BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25778_g5_i3 len=1635 path=[32744:0-19 18687:20-578 19244:579-656
10797:657-698 29742:699-719 19384:720-810 19474:811-816
13901:817-914 30091:915-926 19587:927-1040 32018:1041-1041
32019:1042-1063 19723:1064-1069 19729:1070-1113 12897:1114-1178
19834:1179-1208 7113:1209-1305 19960:1306-1509 20164:1510-1527
15987:1528-1530 15990:1531-1538 32711:1539-1569 29580:1570-1601
10512:1602-1605 32809:1606-1610 32814:1611-1634]

Length=1635
                                                                      Score     E

ref|XP_011100359.1|  PREDICTED: uncharacterized protein At5g43822       259   3e-79   
ref|XP_009631090.1|  PREDICTED: uncharacterized protein At5g43822...    258   9e-79   
ref|XP_009760527.1|  PREDICTED: uncharacterized protein At5g43822       257   1e-78   
ref|XP_009618641.1|  PREDICTED: uncharacterized protein At5g43822...    257   1e-78   
ref|XP_002272933.1|  PREDICTED: uncharacterized protein At5g43822       255   6e-78   Vitis vinifera
ref|XP_004238440.1|  PREDICTED: uncharacterized protein At5g43822       253   5e-77   
emb|CDP11407.1|  unnamed protein product                                253   6e-77   
ref|XP_009796596.1|  PREDICTED: uncharacterized protein At5g43822...    244   1e-73   
ref|XP_009796598.1|  PREDICTED: uncharacterized protein At5g43822...    244   1e-73   
ref|XP_009796599.1|  PREDICTED: uncharacterized protein At5g43822...    243   2e-73   
ref|XP_009796595.1|  PREDICTED: uncharacterized protein At5g43822...    242   7e-73   
ref|XP_009355348.1|  PREDICTED: uncharacterized protein At5g43822...    242   8e-73   
ref|XP_009796594.1|  PREDICTED: uncharacterized protein At5g43822...    242   1e-72   
ref|XP_009350833.1|  PREDICTED: uncharacterized protein At5g43822...    239   2e-71   
ref|XP_010671271.1|  PREDICTED: uncharacterized protein At5g43822       234   1e-69   
ref|XP_006342253.1|  PREDICTED: uncharacterized protein At5g43822...    234   3e-69   
ref|XP_008378915.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    233   4e-69   
ref|XP_010061194.1|  PREDICTED: uncharacterized protein At5g43822       231   1e-68   
ref|XP_008237966.1|  PREDICTED: uncharacterized protein At5g43822...    231   1e-68   
gb|EYU29248.1|  hypothetical protein MIMGU_mgv1a014791mg                230   2e-68   
ref|XP_007210800.1|  hypothetical protein PRUPE_ppa017655mg             229   7e-68   
ref|XP_008347929.1|  PREDICTED: uncharacterized protein At5g43822...    228   2e-67   
ref|XP_004300129.1|  PREDICTED: uncharacterized protein At5g43822...    225   2e-66   
ref|XP_006435396.1|  hypothetical protein CICLE_v10002549mg             223   1e-65   
ref|XP_010266218.1|  PREDICTED: uncharacterized protein At5g43822       223   1e-65   
ref|XP_006473817.1|  PREDICTED: uncharacterized protein At5g43822...    223   1e-65   
ref|XP_004506410.1|  PREDICTED: uncharacterized protein At5g43822...    223   2e-65   
ref|XP_011041205.1|  PREDICTED: uncharacterized protein At5g43822       221   1e-64   
ref|XP_007036443.1|  Pentatricopeptide repeat (PPR) superfamily p...    220   2e-64   
ref|XP_010112541.1|  hypothetical protein L484_007551                   211   3e-61   
ref|XP_008237965.1|  PREDICTED: uncharacterized protein At5g43822...    210   1e-60   
ref|XP_008339419.1|  PREDICTED: uncharacterized protein At5g43822...    207   9e-60   
ref|XP_006586169.1|  PREDICTED: uncharacterized protein At5g43822...    207   9e-60   
ref|XP_003605502.1|  hypothetical protein MTR_4g032370                  207   1e-59   
gb|KHG06032.1|  hypothetical protein F383_32806                         206   3e-59   
gb|AFK49433.1|  unknown                                                 204   1e-58   
ref|XP_006435395.1|  hypothetical protein CICLE_v10002549mg             200   3e-57   
gb|KEH43835.1|  PPR superfamily protein                                 201   3e-57   
ref|XP_006435394.1|  hypothetical protein CICLE_v10002549mg             199   3e-57   
ref|XP_010935316.1|  PREDICTED: uncharacterized protein At5g43822       199   2e-56   
ref|XP_008813326.1|  PREDICTED: uncharacterized protein At5g43822...    198   4e-56   
ref|XP_007036445.1|  Pentatricopeptide repeat (PPR) superfamily p...    195   2e-55   
ref|XP_008447827.1|  PREDICTED: uncharacterized protein At5g43822...    195   8e-55   
ref|XP_004144893.1|  PREDICTED: uncharacterized protein At5g43822...    194   2e-54   
ref|XP_007146790.1|  hypothetical protein PHAVU_006G070300g             193   2e-54   
ref|XP_007036444.1|  Pentatricopeptide repeat superfamily protein...    194   3e-54   
ref|XP_008813327.1|  PREDICTED: uncharacterized protein At5g43822...    192   3e-54   
ref|XP_006855714.1|  hypothetical protein AMTR_s00044p00147390          192   6e-54   
ref|XP_006403176.1|  hypothetical protein EUTSA_v10003275mg             189   6e-53   
ref|XP_002510698.1|  conserved hypothetical protein                     188   1e-52   Ricinus communis
ref|NP_001065428.1|  Os10g0566900                                       187   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KHN01819.1|  Hypothetical protein glysoja_028491                     187   3e-52   
ref|XP_008447830.1|  PREDICTED: uncharacterized protein At5g43822...    186   7e-52   
ref|XP_008447828.1|  PREDICTED: uncharacterized protein At5g43822...    186   1e-51   
ref|XP_010549356.1|  PREDICTED: uncharacterized protein At5g43822       186   1e-51   
ref|XP_006586171.1|  PREDICTED: enhancer of mRNA-decapping protei...    194   6e-51   
dbj|BAJ99010.1|  predicted protein                                      183   1e-50   
gb|KHN01816.1|  Hypothetical protein glysoja_028488                     194   3e-50   
gb|KEH43832.1|  PPR superfamily protein                                 181   3e-50   
gb|KEH43829.1|  PPR superfamily protein                                 181   5e-50   
gb|KEH43831.1|  PPR superfamily protein                                 181   8e-50   
gb|KEH43833.1|  PPR superfamily protein                                 181   8e-50   
gb|EMS53980.1|  hypothetical protein TRIUR3_11706                       180   1e-49   
ref|XP_006662076.1|  PREDICTED: uncharacterized protein At5g43822...    180   2e-49   
ref|XP_009101759.1|  PREDICTED: uncharacterized protein At5g43822       180   2e-49   
emb|CDX94726.1|  BnaC07g17350D                                          180   3e-49   
gb|KEH43830.1|  PPR superfamily protein                                 178   3e-49   
gb|EMT01518.1|  hypothetical protein F775_13166                         179   3e-49   
ref|XP_008813328.1|  PREDICTED: uncharacterized protein At5g43822...    177   9e-49   
ref|NP_001154759.1|  uncharacterized protein                            177   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574356.1|  PREDICTED: uncharacterized protein At5g43822...    176   7e-48   
ref|XP_010494364.1|  PREDICTED: uncharacterized protein At5g43822...    176   8e-48   
ref|XP_010481821.1|  PREDICTED: uncharacterized protein At5g43822       175   1e-47   
ref|XP_004983608.1|  PREDICTED: uncharacterized protein At5g43822...    175   1e-47   
ref|XP_009392317.1|  PREDICTED: uncharacterized protein At5g43822       175   2e-47   
ref|XP_010441982.1|  PREDICTED: uncharacterized protein At5g43822...    174   2e-47   
ref|NP_001132257.2|  hypothetical protein                               169   3e-45   Zea mays [maize]
ref|XP_007140428.1|  hypothetical protein PHAVU_008G111000g             168   4e-45   
gb|ABR18239.1|  unknown                                                 169   1e-44   Picea sitchensis
ref|XP_002467466.1|  hypothetical protein SORBIDRAFT_01g028600          156   1e-40   Sorghum bicolor [broomcorn]
dbj|BAB11311.1|  unnamed protein product                                164   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865400.1|  pentatricopeptide repeat-containing protein        163   6e-40   
ref|XP_010235008.1|  PREDICTED: uncharacterized protein At5g43822...    152   3e-39   
ref|XP_006281724.1|  hypothetical protein CARUB_v10027881mg             148   5e-38   
ref|XP_002461050.1|  hypothetical protein SORBIDRAFT_02g039850          147   2e-37   Sorghum bicolor [broomcorn]
gb|EPS66813.1|  hypothetical protein M569_07963                         143   2e-36   
gb|KEH43834.1|  PPR superfamily protein                                 140   2e-35   
ref|XP_007146792.1|  hypothetical protein PHAVU_006G070300g             135   1e-33   
ref|XP_006383777.1|  hypothetical protein POPTR_0005s27450g             124   2e-29   
ref|XP_007146791.1|  hypothetical protein PHAVU_006G070300g             116   4e-27   
gb|KDP36773.1|  hypothetical protein JCGZ_08064                         115   7e-27   
emb|CAN77658.1|  hypothetical protein VITISV_030913                     119   7e-27   Vitis vinifera
gb|EMT03253.1|  hypothetical protein F775_19810                         110   5e-24   
gb|KHN09549.1|  hypothetical protein glysoja_047362                   92.4    5e-19   
dbj|BAM64852.1|  hypothetical protein                                 80.5    9e-13   
ref|XP_007146680.1|  hypothetical protein PHAVU_006G0604000g          58.9    2e-07   



>ref|XP_011100359.1| PREDICTED: uncharacterized protein At5g43822 [Sesamum indicum]
Length=199

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQ+FR+VKDE+ RW+EL +RL+SQF+NASSIIQRLQVIQ  +NYGALKC++ 
Sbjct  1     MESIVKKYQQKFRRVKDEMCRWDELQSRLISQFSNASSIIQRLQVIQDCRNYGALKCVED  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+AVLAKQ+ SLQTILLS+NKT+E FH IV + EKIVRDSRQ VK GS+QP  KQL+QR
Sbjct  61    IENAVLAKQMESLQTILLSINKTMEEFHGIVSSLEKIVRDSRQLVKAGSSQPTAKQLKQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKP+LA+CLDGL +L EMHQSEY LKLS+VSA   LALKPS + DL  LQQLLVDQPN
Sbjct  121   VGVKPTLAECLDGLRLLEEMHQSEYLLKLSVVSALPALALKPSESGDLVALQQLLVDQPN  180

Query  753   IPKEEVQFIFDIIFAEDI  700
             IP+EEVQFI+DI+FAE+I
Sbjct  181   IPREEVQFIYDIVFAEEI  198



>ref|XP_009631090.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631091.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631092.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631093.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631094.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631095.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009631097.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
Length=196

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKVK+ +D W +L +RLLSQFTNASSIIQRLQ++Q SKNYGAL+C++G
Sbjct  1     MENIVKKYQQRFRKVKEGMDTWNDLQSRLLSQFTNASSIIQRLQILQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+AVL KQ++SLQTILLSMN+T+E F S+VL+ EK+VRD RQ +KGGS Q  VKQLQQR
Sbjct  61    IEEAVLLKQMDSLQTILLSMNQTMEKFRSVVLSLEKMVRDGRQLIKGGSTQVTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKPS+ADCLDGL +L EMHQSEY      +S  S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGVKPSIADCLDGLKLLCEMHQSEYH---LKLSVISAVALKPSATDDLGALQQLLVDQPN  177

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPKEEVQFIFDIIFAE++
Sbjct  178   IPKEEVQFIFDIIFAEEM  195



>ref|XP_009760527.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760528.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760529.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760530.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760531.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760532.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
 ref|XP_009760533.1| PREDICTED: uncharacterized protein At5g43822 [Nicotiana sylvestris]
Length=196

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQ++Q SKNYGAL C++G
Sbjct  1     MENIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQILQDSKNYGALSCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +AVL KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGG  Q  VKQLQQR
Sbjct  61    IAEAVLLKQMDSLQTILLSMNQTLENFRSVVLSLEKMVRDGRQLVKGGYTQVTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKPS+ADCLDGL +L EMHQSEY      +S  S +ALKPS TDDL +LQQLLVDQPN
Sbjct  121   VGVKPSIADCLDGLKLLCEMHQSEYH---LKLSVISAVALKPSATDDLGMLQQLLVDQPN  177

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPKEEVQFIFDIIFAE++
Sbjct  178   IPKEEVQFIFDIIFAEEM  195



>ref|XP_009618641.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009618642.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
 ref|XP_009618643.1| PREDICTED: uncharacterized protein At5g43822-like [Nicotiana 
tomentosiformis]
Length=199

