVAVTGER  207

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVF++C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  208  FIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGT  267

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGN+AVV QNC IYAR P   +   +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  268  VDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  327

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            + SV+TYLGRPW++YSRTV++++ +DSL++PAGWL W GNFALNTLYYGE+ N+G G+ST
Sbjct  328  IKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGLGSST  387

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VITSA+EA+KFTVG+FI+G SWLP T VPFT+GL
Sbjct  388  ANRVKWKGYRVITSASEAAKFTVGSFISGNSWLPGTGVPFTAGL  431



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   403 bits (1035),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI   +KN+M VGDGI  T+IT +++   GTTTF+SATV V G G
Sbjct  248  RFVIYVKGGVYKENVEIKKSMKNLMFVGDGIDATVITSNKNTQDGTTTFRSATVGVSGKG  307

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYV+S RQFYR+CDIYGT
Sbjct  308  FIARDITFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQRQFYRDCDIYGT  367

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P +K TNT+TAQGR+DP++NTGI IHN +V AA DL+  
Sbjct  368  VDFIFGDAVAVLQNCNIYVRRPMSKQTNTVTAQGRTDPDENTGIVIHNSRVMAAPDLRPV  427

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPW++YSRTVF+K+++D LIDPAGWLPW G+FAL+TLYYGEY +TG+GAST
Sbjct  428  QGSFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYYGEYMSTGSGAST  487

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH ITS  EA KFTV NF+AG SW+ A  VPF SGL
Sbjct  488  KGRVKWPGYHTITSPLEAGKFTVENFLAGNSWISAAGVPFESGL  531



>ref|XP_003530788.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=526

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 235/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYKEN++I   +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  244  RVVVHVKAGVYKENIDIKRTVKNLMIVGDGMGATIVTGNHNAIDGSTTFRSATFAVDGDG  303

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT
Sbjct  304  FIARDITFENTAGPQKHQAVALRSGADHSVFYRCSFRGYQDTLYVYANRQFYRDCDIYGT  363

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK  
Sbjct  364  VDFIFGDAVAVLQNCNIYVRKPMSNQQNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAV  423

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +T+LGRPWQ+YSRTV MK++LD LI PAGW PW GNFAL+TLYY E++NTGAGAST
Sbjct  424  QGSFRTFLGRPWQKYSRTVVMKSALDGLISPAGWFPWSGNFALSTLYYAEHANTGAGAST  483

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV WAG+ VI+S TEA KFTVGNF+AGGSW+P + VPF  GL
Sbjct  484  GGRVDWAGFRVISS-TEAVKFTVGNFLAGGSWIPGSGVPFDEGL  526



>ref|XP_010277646.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=521

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/283 (72%), Positives = 240/283 (85%), Gaps = 2/283 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+V+++KAG+Y+E++++ +   N+M  GDGIGKT+ITGS SVGGG TTF SAT+AV+GDG
Sbjct  241  RHVVHMKAGIYQEHMQVYTP--NMMFTGDGIGKTVITGSMSVGGGATTFNSATIAVMGDG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  NHQAVALRSGSD SVFY+CSFEGYQDTLYV+S+RQFY++CDIYGT
Sbjct  299  FIARDITFQNTAGPQNHQAVALRSGSDASVFYRCSFEGYQDTLYVHSNRQFYKQCDIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            VDFIFGNAA V Q+CNIYAR P   T  +TAQGR + NQ+TGI IHN ++TAA DLK   
Sbjct  359  VDFIFGNAAAVLQDCNIYARKPIAGTVVVTAQGRLNANQSTGIVIHNSRITAAPDLKPVQ  418

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             SV+TYLGRPWQ YSRTV +KT LDSLI+PAGW+ W+G FALNTLYYGE+ NTG G+STA
Sbjct  419  RSVETYLGRPWQLYSRTVILKTFLDSLINPAGWMEWNGTFALNTLYYGEFQNTGPGSSTA  478

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRVKW GYHVITSA EAS+FTVGNFI G SWLP TNVPFTSGL
Sbjct  479  NRVKWGGYHVITSAAEASQFTVGNFIDGNSWLPDTNVPFTSGL  521



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 242/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI VK GVYKENV I  K+KN+MLVGDG+  TIITGSRSVGGG+TTF SATVAV G+ 
Sbjct  239  RFVIRVKKGVYKENVVI--KVKNLMLVGDGLKYTIITGSRSVGGGSTTFNSATVAVTGER  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVF++C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  297  FIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGN+AVV QNC IYAR P   +   +TAQGR+DPNQNTGISIHN +V A  DLK  
Sbjct  357  VDFIFGNSAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPV  416

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            + SV+TYLGRPW++YSRTV++++ +DSL++PAGWL W GNFALNTLYYGE+ N+G G+ST
Sbjct  417  IKSVRTYLGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGPGSST  476

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VITSA+EA+KFTVG+FIAG SWLP T VPFT+GL
Sbjct  477  ANRVKWKGYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL  520



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   403 bits (1036),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 227/280 (81%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y E +++  K   IM VGDGIGKT I G+R+V  G TTF+SATVAVVG+G
Sbjct  274  RFVIYIKAGTYFEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRSGSDLS FYQCSF  YQDTLYV+S RQFYRECD+YGT
Sbjct  334  FIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  394  VDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVAAASDLVPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S K YLGRPW+QYSRTVF+++++ SLIDPAGWL WDGNFALNTLYYGEY N G G+ T
Sbjct  454  LSSFKNYLGRPWKQYSRTVFLRSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNNGPGSIT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RVKW GY VI S+ EAS+FTVGNFI G  WLPAT  PF
Sbjct  514  SARVKWPGYRVINSSAEASQFTVGNFIQGSQWLPATGFPF  553



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 235/284 (83%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IYVK GVYKENVEI  +  NIML+GDGI  TI++ SR+V  G+TTF+SATVAV G G
Sbjct  246  RFIIYVKRGVYKENVEI--RASNIMLIGDGIDATIVSSSRNVQQGSTTFRSATVAVSGGG  303

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF N+AG  NHQAVALRSGSDLSV Y CSF+GYQDTLYV+S RQFYR+CDIYGT
Sbjct  304  FIARDMTFENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLYVHSQRQFYRDCDIYGT  363

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
             DFI GNAA VFQNCNIY R P   + NT+TAQ R+DPNQNTGISIHN +VTAASDL+  
Sbjct  364  QDFICGNAAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGISIHNSRVTAASDLRAV  423

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLIDPAGWL W G+FAL+TLYYGE+ N+GAGAST
Sbjct  424  QGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEFMNSGAGAST  483

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY V++S  EA +FTVG+F+ GGSW+ A  VPFTSGL
Sbjct  484  SGRVTWPGYRVMSS-EEAGEFTVGSFLGGGSWIAAAGVPFTSGL  526



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   402 bits (1034),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 237/284 (83%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENVE+G   KN+M +GDGIGKT+I  SR+V  G TTF+SATVAVVG+ 
Sbjct  278  RYVIYIKAGAYLENVEVGKNQKNLMFIGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNN  337

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+R+CD+YGT
Sbjct  338  FIARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGT  397

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDF+FGN+AVV Q C++YAR P   ++NT TAQGR+DPNQNTGIS+  CKV+AASDL   
Sbjct  398  VDFVFGNSAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNTGISVQRCKVSAASDLAAV  457

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +TYLGRPWQQYSRTVFM++ +DS+++PAGWL W+GNFAL+TLYYGEY NTGAGA+T
Sbjct  458  QSSFRTYLGRPWQQYSRTVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGAGAAT  517

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +NRVKW GY VITSA+EAS FTVG+FI G  WLP T+VPF++GL
Sbjct  518  SNRVKWKGYRVITSASEASAFTVGSFIDGDVWLPRTSVPFSTGL  561



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   402 bits (1033),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y E +++  K   IM VGDGIGKT I G+R+V  G TTF+SATVAVVG+G
Sbjct  274  RFVIYIKAGTYSEYIDVERKKSMIMFVGDGIGKTQIKGNRNVVDGWTTFRSATVAVVGNG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRSGSDLS FYQCSF  YQDTLYV+S RQFYRECD+YGT
Sbjct  334  FIARGITFENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  394  VDFIFGNAAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVEAASDLVPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S K YLGRPW+QYSRTVF+ +++ SLIDPAGWL WDGNFALNTLYYGEY N G G++T
Sbjct  454  LSSFKNYLGRPWKQYSRTVFLLSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNKGPGSNT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VI S+ EAS+F VGNF+ G  WLPAT  PF  GL
Sbjct  514  NARVKWPGYRVINSSAEASQFNVGNFLQGSQWLPATGFPFFLGL  557



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVYKENVEI   +KNIM +GDGI  TI+TG+R+   G+TT+ SAT  V G+G
Sbjct  237  RFVIHVKAGVYKENVEIKKTMKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVQGEG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QG+TF NTAG   HQAVALRSG+D SVFY+CSF+GYQDTLYVY+ RQFYRECD+YGT
Sbjct  297  FIAQGMTFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYAQRQFYRECDVYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFI G+A  V QNCN+Y R P  N+ NT+TAQ R+D N+NTGI IH+ +VTAA DL+  
Sbjct  357  VDFICGDATAVLQNCNMYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAV  416

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSRTV MK+ LD LIDPAGW PW+GNFAL+TLYYGEY N+GAGA+T
Sbjct  417  QGSFRTYLGRPWQKYSRTVIMKSDLDGLIDPAGWFPWNGNFALSTLYYGEYMNSGAGAAT  476

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VITSA EA KFTVGN +AG SW+PAT VPF++GL
Sbjct  477  GGRVKWPGYRVITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  520



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 240/285 (84%), Gaps = 2/285 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEI-GSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGD  806
            R+VI VK GVY EN+EI GSK+KNIM+VGDGI  TIITG+RSVGGG+TTF+SATV V  +
Sbjct  246  RFVILVKRGVYSENIEIAGSKMKNIMIVGDGIDNTIITGNRSVGGGSTTFESATVIVTAE  305

Query  805  GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  626
            GFI +GIT RNTAG  NHQAVALRSG+DLSVFY+CSFE YQDTLYV+S RQFY+ECDIYG
Sbjct  306  GFIARGITIRNTAGPENHQAVALRSGADLSVFYRCSFEAYQDTLYVHSQRQFYKECDIYG  365

Query  625  TVDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  449
            T+DFIFGNAA V Q+C IYAR P  K  N +TAQGR+DPNQNTGISIHN +V A+ DL  
Sbjct  366  TIDFIFGNAAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLVP  425

Query  448  SLGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAS  269
             LGS +++LGRPW+ YSRTV+M+T +DSLIDP GWL WDG+FAL+TLYYGEY N+G G++
Sbjct  426  VLGSFRSFLGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGSN  485

Query  268  TANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            T  RV W+GY VIT+A+EAS FTV NFIAG SWLPAT VPFT+GL
Sbjct  486  TTRRVNWSGYRVITNASEASTFTVANFIAGQSWLPATGVPFTAGL  530



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   401 bits (1031),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVKAGVYKENVE+   +K +M VGDG+  TI+TG+++   G+TTF+SAT  V G+G
Sbjct  265  RVVIYVKAGVYKENVEVKKTMKKLMFVGDGMDATIVTGNKNAQDGSTTFRSATFGVSGEG  324

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG   HQAVALRSG+D SVFY+CSF+GYQDTLYVYS RQFYR+C+IYGT
Sbjct  325  FIAQDMTFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYSQRQFYRDCNIYGT  384

Query  622  VDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A+ + QNCNIY R P  N+ NT+TAQ R DPN+NTGI IHNC++TAA DL+  
Sbjct  385  VDFIFGDASAILQNCNIYVRKPSSNQINTVTAQSRRDPNENTGIIIHNCRITAAPDLRAV  444

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSR V MK++LD LI+P GW PW G+F L+TLYYGEY NTGAGA+T
Sbjct  445  QGSFRTYLGRPWQKYSRVVIMKSNLDGLIEPQGWFPWSGSFGLDTLYYGEYMNTGAGAAT  504

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+ VITSATEA KFTVGNF+AG +WLP T VPF +GL
Sbjct  505  GGRVKWPGFRVITSATEAGKFTVGNFLAGDAWLPGTGVPFEAGL  548



>gb|EYU24929.1| hypothetical protein MIMGU_mgv1a025888mg, partial [Erythranthe 
guttata]
Length=486

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 235/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVE+   +KN+M +GDGI  T++TGS++V  G+TTF+SAT AV GDG
Sbjct  207  RFVIYVKKGVYKENVEVKRSMKNLMFIGDGIDATVVTGSKNVQDGSTTFRSATFAVTGDG  266

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  267  FIARDMTFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGT  326

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG++  V QN NIY R P  N+ NT+TAQGR DPN+NTGI IHN +VT+AS   GS
Sbjct  327  IDFIFGDSVSVIQNSNIYIRKPMSNQKNTVTAQGRKDPNENTGIVIHNSRVTSAS---GS  383

