BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25778_g4_i1 len=2622 path=[24335:0-2381 15990:2382-2389
32711:2390-2420 32742:2421-2451 32804:2452-2455 32808:2456-2456
32809:2457-2461 32814:2462-2485 32871:2486-2493 12684:2494-2545
16143:2546-2621]

Length=2622
                                                                      Score     E

ref|XP_009614209.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    855   0.0      
ref|XP_006354193.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    853   0.0      
ref|XP_009766933.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    850   0.0      
ref|XP_004228633.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    843   0.0      
ref|XP_010315999.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    842   0.0      
ref|XP_010660644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    800   0.0      
ref|XP_002276467.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    799   0.0      Vitis vinifera
ref|XP_011080220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    794   0.0      
emb|CDP11098.1|  unnamed protein product                                780   0.0      
ref|XP_010276751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    763   0.0      
ref|XP_011033696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    762   0.0      
ref|XP_007215032.1|  hypothetical protein PRUPE_ppa004297mg             760   0.0      
ref|XP_008231214.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    760   0.0      
ref|XP_002512794.1|  dead box ATP-dependent RNA helicase, putative      757   0.0      Ricinus communis
ref|XP_002320399.1|  hypothetical protein POPTR_0014s13620g             757   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO63488.1|  hypothetical protein CISIN_1g009490mg                   756   0.0      
ref|XP_006446872.1|  hypothetical protein CICLE_v10017882mg             754   0.0      
ref|XP_006468941.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    754   0.0      
gb|KDP41892.1|  hypothetical protein JCGZ_26910                         753   0.0      
ref|XP_004303760.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    751   0.0      
ref|XP_008341198.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    751   0.0      
ref|XP_004303761.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    750   0.0      
gb|KHN00644.1|  DEAD-box ATP-dependent RNA helicase 41                  748   0.0      
ref|XP_003519940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    748   0.0      
ref|XP_009378069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    747   0.0      
gb|KEH25620.1|  DEAD-box ATP-dependent RNA helicase                     743   0.0      
ref|XP_003548927.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    742   0.0      
ref|XP_004489746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    741   0.0      
ref|XP_010685097.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    736   0.0      
ref|XP_010688944.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    734   0.0      
ref|XP_007032088.1|  P-loop containing nucleoside triphosphate hy...    732   0.0      
ref|XP_010037052.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    731   0.0      
ref|XP_010037048.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    731   0.0      
ref|XP_007151689.1|  hypothetical protein PHAVU_004G067700g             727   0.0      
gb|KDO63487.1|  hypothetical protein CISIN_1g009490mg                   722   0.0      
ref|XP_006468942.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    721   0.0      
ref|XP_007032087.1|  P-loop containing nucleoside triphosphate hy...    718   0.0      
gb|KHG21940.1|  DEAD-box ATP-dependent RNA helicase 41 -like protein    714   0.0      
ref|XP_010930326.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    714   0.0      
ref|XP_008801313.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    712   0.0      
ref|XP_010660645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    707   0.0      
ref|XP_004167588.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    703   0.0      
ref|XP_009417077.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    702   0.0      
ref|XP_008449976.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    702   0.0      
ref|XP_004145645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    700   0.0      
gb|KDO63493.1|  hypothetical protein CISIN_1g009490mg                   674   0.0      
ref|XP_002453503.1|  hypothetical protein SORBIDRAFT_04g006980          676   0.0      Sorghum bicolor [broomcorn]
ref|XP_006468943.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    672   0.0      
ref|XP_010042550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    671   0.0      
ref|NP_974208.1|  DEAD-box ATP-dependent RNA helicase 41                667   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951531.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    668   0.0      
ref|XP_002884245.1|  DEAD/DEAH box helicase family protein              666   0.0      
gb|AFW70669.1|  putative DEAD-box ATP-dependent RNA helicase fami...    667   0.0      
ref|XP_008645381.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    667   0.0      
dbj|BAH19831.1|  AT3G02065                                              665   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645376.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    667   0.0      
ref|XP_008645380.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    666   0.0      
sp|Q0E2Z7.2|RH41_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    662   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE56516.1|  hypothetical protein OsJ_05798                          663   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC72698.1|  hypothetical protein OsI_06281                          663   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006647045.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    656   0.0      
ref|XP_006408578.1|  hypothetical protein EUTSA_v10020567mg             654   0.0      
ref|XP_010553222.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    653   0.0      
ref|XP_006299543.1|  hypothetical protein CARUB_v10015716mg             650   0.0      
ref|XP_006852211.1|  hypothetical protein AMTR_s00049p00131010          652   0.0      
gb|EMT32669.1|  DEAD-box ATP-dependent RNA helicase 41                  650   0.0      
ref|XP_010496403.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    649   0.0      
emb|CDY28661.1|  BnaCnng05470D                                          641   0.0      
ref|XP_009124827.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    641   0.0      
ref|XP_010316002.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    635   0.0      
ref|XP_010233998.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    642   0.0      
gb|KFK43866.1|  hypothetical protein AALP_AA1G184200                    639   0.0      
ref|XP_006599421.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    627   0.0      
ref|XP_006574743.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    626   0.0      
gb|AFN53706.1|  putative dead box ATP-dependent RNA helicase            644   0.0      
ref|XP_007151688.1|  hypothetical protein PHAVU_004G067700g             615   0.0      
gb|EYU46329.1|  hypothetical protein MIMGU_mgv1a008399mg                600   0.0      
gb|EMS56659.1|  DEAD-box ATP-dependent RNA helicase 41                  590   0.0      
ref|XP_001763680.1|  predicted protein                                  568   0.0      
ref|XP_002979867.1|  hypothetical protein SELMODRAFT_111217             531   4e-176   
ref|NP_850499.1|  DEAD-box ATP-dependent RNA helicase 41                519   2e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988436.1|  hypothetical protein SELMODRAFT_127995             523   2e-173   
ref|XP_005961576.1|  PREDICTED: probable ATP-dependent RNA helica...    456   2e-145   
ref|XP_002914657.1|  PREDICTED: probable ATP-dependent RNA helica...    453   2e-144   
ref|XP_004458141.1|  PREDICTED: probable ATP-dependent RNA helica...    452   6e-144   
ref|XP_004392784.1|  PREDICTED: probable ATP-dependent RNA helica...    452   7e-144   
ref|XP_008683324.1|  PREDICTED: probable ATP-dependent RNA helica...    451   9e-144   
ref|XP_004625377.1|  PREDICTED: probable ATP-dependent RNA helica...    451   1e-143   
ref|XP_003410253.1|  PREDICTED: probable ATP-dependent RNA helica...    451   1e-143   
ref|XP_005622331.1|  PREDICTED: probable ATP-dependent RNA helica...    451   2e-143   
ref|XP_008828488.1|  PREDICTED: probable ATP-dependent RNA helica...    450   2e-143   
ref|XP_005622329.1|  PREDICTED: probable ATP-dependent RNA helica...    450   3e-143   