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKVK+E+D W +L +RLLSQFTN SSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MENIVKKYQQRFRKVKEEMDTWIDLQSRLLSQFTNVSSIIQRLQVLQNSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I++AVL KQ+ SLQ IL+SMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQR
Sbjct  61    IQEAVLLKQMESLQIILISMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSE RLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSECRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPKEEVQFIFDIIFAE++
Sbjct  181   IPKEEVQFIFDIIFAEEM  198



>ref|XP_002272933.1| PREDICTED: uncharacterized protein At5g43822 [Vitis vinifera]
 emb|CBI40736.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ+FRKV+DE  RW+EL +RLLSQF NASSII+RLQ IQ SKNYG LKCI G
Sbjct  1     MEGMVKKYQQKFRKVRDETKRWDELQSRLLSQFRNASSIIERLQSIQNSKNYGTLKCIDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I DAVL KQ+ SL+TILLS+ KTL+ FH IVL+ EKIVRD RQ VKGGS +  +KQLQQR
Sbjct  61    IGDAVLRKQMESLETILLSLKKTLKEFHGIVLSLEKIVRDGRQLVKGGSVKLTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKPSLADCLDGL++L EMHQSEY LK S+VSA STL LKPS   DL  L QLLVDQPN
Sbjct  121   IGVKPSLADCLDGLSLLHEMHQSEYLLKSSVVSALSTLTLKPS-ASDLGALHQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPKEEVQFIFDI+FAE+IC
Sbjct  180   IPKEEVQFIFDIVFAEEIC  198



>ref|XP_004238440.1| PREDICTED: uncharacterized protein At5g43822 [Solanum lycopersicum]
 ref|XP_004245434.1| PREDICTED: uncharacterized protein At5g43822-like [Solanum lycopersicum]
 ref|XP_010320467.1| PREDICTED: uncharacterized protein At5g43822 [Solanum lycopersicum]
Length=199

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             M+  +KKYQQRFRKVK+E+++W EL +RLLSQF NASSIIQRLQ++Q SKNYGAL C++ 
Sbjct  1     MDVIIKKYQQRFRKVKEEMEKWNELQSRLLSQFNNASSIIQRLQILQDSKNYGALTCVEA  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I++AVL KQ+NSLQ ILLSMN+T+E FH +VL+ +K+VRD RQ +KGGS Q NVKQLQQ 
Sbjct  61    IQEAVLLKQMNSLQNILLSMNETMEKFHVVVLSLDKMVRDGRQLIKGGSVQKNVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S  AL+PS TDDL+ LQQLL DQPN
Sbjct  121   VGMKPSIADCLDGLQLLYEMHQSEYRLKLSVISAISAFALQPSATDDLAALQQLLDDQPN  180

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPKEEVQ IF+IIFAE+I 
Sbjct  181   IPKEEVQVIFEIIFAEEIA  199



>emb|CDP11407.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQ+FRKVK+E+ RWEEL +RL+SQFT+AS+IIQRLQ++Q SK YGAL+C+QG
Sbjct  1     MESMVKKYQQKFRKVKEEMGRWEELQSRLISQFTSASAIIQRLQLLQDSKKYGALQCVQG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I+DAVLAKQL SLQTILLSMNKTLE F  +  + EK+VRD RQ VKGGSA    KQLQQR
Sbjct  61    IQDAVLAKQLESLQTILLSMNKTLEDFRGVSSSLEKVVRDGRQLVKGGSAVATAKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKPSLADCL+GL +LSEMH SEY LK S++SA + ++L PS ++DL+ LQQLLVDQPN
Sbjct  121   VGVKPSLADCLEGLRLLSEMHHSEYLLKSSVISALAKVSLTPSASNDLNALQQLLVDQPN  180

Query  753   IPKEEVQFIFDIIFAEDI  700
             IP+EEV  IFDIIFAE+I
Sbjct  181   IPREEVHGIFDIIFAEEI  198



>ref|XP_009796596.1| PREDICTED: uncharacterized protein At5g43822-like isoform X3 
[Nicotiana sylvestris]
Length=193

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MESIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQVLQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+A+L KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQ 
Sbjct  61    IEEAILLKQMDSLQTILLSMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSEYRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEEVQFIFDI  718
             IPKEE   +  +
Sbjct  181   IPKEEGDVVLQV  192



>ref|XP_009796598.1| PREDICTED: uncharacterized protein At5g43822-like isoform X4 
[Nicotiana sylvestris]
Length=189

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MESIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQVLQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+A+L KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQ 
Sbjct  61    IEEAILLKQMDSLQTILLSMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSEYRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEE  739
             IPKEE
Sbjct  181   IPKEE  185



>ref|XP_009796599.1| PREDICTED: uncharacterized protein At5g43822-like isoform X5 
[Nicotiana sylvestris]
Length=186

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MESIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQVLQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+A+L KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQ 
Sbjct  61    IEEAILLKQMDSLQTILLSMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSEYRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEE  739
             IPKEE
Sbjct  181   IPKEE  185



>ref|XP_009796595.1| PREDICTED: uncharacterized protein At5g43822-like isoform X2 
[Nicotiana sylvestris]
Length=205

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MESIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQVLQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+A+L KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQ 
Sbjct  61    IEEAILLKQMDSLQTILLSMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSEYRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEE  739
             IPKEE
Sbjct  181   IPKEE  185



>ref|XP_009355348.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
 ref|XP_009355349.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
 ref|XP_009355350.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
 ref|XP_009355351.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
 ref|XP_009355352.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
Length=199

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 166/200 (83%), Gaps = 2/200 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKV+DE++ W  L +RL+SQF NASSIIQRLQV+Q SKNYG LK + G
Sbjct  1     MEAMVKKYQQRFRKVRDEMNSWAVLQSRLISQFRNASSIIQRLQVLQDSKNYGCLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQ  937
             IE+A+LAKQ++SLQ ILLSM KT+E FH IVL+  KI RD RQ VK GGS+Q +VKQLQQ
Sbjct  61    IEEALLAKQMDSLQNILLSMKKTMEEFHVIVLSLGKIHRDGRQMVKGGGSSQLSVKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             R+GVKPSLADCLDGL +L +MH SEY LK SLV+A S L LKPS   DL  LQQLLVDQP
Sbjct  121   RVGVKPSLADCLDGLMLLQDMHCSEYLLKSSLVTALSQLTLKPS-ASDLGALQQLLVDQP  179

Query  756   NIPKEEVQFIFDIIFAEDIC  697
             NIPKEEVQFIFDIIFAEDIC
Sbjct  180   NIPKEEVQFIFDIIFAEDIC  199



>ref|XP_009796594.1| PREDICTED: uncharacterized protein At5g43822-like isoform X1 
[Nicotiana sylvestris]
Length=213

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKKYQQRFRKVK+E+D W +L +RLLSQFTNASSIIQRLQV+Q SKNYGAL+C++G
Sbjct  1     MESIVKKYQQRFRKVKEEMDTWNDLQSRLLSQFTNASSIIQRLQVLQDSKNYGALRCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE+A+L KQ++SLQTILLSMN+TLE F S+VL+ EK+VRD RQ VKGGS Q  VKQLQQ 
Sbjct  61    IEEAILLKQMDSLQTILLSMNQTLEKFRSVVLSLEKMVRDGRQLVKGGSTQVTVKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPS+ADCLDGL +L EMHQSEYRLKLS++SA S +ALKPS TDDL  LQQLLVDQPN
Sbjct  121   VGIKPSIADCLDGLKLLCEMHQSEYRLKLSVISAISAVALKPSATDDLGALQQLLVDQPN  180

Query  753   IPKEE  739
             IPKEE
Sbjct  181   IPKEE  185



>ref|XP_009350833.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
 ref|XP_009350834.1| PREDICTED: uncharacterized protein At5g43822-like [Pyrus x bretschneideri]
Length=199

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 161/200 (81%), Gaps = 2/200 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VK+YQQRFRKVKDE+D W  L +RL SQF NASSIIQRLQV+Q SKNYG LK + G
Sbjct  1     MEPMVKRYQQRFRKVKDEMDSWALLQSRLTSQFRNASSIIQRLQVLQDSKNYGRLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGG-SAQPNVKQLQQ  937
             IE+A+LAKQ+ SLQ I LSM KT+E FH IVL+  KI RD RQ VKGG S Q +VKQLQQ
Sbjct  61    IEEALLAKQMESLQNIFLSMKKTMEEFHGIVLSLGKIHRDGRQMVKGGASGQLSVKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             RIGVKPSLADCLDGL +L +MH SEY LK SLVSA S L LKPS   DL  LQQLLVDQP
Sbjct  121   RIGVKPSLADCLDGLILLQDMHSSEYLLKSSLVSALSELTLKPS-ASDLGALQQLLVDQP  179

Query  756   NIPKEEVQFIFDIIFAEDIC  697
             NIPKEEVQFIFDIIFAE+IC
Sbjct  180   NIPKEEVQFIFDIIFAEEIC  199



>ref|XP_010671271.1| PREDICTED: uncharacterized protein At5g43822 [Beta vulgaris subsp. 
vulgaris]
Length=198

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  +KKYQQ+F+KV++E+D WE L +RL+SQF+NASSIIQRLQVI   KNYG LK + G
Sbjct  1     MEGILKKYQQKFKKVREEMDNWENLQSRLISQFSNASSIIQRLQVIGDKKNYGNLKGVDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAVL KQ+ SL+  LLSM  T+E FH IVL+ EK+VRDS+Q + GGS QP+ KQLQQR
Sbjct  61    IEDAVLQKQMESLENNLLSMKNTMEEFHKIVLSLEKMVRDSKQLLGGGSRQPSTKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPSL+DCLDGL IL EMH+SEY LK S+VSA   +A K S ++DL  L+QLLVDQPN
Sbjct  121   MGIKPSLSDCLDGLVILQEMHKSEYLLKTSVVSALLKIAFKAS-SNDLGALRQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IP++EVQFIFDIIFAE+IC
Sbjct  180   IPRDEVQFIFDIIFAENIC  198



>ref|XP_006342253.1| PREDICTED: uncharacterized protein At5g43822-like [Solanum tuberosum]
Length=234

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 171/234 (73%), Gaps = 35/234 (15%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             M+  +KKYQQRFRKVK+E++ W EL +RL+SQF NASSIIQRLQ++Q SKNYGAL C++G
Sbjct  1     MDIIIKKYQQRFRKVKEEMENWNELQSRLISQFINASSIIQRLQILQDSKNYGALTCVEG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I++AVL KQ+NSLQTILLSMN+T+E FHS+VL+ +K+VRD RQ +KGGS Q N+KQLQQ 
Sbjct  61    IQEAVLLKQMNSLQTILLSMNETMEKFHSVVLSLDKMVRDGRQLIKGGSVQKNLKQLQQH  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRl---------------------------------  853
             +G+KPS+ADCLDGL +L EMHQSEY                                   
Sbjct  121   VGMKPSIADCLDGLQLLYEMHQSEYAYNHPLLLELFLILALFVILHRTFVTDSPSTFFRY  180

Query  852   --klslvsatstlalKPSvtddlsvlqqllvdQPNIPKEEVQFIFDIIFAEDIC  697
               KLS++SA S  ALKPS TDDL  LQQLLVDQPNIPKEEVQ IF+IIFAE+I 
Sbjct  181   CLKLSVISAISAFALKPSATDDLGALQQLLVDQPNIPKEEVQVIFEIIFAEEIA  234



>ref|XP_008378915.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g43822-like 
[Malus domestica]
Length=201

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 160/202 (79%), Gaps = 4/202 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKV+DE+D W  L +RL+SQF NASSI+QRLQV+Q SKNYG LK +  
Sbjct  1     MEAMVKKYQQRFRKVRDEMDSWAVLQSRLISQFRNASSIVQRLQVLQDSKNYGCLKDVVS  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQ  937
             IE+A+LAKQ++SLQ ILLSM KT+E FH IVL+  KI RD  Q  K GGS+Q +VKQLQQ
Sbjct  61    IEEALLAKQMDSLQNILLSMKKTMEEFHVIVLSLGKIHRDGGQMAKGGGSSQLSVKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEY--RlklslvsatstlalKPSvtddlsvlqqllvd  763
             R+GVKPSLADCLDGL +L +MH SEY  +  L   +A S L LKPS   +L  LQQLLVD
Sbjct  121   RVGVKPSLADCLDGLMLLQDMHCSEYLLKSSLVTGTALSQLTLKPS-ASBLGALQQLLVD  179

Query  762   QPNIPKEEVQFIFDIIFAEDIC  697
             QPNIP+EEVQFIFDIIFAEDIC
Sbjct  180   QPNIPREEVQFIFDIIFAEDIC  201



>ref|XP_010061194.1| PREDICTED: uncharacterized protein At5g43822 [Eucalyptus grandis]
 gb|KCW68113.1| hypothetical protein EUGRSUZ_F01788 [Eucalyptus grandis]
Length=198