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             G   +YLGRPWQQYSRTVFMK ++D +I+PAGWLPW G+FAL+TLYYGEY NTG+GAST
Sbjct  384  -GPGPSYLGRPWQQYSRTVFMKCAIDGIIEPAGWLPWSGSFALSTLYYGEYMNTGSGAST  442

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+HVITSA EA KF+VGNF+AGGSW+PAT VP+TSG+
Sbjct  443  GGRVKWPGFHVITSAAEAGKFSVGNFLAGGSWIPATGVPYTSGV  486



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 240/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI +K GVYKENV I  K+KN+MLVGDG+  TIITGSRSVGGG+TTF SATVAV G+ 
Sbjct  238  RFVIRIKKGVYKENVVI--KVKNLMLVGDGLRYTIITGSRSVGGGSTTFNSATVAVTGER  295

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG  NHQAVALRSG+DLSVF++C FEGYQDTLY +S RQFYREC IYGT
Sbjct  296  FIARGITFRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYAHSQRQFYRECYIYGT  355

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVV QNC IYAR P   +   +TAQGR+DPNQNTGISIHN +V AA DLK  
Sbjct  356  IDFIFGNAAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMAADDLKPV  415

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            + SV+TYLGRPW++YSRTV++++ ++SL++PAGWL W GNFALNTLYYGE+ N G G+ST
Sbjct  416  IKSVRTYLGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGPGSST  475

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VITSA EA+KFTVGNFIAG SWLP T VPFT+GL
Sbjct  476  ANRVKWKGYRVITSANEAAKFTVGNFIAGNSWLPGTGVPFTAGL  519



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVYKENVEI   LKNIM +GDGI  TI+TG+R+   G+TT+ SAT  V G+G
Sbjct  189  RFVIHVKAGVYKENVEIKKTLKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVTGEG  248

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QG+TF NTAG   HQAVALRSG+D SVFY+CSF+GYQDTLYVYS RQFYRECD+YGT
Sbjct  249  FIAQGMTFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYSQRQFYRECDVYGT  308

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFI G+A  V QNCN+Y R P  N+ NT+TAQ R+D N+NTGI IH+ +VTAA DL+  
Sbjct  309  IDFICGDATAVLQNCNVYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAV  368

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPW++YSRTV MK+ LD LIDPAGW PW G+FAL+TLYYGEY N+GAG +T
Sbjct  369  QGSFRTYLGRPWKKYSRTVIMKSDLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGGAT  428

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VITSA EA KFTVGN +AG SW+PAT VPF++GL
Sbjct  429  GGRVKWPGYRVITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  472



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 229/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y E +++  K   IM VGDGIGKT+I G+R+V  G TTF+SATVAVVG+G
Sbjct  193  RFVIYIKAGTYFEYIDVERKKSMIMFVGDGIGKTVIKGNRNVVDGWTTFRSATVAVVGNG  252

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITF N AG + HQAVALRSGSDLS FYQCSF  YQDTLYV+S RQFYR CD+YGT
Sbjct  253  FLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRNCDVYGT  312

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  313  VDFIFGNAAVVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISILNCKVEAASDLVPV  372

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S K YLGRPW+QYSRTV + +++ SLIDPAGWL W G+FALNTLYYGEY N G G++T
Sbjct  373  LSSFKNYLGRPWKQYSRTVILFSNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNT  432

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VI S+TEAS+FTVGNFI G  W+PAT VPF SGL
Sbjct  433  SARVKWPGYRVINSSTEASQFTVGNFIQGSEWIPATEVPFYSGL  476



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   397 bits (1021),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V+YVKAGVYKENVEI + +KN+M VGDGI  TI+TG+R+   G+TTF+SAT  V GDG
Sbjct  231  RIVVYVKAGVYKENVEIKNDIKNLMFVGDGIDATIVTGNRNNVDGSTTFQSATFGVSGDG  290

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG A HQAVALRSGSD SVF++CSF+GYQDTLYVYS RQFYR+C++YGT
Sbjct  291  FIAQDMTFENTAGPAKHQAVALRSGSDHSVFHRCSFKGYQDTLYVYSQRQFYRDCNVYGT  350

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFI G+A  + QNCNI  R P  ++ NT+T+Q R+DPN+NTGI IHN ++TA+SDL+  
Sbjct  351  VDFICGDAVAILQNCNILVRKPMSDQRNTVTSQARTDPNENTGIIIHNSRITASSDLRPV  410

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSRTV MK+SLD LIDP GWLPW GNFAL+TLYY E+ N+GAGA+T
Sbjct  411  QGSFETYLGRPWQKYSRTVIMKSSLDGLIDPKGWLPWSGNFALSTLYYAEFMNSGAGAAT  470

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GYHV+TSA EA KFTVGNF+ G SW+PAT VPF +GL
Sbjct  471  GGRVSWPGYHVLTSAAEAGKFTVGNFLGGDSWIPATGVPFAAGL  514



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY+ENVEI   +KNIM +GDGI  TI+TG+++   G+TT++SAT  V G+G
Sbjct  254  RFVIHVKAGVYRENVEIKKTMKNIMFIGDGIDATIVTGNKNSQDGSTTYRSATFGVTGEG  313

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG   HQAVALRS SD SVFY+CSF+GYQDTLYV+S RQFYR+CDI+GT
Sbjct  314  FIAQDMTFENTAGPQKHQAVALRSSSDHSVFYRCSFKGYQDTLYVHSQRQFYRDCDIHGT  373

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFI G+A  V QNCNIYAR P  N+ NTITAQ R+DPN+NTGI IHN ++TAA DL+  
Sbjct  374  VDFICGDATAVLQNCNIYARKPMSNQINTITAQSRTDPNENTGIVIHNSRITAAQDLRPV  433

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPW++YSRTV MK++LD LIDPAGW PW G+FAL+TLYYGEY N+GAGA T
Sbjct  434  QGSFKTYLGRPWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGAGT  493

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VI SATEA KFTVGN +AG SW+P T VPFT+GL
Sbjct  494  GGRVNWPGYRVIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTGL  537



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   387 bits (995),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 204/260 (78%), Positives = 223/260 (86%), Gaps = 1/260 (0%)
 Frame = -1

Query  910  MLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGFIGQGITFRNTAGAANHQAVALRS  731
            MLVGDG+  TIITGSRSVGGG TTF SATVAV G+GFI +GITFRNTAG  NHQAVALRS
Sbjct  1    MLVGDGLRNTIITGSRSVGGGFTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRS  60

Query  730  GSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNPPN  551
            GSDLSVFYQCSFEGYQDTLYV+S RQFY+EC IYGTVDFIFGNAAVV QNC IYAR P +
Sbjct  61   GSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMD  120

Query  550  K-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSLGSVKTYLGRPWQQYSRTVFMKTS  374
            K  N +TAQGR+DPNQNTGISIHN +V AA+DLK  L S KTYLGRPW++YSRTV++ T 
Sbjct  121  KQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTYLGRPWKEYSRTVYLGTY  180

Query  373  LDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTANRVKWAGYHVITSATEASKFTVG  194
            LD+L+D AGWL WDGNFALNTLYYGEY N G G+ST+ RVKW GY VITSATEASKF+V 
Sbjct  181  LDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWRGYRVITSATEASKFSVA  240

Query  193  NFIAGGSWLPATNVPFTSGL  134
            NFIAG SWLPAT VPF SGL
Sbjct  241  NFIAGQSWLPATGVPFRSGL  260



>ref|XP_011038599.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=531

 Score =   396 bits (1017),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 228/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVEI   +KN+M VGDGI  T+IT +++   GTTTF+SATV V G G
Sbjct  248  RFVIYVKRGVYKENVEIKKSMKNLMFVGDGIDATVITSNKNTQDGTTTFRSATVGVSGKG  307

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYV+S RQFYR+CDIYGT
Sbjct  308  FIARDMTFENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQRQFYRDCDIYGT  367

Query  622  VDFIFGNAAVVFQNCNIYARNPPNK-TNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P +K  NT+TAQGR+DP +NTGI IHN +V AASDL+  
Sbjct  368  VDFIFGDAVAVLQNCNIYVRRPMSKQENTVTAQGRTDPGENTGIVIHNSRVMAASDLRPV  427

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             G  K+YLGRPW++YSRTVF+K+++D LIDPAGWLPW G+FAL+TLYYGEY +TG+GAST
Sbjct  428  QGLFKSYLGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYYGEYMSTGSGAST  487

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH ITS  EA KFTV NF+AG SW+ A  VPF +GL
Sbjct  488  KGRVKWPGYHTITSPLEAGKFTVENFLAGNSWISAAGVPFEAGL  531



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   396 bits (1018),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 198/283 (70%), Positives = 231/283 (82%), Gaps = 1/283 (0%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            +VIYVKAGVY ENVE+   +KN+M+VGDGI  TI+TG ++   G+TTF+SAT AV+GDGF
Sbjct  270  FVIYVKAGVYSENVEVKRSMKNLMIVGDGIDATIVTGDKNAQDGSTTFRSATFAVMGDGF  329

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            I + ITF+NTAG   HQAVALRSGSD SVFY CSF+GYQDTLYVY+ RQFYR+CDIYGT 
Sbjct  330  IARDITFQNTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYAQRQFYRDCDIYGTQ  389

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFG+A  V QNCNIY R P + + NT+TAQGRSDPN+NTGI +HN +VTA+SD+K   
Sbjct  390  DFIFGDAVTVLQNCNIYIRKPISGQINTVTAQGRSDPNENTGIIVHNSRVTASSDMKPVQ  449

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            GS K YLGRPWQ+YSRTVFM+T LDSLI P GW PW G+FAL+TLYYGEY NTG GA T 
Sbjct  450  GSFKNYLGRPWQKYSRTVFMRTFLDSLIAPQGWYPWSGSFALSTLYYGEYMNTGGGAGTG  509

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W GYH   SATEA+KFTVGNF+AG SWLPAT VPF++GL
Sbjct  510  GRVNWPGYHATMSATEAAKFTVGNFLAGNSWLPATGVPFSAGL  552



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y E +++  K   IM +GDGIGKT+I G+R+V  G TTF+SATVAVVG+G
Sbjct  278  RFVIYIKAGTYFEYIDVERKKSMIMFIGDGIGKTVIKGNRNVVDGWTTFRSATVAVVGNG  337

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITF N AG + HQAVALRSGSDLS FYQCSF  YQDTLYV+S RQFYR+CD+YGT
Sbjct  338  FLARGITFENYAGPSKHQAVALRSGSDLSAFYQCSFIAYQDTLYVHSLRQFYRDCDVYGT  397

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  398  VDFIFGNAAVVLQNCNLYARKPNPNQKNMFTAQGREDPNQNTGISILNCKVEAASDLVPV  457

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            + S K YLGRPW+QYSRTV + +++ SLIDPAGWL W G+FALNTLYYGEY N G G++T
Sbjct  458  VSSFKNYLGRPWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNT  517

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VI S++EAS+FTVGNFI G  W+PAT VPF SGL
Sbjct  518  SARVKWPGYRVINSSSEASQFTVGNFIQGSEWIPATGVPFYSGL  561



>gb|EYU33116.1| hypothetical protein MIMGU_mgv1a022674mg [Erythranthe guttata]
Length=521

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 235/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVE+   +KN+M +GDGI  T++TGS++V  G+TTF+SAT AV GDG
Sbjct  242  RFVIYVKKGVYKENVEVKRSMKNLMFIGDGIDSTVVTGSKNVQDGSTTFRSATFAVTGDG  301

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+CD+YGT
Sbjct  302  FIARDMTFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCDVYGT  361

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QN NIY R P  N+ NT+TAQGR DPN+NTGI IHN +VT+AS     
Sbjct  362  IDFIFGDAVSVIQNSNIYIRKPMSNQKNTVTAQGRKDPNENTGIVIHNSRVTSAS----G  417

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS  +YLGRPWQQYSRTVFMK ++D +I+PAGWLPW G+FAL+TLYYGEY NTG+GAST
Sbjct  418  SGSGPSYLGRPWQQYSRTVFMKCAIDGIIEPAGWLPWSGSFALSTLYYGEYMNTGSGAST  477

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+HVITSA EA KF+VGNF+AGGSW+PAT VP+TSG+
Sbjct  478  GGRVKWPGFHVITSAAEAGKFSVGNFLAGGSWIPATGVPYTSGV  521



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 231/284 (81%), Gaps = 4/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKE VEI  K  NIML+GDGI  T++TGS+S+    T+F+SATV + G+G
Sbjct  252  RFVIYVKRGVYKETVEI--KAPNIMLIGDGIDVTVVTGSKSIQDAGTSFRSATVGITGNG  309

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSDLSVFY+CSF+GYQDTLYV+S+RQFYR CDIYGT
Sbjct  310  FIARDMTFENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVHSNRQFYRNCDIYGT  369

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFI+G+A  V QNCNIY R P + + NT+TAQGR+DPN+NTGISIHN  VTA SDLK  
Sbjct  370  VDFIWGDAVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSLVTATSDLKAV  429

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPWQ+YSRTVFMKTSLDSLIDP GWL W GNFAL+TLYYGE+ NTG GAST
Sbjct  430  QGSFKTYLGRPWQKYSRTVFMKTSLDSLIDPEGWLEWSGNFALSTLYYGEFLNTGPGAST  489

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKWAG+HV+  A +A KFTV +F+ G SW+ A  VPFT GL
Sbjct  490  SGRVKWAGFHVMNKA-DAQKFTVESFLGGSSWIAAAGVPFTPGL  532



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAGVY+ENVEI  K+KNIM++GDG   TI+TG+++V  G+TTF+SAT AV G+G
Sbjct  224  RFVIYVKAGVYRENVEIKRKMKNIMIIGDGKDATIVTGNKNVQDGSTTFRSATFAVSGNG  283

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRS SD SVFY CSF+GYQDTLYV++ RQFYR CD+YGT
Sbjct  284  FIARDMTFENTAGPQKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGT  343

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P  N+ N ITAQGRSD N+NTGISIHN +V AA DL+  
Sbjct  344  VDFIFGDAVAVLQNCNIYVRRPMSNQPNVITAQGRSDQNENTGISIHNSRVMAAPDLRPV  403

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
                KTYLGRPW++YSRTVFMKTSLD LI P GW PW G+F L+TLYYGEY NTG+GAST
Sbjct  404  QSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGAST  463

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYHVITSA EA KFTVG F+ G SW+P T VP+ SGL
Sbjct  464  RGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  507



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENVE+G   KN+M +GDG+GKT+I  S +V  G+TTF+SATVAVVG+ 
Sbjct  283  RYVIYIKAGAYMENVEVGKNHKNLMFMGDGMGKTVIKASLNVVDGSTTFRSATVAVVGNN  342

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  343  FLARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT  402

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DF+FGN+A V Q+CN+YAR P PN++N  TAQGR+DPNQNTGISI  CKV AASDL   
Sbjct  403  IDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAV  462

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTVFM++ LDS+++PAGWL WDG FAL+TLYYGEY NTG GA T
Sbjct  463  QSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLAWDGTFALDTLYYGEYQNTGPGAGT  522

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VITSA+EAS FTVG+FI G  WL  T++PF++GL
Sbjct  523  SGRVTWKGYRVITSASEASTFTVGSFIDGDVWLAGTSIPFSAGL  566



>ref|XP_004155863.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=227

 Score =   383 bits (984),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 200/228 (88%), Gaps = 4/228 (2%)
 Frame = -1

Query  817  VVGDGFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYREC  638
            V GDGFI + ITFRNTAGA NHQAVALRSGSDLSVFY+C FEGYQDTLYVY++RQFY++C
Sbjct  4    VDGDGFIARDITFRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQC  63

Query  637  DIYGTVDFIFGNAAVVFQNCNIYARNPPNKTNTITAQGRSDPNQNTGISIHNCKVTAASD  458
            DIYGTVDFIFGNAAVV Q+CNI AR+PPNKT T+TAQGRSDPNQNTGISIHNC++T++  
Sbjct  64   DIYGTVDFIFGNAAVVLQDCNIIARDPPNKTITLTAQGRSDPNQNTGISIHNCRITSSGG  123

Query  457  LKGSLGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGA  278
            L G    VK YLGRPW+QYSRTV MK+S+   I PAGW+PW GNFALNTLYY EY NTG 
Sbjct  124  LSG----VKAYLGRPWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGP  179

Query  277  GASTANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            GASTANRV W GYHVITSA+EASKFTVGNFIAGGSWLP+T VPFTSGL
Sbjct  180  GASTANRVNWKGYHVITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  227



>emb|CDP00815.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 232/284 (82%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK G+YKENV +   +KNIM +GDGI  T++TG+++V  G+TTF+SAT A+ G G
Sbjct  250  RVVIYVKKGIYKENVVV--TMKNIMFIGDGIDATVVTGNKNVQDGSTTFRSATFAITGSG  307

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVY+ RQFYR+CD+YGT
Sbjct  308  FIARDMTFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYAQRQFYRDCDVYGT  367

Query  622  VDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
             DF+FG+A VVFQNCN   R P  N+ NT+TAQ R+DPN+NTGI IHN ++TAASDLK  
Sbjct  368  QDFVFGDAIVVFQNCNFNLRRPLGNQMNTLTAQARTDPNENTGIIIHNSRITAASDLKSV  427

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS+K+YLGRPWQ+YSRTV M TS+D++IDPAGWLPW GNFAL+TLYY EY N+G GA+T
Sbjct  428  QGSIKSYLGRPWQKYSRTVIMTTSIDNVIDPAGWLPWSGNFALSTLYYAEYMNSGPGAAT  487

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+H++TS  EA KF+VGNF+AG SW+P T VPFTSGL
Sbjct  488  GGRVKWGGFHILTSPAEAGKFSVGNFLAGNSWIPGTGVPFTSGL  531



>ref|XP_009351519.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 229/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY+EN+EI   +KNIM +GDGI  TI+TG+++V  G+TT++SAT    GDG
Sbjct  254  RFVIHVKAGVYRENIEIKKTMKNIMFIGDGIDATIVTGNKNVQDGSTTYRSATFGATGDG  313

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  314  FIAQDMTFENTAGPQKHQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  373

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFI G+A VV QNCNIYAR P  N+ NT+TAQ R+DPN+NTGI IHN ++TAA DL+  
Sbjct  374  VDFICGDATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVIHNSRITAAQDLRPV  433

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTY+GRPW+QYSRTV MK++LD LI PAGW PW G+ AL+TLYYGEY N+GAGA T
Sbjct  434  QGSFKTYMGRPWKQYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGT  493

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT A EA KFTVGNF+AG SW+  T VPFT+GL
Sbjct  494  GGRVNWPGYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 226/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAGVY+ENVEI  K+KNIM++GDG   TI+TG+++V  G+TTF+SAT AV G G
Sbjct  251  RFVIYVKAGVYRENVEIKRKMKNIMIIGDGKDATIVTGNKNVQDGSTTFRSATFAVSGHG  310

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRS SD SVFY CSF+GYQDTLYV++ RQFYR CD+YGT
Sbjct  311  FIARDMTFENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGT  370

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P  N+ N ITAQGRSD N+NTGISIHN +V AA DL+  
Sbjct  371  VDFIFGDAVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISIHNSRVMAAPDLRPV  430

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
                KTYLGRPW++YSRTVFMKTSLD LI P GW PW G+F L+TLYYGEY NTG+GAST
Sbjct  431  QSRFKTYLGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGAST  490

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYHVITSA EA KFTVG F+ G SW+P T VP+ SGL
Sbjct  491  RGRVKWRGYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  534



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 234/284 (82%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYK++++I   +KN+M++GDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  239  RVVVHVKAGVYKDSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT
Sbjct  299  FIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P  N+ NT+TAQ R+DPN+NTGI IHNC++TAA DL   
Sbjct  359  IDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAV  418

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KT+LGRPWQ+YSRTV MK++LD LIDPAGW PW GNF L++LYY EY+NTGAGAST
Sbjct  419  QGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGAST  478

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RVKW G+ +I+S +EA KFTVGNF+AGGSW+  + VPF +GL
Sbjct  479  AGRVKWPGFRLISS-SEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 234/284 (82%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYK++++I   +KN+M++GDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  239  RVVVHVKAGVYKDSIDIKRTVKNLMIIGDGMGATIVTGNLNAQDGSTTFRSATFAVSGDG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSG+D SVFY+CSF GYQDTLYVY++RQFYR+CDIYGT
Sbjct  299  FIARDITFENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P  N+ NT+TAQ R+DPN+NTGI IHNC++TAA DL   
Sbjct  359  IDFIFGDAVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAV  418

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KT+LGRPWQ+YSRTV MK++LD LIDPAGW PW GNF L++LYY EY+NTGAGAST
Sbjct  419  QGSFKTFLGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGAST  478

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RVKW G+ +I+S +EA KFTVGNF+AGGSW+  + VPF +GL
Sbjct  479  AGRVKWPGFRLISS-SEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 228/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++KAG Y ENVE+  K  N+M VGDGIGKT++  SR+V  G TTF+SATVAVVGDG
Sbjct  317  RFVIHIKAGAYFENVEVIRKKSNLMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDG  376

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSG+DLS FYQCSF  YQDTLYV+S RQFYRECD+YGT
Sbjct  377  FIAKGITFENSAGPSKHQAVALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGT  436

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAA V QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  437  VDFIFGNAAAVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISIINCKVAAAADLIPV  496

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
                K YLGRPW++YSRTV++ + ++ LIDPAGWL WDGNFAL+TLYYGEY+N G GA+T
Sbjct  497  KSEFKNYLGRPWKKYSRTVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANT  556

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VIT++TEAS+FTV NFI G  WL +  +PF SGL
Sbjct  557  SRRVTWPGYRVITNSTEASQFTVANFIQGNEWLTSLGIPFFSGL  600



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 235/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYKE+++I   +KN+M++GDG+G TI+TGS +   G+TTF+SAT AV GD 
Sbjct  235  RVVVHVKAGVYKESIDIKRTVKNLMIIGDGMGATIVTGSNNAQDGSTTFRSATFAVSGDN  294

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSG+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGT
Sbjct  295  FIARDITFENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGT  354

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  V QNCNIY R P  N+ N++TAQGR+DPN+NTGI IHNC +TAA DLK  
Sbjct  355  VDFIFGDAVSVLQNCNIYVRKPMSNQQNSVTAQGRTDPNENTGIIIHNCVITAAGDLKAV  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRPWQ+YSRTV MK++LD LI+PAGW  W GNFAL+TLYYGEY+NTGAGAST
Sbjct  415  QGSFRTYLGRPWQKYSRTVVMKSALDGLINPAGWSEWSGNFALSTLYYGEYANTGAGAST  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+ V++S ++A KFTVG F+AGGSW+P + VPF +GL
Sbjct  475  GGRVKWGGFRVMSS-SDAVKFTVGEFLAGGSWIPGSGVPFDAGL  517



>ref|XP_011010930.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=516

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 231/284 (81%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G G
Sbjct  237  RFVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  297  FIARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A D    
Sbjct  357  IDFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAED----  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LGS KTYLGRPW++YSRTVF+ T LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST
Sbjct  413  LGSSKTYLGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGAST  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EASKFTV NFI G SWLPAT V F +GL
Sbjct  473  SGRVKWPGYKVITSAEEASKFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 235/284 (83%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY EN++  + +KN+ ++GDGI  TI+TGS++V  G+TTF+SAT AV GDG
Sbjct  234  RFVIHVKAGVYNENID--TSMKNLTIIGDGINATIVTGSKNVKDGSTTFRSATFAVTGDG  291

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +G+TF+NTAG   +QAVA RS SDLSV+YQCSFEGYQDTLYV+S +QFYR C+IYGT
Sbjct  292  FIARGMTFQNTAGPEKYQAVAFRSSSDLSVYYQCSFEGYQDTLYVHSKQQFYRNCNIYGT  351

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A VVFQNCNIY R P   + NT+TAQGR+D   +TGISIH+  VTAA DLK  
Sbjct  352  IDFIFGDATVVFQNCNIYVRKPMTGQKNTVTAQGRTDERTDTGISIHDSVVTAAPDLKPV  411

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +TYLGRPW++YSRTV+MKT LDSLIDPAGWL WDG+FAL TLYYGEY NTGAGA T
Sbjct  412  QSSFQTYLGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGAGADT  471

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GYHVITSA EAS+FTVGNF++G SW+PAT VP+T GL
Sbjct  472  SQRVTWPGYHVITSAAEASQFTVGNFLSGNSWIPATGVPYTPGL  515



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 235/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IYVKAGVY+EN+EIG+ + NIML+GDG+ +T+ITGSRSV  G TTF SATVAV G+ 
Sbjct  245  RFIIYVKAGVYRENIEIGNNMPNIMLIGDGMRRTLITGSRSVRKGYTTFNSATVAVSGER  304

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+  GITFRNTAG  + QAVAL SGSDLSVFY+C F GYQDTLYV+S RQFY++C IYGT
Sbjct  305  FVATGITFRNTAGPLS-QAVALVSGSDLSVFYRCGFIGYQDTLYVHSQRQFYKQCYIYGT  363

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVV QNC I AR P + + N ITAQGRSDP+QNTGISIH  +V A+SDL+  
Sbjct  364  IDFIFGNAAVVLQNCMIVARRPLHGQANVITAQGRSDPHQNTGISIHKSRVIASSDLRPV  423

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L SVKT+LGRPWQQYSRTV+++T LD L+DPAGWL W G+FALNTLYYGEY N G G+ST
Sbjct  424  LSSVKTFLGRPWQQYSRTVYLQTYLDGLVDPAGWLEWGGSFALNTLYYGEYKNIGPGSST  483