ref|XP_004756299.1|  PREDICTED: probable ATP-dependent RNA helica...    449   5e-143   
ref|XP_002717721.1|  PREDICTED: probable ATP-dependent RNA helica...    449   7e-143   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007522130.1|  PREDICTED: probable ATP-dependent RNA helica...    449   8e-143   
ref|XP_007939290.1|  PREDICTED: probable ATP-dependent RNA helica...    449   9e-143   
ref|XP_007086500.1|  PREDICTED: probable ATP-dependent RNA helica...    448   1e-142   
ref|XP_003999408.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    448   1e-142   
ref|NP_001179318.1|  probable ATP-dependent RNA helicase DDX59          448   2e-142   
ref|XP_004028162.1|  PREDICTED: probable ATP-dependent RNA helica...    447   3e-142   
ref|XP_006078494.1|  PREDICTED: probable ATP-dependent RNA helica...    447   3e-142   
ref|NP_001026895.2|  probable ATP-dependent RNA helicase DDX59          447   4e-142   Homo sapiens [man]
ref|XP_003264573.1|  PREDICTED: probable ATP-dependent RNA helica...    447   4e-142   
ref|XP_006740550.1|  PREDICTED: probable ATP-dependent RNA helica...    447   4e-142   
ref|XP_005909327.1|  PREDICTED: probable ATP-dependent RNA helica...    447   5e-142   
ref|XP_005653853.1|  PREDICTED: probable ATP-dependent RNA helica...    446   5e-142   
ref|XP_001143546.1|  PREDICTED: probable ATP-dependent RNA helica...    447   6e-142   Pan troglodytes
ref|XP_005029220.1|  PREDICTED: probable ATP-dependent RNA helica...    447   6e-142   
ref|XP_009281451.1|  PREDICTED: probable ATP-dependent RNA helica...    447   7e-142   
ref|XP_003893385.1|  PREDICTED: probable ATP-dependent RNA helica...    446   7e-142   
ref|XP_010829376.1|  PREDICTED: probable ATP-dependent RNA helica...    446   8e-142   
gb|EHH50682.1|  hypothetical protein EGM_01547                          446   8e-142   
ref|XP_005423763.1|  PREDICTED: probable ATP-dependent RNA helica...    446   1e-141   
ref|XP_010360968.1|  PREDICTED: probable ATP-dependent RNA helica...    446   1e-141   
ref|XP_004439030.1|  PREDICTED: probable ATP-dependent RNA helica...    446   1e-141   
ref|XP_010147610.1|  PREDICTED: probable ATP-dependent RNA helica...    446   1e-141   
gb|AAH41801.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 59               446   1e-141   Homo sapiens [man]
ref|XP_005540405.1|  PREDICTED: probable ATP-dependent RNA helica...    446   1e-141   
ref|XP_005029219.1|  PREDICTED: probable ATP-dependent RNA helica...    446   2e-141   
ref|XP_006107799.1|  PREDICTED: probable ATP-dependent RNA helica...    445   2e-141   
ref|XP_003498919.1|  PREDICTED: probable ATP-dependent RNA helica...    445   2e-141   
ref|XP_009817773.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    445   2e-141   
ref|XP_004375372.1|  PREDICTED: probable ATP-dependent RNA helica...    445   2e-141   
ref|XP_006155512.1|  PREDICTED: probable ATP-dependent RNA helica...    445   3e-141   
ref|XP_007421698.1|  PREDICTED: probable ATP-dependent RNA helica...    445   3e-141   
ref|XP_005375200.1|  PREDICTED: probable ATP-dependent RNA helica...    444   4e-141   
ref|XP_004312578.1|  PREDICTED: probable ATP-dependent RNA helica...    444   4e-141   
ref|XP_005029218.1|  PREDICTED: probable ATP-dependent RNA helica...    447   4e-141   
ref|XP_003938296.1|  PREDICTED: probable ATP-dependent RNA helica...    444   4e-141   
ref|XP_001493676.1|  PREDICTED: probable ATP-dependent RNA helica...    444   5e-141   Equus caballus [domestic horse]
ref|XP_005885059.1|  PREDICTED: probable ATP-dependent RNA helica...    443   6e-141   
emb|CAL38423.1|  hypothetical protein                                   444   6e-141   
ref|XP_009987672.1|  PREDICTED: probable ATP-dependent RNA helica...    444   7e-141   
ref|XP_004578843.1|  PREDICTED: probable ATP-dependent RNA helica...    444   8e-141   
ref|XP_008567804.1|  PREDICTED: probable ATP-dependent RNA helica...    444   9e-141   
ref|XP_005073490.1|  PREDICTED: probable ATP-dependent RNA helica...    443   9e-141   
emb|CAL38329.1|  hypothetical protein                                   443   2e-140   
ref|XP_007987210.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   
ref|XP_007456195.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   
ref|XP_002760671.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   Callithrix jacchus [common marmoset]
ref|XP_010713962.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   
ref|XP_009490544.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   
ref|XP_004285456.1|  PREDICTED: probable ATP-dependent RNA helica...    443   2e-140   
ref|XP_004013983.1|  PREDICTED: probable ATP-dependent RNA helica...    442   2e-140   
ref|NP_001177749.1|  probable ATP-dependent RNA helicase DDX59 is...    442   3e-140   
ref|XP_010178862.1|  PREDICTED: probable ATP-dependent RNA helica...    442   3e-140   
ref|XP_005498847.1|  PREDICTED: probable ATP-dependent RNA helica...    442   3e-140   
ref|XP_008501518.1|  PREDICTED: probable ATP-dependent RNA helica...    442   4e-140   
ref|XP_010281713.1|  PREDICTED: probable ATP-dependent RNA helica...    442   4e-140   
ref|XP_007167312.1|  PREDICTED: probable ATP-dependent RNA helica...    442   4e-140   
ref|XP_005498846.1|  PREDICTED: probable ATP-dependent RNA helica...    442   5e-140   
ref|XP_009634490.1|  PREDICTED: probable ATP-dependent RNA helica...    442   6e-140   
ref|XP_004610070.1|  PREDICTED: probable ATP-dependent RNA helica...    441   7e-140   
ref|XP_010643424.1|  PREDICTED: probable ATP-dependent RNA helica...    441   9e-140   
ref|XP_002193182.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   Taeniopygia guttata
ref|XP_005050549.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_009933150.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_009970742.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_009911541.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_010980505.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_009068485.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_003823105.1|  PREDICTED: probable ATP-dependent RNA helica...    441   1e-139   
ref|XP_003792348.1|  PREDICTED: probable ATP-dependent RNA helica...    440   2e-139   
ref|NP_080776.1|  probable ATP-dependent RNA helicase DDX59             440   2e-139   Mus musculus [mouse]
ref|XP_002609992.1|  hypothetical protein BRAFLDRAFT_287272             442   2e-139   Branchiostoma floridae
ref|XP_010407564.1|  PREDICTED: probable ATP-dependent RNA helica...    440   2e-139   
ref|XP_006834224.1|  PREDICTED: probable ATP-dependent RNA helica...    440   2e-139   
gb|EDL39547.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 59               440   2e-139   
ref|XP_009554086.1|  PREDICTED: probable ATP-dependent RNA helica...    440   3e-139   
ref|XP_009899186.1|  PREDICTED: probable ATP-dependent RNA helica...    440   3e-139   
ref|XP_005691173.1|  PREDICTED: probable ATP-dependent RNA helica...    436   3e-139   
ref|XP_009883094.1|  PREDICTED: probable ATP-dependent RNA helica...    440   3e-139   
gb|KFP54935.1|  putative ATP-dependent RNA helicase DDX59               439   3e-139   
ref|XP_005520969.1|  PREDICTED: probable ATP-dependent RNA helica...    439   4e-139   
ref|XP_007127728.1|  PREDICTED: probable ATP-dependent RNA helica...    439   4e-139   
ref|XP_006982482.1|  PREDICTED: probable ATP-dependent RNA helica...    439   4e-139   
ref|XP_009324443.1|  PREDICTED: probable ATP-dependent RNA helica...    439   4e-139   
ref|XP_008065299.1|  PREDICTED: probable ATP-dependent RNA helica...    439   5e-139   
ref|XP_005487140.1|  PREDICTED: probable ATP-dependent RNA helica...    439   5e-139   
ref|XP_006213318.1|  PREDICTED: probable ATP-dependent RNA helica...    437   6e-139   
dbj|BAE21808.1|  unnamed protein product                                439   6e-139   
ref|XP_009086718.1|  PREDICTED: probable ATP-dependent RNA helica...    439   7e-139   
ref|XP_422189.2|  PREDICTED: probable ATP-dependent RNA helicase ...    439   7e-139   Gallus gallus [bantam]
ref|XP_008628441.1|  PREDICTED: probable ATP-dependent RNA helica...    438   1e-138   
ref|XP_010004983.1|  PREDICTED: probable ATP-dependent RNA helica...    438   1e-138   
ref|XP_009472688.1|  PREDICTED: probable ATP-dependent RNA helica...    438   1e-138   
gb|KFW68586.1|  putative ATP-dependent RNA helicase DDX59               438   1e-138   
ref|XP_010200730.1|  PREDICTED: probable ATP-dependent RNA helica...    438   1e-138   
gb|KFZ61480.1|  putative ATP-dependent RNA helicase DDX59               438   1e-138   
ref|XP_003474898.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    437   2e-138   
ref|XP_005454017.1|  PREDICTED: probable ATP-dependent RNA helica...    438   2e-138   
ref|XP_005800397.1|  PREDICTED: probable ATP-dependent RNA helica...    437   2e-138   