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+AV+K+QQ+F+KV++E+DRW EL  RL+SQF NASSI+ RLQVI+  KNYG LK + G
Sbjct  1     MEAAVRKFQQKFKKVREEMDRWGELQLRLVSQFRNASSIMDRLQVIRDGKNYGPLKAVDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +AV  KQ+ SL+ I+LSM KT+E FH +V++ EKI RD +Q VKGGS QP+VK LQQR
Sbjct  61    IGEAVWTKQVESLENIMLSMRKTMEEFHGVVMSLEKIHRDGKQLVKGGSGQPSVKYLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKP L DCLDGL IL EMH+SEY LK S+VSA STLALKPS   DL  LQQLLVDQPN
Sbjct  121   VGVKPCLQDCLDGLMILYEMHRSEYFLKSSVVSALSTLALKPS-ASDLHALQQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPKEEVQFI+DIIFAE+IC
Sbjct  180   IPKEEVQFIYDIIFAEEIC  198



>ref|XP_008237966.1| PREDICTED: uncharacterized protein At5g43822 isoform X2 [Prunus 
mume]
Length=198

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKV+DE+DRW EL +RL+SQF NASSIIQRLQV++ SK Y  LK + G
Sbjct  1     MEAMVKKYQQRFRKVRDEMDRWSELQSRLISQFRNASSIIQRLQVLRDSKKYVRLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQ  937
             I++AVLAKQ+ SLQ IL SMNKT+E FH IVL+F KI RD RQ VK GGS Q  ++QLQQ
Sbjct  61    IQEAVLAKQMESLQKILFSMNKTMEEFHGIVLSFGKIHRDGRQMVKGGGSNQLTIRQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             R+GVKPSLADCLDGL +L EMH SEY LK S+VSA S L LKPS   DL  LQQLLVDQP
Sbjct  121   RVGVKPSLADCLDGLMLLQEMHCSEYLLKSSVVSALSALTLKPS-ASDLGALQQLLVDQP  179

Query  756   NIPKEEVQFIFDIIFAEDI  700
             NIP EEVQ IFDIIFAE+I
Sbjct  180   NIPNEEVQSIFDIIFAEEI  198



>gb|EYU29248.1| hypothetical protein MIMGU_mgv1a014791mg [Erythranthe guttata]
Length=178

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES V+KYQQRFRKVKDE+ +WEELH+RL+SQF+NASSIIQRLQVIQ S N+G LKC+ G
Sbjct  1     MESIVRKYQQRFRKVKDEMSQWEELHSRLISQFSNASSIIQRLQVIQNSNNFGGLKCVDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I+DAVLAKQ++SLQ I +SMNKT+E  HS+V + EKIVRDS+Q VK GSAQP  KQL+QR
Sbjct  61    IQDAVLAKQMDSLQNIFISMNKTMEELHSVVRSLEKIVRDSKQLVKVGSAQPTAKQLRQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +GVKP+LADCLDGL +L EMHQSEY
Sbjct  121   VGVKPTLADCLDGLRLLQEMHQSEY  145



>ref|XP_007210800.1| hypothetical protein PRUPE_ppa017655mg [Prunus persica]
 gb|EMJ11999.1| hypothetical protein PRUPE_ppa017655mg [Prunus persica]
Length=199

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKV+DE+DRW  L +RL+SQF NASSIIQRLQV+  SK Y  LK + G
Sbjct  1     MEAMVKKYQQRFRKVRDEMDRWSSLQSRLISQFRNASSIIQRLQVLLDSKKYVRLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQ  937
             I++AVLAKQ+ SL+ IL SMNKT+E FH IVL+  KI RD RQ VK GGS Q  VKQLQQ
Sbjct  61    IQEAVLAKQMESLRKILFSMNKTMEEFHGIVLSLGKIHRDGRQMVKGGGSNQLTVKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             R+GVKP LADCLDGL +L +MH SEY LK SLVSA S L  KPS   DL  LQQLLVDQP
Sbjct  121   RVGVKPRLADCLDGLMLLQDMHCSEYLLKSSLVSALSALTFKPS-ASDLGALQQLLVDQP  179

Query  756   NIPKEEVQFIFDIIFAEDIC  697
             NIP EEVQFIFDIIFAE+IC
Sbjct  180   NIPNEEVQFIFDIIFAEEIC  199



>ref|XP_008347929.1| PREDICTED: uncharacterized protein At5g43822-like [Malus domestica]
Length=196

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  1281  VKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQGIEDA  1102
             VKKYQQRFRKV+DE+D W  L +RL+SQF NASSIIQRLQV+Q SKNYG LK +  IE+A
Sbjct  2     VKKYQQRFRKVRDEMDSWAVLQSRLISQFRNASSIIQRLQVLQDSKNYGCLKDVVSIEEA  61

Query  1101  VLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQRIGV  925
             +LAKQ++SLQ ILLSM KT+E FH IVL+  KI  D  Q  K GGS+Q +VKQLQQR+GV
Sbjct  62    LLAKQMDSLQNILLSMKKTMEEFHVIVLSLGKIHXDGXQMAKGGGSSQLSVKQLQQRVGV  121

Query  924   KPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIPK  745
             KPSLADCLDGL +L +MH SEY LK SLV+A S L LKPS   +L  LQQLLVDQPNIP 
Sbjct  122   KPSLADCLDGLMLLQDMHCSEYLLKSSLVTALSQLTLKPS-ASBLGALQQLLVDQPNIPX  180

Query  744   EEVQFIFDIIFAEDIC  697
             EEVQFIFDIIFAEDIC
Sbjct  181   EEVQFIFDIIFAEDIC  196



>ref|XP_004300129.1| PREDICTED: uncharacterized protein At5g43822-like [Fragaria vesca 
subsp. vesca]
Length=199

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 2/200 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYG-ALKCIQ  1117
             ME+ VKKYQQRFRKV+DE++ W EL + L SQF NASSIIQRLQV+Q S NYG  L+ + 
Sbjct  1     MEAMVKKYQQRFRKVRDEMETWAELQSLLTSQFRNASSIIQRLQVLQDSNNYGEGLRGVA  60

Query  1116  GIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQ  937
              +++AVL KQ+ SLQ +LLSMN TLE FH IVL+  +I RD RQ +KGGS+Q + KQLQQ
Sbjct  61    HLQEAVLLKQMESLQKLLLSMNNTLEQFHGIVLSLGRIHRDGRQMIKGGSSQLSFKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             R+GVKPSLADC+DGL +L +MH SEY LK SLVSA S L  KPS   DL  LQQ+L+DQP
Sbjct  121   RVGVKPSLADCVDGLMLLQDMHCSEYLLKSSLVSALSELTSKPS-ASDLGSLQQILIDQP  179

Query  756   NIPKEEVQFIFDIIFAEDIC  697
             NIPKEEVQFIFDIIFAE+IC
Sbjct  180   NIPKEEVQFIFDIIFAEEIC  199



>ref|XP_006435396.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
 ref|XP_006473818.1| PREDICTED: uncharacterized protein At5g43822-like isoform X2 
[Citrus sinensis]
 gb|ESR48636.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
 gb|KDO85149.1| hypothetical protein CISIN_1g028912mg [Citrus sinensis]
Length=198

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ+F+K+K+E++RW+EL +RL+SQF NASSII+RLQ++Q +K+YG L  I G
Sbjct  1     MEGIVKKYQQKFKKIKEEMNRWDELQSRLISQFKNASSIIERLQILQDAKHYGNLNSIGG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ+ SLQTILLSM KTLE F  IVL+ EK  RD +Q V+GGS Q  VKQLQQR
Sbjct  61    IEAAVLRKQMESLQTILLSMQKTLEEFRGIVLSLEKFHRDGKQLVRGGSNQLTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KP+LADCLDGL IL +MH SEY LK+SLVS  STLA+KP  T DL  LQQLLVDQPN
Sbjct  121   VGLKPTLADCLDGLMILWDMHNSEYVLKISLVSTLSTLAVKPC-TFDLGALQQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPKEEVQ+I +IIFAE+IC
Sbjct  180   IPKEEVQYISEIIFAEEIC  198



>ref|XP_010266218.1| PREDICTED: uncharacterized protein At5g43822 [Nelumbo nucifera]
 ref|XP_010266219.1| PREDICTED: uncharacterized protein At5g43822 [Nelumbo nucifera]
Length=195

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+QQ+FRKVKD++ RW++L ++LL+QF NASSII+RLQV+Q  KNYG   CI G
Sbjct  1     MEMMVKKHQQKFRKVKDDMSRWDQLQSQLLAQFRNASSIIERLQVLQEPKNYGVFTCISG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + VL KQ+ SL+TI LSM KT+E FHSIV++ EKI+RD RQ +KGGS  P+ KQ+Q R
Sbjct  61    IREEVLGKQMESLETIFLSMKKTIEEFHSIVVSLEKILRDGRQLMKGGSISPSTKQMQLR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IG++PSL DCL+GL I+ EMH SEY     L S+  +     S   DL  L QLL+DQPN
Sbjct  121   IGIRPSLFDCLEGLRIIFEMHYSEY----LLKSSIVSALSLKSSASDLGALNQLLIDQPN  176

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPKEEVQFIFDIIFAE+IC
Sbjct  177   IPKEEVQFIFDIIFAEEIC  195



>ref|XP_006473817.1| PREDICTED: uncharacterized protein At5g43822-like isoform X1 
[Citrus sinensis]
 gb|KDO85148.1| hypothetical protein CISIN_1g028912mg [Citrus sinensis]
Length=202

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 161/202 (80%), Gaps = 3/202 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ+F+K+K+E++RW+EL +RL+SQF NASSII+RLQ++Q +K+YG L  I G
Sbjct  1     MEGIVKKYQQKFKKIKEEMNRWDELQSRLISQFKNASSIIERLQILQDAKHYGNLNSIGG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ+ SLQTILLSM KTLE F  IVL+ EK  RD +Q V+GGS Q  VKQLQQR
Sbjct  61    IEAAVLRKQMESLQTILLSMQKTLEEFRGIVLSLEKFHRDGKQLVRGGSNQLTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddls---vlqqllvd  763
             +G+KP+LADCLDGL IL +MH SEY LK+SLVS  STLA+KP   +       LQQLLVD
Sbjct  121   VGLKPTLADCLDGLMILWDMHNSEYVLKISLVSTLSTLAVKPWYMEITFDLGALQQLLVD  180

Query  762   QPNIPKEEVQFIFDIIFAEDIC  697
             QPNIPKEEVQ+I +IIFAE+IC
Sbjct  181   QPNIPKEEVQYISEIIFAEEIC  202



>ref|XP_004506410.1| PREDICTED: uncharacterized protein At5g43822-like [Cicer arietinum]
Length=198

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQ +FR+V++E++RW+EL +RL+SQF NAS I+ RLQV+Q S NYG L+C+ G
Sbjct  1     MEVMVKKYQSKFRQVREEMNRWDELQSRLISQFRNASHILDRLQVLQKSNNYGILRCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             ++DA+L KQ++SL TIL+SM KTLE  HSIVL+ EKI RD RQ VKG S++P+VKQLQQR
Sbjct  61    VKDALLEKQISSLNTILVSMRKTLEELHSIVLSLEKIHRDGRQLVKGSSSRPSVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP L DCLDGL  L E++ SEY LK S+VSA S + L PS   DL  LQQ LVDQPN
Sbjct  121   IGVKPRLIDCLDGLLFLHEIYSSEYLLKSSVVSALSAMVLMPS-PSDLGSLQQFLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             +P EEVQF+ D IFAE++C
Sbjct  180   LPTEEVQFVLDTIFAEELC  198



>ref|XP_011041205.1| PREDICTED: uncharacterized protein At5g43822 [Populus euphratica]
Length=200

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQRFRKV+  ++ WE+L +RL+SQF+NAS+II+RL+VI    NYG LK + G
Sbjct  1     MEGLVKKYQQRFRKVRGLMEEWEQLQSRLISQFSNASAIIERLKVIGDCNNYGNLKSVDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK--GGSAQPNVKQLQ  940
             I DAV+ KQL SLQTIL SMNKTLE F  +VL  EK+ RD RQ VK  GGS Q N KQL 
Sbjct  61    IVDAVVRKQLESLQTILFSMNKTLEEFRGVVLTIEKMYRDGRQLVKGGGGSNQLNAKQLW  120

Query  939   QRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             QR+G+KP LADCLDGL IL EMHQ+EY LK S+VSA S L LKPS + DL  LQQLL+DQ
Sbjct  121   QRVGIKPCLADCLDGLMILHEMHQAEYLLKSSVVSALSALTLKPS-SSDLGALQQLLIDQ  179

Query  759   PNIPKEEVQFIFDIIFAEDIC  697
             PNIPKEEVQ +F+IIFAE+IC
Sbjct  180   PNIPKEEVQVVFEIIFAEEIC  200



>ref|XP_007036443.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY20944.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=198

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KKYQQ+FRK KD++ +W+EL +RL+SQF+NASSII RLQVIQ SKNY +L  +QG
Sbjct  1     MEAMIKKYQQKFRKAKDDLSKWDELQSRLISQFSNASSIIDRLQVIQNSKNYASLNSVQG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ++SLQTILL M  T+E F ++VL+ +K+ RD +Q  +GGS Q N KQLQQR
Sbjct  61    IEVAVLQKQMDSLQTILLLMKNTMEEFRAVVLSLDKLQRDGKQLAQGGSNQMNRKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKPSL +C+DGL +L EMH +EY LK SLVSA S LAL+P+ + DL  LQQLLVDQPN
Sbjct  121   IGVKPSLKNCMDGLMLLHEMHLAEYLLKSSLVSALSVLALRPN-SSDLHALQQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             I KEEVQ+I DIIFAE+IC
Sbjct  180   IVKEEVQYILDIIFAEEIC  198