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            A RVKW GY VI + +EAS FTVGNFI+G SWLP T VPFTSGL
Sbjct  484  ARRVKWRGYRVIRNPSEASLFTVGNFISGRSWLPGTGVPFTSGL  527



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENV++    KN+M +GDGIGKT++  SR+V  G TTF+SATVAVVGDG
Sbjct  274  RFVIYIKAGAYFENVDVAKNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + IT  N+AG + HQAVALR G+DLS FY+CSF  YQDTLYV+S RQFYR+CD+YGT
Sbjct  334  FLARDITIENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV Q+CN+YAR P PN+ N  TAQGR DPNQNTGISI  CKV AASDL   
Sbjct  394  VDFIFGNAAVVLQSCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW+QYSRTVFM++ L SLIDPAGWL WDG+FAL+TLYYGEY N G G++T
Sbjct  454  QSNFSTYLGRPWKQYSRTVFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VITSA EAS FTV +FI G  WL AT+VPFTSGL
Sbjct  514  SRRVTWPGYRVITSAAEASNFTVASFIQGDQWLGATSVPFTSGL  557



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 230/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+ SK  N+M +GDGIGKT++  SR+V  G TTF+SATVAVVG G
Sbjct  283  RFVIYIKAGAYFENVEVVSKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGG  342

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  343  FIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGT  402

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P + + N  TAQGR DPNQNTGISI NCKVTAASDL   
Sbjct  403  VDFIFGNAAVVFQNCNLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPV  462

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              + KTYLGRPW++YSRTV++++++D  +DPAGWL W+G FAL+TLYYGEY N G G+ T
Sbjct  463  KSTFKTYLGRPWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGT  522

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VI ++TEAS+FTVG FI G  WL +T +P+ +GL
Sbjct  523  TARVTWPGYRVINNSTEASQFTVGAFIQGNEWLNSTGIPYFAGL  566



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   392 bits (1007),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 228/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+  K K +M VGDGIGKT++  +R+V  G TTF+SATVAVVG+G
Sbjct  276  RFVIYIKAGSYFENVEVVKKKKMLMFVGDGIGKTVVKANRNVVDGFTTFRSATVAVVGEG  335

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FY+CSF  YQDTLYV+S RQFYRECDIYGT
Sbjct  336  FIAKGITFENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGT  395

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQ+CN+YAR P PN+ N  TAQGR DPNQNTGISI NCK+ AA+DL   
Sbjct  396  VDFIFGNAAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPV  455

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTV M++ +D  +DPAGWL W+G FAL+TLYYGEY N G G+ST
Sbjct  456  KSSFKTYLGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSST  515

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VI S+TEA++FT+  FI G  WL ++N+PF  GL
Sbjct  516  SARVTWPGYRVINSSTEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_011010924.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=516

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 231/284 (81%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G G
Sbjct  237  RFVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  297  FIARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A D    
Sbjct  357  IDFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAED----  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LGS KTYLGRPW++YSRTVF+ T LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST
Sbjct  413  LGSSKTYLGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGAST  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  473  SGRVKWPGYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_011010925.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=518

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 231/284 (81%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++S+GGG  TF +ATV V G G
Sbjct  239  RFVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKSLGGGVDTFHTATVGVDGQG  298

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  299  FIARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGT  358

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V +A D    
Sbjct  359  IDFIFGDAAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAED----  414

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LGS KTYLGRPW++YSRTVF+ T LDSL+DPAGWL WDGNFALNTLYYGEY NTG GAST
Sbjct  415  LGSSKTYLGRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGAST  474

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  475  SGRVKWPGYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  518



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 225/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IYVKAG+YKENV I +K+KN+ML+GDGI  TI+T +++V  G+TTF+SAT A+ GDG
Sbjct  254  RFIIYVKAGIYKENVVITNKMKNLMLIGDGIDATIVTCNKNVQDGSTTFRSATFAISGDG  313

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSGSD S+FY+CSF+GYQDTLYVYS RQFY+ECDIYGT
Sbjct  314  FIAKDITFENTAGPQKHQAVALRSGSDYSIFYRCSFKGYQDTLYVYSKRQFYKECDIYGT  373

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAA + Q+CNIY R P N + NTITAQGRSDPN+NTGI IH+  + AA DLK  
Sbjct  374  IDFIFGNAAAILQSCNIYVRKPMNNQMNTITAQGRSDPNENTGIVIHDSIIKAAQDLKPV  433

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +T+LGRPW+ YSRT+ MK+ +D L+D AGW PW G+FAL TLYYGEY N G GA T
Sbjct  434  QGSFQTFLGRPWRMYSRTMIMKSHIDGLVDIAGWAPWSGDFALKTLYYGEYMNYGPGADT  493

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH I S  +A KFTV NF+ G  W+P T VPFTSGL
Sbjct  494  HGRVKWPGYHAIKSPVDAEKFTVRNFLTGDEWIPGTGVPFTSGL  537



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENV++G K   +M VGDGIGKT++  SR+V  G TTF+SATVAVVG+G
Sbjct  299  RFVIYIKAGTYFENVDVGKKKTMLMFVGDGIGKTVVKASRNVVDGWTTFRSATVAVVGNG  358

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +T  N AG + HQAVALRSGSDLS FY+CSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  359  FIARDMTIENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRECDIYGT  418

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKVT A+DL   
Sbjct  419  VDFIFGNAAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNTGISILNCKVTLAADLSPV  478

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S  TYLGRPW++YSRTVF+ + LD LI+PAGWL W GNF L+TLYYGEY N G G+ T
Sbjct  479  KSSFHTYLGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYMNKGPGSDT  538

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             NRVKW GY VI S+TEA++FTV +FI GG WL +T +P+++GL
Sbjct  539  TNRVKWPGYRVINSSTEATQFTVASFIQGGGWLSSTGIPYSAGL  582



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   391 bits (1004),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 226/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+G Y ENVE+  K  N+M +GDGIGKT++  SR+V  G TTF+SATVAVVGDG
Sbjct  277  RFVIYIKSGAYFENVEVVRKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDG  336

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITF N AG + HQAVA RSGSD S FY+CSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  337  FIAQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGT  396

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  397  VDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNCKVAAASDLVPV  456

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              + KTYLGRPW++YSRTV+MK+ +D L+ PAGWL W+G FAL+TLYYGEY N G G++T
Sbjct  457  KSTFKTYLGRPWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNT  516

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VI S+ EA++FTVG FI G  WL +TN+P+  GL
Sbjct  517  SARVKWPGYRVINSSDEANQFTVGPFIQGNEWLNSTNIPYFIGL  560



>gb|KHN21590.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=527

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 237/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYKEN++I   +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  245  RVVVHVKAGVYKENIDIKRTVKNLMIVGDGMGATIVTGNLNAQDGSTTFRSATFAVDGDG  304

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVA+RSG+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGT
Sbjct  305  FIARDITFENTAGPQKHQAVAVRSGADQSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGT  364

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK  
Sbjct  365  IDFIFGDAVTVLQNCNIYVRKPMSNQLNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAV  424

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +T+LGRPWQ+YSRTVFMK++LDSLI PAGW PW GNFAL+TLYY EY NTGAGA T
Sbjct  425  QGSFRTFLGRPWQKYSRTVFMKSALDSLISPAGWFPWSGNFALSTLYYAEYGNTGAGAGT  484

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+ VI+S TEA KFTVG+F+AGGSW+P + VPF +GL
Sbjct  485  GGRVKWEGFRVISS-TEAVKFTVGSFLAGGSWIPGSGVPFDAGL  527



>ref|XP_006580437.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
isoform X1 [Glycine max]
Length=527

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 237/284 (83%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V++VKAGVYKEN++I   +KN+M+VGDG+G TI+TG+ +   G+TTF+SAT AV GDG
Sbjct  245  RVVVHVKAGVYKENIDIKRTVKNLMIVGDGMGATIVTGNLNAQDGSTTFRSATFAVDGDG  304

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVA+RSG+D SVFY+CSF+GYQDTLYVY++RQFYR+CDIYGT
Sbjct  305  FIARDITFENTAGPQKHQAVAVRSGADQSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGT  364

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P  N+ NT+TAQGR+DPN+NTGI IHNC++TAA DLK  
Sbjct  365  IDFIFGDAVTVLQNCNIYVRKPMSNQLNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAV  424

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +T+LGRPWQ+YSRTVFMK++LDSLI PAGW PW GNFAL+TLYY EY NTGAGA T
Sbjct  425  QGSFRTFLGRPWQKYSRTVFMKSALDSLISPAGWFPWSGNFALSTLYYAEYGNTGAGAGT  484

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+ VI+S TEA KFTVG+F+AGGSW+P + VPF +GL
Sbjct  485  GGRVKWEGFRVISS-TEAVKFTVGSFLAGGSWIPGSGVPFDAGL  527



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 221/285 (78%), Gaps = 2/285 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIG-KtiitgsrsvgggttTFKSATVAVVGD  806
            R++IYVK GVY+ENVEI  K   +M +GDG G   +       G   TTF SATVAV G 
Sbjct  310  RFIIYVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRSVRGSNHTTFHSATVAVTGK  369

Query  805  GFIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYG  626
            GFI + +TF NTAG +NHQAVALR GSD SVFY+CSF+GYQDTLYV+S RQF+R+CDIYG
Sbjct  370  GFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDIYG  429

Query  625  TVDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKG  449
            TVDFIFGNAAVVFQNCN+YAR P  N+    TAQGR DPNQNTGISIHNC+VTA SD+  
Sbjct  430  TVDFIFGNAAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTGISIHNCRVTADSDMAA  489

Query  448  SLGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAS  269
               S KTYLGRPW++YSRTVF+++ LD LI PAGWL W+  FAL+TLYYGEY NTG GA 
Sbjct  490  VKSSFKTYLGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGAG  549

Query  268  TANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            TANRV W GY VITSATEAS+FTV  FI G +WLP+T V ++SGL
Sbjct  550  TANRVNWPGYRVITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 226/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K G Y ENV++G K  N+ML+GDGI KT++  SR+V  G TTF+SAT AVVG  
Sbjct  256  RFVIYIKTGEYLENVDVGEKKTNLMLIGDGIEKTVVKASRNVVDGWTTFRSATFAVVGSN  315

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ++F N+AG + HQAVALRSG+DLS FY+CSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  316  FIARDMSFENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDTLYVHSLRQFYRECDVYGT  375

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV Q+CN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  376  VDFIFGNAAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNTGISIQNCKVAAAADLIPV  435

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K YLGRPW+QYSRT+FM++ +  LIDPAGW  W G+FAL+TLYYGEY N G GA T
Sbjct  436  QSSFKNYLGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGPGADT  495

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +NRVKW GY VI S++EAS+FTV +FI G  WLPA+NV F +GL
Sbjct  496  SNRVKWPGYRVINSSSEASQFTVASFIQGNEWLPASNVAFYAGL  539



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENV++  K   +M +GDGIGKT+I  +RSV  G TTF+SATVAVVG+G
Sbjct  146  RFVIYIKAGAYFENVDVHKKKNMLMFIGDGIGKTVIKANRSVVDGWTTFRSATVAVVGNG  205

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  206  FIAKGITFENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGT  265

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQNCN+YAR P  N+ N +TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  266  IDFIFGNAAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPV  325

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTV++ + +D LIDPAGWL W+G+FAL TLYYGEY N G G++T
Sbjct  326  KSSFKTYLGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNT  385

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VI ++ EAS+F V  FI G  WL AT VPF+ GL
Sbjct  386  SGRVTWPGYRVINNSAEASQFAVEPFIQGSEWLNATGVPFSLGL  429



>ref|XP_009351517.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 229/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI+VKAGVY+EN+EI   +KNIM +GDGI  TI+TG+++V  G+TT++SAT    GDG
Sbjct  254  RFVIHVKAGVYRENIEIKKTMKNIMFIGDGIDATIVTGNKNVPDGSTTYRSATFGATGDG  313

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG   +QAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+CD+YGT
Sbjct  314  FIAQDMTFENTAGPQKYQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCDVYGT  373

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFI G+A VV QNCNIYAR P  N+ NT+TAQ R+DPN+NTGI IHN ++TAA DL+  
Sbjct  374  IDFICGDATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVIHNSRITAAQDLRPV  433

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS KTYLGRPW++YSRTV MK++LD LI PAGW PW G+ AL+TLYYGEY N+GAGA T
Sbjct  434  QGSFKTYLGRPWEKYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGT  493

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT A EA KFTVGNF+AG SW+  T VPFT+GL
Sbjct  494  GGRVNWPGYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y E +E+  +   IM +GDGIGKT+I G+RSVG G TTF+S+TVAVVGDG
Sbjct  301  RFVIYIKAGAYYEYIEVERRKTMIMFMGDGIGKTVIKGNRSVGAGWTTFRSSTVAVVGDG  360