ref|XP_006135453.1|  PREDICTED: probable ATP-dependent RNA helica...    437   2e-138   
ref|XP_005348490.1|  PREDICTED: probable ATP-dependent RNA helica...    437   2e-138   
ref|XP_009500112.1|  PREDICTED: probable ATP-dependent RNA helica...    437   2e-138   
ref|XP_009583110.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_004685530.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_009668082.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_006892154.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_010214505.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_009694569.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
ref|XP_010954570.1|  PREDICTED: probable ATP-dependent RNA helica...    437   3e-138   
gb|KFP63098.1|  putative ATP-dependent RNA helicase DDX59               437   4e-138   
ref|XP_005148130.1|  PREDICTED: probable ATP-dependent RNA helica...    437   4e-138   
ref|XP_009668080.1|  PREDICTED: probable ATP-dependent RNA helica...    437   4e-138   
ref|XP_003223658.1|  PREDICTED: probable ATP-dependent RNA helica...    436   4e-138   
ref|XP_009668081.1|  PREDICTED: probable ATP-dependent RNA helica...    437   4e-138   
gb|KFW89466.1|  putative ATP-dependent RNA helicase DDX59               436   6e-138   
ref|XP_002932198.2|  PREDICTED: probable ATP-dependent RNA helica...    438   9e-138   
ref|XP_006183991.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    436   1e-137   
ref|XP_005730368.1|  PREDICTED: probable ATP-dependent RNA helica...    436   2e-137   
ref|XP_010140891.1|  PREDICTED: probable ATP-dependent RNA helica...    435   2e-137   
ref|XP_003767605.1|  PREDICTED: probable ATP-dependent RNA helica...    435   2e-137   
ref|XP_010164427.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    435   2e-137   
ref|XP_008405024.1|  PREDICTED: probable ATP-dependent RNA helica...    434   3e-137   
ref|XP_007541498.1|  PREDICTED: probable ATP-dependent RNA helica...    434   4e-137   
ref|XP_007055261.1|  PREDICTED: probable ATP-dependent RNA helica...    434   4e-137   
gb|ESA07180.1|  hypothetical protein GLOINDRAFT_52624                   431   5e-137   
ref|XP_010017051.1|  PREDICTED: probable ATP-dependent RNA helica...    434   5e-137   
ref|XP_005242076.1|  PREDICTED: probable ATP-dependent RNA helica...    434   7e-137   
ref|XP_004562058.1|  PREDICTED: probable ATP-dependent RNA helica...    434   8e-137   
ref|XP_005730370.1|  PREDICTED: probable ATP-dependent RNA helica...    433   1e-136   
ref|XP_005304422.1|  PREDICTED: probable ATP-dependent RNA helica...    433   1e-136   
gb|KFO93757.1|  putative ATP-dependent RNA helicase DDX59               432   2e-136   
ref|XP_004943159.1|  PREDICTED: probable ATP-dependent RNA helica...    437   2e-136   
ref|XP_001377534.2|  PREDICTED: probable ATP-dependent RNA helica...    432   3e-136   Monodelphis domestica
ref|XP_008925093.1|  PREDICTED: probable ATP-dependent RNA helica...    432   3e-136   
gb|EAW91319.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 59, isofor...    429   4e-136   
ref|XP_004562060.1|  PREDICTED: probable ATP-dependent RNA helica...    431   6e-136   
ref|XP_010307694.1|  PREDICTED: probable ATP-dependent RNA helica...    431   6e-136   
ref|XP_005440161.1|  PREDICTED: probable ATP-dependent RNA helica...    431   8e-136   
ref|XP_005997780.1|  PREDICTED: probable ATP-dependent RNA helica...    431   1e-135   
ref|XP_007233278.1|  PREDICTED: probable ATP-dependent RNA helica...    433   1e-135   
ref|XP_006278607.1|  PREDICTED: probable ATP-dependent RNA helica...    431   1e-135   
emb|CAG00632.1|  unnamed protein product                                426   4e-135   Tetraodon nigroviridis
ref|XP_006025567.1|  PREDICTED: probable ATP-dependent RNA helica...    427   1e-134   
ref|XP_006025566.1|  PREDICTED: probable ATP-dependent RNA helica...    428   2e-134   
ref|NP_001038443.2|  probable ATP-dependent RNA helicase DDX59          426   2e-134   Danio rerio [leopard danio]
ref|XP_004886053.1|  PREDICTED: probable ATP-dependent RNA helica...    427   2e-134   
gb|AAI60762.1|  LOC100127243 protein                                    427   3e-134   Xenopus laevis [clawed frog]
gb|AAI39522.1|  LOC562123 protein                                       425   3e-134   Danio rerio [leopard danio]
gb|KFO06166.1|  putative ATP-dependent RNA helicase DDX59               426   7e-134   
ref|XP_010588497.1|  PREDICTED: probable ATP-dependent RNA helica...    424   1e-133   
ref|XP_003974349.1|  PREDICTED: probable ATP-dependent RNA helica...    425   2e-133   
emb|CDQ85337.1|  unnamed protein product                                424   2e-133   
gb|KFQ83848.1|  putative ATP-dependent RNA helicase DDX59               422   2e-132   
ref|XP_006635016.1|  PREDICTED: probable ATP-dependent RNA helica...    421   5e-132   
ref|XP_005330435.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    420   2e-131   
ref|XP_008530673.1|  PREDICTED: probable ATP-dependent RNA helica...    418   3e-131   
ref|XP_010894289.1|  PREDICTED: probable ATP-dependent RNA helica...    417   3e-130   
ref|XP_005920971.1|  PREDICTED: probable ATP-dependent RNA helica...    416   4e-130   
ref|XP_001641091.1|  predicted protein                                  415   7e-130   Nematostella vectensis
ref|XP_008290432.1|  PREDICTED: probable ATP-dependent RNA helica...    416   1e-129   
ref|XP_005920974.1|  PREDICTED: probable ATP-dependent RNA helica...    414   3e-129   
gb|KFQ03728.1|  putative ATP-dependent RNA helicase DDX59               413   4e-129   
ref|XP_006792056.1|  PREDICTED: probable ATP-dependent RNA helica...    412   2e-128   
ref|XP_002110268.1|  hypothetical protein TRIADDRAFT_23332              407   2e-128   Trichoplax adhaerens
ref|XP_010740651.1|  PREDICTED: probable ATP-dependent RNA helica...    412   3e-128   
ref|XP_009956255.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    411   3e-128   
ref|XP_009188791.1|  PREDICTED: probable ATP-dependent RNA helica...    409   6e-128   
ref|XP_010778417.1|  PREDICTED: probable ATP-dependent RNA helica...    410   1e-127   
gb|EQB78242.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 59-like pr...    416   3e-127   
ref|XP_006814002.1|  PREDICTED: probable ATP-dependent RNA helica...    407   1e-126   
ref|XP_007987211.1|  PREDICTED: probable ATP-dependent RNA helica...    405   2e-126   
ref|XP_008329918.1|  PREDICTED: probable ATP-dependent RNA helica...    406   3e-126   
ref|XP_004067997.1|  PREDICTED: probable ATP-dependent RNA helica...    405   6e-126   
ref|XP_005245577.1|  PREDICTED: probable ATP-dependent RNA helica...    401   4e-125   
ref|XP_003264574.1|  PREDICTED: probable ATP-dependent RNA helica...    401   4e-125   
ref|XP_004028163.1|  PREDICTED: probable ATP-dependent RNA helica...    401   4e-125   
ref|XP_006078497.1|  PREDICTED: probable ATP-dependent RNA helica...    400   7e-125   
ref|XP_006711625.1|  PREDICTED: probable ATP-dependent RNA helica...    399   1e-124   
ref|XP_004028164.1|  PREDICTED: probable ATP-dependent RNA helica...    400   2e-124   
emb|CAB66546.1|  hypothetical protein                                   400   2e-124   Homo sapiens [man]
ref|XP_006155516.1|  PREDICTED: probable ATP-dependent RNA helica...    398   2e-124   
ref|XP_008266900.1|  PREDICTED: probable ATP-dependent RNA helica...    398   2e-124   
gb|ELW57895.1|  putative ATP-dependent RNA helicase DDX59               399   3e-124   
ref|XP_005608107.1|  PREDICTED: probable ATP-dependent RNA helica...    397   6e-124   
ref|XP_010643425.1|  PREDICTED: probable ATP-dependent RNA helica...    396   2e-123   
ref|XP_006529907.1|  PREDICTED: probable ATP-dependent RNA helica...    391   2e-121   
ref|XP_006529905.1|  PREDICTED: probable ATP-dependent RNA helica...    390   5e-121   
ref|XP_010643426.1|  PREDICTED: probable ATP-dependent RNA helica...    382   4e-118   
ref|XP_006904510.1|  PREDICTED: probable ATP-dependent RNA helica...    382   1e-117   
gb|ELK19091.1|  Putative ATP-dependent RNA helicase DDX59               374   2e-115   
ref|XP_004659519.1|  PREDICTED: probable ATP-dependent RNA helica...    372   6e-114   
ref|XP_009911542.1|  PREDICTED: probable ATP-dependent RNA helica...    370   5e-113   
ref|XP_005245576.1|  PREDICTED: probable ATP-dependent RNA helica...    369   6e-113   
ref|XP_003389551.1|  PREDICTED: probable ATP-dependent RNA helica...    366   2e-112   
ref|XP_010347145.1|  PREDICTED: probable ATP-dependent RNA helica...    366   8e-112   
ref|XP_006529906.1|  PREDICTED: probable ATP-dependent RNA helica...    362   2e-110   
ref|XP_004943160.1|  PREDICTED: probable ATP-dependent RNA helica...    365   8e-110   
ref|XP_010084613.1|  PREDICTED: probable ATP-dependent RNA helica...    345   7e-105   
ref|XP_005029223.1|  PREDICTED: probable ATP-dependent RNA helica...    346   6e-104   