>ref|XP_010112541.1| hypothetical protein L484_007551 [Morus notabilis]
 gb|EXC33994.1| hypothetical protein L484_007551 [Morus notabilis]
Length=198

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQRFRKV++E++RW+EL +  + QF NASSII+RLQ +Q SKNYG L  + G
Sbjct  1     MEAMIKKFQQRFRKVREEMNRWDELQSLFVLQFRNASSIIERLQALQDSKNYGNLNGVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I+DAVL KQ+ SLQ I LSM KTLE FH I L+  KI RD RQ VKGG+ +   KQLQ R
Sbjct  61    IKDAVLMKQMESLQNIFLSMAKTLEEFHGITLSLGKIHRDGRQMVKGGTNRLTEKQLQLR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IG+KP+LA CLDGL  L EM+QSEY LK+SL SA S + LKP+   DL+ +QQ LVDQPN
Sbjct  121   IGIKPTLAYCLDGLMTLHEMYQSEYNLKVSLFSALSAVTLKPN-LGDLNAIQQFLVDQPN  179

Query  753   IPKEEVQFIFDIIFAED  703
             IP EEVQF+FDIIFAED
Sbjct  180   IPMEEVQFMFDIIFAED  196



>ref|XP_008237965.1| PREDICTED: uncharacterized protein At5g43822 isoform X1 [Prunus 
mume]
Length=202

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%), Gaps = 2/186 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRKV+DE+DRW EL +RL+SQF NASSIIQRLQV++ SK Y  LK + G
Sbjct  1     MEAMVKKYQQRFRKVRDEMDRWSELQSRLISQFRNASSIIQRLQVLRDSKKYVRLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQ  937
             I++AVLAKQ+ SLQ IL SMNKT+E FH IVL+F KI RD RQ VK GGS Q  ++QLQQ
Sbjct  61    IQEAVLAKQMESLQKILFSMNKTMEEFHGIVLSFGKIHRDGRQMVKGGGSNQLTIRQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQP  757
             R+GVKPSLADCLDGL +L EMH SEY LK S+VSA S L LKPS   DL  LQQLLVDQP
Sbjct  121   RVGVKPSLADCLDGLMLLQEMHCSEYLLKSSVVSALSALTLKPS-ASDLGALQQLLVDQP  179

Query  756   NIPKEE  739
             NIP EE
Sbjct  180   NIPNEE  185



>ref|XP_008339419.1| PREDICTED: uncharacterized protein At5g43822-like [Malus domestica]
Length=174

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VK+YQQRFRKVKDE+D W  L +RL+SQF NASSIIQRLQV+Q SKNYG LK + G
Sbjct  1     MEAMVKRYQQRFRKVKDEMDSWALLQSRLISQFRNASSIIQRLQVLQDSKNYGRLKDVVG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGG-SAQPNVKQLQQ  937
             IE+A+LAKQ+ SLQ I LSM KT+E FH+IVL+  KI RD RQ VKGG S Q +VKQLQQ
Sbjct  61    IEEALLAKQMESLQNIFLSMKKTMEEFHAIVLSLGKIHRDGRQMVKGGASGQLSVKQLQQ  120

Query  936   RIGVKPSLADCLDGLTILSEMHQSEY  859
             RIGVKPSLADCLDGL +L +MH SEY
Sbjct  121   RIGVKPSLADCLDGLMLLQDMHCSEY  146



>ref|XP_006586169.1| PREDICTED: uncharacterized protein At5g43822-like [Glycine max]
Length=198

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKK+Q +FRKV++E+ RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C  G
Sbjct  1     MEAIVKKFQSKFRKVREEMSRWDELQSCLISQFRNASHIVDRLQVLQNSNNYGVLNCASG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             ++DA+L KQ+ SL+ IL+SM KTLE FH IVL+ +KI RDSRQQVKGGS   N+KQLQQ+
Sbjct  61    LKDALLVKQIESLRNILVSMRKTLEEFHCIVLSLDKIHRDSRQQVKGGSCHLNMKQLQQQ  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IG+KPSL  CLD L  + E++ SEY LK S++SA S +ALKPS   DL  LQQLLVDQPN
Sbjct  121   IGIKPSLIYCLDSLMFIHEIYNSEYLLKSSVISALSEIALKPS-DSDLGALQQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDI  700
             +  EEVQF+FD+IFAE++
Sbjct  180   LQTEEVQFVFDVIFAEEL  197



>ref|XP_003605502.1| hypothetical protein MTR_4g032370 [Medicago truncatula]
 gb|AES87699.1| PPR superfamily protein [Medicago truncatula]
Length=198

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 0/198 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +F KV++E+++W+EL +RL+SQF NAS I+ RLQV+Q S NYG L C+  
Sbjct  1     MEMMVKKFQSKFNKVREEMNQWDELQSRLISQFRNASHIVDRLQVLQKSSNYGILNCVGA  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + D +L KQ++SL TI  SM KTLE FH IVL+ EK+ RD RQ VKG S++P +KQLQQR
Sbjct  61    VSDVLLQKQIDSLNTISFSMRKTLEEFHCIVLSLEKMHRDGRQLVKGSSSRPTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKP+L DCLDGL+ L E++ SEY LK S+VSA S++AL PS   DL  LQQLLVDQPN
Sbjct  121   VGVKPTLIDCLDGLSFLHEIYYSEYLLKTSIVSALSSMALIPSNASDLGALQQLLVDQPN  180

Query  753   IPKEEVQFIFDIIFAEDI  700
             I  EEVQ +FD IFAED+
Sbjct  181   ILTEEVQSLFDTIFAEDL  198



>gb|KHG06032.1| hypothetical protein F383_32806 [Gossypium arboreum]
Length=198

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KKYQQ+F+K KDE+ +W++L +RL+S F NASSII RLQ+IQ SKNY +L C+ G
Sbjct  1     METMIKKYQQKFKKAKDEMSKWDDLQSRLISHFRNASSIISRLQIIQNSKNYASLNCVGG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             +E AV+ KQ++SLQTILLSM  T+E F  +VL+ EK+  D +Q  KG   Q N KQLQ R
Sbjct  61    MEAAVMQKQMDSLQTILLSMKNTMEDFRGVVLSLEKVQHDGKQLAKGSFNQMNKKQLQHR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP+L +C+DGL +L E++  EY LK SLVSA S LALKP+ + DL  L QLL DQPN
Sbjct  121   IGVKPTLTNCIDGLVLLHEIYHDEYLLKSSLVSALSALALKPN-SGDLGALHQLLADQPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             I  EEVQ+IFDI+FAE+IC
Sbjct  180   ILNEEVQYIFDIVFAEEIC  198



>gb|AFK49433.1| unknown [Medicago truncatula]
Length=198

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +F KV++E+++W+EL +RL+SQF NAS I+ RLQV+Q S NYG L C+  
Sbjct  1     MEMMVKKFQSKFNKVREEMNQWDELQSRLISQFRNASHIVDRLQVLQKSSNYGILNCVGA  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + D +L KQ++SL TI  SM KTLE FH IVL+ EK+ RD RQ VKG S++P +KQLQQR
Sbjct  61    VSDVLLQKQIDSLNTISFSMRKTLEEFHCIVLSLEKMHRDGRQLVKGSSSRPTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             + VKP+L DCLDGL+ L E++ SEY LK S+VSA S++AL PS   DL  LQQLLVDQPN
Sbjct  121   VDVKPTLIDCLDGLSFLHEIYYSEYLLKTSIVSALSSMALIPSNASDLGALQQLLVDQPN  180

Query  753   IPKEEVQFIFDIIFAEDI  700
             I  EEVQ +FD IFAED+
Sbjct  181   ILTEEVQSLFDTIFAEDL  198



>ref|XP_006435395.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
 gb|ESR48635.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
 gb|KDO85150.1| hypothetical protein CISIN_1g028912mg [Citrus sinensis]
Length=167

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ+F+K+K+E++RW+EL +RL+SQF NASSII+RLQ++Q +K+YG L  I G
Sbjct  1     MEGIVKKYQQKFKKIKEEMNRWDELQSRLISQFKNASSIIERLQILQDAKHYGNLNSIGG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ+ SLQTILLSM KTLE F  IVL+ EK  RD +Q V+GGS Q  VKQLQQR
Sbjct  61    IEAAVLRKQMESLQTILLSMQKTLEEFRGIVLSLEKFHRDGKQLVRGGSNQLTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+KP+LADCLDGL IL +MH SEY
Sbjct  121   VGLKPTLADCLDGLMILWDMHNSEY  145



>gb|KEH43835.1| PPR superfamily protein [Medicago truncatula]
Length=198

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +GVKP L DCLDGL  L E++ SEY LK S+VS  S +A+ PS   DL  LQQLL D+PN
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSEYLLKSSVVSVLSAMAIMPS-ACDLGALQQLLDDEPN  179

Query  753   IPKEEVQFIFDIIFAEDIC  697
             +  EEVQF+ D IFAE++C
Sbjct  180   LLTEEVQFLLDTIFAEELC  198



>ref|XP_006435394.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
 gb|ESR48634.1| hypothetical protein CICLE_v10002549mg [Citrus clementina]
Length=150

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ+F+K+K+E++RW+EL +RL+SQF NASSII+RLQ++Q +K+YG L  I G
Sbjct  1     MEGIVKKYQQKFKKIKEEMNRWDELQSRLISQFKNASSIIERLQILQDAKHYGNLNSIGG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ+ SLQTILLSM KTLE F  IVL+ EK  RD +Q V+GGS Q  VKQLQQR
Sbjct  61    IEAAVLRKQMESLQTILLSMQKTLEEFRGIVLSLEKFHRDGKQLVRGGSNQLTVKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+KP+LADCLDGL IL +MH SEY
Sbjct  121   VGLKPTLADCLDGLMILWDMHNSEY  145



>ref|XP_010935316.1| PREDICTED: uncharacterized protein At5g43822 [Elaeis guineensis]
Length=194

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 149/198 (75%), Gaps = 5/198 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKK+QQ++++V+DE+ RW+EL +RLLSQF NASSII+RL+V++ +KNYGAL+C+ G
Sbjct  1     METMVKKFQQKYKRVRDEMGRWDELQSRLLSQFGNASSIIERLEVLREAKNYGALRCVPG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +AVL KQ+ +L+ I  SM +T++ FHS+V++  KI  D  Q +KGGSA P  +Q++ +
Sbjct  61    IREAVLGKQMEALEMIFCSMRETMKEFHSVVMSLGKIAHDGSQLLKGGSA-PTTRQMRLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ PSLADCLDGL  + EM+QSEY     L S+  +         D+  L++LLVDQPN
Sbjct  120   VGIWPSLADCLDGLKSIHEMYQSEY----LLKSSVISSLTWKCSASDIVALRELLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPK+EVQ IFDIIFAE+I
Sbjct  176   IPKDEVQSIFDIIFAEEI  193



>ref|XP_008813326.1| PREDICTED: uncharacterized protein At5g43822 isoform X1 [Phoenix 
dactylifera]
Length=194

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 146/199 (73%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K+QQ++++ KDE+ RW+E  +RLLSQF NASSII+RL+V++ +KNYGA++C+ G
Sbjct  1     METMVRKFQQKYKRAKDEMGRWDEFQSRLLSQFGNASSIIERLEVLREAKNYGAIRCVPG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I  AVL KQ+ +L+ I  SM  T++ FHS++++ +KI RD  Q +KGGS  P  +Q++ R
Sbjct  61    IRQAVLGKQMEALEMIFCSMRVTMKEFHSVIMSLDKIARDGSQLLKGGSG-PTTRQMRLR  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ PSLADCLDGL  + EM+QSEY     L S+  +         D+  L+QLLVDQPN
Sbjct  120   VGIWPSLADCLDGLKSIHEMYQSEY----LLKSSVVSSLTCKCSASDIVALRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IP +EVQ IFDIIFAE+IC
Sbjct  176   IPNDEVQSIFDIIFAEEIC  194



>ref|XP_007036445.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY20946.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=167

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KKYQQ+FRK KD++ +W+EL +RL+SQF+NASSII RLQVIQ SKNY +L  +QG
Sbjct  1     MEAMIKKYQQKFRKAKDDLSKWDELQSRLISQFSNASSIIDRLQVIQNSKNYASLNSVQG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ++SLQTILL M  T+E F ++VL+ +K+ RD +Q  +GGS Q N KQLQQR
Sbjct  61    IEVAVLQKQMDSLQTILLLMKNTMEEFRAVVLSLDKLQRDGKQLAQGGSNQMNRKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             IGVKPSL +C+DGL +L EMH +EY
Sbjct  121   IGVKPSLKNCMDGLMLLHEMHLAEY  145



>ref|XP_008447827.1| PREDICTED: uncharacterized protein At5g43822 isoform X1 [Cucumis 
melo]
Length=200