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GIT  N AG + HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  361  FIARGITVENYAGPSQHQAVALRSGSDLSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGT  420

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQ CN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  421  VDFIFGNAAVVFQLCNLYARRPNPNQQNLFTAQGREDPNQNTGISILNCKVAAAADLLPV  480

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S ++YLGRPW++YSRTV++ ++++SLIDPAGWLPW+G+FAL+TL+YGEY N G G++T
Sbjct  481  LSSFRSYLGRPWREYSRTVYLLSNMESLIDPAGWLPWNGSFALSTLFYGEYKNRGPGSNT  540

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VIT+ T AS+FTVGNFI G +WLP T +PF   L
Sbjct  541  TARVKWPGYRVITNTTVASQFTVGNFIQGTAWLPNTGIPFYPNL  584



>ref|XP_010662407.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 59 
[Vitis vinifera]
Length=524

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 232/285 (81%), Gaps = 2/285 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++IYVK G+Y+EN+E+G  + NI LVGDG+ KTIITGSRSV GG TT+ SAT  + G  
Sbjct  240  RFIIYVKKGLYRENIEVGINVNNITLVGDGMKKTIITGSRSVRGGYTTYNSATAGIQGLR  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF+NTAG  N QAVALRS SDLSVFY C+F+GYQDTL V+S RQFYREC IYGT
Sbjct  300  FIARGITFKNTAGPKNGQAVALRSSSDLSVFYHCAFQGYQDTLMVHSQRQFYRECYIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQ C I+AR P   + N ITAQGR DP QNTGISIHN ++ AASDLK  
Sbjct  360  IDFIFGNAAVVFQQCMIFARRPLQGQANVITAQGRGDPYQNTGISIHNSRILAASDLKPV  419

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPW-DGNFALNTLYYGEYSNTGAGAS  269
            +GS KTYLGRPWQQYSRTV +KT LDSL+DP+GW PW   NFA +TLYYGEY N G  +S
Sbjct  420  VGSFKTYLGRPWQQYSRTVILKTYLDSLVDPSGWSPWGTSNFAQSTLYYGEYQNFGPSSS  479

Query  268  TANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            T NRVKW+GYHVITSAT AS+FTVG+FIAG SWLPAT VPFTSGL
Sbjct  480  TRNRVKWSGYHVITSATVASRFTVGSFIAGQSWLPATGVPFTSGL  524



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score =   389 bits (999),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+G K  N+M VGDGIGKT+I  SR+V  G TTF+SATVAVVG+ 
Sbjct  280  RHVIYIKAGAYMENVEVGKKHVNLMFVGDGIGKTVIKASRNVVDGYTTFRSATVAVVGNN  339

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+R+CD+YGT
Sbjct  340  FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGT  399

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DF+FGNAAVV Q CN+YAR P PN++N  TAQGR DPNQNTGISI  CKV AA+DL  +
Sbjct  400  IDFVFGNAAVVLQGCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAAADLAAA  459

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW+QYSRTV++++ LDSL+DPAGWL W+G+FAL+TLYYGEY NTG GA T
Sbjct  460  QSSTKTYLGRPWKQYSRTVYLQSELDSLVDPAGWLEWNGSFALDTLYYGEYMNTGPGAGT  519

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EAS FTVGNFI G  WL  T++PFT+GL
Sbjct  520  SGRVKWKGYRVITSAAEASAFTVGNFIDGDLWLAGTSIPFTTGL  563



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVEIG    N+M VGDGIGKT+I   R+V  G TTF+SATVAVVG G
Sbjct  305  RFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTG  364

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRS SD S FYQCSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  365  FIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGT  424

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  425  IDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPV  484

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S +TYLGRPW+ YSRTVF+++ +  LI+P GWL W+G FAL+TLYYGEY N G G++T
Sbjct  485  LSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNT  544

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT+ATEAS+FTV  FI G SWL +T +PF SGL
Sbjct  545  TMRVTWPGYRVITNATEASQFTVEGFIQGSSWLNSTEIPFFSGL  588



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+G    N+M +GDGIGKT++  SR+V  G TTF+SATVA+VG+G
Sbjct  282  RFVIYIKAGAYLENVEVGKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  341

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLY +S RQFYRECD+YGT
Sbjct  342  FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  401

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNA VV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  402  IDFIFGNAGVVLQNCNLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPV  461

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW+ YSRTV+M++ LDSLI+PAGWL WDG+FAL+TLYYGEY N G G+ST
Sbjct  462  QSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSST  521

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VI S+ EAS FTV +FI G  WL +T+VPFT+GL
Sbjct  522  ANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_006469215.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Citrus sinensis]
Length=525

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 230/284 (81%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK GVY+ENVEI   +KN+ML+GDGI  TI+T +++  GGTTTF++AT AV G G
Sbjct  246  RVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDATIVTSNKNGKGGTTTFRTATFAVSGQG  305

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  306  FIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGT  365

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
             DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +HN +VTA S     
Sbjct  366  QDFIFGDAAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVHNSRVTAES----G  421

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPW+QYSRTVFMK ++D +IDPAGWLPW G+FAL+TLYYGEY N G GAST
Sbjct  422  QGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGAST  481

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW+GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  482  SGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   388 bits (997),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+G    N+M +GDGIGKT++  SR+V  G TTF+SATVA+VG+G
Sbjct  282  RFVIYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  341

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLY +S RQFYRECD+YGT
Sbjct  342  FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  401

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNA VV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  402  IDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPV  461

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW+ YSRTV+M++ LDSLI+PAGWL WDG+FAL+TLYYGEY N G G+ST
Sbjct  462  QSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSST  521

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VI S+ EAS FTV +FI G  WL +T+VPFT+GL
Sbjct  522  ANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVEIG    N+M VGDGIGKT+I   R+V  G TTF+SATVAVVG G
Sbjct  275  RFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTG  334

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRS SD S FYQCSF GYQDTLYV+S RQFYR+CD+YGT
Sbjct  335  FIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGT  394

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  395  IDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPV  454

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S +TYLGRPW+ YSRTVF+++ +  LI+P GWL W+G FAL+TLYYGEY N G G++T
Sbjct  455  LSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNT  514

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT+ATEAS+FTV  FI G SWL +T +PF SGL
Sbjct  515  TMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTEIPFFSGL  558



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+G    N+M +GDGIGKT++  SR+V  G TTF+SATVA+VG+G
Sbjct  281  RFVIYIKAGAYLENVEVGKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNG  340

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N+AG + HQAVALR G+DLS FY+CSF GYQDTLY +S RQFYRECD+YGT
Sbjct  341  FLMRDMTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGT  400

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNA VV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  401  IDFIFGNAGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPV  460

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW+ YSRTV+M++ LDSLI+PAGWL WDG+FAL+TLYYGEY N G G+ST
Sbjct  461  QSNFSTYLGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSST  520

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ANRVKW GY VI S+ EAS FTV +FI G  WL +T+VPFT+GL
Sbjct  521  ANRVKWPGYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  564



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VI++KAGVYKEN++I   + N+M+ GDG+  TI+TG+++   G+TTF+SAT AV+GDG
Sbjct  89   RVVIHLKAGVYKENIDIKRTMSNLMIFGDGMDSTIVTGNQNAIDGSTTFRSATFAVMGDG  148

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSG+D SVFY+C+F+G+QDTLYVY++RQFYR+C+IYGT
Sbjct  149  FIAKDMTFENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGT  208

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNA  V QNCNI+ R P  N+ NT+TAQGR+DPN+NTGI IHNC++TA+SDLK  
Sbjct  209  IDFIFGNAVTVLQNCNIFVRKPMSNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLKAI  268

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              SVKTYLGRPWQ+YSRTV MK++LD LI+  GW PW G FAL+TLYYGEY N G GA+T
Sbjct  269  QNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANT  328

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+HVIT+ ++A KF+VGNF+AG SW+  + VPF +GL
Sbjct  329  DGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAGL  372



>ref|XP_004503381.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cicer arietinum]
Length=546

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 232/284 (82%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V+YVK GVYKENV++   +KN+M+VGDG+  TIIT + +   G TTF+SAT  ++GDG
Sbjct  263  RVVVYVKRGVYKENVDVKKTVKNLMIVGDGMDSTIITSNHNAQHGYTTFRSATFGIMGDG  322

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG  NHQAVALRSG+D SVFY+C+F+GYQDTLYVY+ RQFYR+C+IYGT
Sbjct  323  FIAKDMTFENTAGPQNHQAVALRSGADYSVFYRCAFKGYQDTLYVYAQRQFYRDCNIYGT  382

Query  622  VDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNA  V QNCNI+ R P  N+ NT+TAQ R+DPN+NTGI IHNC++TA++DLK  
Sbjct  383  VDFIFGNAVTVLQNCNIFVRKPMGNQQNTVTAQARTDPNENTGIIIHNCRITASNDLKPV  442

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              SVKT+LGRPWQ+YSRTV MK++LD LI+P GW  W+G FAL+TLYYGEY N GAGA+T
Sbjct  443  QNSVKTFLGRPWQKYSRTVVMKSNLDGLINPKGWSVWNGGFALSTLYYGEYMNIGAGANT  502

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV+W G+H+IT ++EA+KF+V NF+AGGSW+ +T VPF +GL
Sbjct  503  GGRVQWPGFHLITQSSEAAKFSVSNFLAGGSWISSTGVPFDAGL  546



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 231/284 (81%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK GVY+ENV +  +++N+MLVGDGIGK++ITGS+S GGG+TT+ SA  AV G+ 
Sbjct  179  RIVIYVKKGVYEENVNV--EMRNLMLVGDGIGKSVITGSKSAGGGSTTYNSAAFAVTGEK  236

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITFRNTAG A HQAVALRS SDLSVF+QCSFEGYQDTLYV+S RQFYREC++YGT
Sbjct  237  FMARGITFRNTAGPAKHQAVALRSNSDLSVFHQCSFEGYQDTLYVHSLRQFYRECEVYGT  296

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQ+CNIY R P   + NTITAQGR+DPNQNTGISI  C+V AA DL+ +
Sbjct  297  VDFIFGNAAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQYCRVRAAKDLRPA  356

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +T+LGRPW++ SRTV+M+T +D LI PAGWL W G FAL TL+YGE+ NTG G++T
Sbjct  357  QSSFETFLGRPWKENSRTVYMETYMDDLISPAGWLEWSGGFALETLFYGEFRNTGPGSNT  416

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVIT  + AS+FT  N IAG  WLP+T VPFT  L
Sbjct  417  SKRVKWGGYHVITDPSAASEFTARNLIAGEMWLPSTGVPFTLDL  460



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   388 bits (997),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/284 (69%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVEIG    N+M VGDGIGKT+I   R+V  G TTF+SATVAVVG G
Sbjct  328  RFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTG  387

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRS SD S FYQCSF GYQDTLYV+S RQFYR+CD+YGT
Sbjct  388  FIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGT  447

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  448  IDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPV  507

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S +TYLGRPW+ YSRTVF+++ +  LI+P GWL W+G FAL+TLYYGEY N G G++T
Sbjct  508  LSSFRTYLGRPWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNT  567

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT+ATEAS+FTV  FI G SWL +T +PF SGL
Sbjct  568  TMRVTWPGYRVITNATEASQFTVERFIQGSSWLNSTEIPFFSGL  611



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   386 bits (992),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENV++  K   +M VGDGIGKT++  +RSV  G TTF+SATVAVVG+G
Sbjct  277  RFVIYIKAGAYFENVDVDKKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNG  336

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF N+AG   HQAVALRSGSDLS FY+CSF GYQDTLYV+S RQFYR+CDIYGT
Sbjct  337  FIARDMTFENSAGPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGT  396

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNT ISI + KVTAASDL   
Sbjct  397  VDFIFGNAAVVFQNCNLYARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASDLIPV  456

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTVF+++ LD LIDPAGWL W G+FAL TLYYGEY N G GA+T
Sbjct  457  KSSFKTYLGRPWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANT  516

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ++RV W GY VI S+TEAS+FTV +FI G  WL +T VP+ SGL
Sbjct  517  SSRVSWPGYRVINSSTEASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   387 bits (995),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 225/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVEIG    N+M VGDGIGKT+I G R+V  G TTF+SATVAVVG G
Sbjct  309  RFVIYIKAGAYFENVEIGRAKSNLMFVGDGIGKTLIKGDRNVVDGWTTFRSATVAVVGTG  368

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRS SD S FYQCSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  369  FIAKGITFENYAGPSKHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDIYGT  428

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AASDL   
Sbjct  429  IDFIFGNAAVVFQNCNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVEAASDLIPV  488

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            L S +TYLGRPW+ +SRTVF+++ +  L++P GWL W+G FAL+TLYYGEY N G G++T
Sbjct  489  LSSFRTYLGRPWKLHSRTVFLRSFIGQLVEPVGWLEWNGTFALDTLYYGEYLNRGPGSNT  548