ref|XP_006078499.1|  PREDICTED: probable ATP-dependent RNA helica...    341   1e-102   
ref|XP_007656563.1|  PREDICTED: probable ATP-dependent RNA helica...    331   2e-99    
ref|XP_002907583.1|  DEAD/DEAH box RNA helicase, putative               332   4e-99    
gb|ETL81122.1|  hypothetical protein L917_18488                         331   1e-98    
gb|ETP32134.1|  hypothetical protein F442_19113                         330   1e-98    
gb|ETP03981.1|  hypothetical protein F441_19163                         330   2e-98    
gb|ETK74456.1|  hypothetical protein L915_18765                         330   2e-98    
gb|ETO62885.1|  hypothetical protein F444_19290                         330   3e-98    
gb|ETI34077.1|  hypothetical protein F443_19341                         329   4e-98    
ref|XP_008897228.1|  hypothetical protein PPTG_05434                    329   6e-98    
gb|ETM34310.1|  hypothetical protein L914_18582                         328   8e-98    
ref|XP_009835383.1|  hypothetical protein H257_10516                    327   3e-97    
ref|XP_009517240.1|  hypothetical protein PHYSODRAFT_310080             323   2e-95    
ref|XP_007883802.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    313   3e-92    
ref|XP_008875474.1|  hypothetical protein H310_10797                    313   5e-92    
ref|XP_001109688.2|  PREDICTED: probable ATP-dependent RNA helica...    302   1e-90    
gb|KFH67932.1|  hypothetical protein MVEG_06663                         303   4e-88    
ref|XP_003391542.1|  PREDICTED: probable ATP-dependent RNA helica...    292   6e-87    
ref|XP_008611504.1|  hypothetical protein SDRG_07449                    298   8e-87    
gb|EPB92876.1|  hypothetical protein HMPREF1544_00315                   293   1e-84    
ref|XP_002167172.2|  PREDICTED: uncharacterized protein LOC100210997    302   3e-83    
ref|XP_010126167.1|  PREDICTED: probable ATP-dependent RNA helica...    286   4e-83    
gb|KFP37430.1|  putative ATP-dependent RNA helicase DDX59               285   5e-83    
gb|AAH86823.1|  LOC553282 protein                                       283   3e-82    
ref|XP_010360970.1|  PREDICTED: probable ATP-dependent RNA helica...    285   8e-82    
gb|AAI09422.1|  LOC562123 protein                                       283   1e-81    
gb|ETK74457.1|  hypothetical protein, variant                           282   3e-81    
ref|XP_007987215.1|  PREDICTED: probable ATP-dependent RNA helica...    282   8e-81    
gb|KDP26941.1|  hypothetical protein JCGZ_21034                         280   3e-79    
ref|XP_006663583.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   4e-79    
gb|EAZ18899.1|  hypothetical protein OsJ_34439                          276   9e-79    
gb|AAL90351.1|  RE28061p                                                283   1e-78    
ref|XP_001980939.1|  GG17436                                            282   2e-78    
gb|AAH14183.1|  DDX59 protein                                           272   3e-78    
ref|NP_001068221.1|  Os11g0599500                                       277   3e-78    
ref|XP_002304009.2|  hypothetical protein POPTR_0003s21330g             277   4e-78    
ref|XP_001955251.1|  GF16329                                            280   6e-78    
ref|XP_011025172.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   6e-78    
ref|XP_002032017.1|  GM26328                                            280   1e-77    
ref|XP_011025171.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   1e-77    
ref|NP_536783.1|  belle, isoform A                                      280   1e-77    
ref|NP_001262379.1|  belle, isoform B                                   280   1e-77    
gb|AGJ89708.1|  FI21109p1                                               280   1e-77    
ref|XP_009413313.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   2e-77    
ref|XP_009413311.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   2e-77    
ref|XP_002096830.1|  bel                                                279   2e-77    
ref|XP_002000433.1|  GI10230                                            279   2e-77    
gb|KHG22973.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    274   4e-77    
gb|EFZ17785.1|  hypothetical protein SINV_13785                         273   4e-77    
ref|XP_008384403.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   4e-77    
ref|XP_007145713.1|  hypothetical protein PHAVU_007G262000g             274   5e-77    
ref|XP_003533906.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   5e-77    
ref|XP_008349416.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   5e-77    
ref|XP_010923340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   5e-77    
ref|XP_009364117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   5e-77    
ref|XP_006842770.1|  hypothetical protein AMTR_s00133p00101570          274   7e-77    
ref|XP_004535594.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    277   7e-77    
ref|XP_002073325.1|  GK14071                                            278   8e-77    
ref|XP_004535593.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    277   8e-77    
ref|XP_001761340.1|  predicted protein                                  273   8e-77    
ref|XP_004535591.1|  PREDICTED: ATP-dependent RNA helicase bel-li...    277   9e-77    
ref|XP_002137583.1|  GA27302                                            277   1e-76    
ref|XP_002104236.1|  GD20854                                            277   1e-76    
gb|ESX02190.1|  ATP-dependent RNA helicase DED1                         273   1e-76    
gb|AAZ41384.1|  Ded1-like DEAD-box RNA helicase                         276   2e-76    
ref|XP_001994075.1|  GH22875                                            276   2e-76    
ref|XP_004294989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   2e-76    
ref|XP_008554956.1|  PREDICTED: ATP-dependent RNA helicase bel          274   2e-76    
ref|XP_002056603.1|  GJ11034                                            276   2e-76    
ref|XP_005180410.1|  PREDICTED: ATP-dependent RNA helicase bel-like     275   3e-76    
ref|XP_010243434.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   3e-76    
ref|XP_002527063.1|  dead box ATP-dependent RNA helicase, putative      273   3e-76    
gb|AFW60456.1|  putative DEAD-box ATP-dependent RNA helicase fami...    271   3e-76    
emb|CCD58866.1|  DEAD box ATP-dependent RNA helicase, putative          272   3e-76    
ref|XP_011010680.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   3e-76    
pdb|2I4I|A  Chain A, Crystal Structure Of Human Dead-Box Rna Heli...    266   3e-76    
ref|XP_011048237.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   3e-76    
ref|XP_009375510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   3e-76    
ref|XP_010101088.1|  DEAD-box ATP-dependent RNA helicase 37             271   3e-76    
ref|XP_004341811.1|  DEAD/DEAH box helicase domain containing pro...    278   4e-76    
ref|XP_008351686.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   4e-76    
ref|XP_004980690.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   5e-76    
ref|XP_006015705.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   5e-76    
ref|XP_002267581.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   5e-76    
ref|XP_002297644.2|  hypothetical protein POPTR_0001s04510g             271   6e-76    
ref|XP_006265283.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   6e-76    
ref|XP_008874837.1|  hypothetical protein H310_10276                    271   7e-76    
ref|XP_003699498.1|  PREDICTED: putative ATP-dependent RNA helica...    273   7e-76    
gb|EPS58220.1|  hypothetical protein M569_16595                         269   7e-76    
ref|XP_010693834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   7e-76    
dbj|BAM75192.1|  vasa-like gene-1                                       266   9e-76    
ref|XP_006462145.1|  hypothetical protein AGABI2DRAFT_70511             271   9e-76    
ref|XP_004349702.1|  ATP dependent RNA helicase                         271   9e-76    
ref|XP_006015706.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   9e-76    
ref|XP_006354152.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   9e-76    
ref|XP_009833245.1|  hypothetical protein H257_08873                    271   9e-76    
ref|XP_001627306.1|  predicted protein                                  272   9e-76    
ref|NP_001254690.1|  ATP-dependent RNA helicase DDX3Y                   271   1e-75    
ref|XP_004228610.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
ref|XP_004142160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
ref|XP_004349510.1|  predicted protein                                  273   1e-75    
gb|KGN54076.1|  hypothetical protein Csa_4G280530                       270   1e-75    