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 2/197 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRK KDE+DRW+EL  RL+SQF NASSII RLQ++Q  KN+G+L  + G
Sbjct  1     MEAMVKKYQQRFRKFKDEMDRWDELQVRLISQFQNASSIIGRLQLLQDPKNFGSLSGMDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +A+L KQ+ SLQ    S+ KT+E   ++V + EKI RD +Q VKGGS QP++KQLQQR
Sbjct  61    IVEALLGKQMESLQLSFSSIKKTMEELGNVVNSMEKIYRDGKQLVKGGSNQPSIKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY--RlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             +G+KPSL DCL+GL +L  MH+SEY  +  +           +     DLS L QLLVDQ
Sbjct  121   VGLKPSLEDCLNGLMVLCNMHRSEYSLKESIVSALPELFWKARNHGAQDLSSLHQLLVDQ  180

Query  759   PNIPKEEVQFIFDIIFA  709
             PNI KEEVQF+FD I  
Sbjct  181   PNIKKEEVQFVFDTILV  197



>ref|XP_004144893.1| PREDICTED: uncharacterized protein At5g43822-like [Cucumis sativus]
 ref|XP_004154081.1| PREDICTED: uncharacterized protein At5g43822-like [Cucumis sativus]
 ref|XP_004161020.1| PREDICTED: uncharacterized protein At5g43822-like [Cucumis sativus]
 gb|KGN43347.1| hypothetical protein Csa_7G025190 [Cucumis sativus]
Length=200

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 140/197 (71%), Gaps = 2/197 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRK KDE+DRW+EL  RL+SQF NASSII RLQ++Q  KN+G+L  + G
Sbjct  1     MEAMVKKYQQRFRKFKDEMDRWDELQVRLISQFQNASSIIGRLQLLQDPKNFGSLSGMDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +A+LAKQ+ SLQ    S+ KT+E   +IV + EKI RD +Q VKGGS QP++KQLQQ+
Sbjct  61    IVEALLAKQMESLQLSFSSIKKTMEELGNIVNSMEKIYRDGKQLVKGGSNQPSIKQLQQK  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY--RlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             +G+KPSL DCL+GL +L  MH+SEY  +  +           +     DLS L QLLVDQ
Sbjct  121   VGLKPSLEDCLNGLMLLCHMHRSEYNLKESIVSALPELFWKARNHGAQDLSSLHQLLVDQ  180

Query  759   PNIPKEEVQFIFDIIFA  709
             PNI KEEV+F+FD I  
Sbjct  181   PNIKKEEVEFVFDTILV  197



>ref|XP_007146790.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
 gb|ESW18784.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
Length=198

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKK+Q +FRKV++EI+RW+EL + L+SQF NAS I+ R Q++Q + N+G L C+ G
Sbjct  1     MESIVKKFQSKFRKVREEINRWDELQSCLISQFRNASHIVDRFQLLQNTNNHGVLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH I L+ +KI RDSRQ V GGS+  N KQLQQ+
Sbjct  61    MRDALLDKQIESLSNILVSMRKTLEEFHCIALSLDKIHRDSRQLVNGGSSHLNRKQLQQQ  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPSL  CLD L  + E++ SEY L  S V +  +     S   DL  LQQLLVDQPN
Sbjct  121   VGMKPSLIYCLDSLMFIHEIYNSEY-LLKSSVISALSEIALKSSASDLGALQQLLVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDI  700
             I  EEVQ++FD+IFAE++
Sbjct  180   IQTEEVQYVFDMIFAEEL  197



>ref|XP_007036444.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY20945.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=212

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KKYQQ+FRK KD++ +W+EL +RL+SQF+NASSII RLQVIQ SKNY +L  +QG
Sbjct  1     MEAMIKKYQQKFRKAKDDLSKWDELQSRLISQFSNASSIIDRLQVIQNSKNYASLNSVQG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IE AVL KQ++SLQTILL M  T+E F ++VL+ +K+ RD +Q  +GGS Q N KQLQQR
Sbjct  61    IEVAVLQKQMDSLQTILLLMKNTMEEFRAVVLSLDKLQRDGKQLAQGGSNQMNRKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             IGVKPSL +C+DGL +L EMH +EY
Sbjct  121   IGVKPSLKNCMDGLMLLHEMHLAEY  145



>ref|XP_008813327.1| PREDICTED: uncharacterized protein At5g43822 isoform X2 [Phoenix 
dactylifera]
Length=178

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 141/199 (71%), Gaps = 21/199 (11%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K+QQ++++ KDE+ RW+E  +RLLSQF NASSII+RL+V++ +KNYGA++C+ G
Sbjct  1     METMVRKFQQKYKRAKDEMGRWDEFQSRLLSQFGNASSIIERLEVLREAKNYGAIRCVPG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I  AVL KQ+ +L+ I  SM  T++ FHS++++ +KI RD  Q +KGGS  P  +Q++ R
Sbjct  61    IRQAVLGKQMEALEMIFCSMRVTMKEFHSVIMSLDKIARDGSQLLKGGSG-PTTRQMRLR  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ PSLADCLDGL  + EM+QS+                      D+  L+QLLVDQPN
Sbjct  120   VGIWPSLADCLDGLKSIHEMYQSD--------------------ASDIVALRQLLVDQPN  159

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IP +EVQ IFDIIFAE+IC
Sbjct  160   IPNDEVQSIFDIIFAEEIC  178



>ref|XP_006855714.1| hypothetical protein AMTR_s00044p00147390 [Amborella trichopoda]
 gb|ERN17181.1| hypothetical protein AMTR_s00044p00147390 [Amborella trichopoda]
Length=195

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQ++++V+D++D WE+L++RLLSQF NASSII+R+QV+Q +K YG L C+ G
Sbjct  1     MERLVKKYQQKYKRVRDQMDTWEDLNSRLLSQFGNASSIIERMQVLQNTKYYGVLTCVPG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             ++  +L KQ+ SL++ L +M  TL  F  IV A EK+ +D  Q +KG S QP  +Q+Q R
Sbjct  61    MKKELLGKQMESLESFLRAMKTTLNEFDGIVKALEKLWQDGCQLLKGESKQPTARQMQAR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IG++PSL+DCL+GL  + EMH SEY     L S+        S + DLS   +LL DQPN
Sbjct  121   IGIRPSLSDCLEGLRAIHEMHHSEY----LLKSSIIAAISLNSSSADLSAFHRLLADQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IP+EEV+FIF+IIFAE+I
Sbjct  177   IPREEVKFIFNIIFAEEI  194



>ref|XP_006403176.1| hypothetical protein EUTSA_v10003275mg [Eutrema salsugineum]
 gb|ESQ44629.1| hypothetical protein EUTSA_v10003275mg [Eutrema salsugineum]
Length=195

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQ+ RK K+E+++WE L  R +S+F+NASSIIQRLQVIQ   ++GAL+C++G
Sbjct  1     MEAVIKKWQQKLRKAKEEMEKWEALQVRWVSRFSNASSIIQRLQVIQNHGSFGALRCVKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAVL K+++ L+T+LLSM   LE F   VL FEK+ RD  Q +K    + + K+ ++R
Sbjct  61    IEDAVLQKEMDQLKTLLLSMRNILEEFRGCVLTFEKLHRDGSQTLK---MELSKKRAEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL+GL++L +MHQSEY LK S+ SA S L LKPS   DL+ LQ L+VDQPN
Sbjct  118   IGVKPCIADCLEGLSLLYDMHQSEYHLKTSIFSALSCLILKPS-PGDLNALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IP  EVQ IFD+IFAE+I
Sbjct  177   IPNNEVQHIFDVIFAEEI  194



>ref|XP_002510698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52885.1| conserved hypothetical protein [Ricinus communis]
Length=181

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = -1

Query  1239  IDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQGIEDAVLAKQLNSLQTILL  1060
             +++W+   +RL+SQF NASSII RLQ+I+ S NYG+L C+ GI D V+ KQ+ SLQTIL+
Sbjct  1     MEKWDNFQSRLVSQFRNASSIIDRLQMIRESNNYGSLNCVGGIADVVMRKQMESLQTILI  60

Query  1059  SMNKTLEGFHSIVLAFEKIVRDSRQQVK-GGSAQPNVKQLQQRIGVKPSLADCLDGLTIL  883
             S+NKTL+ F  IV+  E++ RD +Q V+ GGS     KQLQQR+G+KP LADCLDGL IL
Sbjct  61    SINKTLDEFQGIVMILERMHRDGKQLVQGGGSNHLTAKQLQQRVGIKPCLADCLDGLMIL  120

Query  882   SEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIPKEEVQFIFDIIFAED  703
              +MH+SEY LK SLVSA   L LKPS + DL+ LQQLLVDQPNIP+EEVQFIFDIIFAE+
Sbjct  121   RDMHRSEYLLKSSLVSALPALVLKPS-SSDLAALQQLLVDQPNIPREEVQFIFDIIFAEE  179

Query  702   IC  697
             IC
Sbjct  180   IC  181



>ref|NP_001065428.1| Os10g0566900 [Oryza sativa Japonica Group]
 gb|AAL79693.1|AC087599_12 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP55069.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27265.1| Os10g0566900 [Oryza sativa Japonica Group]
 dbj|BAG95187.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67466.1| hypothetical protein OsI_34696 [Oryza sativa Indica Group]
 gb|EEE51425.1| hypothetical protein OsJ_32504 [Oryza sativa Japonica Group]
Length=194

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 149/199 (75%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES+V++ QQR RK ++E+DRW++L++RLLSQF NA++I+ RL V++  KNYG L+C+  
Sbjct  1     MESSVRRVQQRVRKAREEMDRWDDLNSRLLSQFANAAAIVARLPVLEEVKNYGVLRCVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + +L KQ+ SL+ I +SM +T+E F+SI  +  K +RD+ Q V+GGSA  + KQ+Q +
Sbjct  61    IRENLLGKQMESLEIIFVSMRETVEEFNSIARSLHKALRDTNQMVRGGSAL-SAKQMQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++ADCLDGL  L EMHQ+EY    +L S+  +     S + D++ ++QLLVDQPN
Sbjct  120   VGILPTIADCLDGLRTLCEMHQAEY----ALKSSVISSLTWTSSSSDIAAMRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  176   IPKDEVQAIFDIIFADEIC  194



>gb|KHN01819.1| Hypothetical protein glysoja_028491 [Glycine soja]
Length=192

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKK+Q +FRKV++E+ RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C  G
Sbjct  1     MEAIVKKFQSKFRKVREEMSRWDELQSCLISQFRNASHIVDRLQVLQNSNNYGVLNCASG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             ++DA+L KQ+ SL+ IL+SM KTLE FH IVL+ +KI RDSRQQVKGGS   N+KQLQQ+
Sbjct  61    LKDALLVKQIESLRNILVSMRKTLEEFHCIVLSLDKIHRDSRQQVKGGSCHLNMKQLQQQ  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             IG+KPSL  CLD L  + E++ SEY
Sbjct  121   IGIKPSLIYCLDSLMFIHEIYNSEY  145



>ref|XP_008447830.1| PREDICTED: uncharacterized protein At5g43822 isoform X3 [Cucumis 
melo]
Length=167

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRK KDE+DRW+EL  RL+SQF NASSII RLQ++Q  KN+G+L  + G
Sbjct  1     MEAMVKKYQQRFRKFKDEMDRWDELQVRLISQFQNASSIIGRLQLLQDPKNFGSLSGMDG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +A+L KQ+ SLQ    S+ KT+E   ++V + EKI RD +Q VKGGS QP++KQLQQR
Sbjct  61    IVEALLGKQMESLQLSFSSIKKTMEELGNVVNSMEKIYRDGKQLVKGGSNQPSIKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+KPSL DCL+GL +L  MH+SEY
Sbjct  121   VGLKPSLEDCLNGLMVLCNMHRSEY  145



>ref|XP_008447828.1| PREDICTED: uncharacterized protein At5g43822 isoform X2 [Cucumis 
melo]
Length=197

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 5/197 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ VKKYQQRFRK KDE+DRW+EL  RL+SQF NASSII RLQ     KN+G+L  + G
Sbjct  1     MEAMVKKYQQRFRKFKDEMDRWDELQVRLISQFQNASSIIGRLQ---DPKNFGSLSGMDG  57

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +A+L KQ+ SLQ    S+ KT+E   ++V + EKI RD +Q VKGGS QP++KQLQQR
Sbjct  58    IVEALLGKQMESLQLSFSSIKKTMEELGNVVNSMEKIYRDGKQLVKGGSNQPSIKQLQQR  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEY--RlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             +G+KPSL DCL+GL +L  MH+SEY  +  +           +     DLS L QLLVDQ
Sbjct  118   VGLKPSLEDCLNGLMVLCNMHRSEYSLKESIVSALPELFWKARNHGAQDLSSLHQLLVDQ  177

Query  759   PNIPKEEVQFIFDIIFA  709
             PNI KEEVQF+FD I  
Sbjct  178   PNIKKEEVQFVFDTILV  194



>ref|XP_010549356.1| PREDICTED: uncharacterized protein At5g43822 [Tarenaya hassleriana]
Length=198