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VIT+ATEAS+FTV  FI G SWL +T +PF SGL
Sbjct  549  TGRVTWPGYRVITNATEASQFTVEEFIQGSSWLNSTGIPFFSGL  592



>ref|XP_011070723.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase [Sesamum indicum]
Length=511

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 227/284 (80%), Gaps = 2/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKENVE+   +KN+M VGDGI  TI+TGS++V  G+TTF+SAT A+ GDG
Sbjct  229  RFVIYVKRGVYKENVEVKKSMKNLMFVGDGIDATIVTGSKNVQDGSTTFRSATFAISGDG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAGA  HQAVALRS SD S+FY+CSF+GYQDTLYV+S RQFYR+CDIYGT
Sbjct  289  FIARDMTFENTAGAHKHQAVALRSSSDFSIFYRCSFKGYQDTLYVHSQRQFYRDCDIYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P PN+ NT+TAQGRSDPN+NTGI IHN  V A SDL+  
Sbjct  349  IDFIFGDAVAVLQNCNIYVRKPMPNQKNTVTAQGRSDPNENTGIIIHNSHVRAFSDLRPV  408

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S ++YLGRPW++YSRTVFMK +++ LIDPAGWLPW G F L+TLYYGEY NTG+GA T
Sbjct  409  QDSYRSYLGRPWRKYSRTVFMKCTIEGLIDPAGWLPWSGAFGLSTLYYGEYMNTGSGART  468

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+HVITS  EA KF+ G F+A G  + A  VPFT+GL
Sbjct  469  NGRVKWPGFHVITSPAEAGKFSAGKFLA-GEXITAAGVPFTAGL  511



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 219/280 (78%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K G Y E VE+  K   IM VGDG+GKT I G+R+   G TTF+SATVAVVG G
Sbjct  282  RFVIYIKEGSYFEYVEVDKKKNMIMFVGDGVGKTKIKGNRNHVDGWTTFRSATVAVVGKG  341

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITF N AG + HQAV LRS SDLS FYQCSF  YQDTLYV+S RQFYRECDIYGT
Sbjct  342  FLAKGITFENYAGPSKHQAVTLRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDIYGT  401

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  402  VDFIFGNAAVVLQNCNLYARKPDPNQRNLFTAQGREDPNQNTGISILNCKVEAAADLVPV  461

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K YLGRPW++YSRTVF+++ + SLI+PAGWL W+GNFAL TLYYGEY N G G++T
Sbjct  462  QSSFKNYLGRPWKEYSRTVFLQSYIGSLIEPAGWLEWNGNFALKTLYYGEYMNRGPGSNT  521

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RVKW GY VI S+ E S+FTVGNFI GG WLPAT  PF
Sbjct  522  SVRVKWPGYRVINSSAETSQFTVGNFIQGGEWLPATGFPF  561



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            RYVIY+KAG Y ENVE+G   KN+M +GDG+GKT+I  S +V  G+TTF+SATVAVVG  
Sbjct  189  RYVIYIKAGAYMENVEVGKSHKNLMFIGDGMGKTVIKASLNVVDGSTTFRSATVAVVGSN  248

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +T  N AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQF+RECDIYGT
Sbjct  249  FLARDLTIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT  308

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DF+FGN+A V Q+CN+YAR P PN++N  TAQGR+DPNQNTGIS+  C+  AASDL   
Sbjct  309  IDFVFGNSAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISVQKCRGAAASDLAAV  368

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +TYLGRPW+QYSRTVF+++ LDS++DPAGWL WDG FAL+TLYY EY NTG GA T
Sbjct  369  QSSFRTYLGRPWKQYSRTVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGT  428

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY  + SA+EAS FTVG+FI G  WL  T++PF+ GL
Sbjct  429  SGRVSWMGYRGVISASEASTFTVGSFIDGDVWLAGTSIPFSGGL  472



>ref|XP_006448208.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
 gb|ESR61448.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
Length=525

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 229/284 (81%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK GVY+ENVEI   +KN+ML+GDGI  TI+T +++  GGTTTF++AT AV G G
Sbjct  246  RVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDATIVTSNKNGKGGTTTFRTATFAVSGQG  305

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  306  FIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGT  365

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
             DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +HN +VTA S     
Sbjct  366  QDFIFGDAAVVLQSCNIYIRKPIGGQKNTVTAQGRKDPNENTGIIVHNSRVTAES----G  421

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPW+QYSRTVFMK ++D +IDPAGWLPW G+FAL+TLYY EY N G GAST
Sbjct  422  QGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYAEYMNIGTGAST  481

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW+GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  482  SGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>ref|XP_002322399.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06526.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=516

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 228/284 (80%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+GVYKE +EIG KL+NIMLVGDG+ KTIITG++  GGG  TF +ATV V G G
Sbjct  237  RFVIYIKSGVYKEYLEIGKKLENIMLVGDGMTKTIITGNKRSGGGVDTFHTATVGVDGHG  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF+NTAG  NHQAVALRS SD SVFY+C FEGYQDTLYV+S RQFYREC IYGT
Sbjct  297  FIARDITFQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+AAVV QNC IY R P  ++ N ITAQGRS P  NTGI IHN +V AA D    
Sbjct  357  IDFIFGDAAVVLQNCMIYVRRPIGSQNNVITAQGRSCPYTNTGIVIHNSQVFAAED----  412

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
            LGS KTYLGRPW++YSRTVF+ T LDS +DPAGWL W+G+FALNTLYYGEY NTG GAST
Sbjct  413  LGSSKTYLGRPWRKYSRTVFLSTYLDSSVDPAGWLEWNGSFALNTLYYGEYKNTGPGAST  472

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GY VITSA EAS+FTV NFI G SWLPAT V F +GL
Sbjct  473  SGRVKWPGYKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 228/280 (81%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+  K K ++ +GDGIGKT++   RSV  G TTF+SATVAVVGDG
Sbjct  274  RFVIYIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  334  FIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQ  N+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  394  IDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +T+LGRPW++YSRTVF+++ +D L+DPAGWL W+ +FAL+TLYYGEY N G G++T
Sbjct  454  KSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RV W GY VIT++TEAS+FTVG FI G +WL +T++P+
Sbjct  514  SARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPY  553



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 228/280 (81%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+  K K ++ +GDGIGKT++   RSV  G TTF+SATVAVVGDG
Sbjct  274  RFVIYIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  334  FIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQ  N+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  394  IDFIFGNAAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +T+LGRPW++YSRTVF+++ +D L+DPAGWL W+ +FAL+TLYYGEY N G G++T
Sbjct  454  KSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RV W GY VIT++TEAS+FTVG FI G +WL +T++P+
Sbjct  514  SARVTWPGYRVITNSTEASQFTVGAFIQGNTWLNSTDIPY  553



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++K G Y ENVE+  K  N+M VGDGIGKT++ GSR+V  G TTF+SATVAVVG G
Sbjct  187  RFVIHIKEGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAG  246

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG   HQAVALRSG+D S FYQCSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  247  FIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGT  306

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCK+ AA+DL   
Sbjct  307  VDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPV  366

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K+YLGRPW+ YSRTV +K+ ++ LIDPAGWL W+  FAL+TLYYGEY N G GA+T
Sbjct  367  KSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANT  426

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VI S+TEA++FTVG FI G  WL +T +PF SGL
Sbjct  427  NGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  470



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   385 bits (990),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 226/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+  K  N+M +GDGIG TI+  SR+V  G TTF+SATVAVVG+G
Sbjct  294  RFVIYIKAGAYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBG  353

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N AG + HQAVALRSG+D S FY+CSF GYQDTLYV+S RQFYRECD+YGT
Sbjct  354  FIAKGITFENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGT  413

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKVTA SDL   
Sbjct  414  VDFIFGNAAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPV  473

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW++YSRTV++K+ +D L+DPAGWL W+G+FAL+TLYYGEY N G G++T
Sbjct  474  KSNFTTYLGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNT  533

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VI S+ EAS+FTVG FI G  WL +TN+P+  GL
Sbjct  534  SARVTWPGYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGL  577



>gb|KDO64577.1| hypothetical protein CISIN_1g047288mg [Citrus sinensis]
Length=508

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 213/284 (75%), Gaps = 22/284 (8%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVK GVY+ENVEI   +KN+ML+GDGI                   +    V G G
Sbjct  246  RVVIYVKRGVYRENVEIKRSMKNLMLIGDGIDA-----------------TIVTTVSGQG  288

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG ANHQAVALRSGSD SVFY CSF+GYQDTLYVYS RQFYR CDIYGT
Sbjct  289  FIARDMTFENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGT  348

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
             DFIFG+AAVV Q+CNIY R P   + NT+TAQGR DPN+NTGI +HN +VTA S     
Sbjct  349  QDFIFGDAAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVHNSRVTAES----G  404

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPW+QYSRTVFMK ++D +IDPAGWLPW G+FAL+TLYYGEY N G GAST
Sbjct  405  QGSFKSYLGRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGAST  464

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW+GYHVI S  EA KFTVGNF+AG SW+PAT VPF SGL
Sbjct  465  SGRVKWSGYHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  508



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 226/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K G Y ENV++  K  N+M +GDGIGKT++  +RSV GG TTF+SATVAVVG+G
Sbjct  273  RFVIYIKEGAYFENVDVDKKKTNLMFIGDGIGKTVVKANRSVVGGWTTFRSATVAVVGNG  332

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITF N+AG   HQAVALRSGSDLS FYQCSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  333  FVAKGITFENSAGPDMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGT  392

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNC+IYAR P  N+ N  TAQGR DPNQNTGISI N KVTAA+DL   
Sbjct  393  VDFIFGNAAVVFQNCSIYARKPNSNQQNIFTAQGREDPNQNTGISIMNSKVTAAADLIPV  452

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTVF+++ +D ++DP GWL W+G FAL+TLYYGEY N G G++T
Sbjct  453  KKSFKTYLGRPWKEYSRTVFLRSYIDDVVDPVGWLEWNGAFALSTLYYGEYMNRGPGSNT  512

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VI S TEAS+FTV  FI G  WL AT +PF  GL
Sbjct  513  SARVTWPGYRVINSTTEASQFTVRPFIQGSEWLNATGIPFFLGL  556



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 229/284 (81%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK GVYKE V +G  ++N+MLVGDGIGKT+ITGSRS GGG+TT+ SAT AV G+ 
Sbjct  191  RFVIYVKKGVYKEYVNVG--MRNLMLVGDGIGKTVITGSRSAGGGSTTYNSATFAVTGER  248

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITFRNTAG A HQAVALRS SDLSVFYQCSF+GYQDTLY +S RQFYREC IYGT
Sbjct  249  FIARGITFRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLYAHSLRQFYRECKIYGT  308

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCNIY R P   + NTITAQGR+DPNQNTGISI NC+VTAA DL+  
Sbjct  309  VDFIFGNAAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQNCRVTAAKDLRPV  368

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +T+LGRP ++YSRTV+M+T +D LI PAGWL W G+FAL TL+YGE+ NTG G++T
Sbjct  369  RSSFQTFLGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALETLFYGEFRNTGPGSNT  428

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYH+IT  + A +FT    IAG  WLP++ +PF   L
Sbjct  429  SKRVKWGGYHIITDPSTALEFTARILIAGEMWLPSSGLPFKLDL  472



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   385 bits (989),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 223/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K+G Y ENVE+  K   +M +GDGIGKT++  SR+V  G TTF+SATVAVVGDG
Sbjct  293  RFVIYIKSGAYFENVEVVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDG  352

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI QGITF N AG + HQAVA RSGSD S FY+CSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  353  FIAQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGT  412

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P  N+ N  TAQGR DPNQNTGISI N KV AASDL   
Sbjct  413  VDFIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNSKVAAASDLVPV  472

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
                KTYLGRPW++YSRTV+MK+ +D L++PAGWL W+G FAL+TLYYGEY N G G++T
Sbjct  473  KAMFKTYLGRPWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGPGSNT  532

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VI S+ EA++FTVG FI G  WL ATN+P+  GL
Sbjct  533  SARVTWPGYRVINSSAEANQFTVGPFIQGNEWLNATNIPYFIGL  576



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 227/284 (80%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R++I+VKAGVY ENV+I + +KN+M VGDG G TIIT SRSV GG+TTF SAT AV GD 
Sbjct  237  RFIIHVKAGVYNENVQITNSMKNLMFVGDGKGNTIITASRSVRGGSTTFSSATFAVSGDR  296

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + +TFRNTAG  NHQAVALR  SD + FY+CS +GYQDTL+  + RQFYRECDIYGT
Sbjct  297  FMARDMTFRNTAGPENHQAVALRVSSDFAAFYRCSIDGYQDTLHADTLRQFYRECDIYGT  356

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNA  VFQNCNI+ R P   + NTITAQGRSDPNQNTGISIHN +++AA DL   
Sbjct  357  VDFIFGNAIAVFQNCNIFVRRPMSQQKNTITAQGRSDPNQNTGISIHNSRISAAPDLSPV  416