ref|XP_007327112.1|  hypothetical protein AGABI1DRAFT_35315             271   1e-75    
ref|XP_002283489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
gb|EGW02199.1|  putative ATP-dependent RNA helicase DDX59               261   1e-75    
ref|XP_006650754.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-75    
gb|KFO87449.1|  ATP-dependent RNA helicase DDX3X                        270   1e-75    
ref|XP_004514158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
ref|XP_009406538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
ref|XP_011075074.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   1e-75    
gb|KFW08177.1|  ATP-dependent RNA helicase DDX3X                        270   1e-75    
gb|KFZ58829.1|  ATP-dependent RNA helicase DDX3X                        270   1e-75    
ref|XP_006265282.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   2e-75    
ref|XP_009697235.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   2e-75    
ref|XP_008796685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-75    
ref|XP_008941126.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   2e-75    
ref|XP_001773533.1|  predicted protein                                  269   2e-75    
ref|XP_006193890.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   2e-75    
ref|XP_005001022.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   2e-75    
ref|XP_008449802.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-75    
gb|KFZ65750.1|  ATP-dependent RNA helicase DDX3X                        269   2e-75    
gb|KFR08445.1|  ATP-dependent RNA helicase DDX3X                        269   2e-75    
ref|XP_008941125.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   2e-75    
ref|XP_011078806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   2e-75    
ref|XP_009902571.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   2e-75    
ref|XP_010257586.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-75    
ref|XP_006193891.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   3e-75    
ref|XP_004924685.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   3e-75    
ref|XP_007426570.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   3e-75    
ref|XP_009087868.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   3e-75    
ref|XP_010991698.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   3e-75    
ref|XP_007899773.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   3e-75    
ref|XP_008105617.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   3e-75    
ref|XP_003463879.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   3e-75    
ref|XP_009902562.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   3e-75    
ref|XP_010301697.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   3e-75    
ref|XP_009400848.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   3e-75    
ref|XP_009574281.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   3e-75    
ref|XP_009069924.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        270   3e-75    
ref|XP_005234543.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   3e-75    
ref|XP_010166869.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   3e-75    
ref|XP_003495048.1|  PREDICTED: putative ATP-dependent RNA helica...    266   3e-75    
ref|XP_006265281.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   3e-75    
ref|XP_009516981.1|  hypothetical protein PHYSODRAFT_323195             269   3e-75    
ref|XP_003531232.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   4e-75    
ref|XP_001778715.1|  predicted protein                                  268   4e-75    
gb|KHN47963.1|  DEAD-box ATP-dependent RNA helicase 37                  269   4e-75    
ref|XP_009506791.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   4e-75    
ref|XP_005234540.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_005151781.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_005012557.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_009087864.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_009087865.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
gb|EFW43161.2|  ATP dependent RNA helicase                              271   4e-75    
ref|XP_009973180.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   4e-75    
gb|ERE73017.1|  putative ATP-dependent RNA helicase Pl10-like pro...    266   4e-75    
ref|XP_010125320.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        268   4e-75    
ref|XP_005012555.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_009087867.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_005012558.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   4e-75    
gb|EHJ68220.1|  ATP-dependent RNA helicase belle-like protein           271   4e-75    
ref|XP_009317169.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    269   4e-75    
ref|XP_005151780.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   4e-75    
ref|XP_009087866.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   5e-75    
ref|XP_010130722.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    269   5e-75    
ref|XP_008498587.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        270   5e-75    
ref|XP_006492811.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   5e-75    
ref|XP_005526553.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   5e-75    
ref|XP_004924684.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   5e-75    
ref|XP_005489094.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   5e-75    
ref|XP_005234539.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   5e-75    
ref|XP_010569662.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   5e-75    
ref|XP_007426568.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   5e-75    
ref|XP_005012556.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   5e-75    
ref|XP_005234542.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   5e-75    
ref|XP_006193889.1|  PREDICTED: ATP-dependent RNA helicase DDX3X-...    270   5e-75    
emb|CAX73517.1|  ATP-dependent RNA helicase DDX3X                       269   5e-75    
ref|XP_009953654.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   5e-75    
ref|XP_005234541.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   5e-75    
gb|ETO22562.1|  hypothetical protein RFI_14635                          270   6e-75    
ref|XP_008240826.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   6e-75    
ref|XP_006265280.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    271   6e-75    
ref|NP_001025971.1|  ATP-dependent RNA helicase DDX3X                   269   6e-75    
ref|XP_009990562.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   6e-75    
ref|XP_005526555.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   6e-75    
ref|XP_007208033.1|  hypothetical protein PRUPE_ppa002959mg             268   6e-75    
ref|XP_011078805.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   6e-75    
emb|CDP14280.1|  unnamed protein product                                268   6e-75    
ref|XP_009644407.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        270   6e-75    
ref|XP_010044956.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   6e-75    
ref|XP_009490355.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        270   6e-75    
ref|XP_007159397.1|  hypothetical protein PHAVU_002G234900g             268   6e-75    
gb|KDO70827.1|  hypothetical protein CISIN_1g007368mg                   268   6e-75    
ref|XP_006134027.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   6e-75    
gb|EFN69748.1|  ATP-dependent RNA helicase bel                          270   6e-75    
ref|XP_010569661.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   6e-75    
ref|XP_005526551.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   6e-75    
ref|XP_007899774.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    268   7e-75    
emb|CDX71944.1|  BnaC08g29300D                                          268   7e-75    
ref|XP_010074707.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        268   7e-75    
ref|XP_010723017.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   7e-75    
ref|XP_010153055.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   7e-75    
ref|XP_003524948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   7e-75    
gb|AFM77716.1|  vasa-like DEAD-box RNA helicase                         268   8e-75    
ref|XP_010194904.1|  PREDICTED: ATP-dependent RNA helicase DDX3X        269   8e-75    
ref|XP_005526554.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   8e-75    
ref|XP_005526552.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    269   8e-75    
ref|XP_005012554.1|  PREDICTED: ATP-dependent RNA helicase DDX3X ...    270   8e-75    