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 142/198 (72%), Gaps = 1/198 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KKYQQ+FRK + E+++WE    R +S F NASSII RL  IQ S+ YG LKCI  
Sbjct  1     MEAVIKKYQQKFRKAQSEMEKWEAFQLRFVSLFRNASSIILRLHDIQDSRCYGVLKCISE  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAVL KQ++ L+T+LLSM K LE F    LAFEK+ RD+ Q VK GS Q + KQLQ R
Sbjct  61    IEDAVLKKQMDQLETLLLSMRKILEEFRVSALAFEKLHRDAAQLVKTGSNQLSKKQLQHR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGV P + DCL+GL +L +MH+SEY LK SL S+ S   +  S   DL+ LQQL+VDQPN
Sbjct  121   IGVNPCIEDCLNGLYLLYDMHRSEYLLKSSLFSSLSHAVVNSS-PGDLTALQQLVVDQPN  179

Query  753   IPKEEVQFIFDIIFAEDI  700
             I KEEVQ IFDIIFA +I
Sbjct  180   IQKEEVQHIFDIIFAGEI  197



>ref|XP_006586171.1| PREDICTED: enhancer of mRNA-decapping protein 4-like isoform 
X1 [Glycine max]
 ref|XP_006586172.1| PREDICTED: enhancer of mRNA-decapping protein 4-like isoform 
X2 [Glycine max]
Length=555

 Score =   194 bits (493),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 153/200 (77%), Gaps = 1/200 (1%)
 Frame = -1

Query  1299  LSMESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCI  1120
             L+ME+ VKK+Q +FRKV++ + RW++L + L+SQF NA  I+ RLQV+Q S NYG L C 
Sbjct  356   LTMEAIVKKFQSKFRKVREAMSRWDKLQSCLISQFRNAFHIVDRLQVLQNSNNYGVLNCA  415

Query  1119  QGIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQ  940
              G++DA+L KQ+ SL+ IL+SM KTLE FH IVL+ +KI  DSRQQVKGGS   N+KQLQ
Sbjct  416   SGMKDALLVKQIESLRNILVSMRKTLEEFHCIVLSLDKIHHDSRQQVKGGSCILNMKQLQ  475

Query  939   QRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             Q+IG+KPSL  CLD L  + E++ SEY LK S++SA S +ALKPS   DL  LQQLLVDQ
Sbjct  476   QQIGIKPSLIYCLDSLMFIHEIYNSEYLLKSSVISALSEIALKPS-DSDLGALQQLLVDQ  534

Query  759   PNIPKEEVQFIFDIIFAEDI  700
             PN+   EVQF+FD+IFAE++
Sbjct  535   PNLQTVEVQFVFDVIFAEEL  554



>dbj|BAJ99010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E +RW++L++RLLSQF+NA++II RL V+  +KNYG L+C+  
Sbjct  1     MEAMVRKVQQRVRKAREETERWDDLNSRLLSQFSNATTIITRLPVLGDAKNYGVLRCVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + +L KQ+ SL+ I + M +TLE  + I     K++RD+ Q V+GGSA    KQLQ +
Sbjct  61    IREDLLGKQMESLELIFVLMRETLEELNGIAKGLSKVLRDTNQMVRGGSAL-TAKQLQLK  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++ DCLDGL  LS+MHQ+EY    +L S+  +L    S + D++ ++QLLVDQPN
Sbjct  120   VGILPTITDCLDGLRTLSDMHQAEY----ALKSSIISLLTWKSSSSDIAAMRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  176   IPKDEVQSIFDIIFADEIC  194



>gb|KHN01816.1| Hypothetical protein glysoja_028488 [Glycine soja]
Length=670

 Score =   194 bits (492),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 154/200 (77%), Gaps = 1/200 (1%)
 Frame = -1

Query  1299  LSMESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCI  1120
             L+M++ VKK+Q +FRKV++ + RW++L + L+SQF NA  I+ RLQV+Q S NYG L C 
Sbjct  471   LTMKAIVKKFQSKFRKVREAMSRWDKLQSCLISQFRNAFHIVDRLQVLQNSNNYGVLNCA  530

Query  1119  QGIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQ  940
              G++DA+L KQ+ SL+ IL+SM KTLE FH IVL+ +KI  DSRQQVKGGS   N+KQLQ
Sbjct  531   SGMKDALLVKQIESLRNILVSMRKTLEEFHCIVLSLDKIHHDSRQQVKGGSCILNMKQLQ  590

Query  939   QRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQ  760
             Q+IG+KPSL  CLD L  + E++ SEY LK S++SA S +ALKPS   DL  LQQLLVDQ
Sbjct  591   QQIGIKPSLIYCLDSLMFIHEIYNSEYLLKSSVISALSEIALKPS-DSDLGALQQLLVDQ  649

Query  759   PNIPKEEVQFIFDIIFAEDI  700
             PN+  EEVQF+FD+IFAE++
Sbjct  650   PNLQIEEVQFVFDVIFAEEL  669



>gb|KEH43832.1| PPR superfamily protein [Medicago truncatula]
Length=172

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +GVKP L DCLDGL  L E++ SEY
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSEY  145



>gb|KEH43829.1| PPR superfamily protein [Medicago truncatula]
Length=180

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +GVKP L DCLDGL  L E++ SEY
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSEY  145



>gb|KEH43831.1| PPR superfamily protein [Medicago truncatula]
Length=196

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +GVKP L DCLDGL  L E++ SEY
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSEY  145



>gb|KEH43833.1| PPR superfamily protein [Medicago truncatula]
Length=193

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +GVKP L DCLDGL  L E++ SEY
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSEY  145



>gb|EMS53980.1| hypothetical protein TRIUR3_11706 [Triticum urartu]
Length=178

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 138/199 (69%), Gaps = 21/199 (11%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E DRW+ L++RLLSQF+NA++II RL V+  +KNYG L+C+  
Sbjct  1     MEAMVRKVQQRVRKAREETDRWDNLNSRLLSQFSNATTIITRLPVLGDAKNYGVLRCVPS  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + +L KQ+ SL+ I + M +TLE F  I     K++RD+ Q V+GGSA  + KQLQ +
Sbjct  61    IREDLLGKQMESLELIFVLMRETLEEFSGIAKGLSKVLRDTNQMVRGGSAL-SAKQLQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++ADCLDGL  LS+MHQ++                    + D++ ++QLLVDQPN
Sbjct  120   VGILPTIADCLDGLRTLSDMHQAD--------------------SSDIAAMRQLLVDQPN  159

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  160   IPKDEVQSIFDIIFADEIC  178



>ref|XP_006662076.1| PREDICTED: uncharacterized protein At5g43822-like [Oryza brachyantha]
Length=194

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V++ QQR RK ++E+DRW++L++RLLSQF NA++II RL V++  KNYG L+C+  
Sbjct  1     MEALVRRVQQRVRKAQEEMDRWDDLNSRLLSQFANATAIIARLPVLEEVKNYGVLRCVPS  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + ++ KQ+ SL+ I +SM +T+E F+SI  +  K +RD+ Q VKGG A    KQ+Q +
Sbjct  61    IREDLVGKQMESLEIIFVSMRETVEEFNSIAKSLHKALRDTNQMVKGGPAL-TAKQMQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++ADCLDGL  L EMHQ+EY    +L S+  +L    S + D++ ++QLLVDQPN
Sbjct  120   LGILPTIADCLDGLRTLCEMHQAEY----ALKSSVISLLTWASSSSDITAMRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             I K EVQ IFD+IFA++IC
Sbjct  176   IAKNEVQSIFDVIFADEIC  194



>ref|XP_009101759.1| PREDICTED: uncharacterized protein At5g43822 [Brassica rapa]
 emb|CDY22330.1| BnaA06g36520D [Brassica napus]
Length=195

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ ++K+QQ+FRK K+E+++WE L    +S+F+ ASSIIQRL+ IQ   +YGAL+C++G
Sbjct  1     MEAVIRKWQQKFRKAKEEMNKWEALQVGWVSRFSKASSIIQRLEAIQNPGSYGALRCVKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDA+L KQ++ L+T LLSM   LE F   VL FEK+ R+  Q +K    +   +++++R
Sbjct  61    IEDALLQKQMDQLETTLLSMRNDLEEFRGCVLTFEKLRREGSQLLK---MEQTKRRIEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL GL++L EMHQSEY LK+S++SA S LALKPS   DL  LQ L+VDQPN
Sbjct  118   IGVKPCIADCLKGLSLLYEMHQSEYHLKMSILSALSCLALKPS-PGDLVALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             I   EVQ IFD+IFAEDI
Sbjct  177   ILNNEVQHIFDVIFAEDI  194



>emb|CDX94726.1| BnaC07g17350D [Brassica napus]
Length=195

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ ++K+QQ+FRK K+E+++WE L    +S+F+ ASSIIQRL+ IQ   +YGAL+C++G
Sbjct  1     MEAVIRKWQQKFRKAKEEMNKWEALQVGWVSRFSKASSIIQRLEAIQNPGSYGALRCVKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDA+L KQ+N L+T LLSM   LE F   VL FEK+ R+  Q +K    + + +++++R
Sbjct  61    IEDALLQKQMNQLETTLLSMRNDLEEFRGCVLTFEKLHREGSQLLK---MEQSKRRIEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL GL++L EMHQSEY LK S++SA S LALKPS   DL  LQ L+VDQPN
Sbjct  118   IGVKPCIADCLKGLSLLYEMHQSEYHLKCSILSALSCLALKPS-PGDLVALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             I   EVQ IFD+IFAE+I
Sbjct  177   ILNNEVQHIFDVIFAEEI  194



>gb|KEH43830.1| PPR superfamily protein [Medicago truncatula]
Length=144

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKK+Q +FRKVK+E++RW+EL + L+SQF NAS I+ RLQV+Q S NYG L C+ G
Sbjct  1     MEVMVKKFQSKFRKVKEEMNRWDELQSCLISQFRNASHILDRLQVLQMSNNYGTLNCVSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG S++  +KQLQQR
Sbjct  61    VRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGSSSRTTMKQLQQR  120

Query  933   IGVKPSLADCLDGLTILSEMHQSE  862
             +GVKP L DCLDGL  L E++ SE
Sbjct  121   VGVKPRLIDCLDGLLFLHEIYYSE  144



>gb|EMT01518.1| hypothetical protein F775_13166 [Aegilops tauschii]
Length=178

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 138/199 (69%), Gaps = 21/199 (11%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E +RW++L++RLLSQF+NA++II RL V+  +KNYG L+C+  
Sbjct  1     MEAMVRKVQQRVRKAREETERWDDLNSRLLSQFSNATTIITRLPVLGDAKNYGVLRCVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + +L KQ+ SL+ I + M +TLE F  I     K++RD+ Q V+GGSA    KQLQ +
Sbjct  61    IREDLLGKQMESLELIFVLMRETLEEFSGIAKGLSKVLRDTNQMVRGGSAL-TAKQLQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++ADCLDGL  LS+MHQ++                    + D++ ++QLLV+QPN
Sbjct  120   VGILPTIADCLDGLRTLSDMHQAD--------------------SSDIAAMRQLLVEQPN  159

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  160   IPKDEVQSIFDIIFADEIC  178



>ref|XP_008813328.1| PREDICTED: uncharacterized protein At5g43822 isoform X3 [Phoenix 
dactylifera]
 ref|XP_008813329.1| PREDICTED: uncharacterized protein At5g43822 isoform X3 [Phoenix 
dactylifera]
Length=169

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K+QQ++++ KDE+ RW+E  +RLLSQF NASSII+RL+V++ +KNYGA++C+ G
Sbjct  1     METMVRKFQQKYKRAKDEMGRWDEFQSRLLSQFGNASSIIERLEVLREAKNYGAIRCVPG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I  AVL KQ+ +L+ I  SM  T++ FHS++++ +KI RD  Q +KGGS  P  +Q++ R
Sbjct  61    IRQAVLGKQMEALEMIFCSMRVTMKEFHSVIMSLDKIARDGSQLLKGGSG-PTTRQMRLR  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+ PSLADCLDGL  + EM+QSEY
Sbjct  120   VGIWPSLADCLDGLKSIHEMYQSEY  144



>ref|NP_001154759.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q6NPG7.1|Y5382_ARATH RecName: Full=Uncharacterized protein At5g43822 [Arabidopsis 
thaliana]
 gb|AAR20721.1| At5g43820 [Arabidopsis thaliana]
 gb|AAR24735.1| At5g43820 [Arabidopsis thaliana]
 gb|AED95013.1| uncharacterized protein AT5G43822 [Arabidopsis thaliana]
Length=195

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ ++K+QQ+FRK K+E+++WE L  R +S F NASSIIQRLQ +Q   +YGAL+C++G
Sbjct  1     MEAVIRKWQQKFRKGKEEMEKWEALQVRWVSLFRNASSIIQRLQEMQNHGSYGALRCLKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAV+ +Q+  L+++L SM   +E F   VL FEK+ RD  Q  +  S++   +++++R
Sbjct  61    IEDAVVQQQMGQLESLLRSMKNVMEEFWGCVLTFEKLHRDGLQLREIESSK---RRVEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP + DCL+GL+IL +MHQSEY LK S++S  S L LKPS   DL+ LQ L+VDQPN
Sbjct  118   IGVKPCITDCLEGLSILYDMHQSEYHLKSSILSVLSCLILKPS-PGDLNALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPK+EVQ IFD+IFAE+I
Sbjct  177   IPKDEVQHIFDVIFAEEI  194