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS  TYLGRPWQ+++RT+F+K  LD LI+PAGWL W  NFAL+TLYYGEY NTG G++T
Sbjct  417  QGSFATYLGRPWQKHARTIFLKCFLDDLINPAGWLEWSENFALSTLYYGEYRNTGPGSNT  476

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GYH ITS +EASKF+VG+F+ GGSW+PAT VPFT  L
Sbjct  477  GKRVKWNGYHFITSPSEASKFSVGSFLDGGSWIPATGVPFTLDL  520



>gb|KHG13344.1| Uncharacterized protein F383_18528 [Gossypium arboreum]
Length=522

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 226/284 (80%), Gaps = 3/284 (1%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VI+VKAGVY ENV+I    KNIML+GDGIG T+ITG+++    TT  ++AT AVVGDG
Sbjct  241  RTVIHVKAGVYNENVDIQRSAKNIMLIGDGIGATVITGNKNAQTTTTF-RTATFAVVGDG  299

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + ITF NTAG   HQAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  300  FIARDITFENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  359

Query  622  VDFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  VFQNCNIY R P + + NT+TAQ R+DPN+NTGI IHN +V AASDL+  
Sbjct  360  VDFIFGDAIAVFQNCNIYIRRPMSGQMNTVTAQARTDPNENTGIIIHNSRVMAASDLRAV  419

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K YLGRPWQ+YSRTVFMKT LD LID  GWLPW GNFAL++LYY E+ NTG GAST
Sbjct  420  QGSFKNYLGRPWQKYSRTVFMKTGLDGLIDAEGWLPWSGNFALSSLYYAEHMNTGTGAST  479

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW GY VI  ATEA KFTVGNF+ G +W+P + VPF +GL
Sbjct  480  GGRVKWGGYRVI-DATEAGKFTVGNFLTGNAWIPESGVPFDAGL  522



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 225/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++K G Y ENVE+  K  N+M VGDGIGKT++ GSR+V  G TTF+SATVAV+G+G
Sbjct  269  RFVIHIKEGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVLGEG  328

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG   HQAVALRSG+D S F++CSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  329  FIAKGITFENSAGPEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGT  388

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCK+ AASDL   
Sbjct  389  VDFIFGNAAVVFQNCNLYARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASDLIPV  448

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K+YLGRPW+ YSRTV++K+ ++ LIDPAGWL W+  FAL+TLYYGEY N G G++T
Sbjct  449  KSSFKSYLGRPWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGPGSNT  508

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY +I S+TEAS+FTV  FI G  WL  T +PF SGL
Sbjct  509  SARVTWPGYRIINSSTEASQFTVAQFIQGNDWLNTTGIPFLSGL  552



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   383 bits (983),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++K G Y ENVE+  K  N+M VGDGIGKT++ GSR+V  G TTF+SATVAVVG G
Sbjct  278  RFVIHIKEGAYFENVEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAG  337

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG   HQAVALRSG+D S FYQCSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  338  FIAKGITFENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGT  397

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCK+ AA+DL   
Sbjct  398  VDFIFGNAAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPV  457

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K+YLGRPW+ YSRTV +K+ ++ LIDPAGWL W+  FAL+TLYYGEY N G GA+T
Sbjct  458  KSSFKSYLGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANT  517

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GY VI S+TEA++FTVG FI G  WL +T +PF SGL
Sbjct  518  NGRVTWPGYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  561



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 219/280 (78%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+K G Y E VE+  K   IM VGDGIGKT I G+R+   G TTF+SATVAVVG G
Sbjct  281  RFVIYIKEGSYFEYVEVDKKKTMIMFVGDGIGKTKIKGNRNHVDGWTTFRSATVAVVGKG  340

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ +GITF N AG + HQAVALRS SDLS FYQCSF  YQDTLYV+S RQFYR+CD+YGT
Sbjct  341  FLAKGITFENYAGPSKHQAVALRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGT  400

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P PN+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  401  VDFIFGNAAVVLQNCNLYARKPDPNQKNLFTAQGREDPNQNTGISILNCKVEAAADLIPV  460

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K YLGRPW++YSRTV +++ + SLI+PAGWL W+G+FAL TLYYGEY N G G+ST
Sbjct  461  QSSFKNYLGRPWKEYSRTVVLQSYIGSLIEPAGWLEWNGDFALKTLYYGEYMNRGPGSST  520

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RVKW GY VI S+ EAS+FTVGNFI GG WLP T  PF
Sbjct  521  SARVKWPGYRVINSSIEASQFTVGNFIQGGEWLPPTGFPF  560



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 231/284 (81%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VI++KAG+YKENV+I   +KN+M+ GDG+  TI+TG+ +   G+TTF+SAT  V+GDG
Sbjct  258  RVVIHLKAGIYKENVDIKKTVKNLMIFGDGMDSTIVTGNHNAIDGSTTFRSATFGVMGDG  317

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRSG+D SVFY+C+F+G+QDTLYVY++RQFYR+C+IYGT
Sbjct  318  FIAKDMTFENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGT  377

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNA  V QNCNI+ R P  N+ NT+TAQGR+DPN+NTGI IHNC++TA+SDLK  
Sbjct  378  IDFIFGNAVTVLQNCNIFVRKPMSNQKNTVTAQGRTDPNENTGIVIHNCRITASSDLKAI  437

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              SVKTYLGRPWQ+YSRTV MK++LD LI+  GW PW G FAL+TLYYGEY N G GA+T
Sbjct  438  QNSVKTYLGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANT  497

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RVKW G+HVIT+ ++A KF+VGNF+AG SW+  + VPF +GL
Sbjct  498  DGRVKWPGFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAGL  541



>ref|XP_010253281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Nelumbo nucifera]
Length=560

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 229/283 (81%), Gaps = 2/283 (1%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            +VIY+ AGVY+E V I    KN+M++GDGI +T+ITG+RSV  G TTF SAT+AVVG GF
Sbjct  278  FVIYIAAGVYEEYVSIAKNKKNLMMIGDGINQTVITGNRSVVDGWTTFNSATLAVVGQGF  337

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            +   IT RNTAGA  HQAVA+R+G+DLS FY CSFEGYQDTLY +S RQFYRECDIYGTV
Sbjct  338  VAINITVRNTAGAIKHQAVAVRNGADLSTFYSCSFEGYQDTLYAHSLRQFYRECDIYGTV  397

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNAA VFQNCNIYAR P   + N +TAQGR+DPNQNTGISIHNC + AA DL  S 
Sbjct  398  DFIFGNAAAVFQNCNIYARLPMQGQFNALTAQGRTDPNQNTGISIHNCNIRAAPDLASSS  457

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            G+ K+YLGRPW++YSRTV+M++ +DSLIDPAGW  W GNFAL+TLYY EY+NTG G+ T 
Sbjct  458  GTTKSYLGRPWKEYSRTVYMQSIIDSLIDPAGWKEWSGNFALSTLYYAEYNNTGPGSVTT  517

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV W GYH+I +AT+A+ FTV NFI G SWLPAT VP++ GL
Sbjct  518  DRVSWPGYHLI-NATDAANFTVSNFILGDSWLPATIVPYSGGL  559



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   382 bits (981),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 229/280 (82%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++KAG Y ENVE+  K K ++ +GDGIGKT++  +RSV  G TTF+SATVAVVGDG
Sbjct  274  RFVIHIKAGAYFENVEVERKKKMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDG  333

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVALRSGSDLS FYQCSF GYQDTLYV++ RQFYRECDIYGT
Sbjct  334  FIAKGITFENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGT  393

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFGNAAVVFQN N+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  394  IDFIFGNAAVVFQNSNLYARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPV  453

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S +T+LGRPW++YSRTVF+++ +D L+DPAGWL W+ +FAL+TLYY EY N G G++T
Sbjct  454  KSSFQTFLGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGPGSNT  513

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RV W GY +IT++TEAS+FTVG FI G +WL +T++P+
Sbjct  514  SARVTWPGYRIITNSTEASQFTVGAFIQGNTWLNSTDIPY  553



>ref|XP_010684347.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=590

 Score =   382 bits (981),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 224/283 (79%), Gaps = 2/283 (1%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            ++IYV AGVY+ENV I  K + IM++GDGI +TIITG+RSV    TTF+SAT AV G GF
Sbjct  308  FLIYVSAGVYEENVYIDKKQRYIMMIGDGINQTIITGNRSVVDNYTTFQSATFAVTGTGF  367

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            +   IT RNTAGA  HQAVALRSG+DLS FY CSFEGYQDTLYV+S RQFYRECDIYGTV
Sbjct  368  VAMNITIRNTAGAIKHQAVALRSGADLSAFYSCSFEGYQDTLYVHSLRQFYRECDIYGTV  427

Query  619  DFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNA VVFQNCNIY R P  N+ N ITAQGR+DPNQNTGISI NC + AA DL  S 
Sbjct  428  DFIFGNANVVFQNCNIYPRLPMENQFNAITAQGRTDPNQNTGISIENCIIRAAEDLADSK  487

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            G+ +TYLGRPW+QYSRTVFM + +D+++DPAGW  WDG FAL+TLYYGEY+NTG G++  
Sbjct  488  GTTRTYLGRPWKQYSRTVFMHSYIDNMVDPAGWREWDGTFALDTLYYGEYNNTGPGSNVT  547

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
             RV W GYH++ SAT+AS FTV  F+ G  WLP T VP+ SGL
Sbjct  548  GRVSWVGYHLL-SATDASNFTVSTFVFGDEWLPKTGVPYASGL  589



>ref|XP_010101979.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90903.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=463

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R V+YVKAGVY ENVEI + +KN+M VGDGI  TI+TG+R+   G+TTF+SAT  V GD 
Sbjct  180  RIVVYVKAGVYNENVEIKNDIKNLMFVGDGIDATIVTGNRNNVDGSTTFQSATFGVSGDR  239

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI Q +TF NTAG A +QAVALRSGSD SVFY+CSF+GYQDTLYVYS RQFYR+C++YGT
Sbjct  240  FIAQDMTFENTAGPAKYQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCNVYGT  299

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+A  + QNCNI  R P   + N +T Q R+DPN+NTGI I N ++TA+SDL+  
Sbjct  300  VDFIFGDAVAILQNCNILVRKPISGQENVVTCQTRTDPNENTGIIIQNSRITASSDLRPV  359

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS +TYLGRP Q+YSRTV M +SLD LIDP GWLP  GNFAL+TLYY EY N+GAGA+T
Sbjct  360  QGSFETYLGRPLQKYSRTVIMTSSLDGLIDPKGWLPGSGNFALSTLYYAEYMNSGAGAAT  419

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV W GYHV+TSA EA KFTVGNF+ G SW+PAT VPF +GL
Sbjct  420  GGRVSWPGYHVLTSAAEAGKFTVGNFLGGDSWIPATGVPFAAGL  463



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++K G Y ENVE+  K  N+MLVGDGIGKT++  SR+V  G TTF+SAT AVVG  
Sbjct  265  RFVIHIKEGAYFENVEVIKKKINLMLVGDGIGKTVVKASRNVIDGWTTFQSATFAVVGSN  324

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVA+RSG+D S FY CSF  YQDTLYV+S RQFYRECDIYGT
Sbjct  325  FIAKGITFENSAGPSKHQAVAVRSGADFSAFYNCSFVAYQDTLYVHSLRQFYRECDIYGT  384

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P PN+ N  TAQGR DPNQNTGISI N K+ AA+DL   
Sbjct  385  VDFIFGNAAVVFQNCNLYARKPDPNQQNLFTAQGRQDPNQNTGISIINSKIAAAADLIPV  444

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S K+YLGRPW+QYSRTV++++ ++ LIDPAGWLPW+G FAL+TLYYGEY N G G++T
Sbjct  445  KSSFKSYLGRPWKQYSRTVYLQSLIEDLIDPAGWLPWNGTFALDTLYYGEYKNRGPGSNT  504

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY VIT+ TEAS+FTV NFI G  WL +T +PF   L
Sbjct  505  SARVTWPGYRVITNTTEASQFTVRNFIQGNDWLNSTGIPFFPDL  548



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   379 bits (974),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/280 (66%), Positives = 225/280 (80%), Gaps = 1/280 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VI++KAG Y ENVE+  K  N+MLVGDGIG+T++  SR+V  G TTF+S+T AVVGD 
Sbjct  273  RFVIHIKAGAYFENVEVIKKKTNLMLVGDGIGQTVVKASRNVVDGWTTFQSSTFAVVGDK  332

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GITF N+AG + HQAVA+R+G+D S FYQCSF  YQDTLYV+S RQFYRECD+YGT
Sbjct  333  FIAKGITFENSAGPSKHQAVAVRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGT  392

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P P + N  TAQGR DPNQNTGISI NCK+ AA+DL   
Sbjct  393  VDFIFGNAAVVFQNCNLYARKPDPKQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPV  452