>ref|XP_009614209.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
tomentosiformis]
 ref|XP_009614210.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
tomentosiformis]
 ref|XP_009614211.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
tomentosiformis]
 ref|XP_009614212.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
tomentosiformis]
 ref|XP_009614213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
tomentosiformis]
Length=527

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/532 (77%), Positives = 473/532 (89%), Gaps = 6/532 (1%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             ME+S+ A  +SN      ++ +VK+R W+QREAL  EP+CVICGRYGEYICDETDDDICS
Sbjct  1     MESSVAAENDSNA-----AEDDVKERCWDQREALAGEPRCVICGRYGEYICDETDDDICS  55

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK ILLSR+  SR+PT  P PV+ PATD+CYYVRD+DK SE K L +DQ ELLRRKL+
Sbjct  56    LECKGILLSRLAISRQPTARPCPVKLPATDECYYVRDNDK-SEVKPLTTDQTELLRRKLD  114

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             IVVKGD   PP++SF SC +P+KLL+N+E AGYEMPTPVQMQAIPAAL G+SLLVSAETG
Sbjct  115   IVVKGDTTPPPVLSFASCKLPQKLLENIEVAGYEMPTPVQMQAIPAALAGKSLLVSAETG  174

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKTGSFLIPIV+   K+N    + +QKPLAM+L PTRELC+Q+E+QAKVLGKG+PFKTA
Sbjct  175   SGKTGSFLIPIVSRCAKVNEEHFQNQQKPLAMVLTPTRELCLQVEDQAKVLGKGLPFKTA  234

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLTK EIELD++S+ V+DEVDCMLQRGF 
Sbjct  235   LVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLTKHEIELDTISILVLDEVDCMLQRGFR  294

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             EQVMQIF ALSQPQ+LMYSATI +EVE+MASSM K +TVISVG+ NKPN AVKQLAIWV+
Sbjct  295   EQVMQIFTALSQPQVLMYSATIPKEVERMASSMVKKVTVISVGKPNKPNQAVKQLAIWVD  354

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SK+KKQKLFDIL SKQHYKPPVIVFVGSRLGADLLS AIT+STGLKA+ IHGEKSMKDRR
Sbjct  355   SKRKKQKLFDILMSKQHYKPPVIVFVGSRLGADLLSEAITVSTGLKALPIHGEKSMKDRR  414

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI+RSFLVG+VPVIVATGVLGRG+DLL+VKQV+VFDMPNSIKEYVHQ+GRASRMGEEGT+
Sbjct  415   EIVRSFLVGEVPVIVATGVLGRGIDLLTVKQVVVFDMPNSIKEYVHQVGRASRMGEEGTA  474

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             IVF+NEENKKLFPELVE LK+SGAAIP ELANS++SVGSFS GR QK+RK+G
Sbjct  475   IVFVNEENKKLFPELVETLKTSGAAIPRELANSRHSVGSFSAGRGQKKRKHG  526