>ref|XP_003574356.1| PREDICTED: uncharacterized protein At5g43822 isoform X1 [Brachypodium 
distachyon]
Length=194

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 142/199 (71%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E +RW++L++R LSQF+NA++II RL V+  +KNYG L C+  
Sbjct  1     MEAVVRKVQQRVRKAREETERWDDLNSRFLSQFSNAAAIIARLPVLGDAKNYGVLGCVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + + +L KQ+ SL+ I +SM +TLE F  I     K +R++ Q V+GGS     KQLQ +
Sbjct  61    VREDLLGKQMESLELIFVSMRETLEEFSGIAKGLNKALRNTNQMVRGGSTL-TAKQLQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++A CLDGL  LS+MHQ+EY    +L S+  +L    S + D++ L+QLLVDQPN
Sbjct  120   VGILPTIAYCLDGLQTLSDMHQAEY----ALKSSVISLLTWKSSSSDIAALRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  176   IPKDEVQSIFDIIFADEIC  194



>ref|XP_010494364.1| PREDICTED: uncharacterized protein At5g43822-like [Camelina sativa]
Length=195

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQ+FRK K+E+++W+ L  R  S F N SSIIQRLQ +Q   +YGAL+C++G
Sbjct  1     MEAVIKKWQQKFRKGKEEMEKWDALQVRWASLFRNVSSIIQRLQEMQNHGSYGALRCMKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAV+ +Q++ L T+L S+   LE F S VL  EK+ RD    ++  S++   +++++R
Sbjct  61    IEDAVVQQQMDQLDTLLRSLRNVLEEFWSCVLTLEKLHRDGLHLLEVESSK---RRVEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL+GL+IL +MHQSEY LK S++SA + L LKPS   DL+ LQ L+VDQPN
Sbjct  118   IGVKPCIADCLEGLSILYDMHQSEYHLKSSILSALTCLILKPS-PGDLNALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPK+EVQ IFD+IFAE+I
Sbjct  177   IPKDEVQHIFDVIFAEEI  194



>ref|XP_010481821.1| PREDICTED: uncharacterized protein At5g43822 [Camelina sativa]
Length=195

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQ+FRK K+E+++W+ L  R  S F N SSII+RLQ +Q   +YGAL+C++G
Sbjct  1     MEAVIKKWQQKFRKGKEEMEKWDALQVRWASLFKNVSSIIKRLQEMQNHGSYGALRCMKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAV+ +Q+  L T+L SM   LE F S VL  EK+ RD    ++  S++   +++++R
Sbjct  61    IEDAVVQQQMGQLDTLLRSMRNVLEEFWSCVLTLEKLHRDGLHLLEVESSK---RRVEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL+GL+IL +MHQSEY LK S++SA + L LKPS   DL+ LQ L+VDQPN
Sbjct  118   IGVKPCIADCLEGLSILYDMHQSEYHLKSSILSALTCLILKPS-PGDLNALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPK+EVQ IFD+IFAE+I
Sbjct  177   IPKDEVQHIFDVIFAEEI  194



>ref|XP_004983608.1| PREDICTED: uncharacterized protein At5g43822-like [Setaria italica]
Length=194

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E+D W++L++RLL+ F  A+S+I RL V+   KNYGAL+ +  
Sbjct  1     MEAVVRKVQQRVRKAREEMDLWDDLNSRLLTNFNRATSVIDRLPVLGEDKNYGALRGVAN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I++ ++ KQ+ SL+ I +SM +TLE F+ IV A  K +RD+ Q V+GGSA    KQ+Q +
Sbjct  61    IQEDLMGKQIESLELIFVSMRETLEKFNGIVKALNKALRDTNQMVRGGSA-LTAKQMQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++A+CLDGL  L EMHQ+E+    +L S+  +L    S + D+ VL+QLLVDQPN
Sbjct  120   VGILPTIAECLDGLRTLCEMHQAEF----ALKSSIISLLTWKSSSSDIVVLRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFD+IFA++IC
Sbjct  176   IPKDEVQSIFDVIFADEIC  194



>ref|XP_009392317.1| PREDICTED: uncharacterized protein At5g43822 [Musa acuminata 
subsp. malaccensis]
Length=194

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 144/199 (72%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQ+++K ++++++W+EL +RLLS F +A+SII RLQV+  +KNYG L+ I G
Sbjct  1     METMVRKLQQKYKKAREDMEKWDELQSRLLSLFKSATSIINRLQVLAEAKNYGVLRSISG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I +A+L KQ+ +L+ I  SM +T++ F  IVL+ EKI RD+ Q VKGGSAQ + KQ++ +
Sbjct  61    IREALLGKQMETLEMIFRSMRETMKEFRGIVLSLEKIARDAWQLVKGGSAQTS-KQMKVQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IG+ P++  CL GL  + EMHQSEY +    V ++ T    P+   D +   QLLVDQPN
Sbjct  120   IGLWPNITYCLGGLRSIYEMHQSEY-ILKLSVVSSLTWKCSPT---DAAAFGQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ I+DIIFA++IC
Sbjct  176   IPKDEVQAIYDIIFADEIC  194



>ref|XP_010441982.1| PREDICTED: uncharacterized protein At5g43822-like [Camelina sativa]
Length=195

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQ+FRK K+E+++W+ L  R  S F N SSIIQRLQ +Q   +YGAL+C++G
Sbjct  1     MEAVIKKWQQKFRKGKEEMEKWDALQGRWASLFRNVSSIIQRLQEMQNHGSYGALRCMKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAV+ +Q+  L T+L SM   LE F S VL  EK+ RD    ++  S++   +++++R
Sbjct  61    IEDAVVQQQMGQLDTLLRSMRNVLEEFWSRVLTLEKLHRDGLHLLEVESSK---RRVEER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             IGVKP +ADCL+GL+IL +MHQSEY LK S++SA + L LKPS   DL  LQ L+VDQPN
Sbjct  118   IGVKPCIADCLEGLSILYDMHQSEYHLKSSILSALTCLILKPS-PGDLDALQYLVVDQPN  176

Query  753   IPKEEVQFIFDIIFAEDI  700
             IPK+EVQ IFD+IFAE+I
Sbjct  177   IPKDEVQHIFDVIFAEEI  194



>ref|NP_001132257.2| hypothetical protein [Zea mays]
 gb|ACG27098.1| hypothetical protein [Zea mays]
 gb|ACF81033.2| unknown [Zea mays]
 tpg|DAA63686.1| TPA: hypothetical protein ZEAMMB73_403794 [Zea mays]
Length=194

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 142/199 (71%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E+D+W++L+TRLLSQF+NA+++I RLQ +   KNYG L+ +  
Sbjct  1     MEAVVRKVQQRVRKAREEMDQWDDLNTRLLSQFSNAAAVISRLQALGEDKNYGPLRAVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I   ++  Q+  L+ I + + +TLE F+ +V A  K +RD++Q V+GGSA    KQ+Q +
Sbjct  61    IRVDLIGNQMEVLELIFVKIRETLEKFNDVVKALNKALRDTKQMVRGGSAL-TAKQMQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ PS+A+CLDG   L EMH  E+    +L S+  +L    + + D++VL+QLLVDQPN
Sbjct  120   VGILPSIAECLDGFQTLCEMHHDEF----TLKSSAISLLTWKTCSSDIAVLRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EVQ IFDIIFA++IC
Sbjct  176   IPKDEVQSIFDIIFADEIC  194



>ref|XP_007140428.1| hypothetical protein PHAVU_008G111000g [Phaseolus vulgaris]
 gb|ESW12422.1| hypothetical protein PHAVU_008G111000g [Phaseolus vulgaris]
Length=192

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             MES VKK+Q +FRKV++EI+RW+EL + L+SQF NAS I+ R Q++Q + N+G L C  G
Sbjct  1     MESIVKKFQSKFRKVREEINRWDELQSCLISQFRNASHIVDRFQLLQNTNNHGVLNCDSG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+S+ KTLE FH I L+ +KI RDSRQ V GG +  + KQLQQ+
Sbjct  61    MRDALLEKQIESLNNILVSIRKTLEEFHCIALSLDKIHRDSRQLVNGGFSHLHRKQLQQQ  120

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+KPSL  CLD L  + E++ SEY
Sbjct  121   VGMKPSLIYCLDSLMFIHEIYNSEY  145



>gb|ABR18239.1| unknown [Picea sitchensis]
Length=239

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 134/198 (68%), Gaps = 4/198 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKY+Q++RK ++E+D+W+ L  RLL QF NA++II+RL+V+   +NYG LK    
Sbjct  45    MERLVKKYEQKYRKAREEMDKWDALQLRLLKQFRNAAAIIERLKVLGDKENYGVLKVFSH  104

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I   + AKQ+ SL+ I +SM  TL+ F+ +V + +K+ +D    +KG + QP ++Q+Q R
Sbjct  105   IAKELPAKQVESLEFIFVSMRSTLDEFNKVVKSLKKMWQDGCHLLKGETLQPTLQQIQMR  164

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G++PSL+DCLDGL  + EMH SEY     L  +  +     S   D++ LQ +L DQPN
Sbjct  165   VGLRPSLSDCLDGLKAIYEMHLSEY----LLKVSIISALSYDSRAGDVAALQAVLADQPN  220

Query  753   IPKEEVQFIFDIIFAEDI  700
             IP  EVQFIF+IIFAE+I
Sbjct  221   IPTNEVQFIFNIIFAEEI  238



>ref|XP_002467466.1| hypothetical protein SORBIDRAFT_01g028600 [Sorghum bicolor]
 gb|EER94464.1| hypothetical protein SORBIDRAFT_01g028600 [Sorghum bicolor]
Length=194

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 134/199 (67%), Gaps = 5/199 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  V+K QQR RK ++E+++W++L+T LLS F+NA ++I R Q +   KNYG L+ +  
Sbjct  1     MEVVVRKVQQRLRKAQEEMNQWDDLNTHLLSYFSNAGTVISRFQALGEDKNYGPLRGVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + ++  Q+  L+ I ++  + LE F+ IV A  K + D++Q V+GGSA    KQ+Q R
Sbjct  61    IREDLVGNQMEVLELIFVNAREILEKFNGIVKALNKALHDTKQIVRGGSAL-TAKQMQLR  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++A+CLDG   L EMHQ+E+    +L S+   L    S + D  VL+QLLVDQPN
Sbjct  120   VGILPTIAECLDGFQTLCEMHQAEF----TLKSSIIFLLTWKSSSSDTVVLRQLLVDQPN  175

Query  753   IPKEEVQFIFDIIFAEDIC  697
             IPK+EV  IFDIIFA++IC
Sbjct  176   IPKDEVHSIFDIIFADEIC  194



>dbj|BAB11311.1| unnamed protein product [Arabidopsis thaliana]
Length=680

 Score =   164 bits (414),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 135/196 (69%), Gaps = 23/196 (12%)
 Frame = -1

Query  1287  SAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQGIE  1108
             S ++K+QQ+FRK K+E+++WE L  R +S F NASSIIQRLQ +Q   +YGAL+C++GIE
Sbjct  507   SIIRKWQQKFRKGKEEMEKWEALQVRWVSLFRNASSIIQRLQEMQNHGSYGALRCLKGIE  566

Query  1107  DAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQRIG  928
             DAV+ +Q+  L+++L SM   +E F   VL FEK+ RD  Q  +  S++   +++++RIG
Sbjct  567   DAVVQQQMGQLESLLRSMKNVMEEFWGCVLTFEKLHRDGLQLREIESSK---RRVEERIG  623

Query  927   VKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIP  748
             VKP + DCL+GL+IL +MHQS+                 P    DL+ LQ L+VDQPNIP
Sbjct  624   VKPCITDCLEGLSILYDMHQSD-----------------PG---DLNALQYLVVDQPNIP  663

Query  747   KEEVQFIFDIIFAEDI  700
             K+EVQ IFD+IFAE+I
Sbjct  664   KDEVQHIFDVIFAEEI  679



>ref|XP_002865400.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41659.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=675

 Score =   163 bits (413),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 135/196 (69%), Gaps = 23/196 (12%)
 Frame = -1

Query  1287  SAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQGIE  1108
             S ++K+QQ+FRK K+E+++WE L  R +  F NASSI QRLQ +Q   +YGAL+C++GIE
Sbjct  502   SIIRKWQQKFRKAKEEMEKWEALQVRWVFLFRNASSITQRLQDMQNHGSYGALRCLKGIE  561

Query  1107  DAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQRIG  928
             DAV+ +Q+  L+++L SM   LE F   VL FEK+ RD  Q ++  S++   +++++RIG
Sbjct  562   DAVVQQQMGQLESLLRSMKNVLEEFWGCVLTFEKLHRDGLQLLEVESSK---RRVEERIG  618

Query  927   VKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIP  748
             VKP +ADCL+GL+I+ +MHQS+                 P    DL+ LQ L+VDQPNIP
Sbjct  619   VKPCIADCLEGLSIVYDMHQSD-----------------PG---DLNALQYLVVDQPNIP  658

Query  747   KEEVQFIFDIIFAEDI  700
             K+EVQ IFD+IFAE+I
Sbjct  659   KDEVQHIFDVIFAEEI  674



>ref|XP_010235008.1| PREDICTED: uncharacterized protein At5g43822 isoform X2 [Brachypodium 
distachyon]
Length=184