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              + K+YLGRPW++YSRTV++ + +D+LIDPAGWL W+G FAL+TL+YGEY N G G++T
Sbjct  453  QSTFKSYLGRPWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNT  512

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPF  146
            + RV W GY VIT+ATEAS+FTV  FI G  WL +T VPF
Sbjct  513  SARVTWPGYKVITNATEASQFTVRQFIQGNEWLNSTGVPF  552



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 219/284 (77%), Gaps = 5/284 (2%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R VIYVKAGVY+ENV I  K  NIML+GDG+    +         TTTF SATV V GD 
Sbjct  241  RTVIYVKAGVYRENVNI--KKSNIMLIGDGM-DATVVTGSKSAQTTTTFSSATVGVAGDR  297

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + ITF N+AG   HQAVA RSGSD SV Y+CSF+GYQDTLYVYS RQFYR+CDIYGT
Sbjct  298  FVARDITFDNSAGPQKHQAVAFRSGSDHSVIYRCSFKGYQDTLYVYSQRQFYRDCDIYGT  357

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            +DFIFG+A  V QNCNIY R P  N+ NT+TAQGR+D N+NTGI IHN +VTA+SDL+G 
Sbjct  358  LDFIFGDAVAVLQNCNIYIRKPMSNQRNTVTAQGRTDANENTGIIIHNSRVTASSDLRGV  417

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             GS K+YLGRPWQ+YSRTVFMK+ LD +I   GWLPW G+FAL+TLYY E+ NTGAGA T
Sbjct  418  QGSFKSYLGRPWQKYSRTVFMKSVLDGVITAEGWLPWSGSFALSTLYYAEHMNTGAGADT  477

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RVKW GYHVI SA EA KFTVGNF+AG +W+P T VPF +GL
Sbjct  478  SGRVKWGGYHVI-SAAEAGKFTVGNFLAGDAWIPGTGVPFDAGL  520



>ref|XP_010260073.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 229/283 (81%), Gaps = 2/283 (1%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            ++IYV AG+Y+E V I  K K +M++GDGI +TII+G+RSV  G TTF SAT+AVVG+GF
Sbjct  281  FLIYVVAGIYEEYVSISKKTKYLMMIGDGINQTIISGNRSVVDGWTTFNSATLAVVGEGF  340

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            +   IT RNTAGA  HQAVA+R+G+DLS FY CSFEGYQDTLY +S RQFYRECDIYGTV
Sbjct  341  VAINITVRNTAGAIKHQAVAVRNGADLSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTV  400

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNAA VFQ+CNIYAR P   + N +TAQGR+DPNQNTG SI NC + AASDL  S 
Sbjct  401  DFIFGNAAAVFQDCNIYARLPMQGQFNALTAQGRTDPNQNTGTSIQNCNIRAASDLASSS  460

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            G+ KTYLGRPW+QYSRTV+M++ +DSLIDPAGW+ W G+FAL TLYY EY+NTG G+ T 
Sbjct  461  GTTKTYLGRPWKQYSRTVYMQSFIDSLIDPAGWMAWSGDFALTTLYYAEYNNTGPGSGTT  520

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            +RV W GYH+I +AT+A+ FTV NF+ G +W+P T VP+TSGL
Sbjct  521  DRVTWPGYHLI-NATDAANFTVSNFLLGDNWIPTTKVPYTSGL  562



>ref|XP_004299719.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20-like 
[Fragaria vesca subsp. vesca]
Length=566

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/283 (69%), Positives = 229/283 (81%), Gaps = 2/283 (1%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            +++Y+ AGVY+E V I SK K ++L+GDGI +TIITGS SVGGG+TTF SAT+AVV  GF
Sbjct  284  FLVYITAGVYEEYVSIISKKKYLLLIGDGINQTIITGSNSVGGGSTTFNSATLAVVATGF  343

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            I   IT RNTAG +  QAVA+R+G+DLSVFY CSFEGYQDTLY +S RQFYRECDIYGTV
Sbjct  344  IAVNITVRNTAGPSMGQAVAVRNGADLSVFYSCSFEGYQDTLYTHSMRQFYRECDIYGTV  403

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNAAVVFQNCNIY R P   +TN ITAQGR+DPNQNTG SI NC +TAA DL  S 
Sbjct  404  DFIFGNAAVVFQNCNIYPRQPRQGQTNPITAQGRTDPNQNTGTSIQNCTITAADDLASSN  463

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
             +VKTYLGRPW++YSRTV+++  +DSLIDPAGWL W G+FAL+TLYYGEY N G GA T+
Sbjct  464  FTVKTYLGRPWKEYSRTVYLQNFMDSLIDPAGWLAWSGDFALSTLYYGEYDNKGPGADTS  523

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W GYH+I  AT+AS FTV NF+ G SWLP T VP+T GL
Sbjct  524  NRVTWPGYHII-GATDASNFTVSNFVLGDSWLPQTGVPYTGGL  565



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVKAG Y ENVE+G    N++L+GDGIGKT++  SRSV  G TTF+SATVAVVGDG
Sbjct  283  RFVIYVKAGAYFENVEVGKSKTNLLLIGDGIGKTVVKASRSVVDGWTTFRSATVAVVGDG  342

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            F+ + IT  N AG + HQAVALR G+DLS FY+CSF GYQDTLYV+S RQFYREC++YGT
Sbjct  343  FLMRDITIENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGT  402

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVV QNCN+YAR P PN+ N  TAQGR DPNQNTGISI  CKV AA+DL   
Sbjct  403  VDFIFGNAAVVLQNCNLYARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAADLIPV  462

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              +  TYLGRPW++YSRTVFM++ LDSLI PAGWL W+G+FAL+TLYYGEY N G G++T
Sbjct  463  QANFSTYLGRPWKEYSRTVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGPGSNT  522

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            ++RV W G+ VI  A EAS FT   F+ G  WL +T+VPF+ GL
Sbjct  523  SSRVAWPGFRVIGDAAEASNFTAAAFVQGDQWLGSTSVPFSLGL  566



>ref|XP_004150118.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cucumis sativus]
 gb|KGN51481.1| hypothetical protein Csa_5G568300 [Cucumis sativus]
Length=539

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 224/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIYVK G+YKENV I  ++KNIM+VGDG+ +TI+T  ++V  G+TTF+SAT AV G+G
Sbjct  256  RFVIYVKGGIYKENVVIEKRMKNIMMVGDGMDRTIVTAMKNVQDGSTTFQSATFAVAGEG  315

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI + +TF NTAG   HQAVALRS +D S+FY+CSF+GYQDTLY +S+RQFYREC IYGT
Sbjct  316  FIAKDMTFENTAGPEKHQAVALRSNADRSIFYRCSFKGYQDTLYAHSNRQFYRECHIYGT  375

Query  622  VDFIFGNAAVVFQNCNIYARNPP-NKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFG+  VVFQNCNI+ R P  N+ NTITAQ RSDPN+N+G  IHN  + AA DLK  
Sbjct  376  VDFIFGDGVVVFQNCNIFVRKPMLNQKNTITAQARSDPNENSGFVIHNSVIGAAPDLKPV  435

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
             G   TYLGRPW+ YSRTV MK+ +D LI+PAGWLPW G+F L T+YYGE+ NTG GA+T
Sbjct  436  QGLYGTYLGRPWKAYSRTVIMKSYMDGLIEPAGWLPWAGDFGLRTVYYGEFMNTGDGANT  495

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
              RV+W GYHV+TSA EA +FTV +F+ GG W+PAT VPF +GL
Sbjct  496  KGRVEWPGYHVMTSAVEAERFTVESFLEGGGWIPATGVPFVNGL  539



>ref|XP_004290810.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Fragaria vesca subsp. vesca]
Length=560

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 227/283 (80%), Gaps = 1/283 (0%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            ++IYV AGVY+E V I    + +M+VGDGI +TI+TG+RSV  G TTF SAT+AVV  GF
Sbjct  277  FMIYVTAGVYEEYVSIAKNKRYLMMVGDGINQTILTGNRSVVDGWTTFNSATLAVVAPGF  336

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            +   +TFRNTAGAA HQAVA+R+G+DLS FY CSFE YQDTLY +S RQFYRECDIYGTV
Sbjct  337  VAVNMTFRNTAGAAKHQAVAVRNGADLSTFYSCSFEAYQDTLYTHSLRQFYRECDIYGTV  396

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNAAVV QNCNIY R P   + N ITAQGR+DPNQNTG SIHNC + AA DL  S 
Sbjct  397  DFIFGNAAVVLQNCNIYPRLPMTGQFNAITAQGRTDPNQNTGTSIHNCTIRAADDLASSN  456

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            G+ +TYLGRPW++YSRTV+M++++DS+++ AGW  WDG FAL+TLYY EY+NTGAG+ T 
Sbjct  457  GTTQTYLGRPWKEYSRTVYMQSNIDSVVNSAGWRAWDGEFALSTLYYAEYNNTGAGSDTT  516

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV WAGYHVIT++++AS FTV NF+ G  WLP T VP+T GL
Sbjct  517  NRVTWAGYHVITNSSDASNFTVSNFLLGEDWLPQTGVPYTGGL  559



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 225/284 (79%), Gaps = 1/284 (0%)
 Frame = -1

Query  982  RYVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDG  803
            R+VIY+KAG Y ENVE+ SK  NIM +GDGIGKT I G+R+V  G TTF+SATVA VG G
Sbjct  277  RFVIYIKAGSYFENVEVISKKTNIMFLGDGIGKTWIKGNRNVVDGWTTFRSATVAAVGSG  336

Query  802  FIGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGT  623
            FI +GI+F N AG + HQAVA RSGSDLS FY CSF GYQDTLYV+S RQFYRECDIYGT
Sbjct  337  FIAKGISFENYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDTLYVHSLRQFYRECDIYGT  396

Query  622  VDFIFGNAAVVFQNCNIYARNP-PNKTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGS  446
            VDFIFGNAAVVFQNCN+YAR P  N+ N  TAQGR DPNQNTGISI NCKV AA+DL   
Sbjct  397  VDFIFGNAAVVFQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPV  456

Query  445  LGSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGAST  266
              S KTYLGRPW++YSRTV+M ++++ ++DPAGWL W+G FALNTLYY EY N G G++T
Sbjct  457  KSSFKTYLGRPWKEYSRTVYMLSNIEDVVDPAGWLEWNGTFALNTLYYAEYRNQGPGSNT  516

Query  265  ANRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            + RV W GY V+T+ TEA++FTV +FI G  WL  T++P+  GL
Sbjct  517  SARVTWPGYKVLTNVTEATQFTVSSFIQGNDWLNGTSIPYYLGL  560



>emb|CBI36882.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   377 bits (968),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 189/283 (67%), Positives = 229/283 (81%), Gaps = 2/283 (1%)
 Frame = -1

Query  979  YVIYVKAGVYKENVEIGSKLKNIMLVGDGIGKtiitgsrsvgggttTFKSATVAVVGDGF  800
            +VIY++AGVY+E V I    K +M++GDGI +T+ITG+RSV  G TTF SAT AVV  GF
Sbjct  284  FVIYIQAGVYEEYVSIAKNKKYLMMIGDGINQTVITGNRSVVDGWTTFNSATFAVVAQGF  343

Query  799  IGQGITFRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVYSDRQFYRECDIYGTV  620
            +   ITFRNTAGAA HQAVALRSG+DLS FY CSFE YQDTLY +S RQFYRECDIYGTV
Sbjct  344  VAVNITFRNTAGAAKHQAVALRSGADLSTFYLCSFEAYQDTLYTHSLRQFYRECDIYGTV  403

Query  619  DFIFGNAAVVFQNCNIYARNPPN-KTNTITAQGRSDPNQNTGISIHNCKVTAASDLKGSL  443
            DFIFGNAAVVFQNCN+Y R P + + N ITAQGR+DPNQNTG SIHNC + AA DL  S 
Sbjct  404  DFIFGNAAVVFQNCNLYPRLPLSGQFNAITAQGRTDPNQNTGTSIHNCVIRAADDLAASN  463

Query  442  GSVKTYLGRPWQQYSRTVFMKTSLDSLIDPAGWLPWDGNFALNTLYYGEYSNTGAGASTA  263
            G+ KTYLGRPW++YSRTV+M++++ SLI+P+GW  W G+FAL+TLYY EY+NTG G++T+
Sbjct  464  GTTKTYLGRPWKEYSRTVYMQSNMGSLINPSGWSIWSGDFALSTLYYAEYNNTGPGSNTS  523

Query  262  NRVKWAGYHVITSATEASKFTVGNFIAGGSWLPATNVPFTSGL  134
            NRV W+GYHVI   ++A+ FTVGNF+ GG WLP T VP+T GL
Sbjct  524  NRVTWSGYHVI-GPSDAANFTVGNFLLGGDWLPQTGVPYTGGL  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2157395784052