>ref|XP_006354193.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006354194.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Solanum tuberosum]
Length=527

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/532 (77%), Positives = 471/532 (89%), Gaps = 6/532 (1%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             ME+S+ A  +SN P     + +VK+R W+QREALP EP+CVICGRYGEYICDETDDDICS
Sbjct  1     MESSVAAENDSNPP-----EDDVKERCWDQREALPGEPRCVICGRYGEYICDETDDDICS  55

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK ILLSR+ KSR+PT  P PV+ PATD+CYYVRD+DK SE   L +DQ ELLRRKL+
Sbjct  56    LECKGILLSRLAKSRQPTARPCPVKLPATDECYYVRDNDK-SEVNPLTTDQTELLRRKLD  114

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I+VKGD   PPI+SF SC +P+KLL+N+E AGYEMPTPVQMQAIPAAL  +SLLVSAETG
Sbjct  115   ILVKGDTTPPPILSFASCKLPQKLLENIEVAGYEMPTPVQMQAIPAALARQSLLVSAETG  174

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKTGSFLIPIV+   K N    + +Q+PLAM+L PTRELCIQ+E+QAKVLGKG+PFKTA
Sbjct  175   SGKTGSFLIPIVSQCAKFNEEHFQNQQQPLAMVLTPTRELCIQVEDQAKVLGKGLPFKTA  234

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLTK EIELD++S+ V+DEVDCMLQRGF 
Sbjct  235   LVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLTKHEIELDTISILVLDEVDCMLQRGFR  294

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             EQVMQIF ALSQPQ+LMYSATI ++VEKMASSMAK +TVISVG+ NKPN AVKQLAIWV+
Sbjct  295   EQVMQIFTALSQPQVLMYSATIPKDVEKMASSMAKKVTVISVGKPNKPNQAVKQLAIWVD  354

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SK+KKQKLFDIL SKQHYKPPVI+FV SRLGADLLS AIT+STGLKA+SIHGEKSMKDRR
Sbjct  355   SKRKKQKLFDILMSKQHYKPPVIIFVDSRLGADLLSEAITVSTGLKALSIHGEKSMKDRR  414

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI+RSFLVG++PVIVATGVLGRG+DLL+VKQVIVFDMPNSIKEYVHQ+GRASRMGEEGTS
Sbjct  415   EIVRSFLVGEIPVIVATGVLGRGIDLLTVKQVIVFDMPNSIKEYVHQVGRASRMGEEGTS  474

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             IVF+NEENKKLFP+LVE LK+SGAAIP ELANS+YSV S S GR QK+RK+G
Sbjct  475   IVFVNEENKKLFPQLVEALKTSGAAIPRELANSRYSVASSSTGRGQKKRKHG  526



>ref|XP_009766933.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nicotiana 
sylvestris]
Length=527

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/532 (77%), Positives = 473/532 (89%), Gaps = 6/532 (1%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             ME+S+ A  +SN      ++ +VK+R W+QREALP EP+CVICGRYGEYICDETDDDICS
Sbjct  1     MESSVAAENDSNA-----AEDDVKERCWDQREALPGEPRCVICGRYGEYICDETDDDICS  55

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK ILLSR+ KSR+PT  P PV+ PATD+CYYVRD+DK SE K L +DQ ELLRRKL+
Sbjct  56    LECKGILLSRLAKSRQPTARPCPVKLPATDECYYVRDNDK-SEVKPLTTDQTELLRRKLD  114

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             IVVKGD   PP++SF S  +P+KLL+N+E AGYEMPTPVQMQAIP+ L G+SLLVSAETG
Sbjct  115   IVVKGDTTVPPVLSFASGKLPQKLLENIEVAGYEMPTPVQMQAIPSTLAGQSLLVSAETG  174

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKTGSFLIPIV+   K+N    + +QKPLAM+L PTRELCIQ+E+QAKVLGKG+PFKTA
Sbjct  175   SGKTGSFLIPIVSRCAKVNEEHFQNQQKPLAMVLTPTRELCIQVEDQAKVLGKGLPFKTA  234

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLTK EIEL+++S+ V+DEVDCMLQRGF 
Sbjct  235   LVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLTKHEIELNTISILVLDEVDCMLQRGFL  294

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             EQVMQIF ALSQPQ+LMYSATI +EVE+MASSMAK +TVISVG+ NKPN AVKQLAIWV+
Sbjct  295   EQVMQIFTALSQPQVLMYSATIPKEVERMASSMAKKVTVISVGKPNKPNQAVKQLAIWVD  354

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SK+KKQKLF IL SKQHYKPPVIVFVGSRLGADLLS AIT+STGLKA+ +HGEKSMKDRR
Sbjct  355   SKRKKQKLFGILMSKQHYKPPVIVFVGSRLGADLLSEAITVSTGLKALPMHGEKSMKDRR  414

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI+RSFLVG+VPVIVATGVLGRG+DLL+VKQVIVFDMPNSIKEYVHQ+GRASRMGEEGT+
Sbjct  415   EIVRSFLVGEVPVIVATGVLGRGIDLLTVKQVIVFDMPNSIKEYVHQVGRASRMGEEGTA  474

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             IVF+NEENKKLFPELVE LK+SGAAIP ELANS++SVGSFS GR QK+RK+G
Sbjct  475   IVFVNEENKKLFPELVETLKTSGAAIPRELANSRHSVGSFSAGRGQKKRKHG  526



>ref|XP_004228633.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X2 
[Solanum lycopersicum]
Length=527

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/532 (77%), Positives = 469/532 (88%), Gaps = 6/532 (1%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             ME+S+ A  +SN P     + +VK+R W+QREALP EP+C++CGRYGEYICDETDDDICS
Sbjct  1     MESSVAAENDSNPP-----EDDVKERCWDQREALPGEPRCIVCGRYGEYICDETDDDICS  55

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK ILLSR+ +SR+PT  P PV+ PATD+CYYVRD+ K SE   L ++Q ELLRRKL+
Sbjct  56    LECKGILLSRLGESRQPTARPCPVKLPATDECYYVRDNGK-SEVNPLTTEQTELLRRKLD  114

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I+VKGD   PPI+SF SC +P+KLL+N+E AGYEMPTPVQMQAIPAAL  +SLLVSAETG
Sbjct  115   ILVKGDTTPPPILSFASCKLPQKLLENIEVAGYEMPTPVQMQAIPAALARQSLLVSAETG  174

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKTGSFLIPIV+   K N      +Q+PLAM+L PTRELCIQ+E+QAKVLGKG+PFKTA
Sbjct  175   SGKTGSFLIPIVSQCAKFNEEHFPNQQQPLAMVLTPTRELCIQVEDQAKVLGKGLPFKTA  234

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLTK EIELD++S+ V+DEVDCMLQRGF 
Sbjct  235   LVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLTKHEIELDTISILVLDEVDCMLQRGFR  294

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             EQVMQIF ALSQPQ+LMYSATI ++VEKMASSMAK +TVISVG+ NKPN +VKQLAIWV+
Sbjct  295   EQVMQIFTALSQPQVLMYSATIPKDVEKMASSMAKKVTVISVGKPNKPNQSVKQLAIWVD  354