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 129/185 (70%), Gaps = 5/185 (3%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E +RW++L++R LSQF+NA++II RL V+  +KNYG L C+  
Sbjct  1     MEAVVRKVQQRVRKAREETERWDDLNSRFLSQFSNAAAIIARLPVLGDAKNYGVLGCVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + + +L KQ+ SL+ I +SM +TLE F  I     K +R++ Q V+GGS     KQLQ +
Sbjct  61    VREDLLGKQMESLELIFVSMRETLEEFSGIAKGLNKALRNTNQMVRGGSTL-TAKQLQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+ P++A CLDGL  LS+MHQ+EY    +L S+  +L    S + D++ L+QLLVDQPN
Sbjct  120   VGILPTIAYCLDGLQTLSDMHQAEY----ALKSSVISLLTWKSSSSDIAALRQLLVDQPN  175

Query  753   IPKEE  739
             IPK+E
Sbjct  176   IPKDE  180



>ref|XP_006281724.1| hypothetical protein CARUB_v10027881mg [Capsella rubella]
 gb|EOA14622.1| hypothetical protein CARUB_v10027881mg [Capsella rubella]
Length=176

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ +KK+QQ+FRK KDE+++W+ L  R +S F NASSIIQRLQ IQ   +YGAL+C++G
Sbjct  1     MEAVIKKWQQKFRKGKDEMEKWDALQVRWVSLFRNASSIIQRLQEIQNHGSYGALRCLKG  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             IEDAV+ +Q+  L  +L SM   LE F   VL  +K+ RD    ++  S++  VK   +R
Sbjct  61    IEDAVVQQQMGQLDYLLRSMRNVLEEFWGCVLTLKKLHRDGLHLLEVESSKRRVK---ER  117

Query  933   IGVKPSLADCLDGLTILSEMHQSE  862
             IGVKP +ADCL+GL+IL +MHQS+
Sbjct  118   IGVKPCIADCLEGLSILFDMHQSD  141



>ref|XP_002461050.1| hypothetical protein SORBIDRAFT_02g039850 [Sorghum bicolor]
 gb|EER97571.1| hypothetical protein SORBIDRAFT_02g039850 [Sorghum bicolor]
Length=183

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME+ V+K QQR RK ++E+D+W++L+TRLLSQF+NA+++I RLQ +   KNYG L  +  
Sbjct  1     MEALVRKVQQRVRKAREEMDQWDDLNTRLLSQFSNAAAVISRLQALGEDKNYGPLHGVPN  60

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             I + ++  Q+  L+ I + +  TLE F+ +V A  K +RD++Q V+GGSA    KQ+Q +
Sbjct  61    IREDLIGNQMEVLEFIFVKIRDTLEKFNGVVKALNKALRDTKQMVRGGSAL-TAKQMQLQ  119

Query  933   IGVKPSLADCLDGLTILSEMHQSEY  859
             +G+ PS+ADCLDG   L EMH +E+
Sbjct  120   VGILPSIADCLDGFQTLCEMHHAEF  144



>gb|EPS66813.1| hypothetical protein M569_07963, partial [Genlisea aurea]
Length=155

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -1

Query  1161  VIQGSKNYGALKCIQGIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQ  982
             VIQ S NYGALK +QGIEDA+LAKQ+ SLQ ILLS+ KT++ FH++V +  KIVRD RQ 
Sbjct  1     VIQDSSNYGALKSVQGIEDAILAKQIESLQKILLSIGKTMDEFHAVVSSLGKIVRDGRQL  60

Query  981   VKGGSAQPNVKQLQQRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSv  802
             +  GS+Q   +QL+QRIG+ PS++ CLDGL  L EMH+SEY LK S+VS+   LALKPS 
Sbjct  61    IGVGSSQLTARQLKQRIGLNPSISCCLDGLKQLEEMHRSEYLLKKSIVSSLRVLALKPSG  120

Query  801   tddlsvlqqllvdQPNIPKEEVQFIFDIIFAEDI  700
             +D ++ LQQLLVDQPNIP E+V  I D+ FA +I
Sbjct  121   SDSITALQQLLVDQPNIPAEQVTSILDVRFAFEI  154



>gb|KEH43834.1| PPR superfamily protein [Medicago truncatula]
Length=151

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = -1

Query  1149  SKNYGALKCIQGIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGG  970
             S NYG L C+ G+ DA+L KQ+ SL  IL+SM KTLE FH IV + EK+  D RQ VKG 
Sbjct  2     SNNYGTLNCVSGVRDALLEKQIGSLNNILVSMRKTLEEFHCIVASLEKLHCDGRQLVKGS  61

Query  969   SAQPNVKQLQQRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddl  790
             S++  +KQLQQR+GVKP L DCLDGL  L E++ SEY LK S+VS  S +A+ PS   DL
Sbjct  62    SSRTTMKQLQQRVGVKPRLIDCLDGLLFLHEIYYSEYLLKSSVVSVLSAMAIMPS-ACDL  120

Query  789   svlqqllvdQPNIPKEEVQFIFDIIFAEDIC  697
               LQQLL D+PN+  EEVQF+ D IFAE++C
Sbjct  121   GALQQLLDDEPNLLTEEVQFLLDTIFAEELC  151



>ref|XP_007146792.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
 gb|ESW18786.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
Length=165

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -1

Query  1176  IQRLQVIQGSKNYGALKCIQGIEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVR  997
             I    ++Q + N+G L C+ G+ DA+L KQ+ SL  IL+SM KTLE FH I L+ +KI R
Sbjct  7     ILSFNLLQNTNNHGVLNCVSGMRDALLDKQIESLSNILVSMRKTLEEFHCIALSLDKIHR  66

Query  996   DSRQQVKGGSAQPNVKQLQQRIGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstla  817
             DSRQ V GGS+  N KQLQQ++G+KPSL  CLD L  + E++ SEY L  S V +  +  
Sbjct  67    DSRQLVNGGSSHLNRKQLQQQVGMKPSLIYCLDSLMFIHEIYNSEY-LLKSSVISALSEI  125

Query  816   lKPSvtddlsvlqqllvdQPNIPKEEVQFIFDIIFAEDI  700
                S   DL  LQQLLVDQPNI  EEVQ++FD+IFAE++
Sbjct  126   ALKSSASDLGALQQLLVDQPNIQTEEVQYVFDMIFAEEL  164



>ref|XP_006383777.1| hypothetical protein POPTR_0005s27450g, partial [Populus trichocarpa]
 gb|ERP61574.1| hypothetical protein POPTR_0005s27450g, partial [Populus trichocarpa]
Length=185

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 84/147 (57%), Gaps = 44/147 (30%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQG  1114
             ME  VKKYQQRFRKV+  ++ WE+L +RL+SQF+NAS+II+R                  
Sbjct  1     MEGLVKKYQQRFRKVRGLMEEWEQLQSRLISQFSNASAIIER------------------  42

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGG--SAQPNVKQLQ  940
                                     E F  +VL  EK+ RD RQ VKGG  S Q NVKQL+
Sbjct  43    ------------------------EEFRGVVLTIEKMYRDGRQLVKGGGGSNQLNVKQLR  78

Query  939   QRIGVKPSLADCLDGLTILSEMHQSEY  859
             QRIG+KP LADCLDGL IL EMHQ+EY
Sbjct  79    QRIGIKPCLADCLDGLMILHEMHQAEY  105



>ref|XP_007146791.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
 gb|ESW18785.1| hypothetical protein PHAVU_006G070300g [Phaseolus vulgaris]
Length=138

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             + DA+L KQ+ SL  IL+SM KTLE FH I L+ +KI RDSRQ V GGS+  N KQLQQ+
Sbjct  1     MRDALLDKQIESLSNILVSMRKTLEEFHCIALSLDKIHRDSRQLVNGGSSHLNRKQLQQQ  60

Query  933   IGVKPSLADCLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPN  754
             +G+KPSL  CLD L  + E++ SEY L  S V +  +     S   DL  LQQLLVDQPN
Sbjct  61    VGMKPSLIYCLDSLMFIHEIYNSEY-LLKSSVISALSEIALKSSASDLGALQQLLVDQPN  119

Query  753   IPKEEVQFIFDIIFAEDI  700
             I  EEVQ++FD+IFAE++
Sbjct  120   IQTEEVQYVFDMIFAEEL  137



>gb|KDP36773.1| hypothetical protein JCGZ_08064 [Jatropha curcas]
Length=119

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -1

Query  1086  LNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQRIGVKPSLAD  907
             ++SL+TILLSMNKTLE F SIVL  EK+ +D RQ VKGG  Q   KQLQQR+GVKP LAD
Sbjct  1     MDSLETILLSMNKTLEDFRSIVLFLEKMYKDGRQLVKGGPNQLTTKQLQQRVGVKPCLAD  60

Query  906   CLDGLTILSEMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIPKEE  739
             CLDGL IL +MH+SEY LK SLVSA   L LKPS + DL+ LQQL+VDQPNIPKEE
Sbjct  61    CLDGLMILHDMHRSEYLLKSSLVSALLALTLKPS-SGDLAALQQLMVDQPNIPKEE  115



>emb|CAN77658.1| hypothetical protein VITISV_030913 [Vitis vinifera]
Length=248

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -1

Query  1104  AVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQRIGV  925
              VL KQ+ SL+TILLS+ KTL+ FH IV + EKIVRD RQ VKGGS +  +KQLQQRIGV
Sbjct  145   CVLRKQMESLETILLSLKKTLKEFHGIVSSLEKIVRDGRQLVKGGSVKLIMKQLQQRIGV  204

Query  924   KPSLADCLDGLTILSEMHQSEY  859
             KPSLADCLDGL++L EMHQSEY
Sbjct  205   KPSLADCLDGLSLLHEMHQSEY  226



>gb|EMT03253.1| hypothetical protein F775_19810 [Aegilops tauschii]
Length=238

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 105/181 (58%), Gaps = 23/181 (13%)
 Frame = -1

Query  1239  IDRWEELHTRLLSQFTNASSIIQRLQVIQGSKNYGALKCIQGIEDAVLAKQLNSLQTILL  1060
              DR  +   R     + + S + +  V+  +KNYG L+C+    + +L  Q+ SL+ I +
Sbjct  81    FDRSSKCAARFTDSKSYSVSCVDK--VLGDAKNYGVLRCVPNFREDLLGVQMESLELIFV  138

Query  1059  SMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQRIGVKPSLADCLDGLTILS  880
             SM + LE F  I     K++ D+ Q V+GG A    KQLQ ++G+ P++ADCL GL  LS
Sbjct  139   SMREALEEFSGIAKGLSKVLHDTNQMVRGGLAL-TAKQLQLQVGILPTIADCLGGLQTLS  197

Query  879   EMHQSEYRlklslvsatstlalKPSvtddlsvlqqllvdQPNIPKEEVQFIFDIIFAEDI  700
             +MHQ++                    + D++ ++QLLVDQPNIPK+EVQ +FDIIFA++I
Sbjct  198   DMHQAD--------------------SSDIAAMRQLLVDQPNIPKDEVQSVFDIIFADEI  237

Query  699   C  697
             C
Sbjct  238   C  238


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQV-IQGSKNYGALKCI  1120
             ME+AV+K QQR RK ++E +RW++L++RLLSQF+NA++II RL V     +++ AL C+
Sbjct  1     MEAAVRKMQQRVRKAREETERWDDLNSRLLSQFSNAAAIITRLPVPFILLRSFLALICV  59



>gb|KHN09549.1| hypothetical protein glysoja_047362 [Glycine soja]
Length=73

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  1113  IEDAVLAKQLNSLQTILLSMNKTLEGFHSIVLAFEKIVRDSRQQVKGGSAQPNVKQLQQR  934
             ++DA+L KQ+ SL+ IL+SM KT+E FH IVL+ +KI RDSRQQVKGGS   N+KQLQQ+
Sbjct  1     MKDALLVKQIESLRNILVSMRKTMEEFHCIVLSLDKIHRDSRQQVKGGSCHLNMKQLQQQ  60

Query  933   IGVKPSLA  910
             IG+KPSL+
Sbjct  61    IGIKPSLS  68



>dbj|BAM64852.1| hypothetical protein [Beta vulgaris]
Length=467

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  1005  IVRDSRQQVKGGSAQPNVKQLQQRIGVKPSLADCLDGLTILSEMHQSEY  859
             +VRDS+Q + GGS QP+ KQLQQR+G+KPSL+DCLDGL IL EMH+SEY
Sbjct  1     MVRDSKQILGGGSRQPSTKQLQQRMGIKPSLSDCLDGLVILQEMHKSEY  49



>ref|XP_007146680.1| hypothetical protein PHAVU_006G0604000g, partial [Phaseolus vulgaris]
 gb|ESW18674.1| hypothetical protein PHAVU_006G0604000g, partial [Phaseolus vulgaris]
Length=44

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  1293  MESAVKKYQQRFRKVKDEIDRWEELHTRLLSQFTNASSIIQRLQ  1162
             MES VKK+Q +FRKV++EI+RW+E    L+SQF NAS I+ R Q
Sbjct  1     MESIVKKFQSKFRKVREEINRWDEFQYCLISQFRNASHIVDRFQ  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4734463533708