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SK+KKQKLFDIL SKQHYKPPVIVFV SRLGADLLS AIT+STGLKA+SIHGEKSMKDRR
Sbjct  355   SKRKKQKLFDILMSKQHYKPPVIVFVDSRLGADLLSEAITVSTGLKALSIHGEKSMKDRR  414

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI+RSFLVG++PVIVATGVL RG+DLL+VKQVIVFDMPNSIKEYVHQ+GRASRMGEEGTS
Sbjct  415   EIVRSFLVGEIPVIVATGVLSRGIDLLTVKQVIVFDMPNSIKEYVHQVGRASRMGEEGTS  474

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             IVF+NEENKKLFP+LVE LK+SGAAIP ELANS+YSVGSFS GR QK+RK G
Sbjct  475   IVFVNEENKKLFPQLVEALKTSGAAIPRELANSRYSVGSFSAGRGQKKRKLG  526



>ref|XP_010315999.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Solanum lycopersicum]
Length=545

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/545 (75%), Positives = 471/545 (86%), Gaps = 14/545 (3%)
 Frame = -1

Query  2091  METSIVAATESNQPS-------------GSDSDSEVKKRSWEQREALPDEPKCVICGRYG  1951
             ME+S+ A  +SN P               S S+ +VK+R W+QREALP EP+C++CGRYG
Sbjct  1     MESSVAAENDSNPPDITHGLSAYGIASLMSASEDDVKERCWDQREALPGEPRCIVCGRYG  60

Query  1950  EYICDETDDDICSLECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             EYICDETDDDICSLECK ILLSR+ +SR+PT  P PV+ PATD+CYYVRD+ K SE   L
Sbjct  61    EYICDETDDDICSLECKGILLSRLGESRQPTARPCPVKLPATDECYYVRDNGK-SEVNPL  119

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
              ++Q ELLRRKL+I+VKGD   PPI+SF SC +P+KLL+N+E AGYEMPTPVQMQAIPAA
Sbjct  120   TTEQTELLRRKLDILVKGDTTPPPILSFASCKLPQKLLENIEVAGYEMPTPVQMQAIPAA  179

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQ  1411
             L  +SLLVSAETGSGKTGSFLIPIV+   K N      +Q+PLAM+L PTRELCIQ+E+Q
Sbjct  180   LARQSLLVSAETGSGKTGSFLIPIVSQCAKFNEEHFPNQQQPLAMVLTPTRELCIQVEDQ  239

Query  1410  AKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFV  1231
             AKVLGKG+PFKTALVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLTK EIELD++S+ V
Sbjct  240   AKVLGKGLPFKTALVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLTKHEIELDTISILV  299

Query  1230  IDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNK  1051
             +DEVDCMLQRGF EQVMQIF ALSQPQ+LMYSATI ++VEKMASSMAK +TVISVG+ NK
Sbjct  300   LDEVDCMLQRGFREQVMQIFTALSQPQVLMYSATIPKDVEKMASSMAKKVTVISVGKPNK  359

Query  1050  PNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKA  871
             PN +VKQLAIWV+SK+KKQKLFDIL SKQHYKPPVIVFV SRLGADLLS AIT+STGLKA
Sbjct  360   PNQSVKQLAIWVDSKRKKQKLFDILMSKQHYKPPVIVFVDSRLGADLLSEAITVSTGLKA  419

Query  870   VSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQ  691
             +SIHGEKSMKDRREI+RSFLVG++PVIVATGVL RG+DLL+VKQVIVFDMPNSIKEYVHQ
Sbjct  420   LSIHGEKSMKDRREIVRSFLVGEIPVIVATGVLSRGIDLLTVKQVIVFDMPNSIKEYVHQ  479

Query  690   IGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQK  511
             +GRASRMGEEGTSIVF+NEENKKLFP+LVE LK+SGAAIP ELANS+YSVGSFS GR QK
Sbjct  480   VGRASRMGEEGTSIVFVNEENKKLFPQLVEALKTSGAAIPRELANSRYSVGSFSAGRGQK  539

Query  510   RRKYG  496
             +RK G
Sbjct  540   KRKLG  544



>ref|XP_010660644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X2 
[Vitis vinifera]
Length=539

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/530 (73%), Positives = 454/530 (86%), Gaps = 8/530 (2%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT  1897
             V  T+ N+  G+D    VK+R W+QREALP EPKCVICGRYGEYICDETDDDICSLECK 
Sbjct  14    VELTDDNE--GTDG---VKERCWDQREALPGEPKCVICGRYGEYICDETDDDICSLECKQ  68

Query  1896  ILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
              LL R+ KSR P   PPP R P TD+C+YVRD   KS S+ L   Q E+LRR+L I V+G
Sbjct  69    TLLCRVAKSRLPVVLPPPKRLPTTDECFYVRDSGDKSGSQSLTGSQTEMLRRRLEICVRG  128

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
             D    PI+SF SC++P+KLL N+EAAGYE+PTPVQMQAIPAAL+G++LLVSA+TGSGKT 
Sbjct  129   DFDLSPILSFSSCNLPQKLLQNIEAAGYEIPTPVQMQAIPAALVGKNLLVSADTGSGKTA  188

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGG  1357
             SFL+PIV+    +    S  ++ PLAM+L PTRELC+Q+EEQAK+LGKG+PFKTALVVGG
Sbjct  189   SFLVPIVSRCTSIRPDHSPNQKNPLAMVLTPTRELCMQVEEQAKLLGKGLPFKTALVVGG  248

Query  1356  DAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQ  1177
             DAM RQL+R++ GV LIVGTPGRLIDLL+K EIELD V M V+DEVDCML+RGF +QVMQ
Sbjct  249   DAMPRQLHRIQQGVELIVGTPGRLIDLLSKHEIELDDVFMLVLDEVDCMLERGFRDQVMQ  308

Query  1176  IFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKK  997
             I+RALSQPQ+LMYSATIS+EVEK+ASSMAK + VISVG+ N+PN AVKQLAIWVESKQKK
Sbjct  309   IYRALSQPQVLMYSATISQEVEKVASSMAKDIIVISVGKSNRPNIAVKQLAIWVESKQKK  368

Query  996   QKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRS  817
             QKLFDILTSKQH+ PPV+VFVGSRLGADLL+ AITI+TGLKA+SIHGEKSMK+RREI+ S
Sbjct  369   QKLFDILTSKQHFTPPVVVFVGSRLGADLLTEAITITTGLKALSIHGEKSMKERREIMSS  428

Query  816   FLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFIN  637
             FLVG+VPV+VATGVL RGVDLLSV+QVIVFDMPNSIKEYVHQIGRASR+GEEGT+I+F+N
Sbjct  429   FLVGEVPVMVATGVLSRGVDLLSVRQVIVFDMPNSIKEYVHQIGRASRLGEEGTAILFLN  488

Query  636   EENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGR---HQKRRKYG  496
             EEN+ LFPELVEILKSSGAAIP ELANS+Y +GS +VGR    QK+RK+G
Sbjct  489   EENRNLFPELVEILKSSGAAIPRELANSRYRLGSVNVGRGQIRQKKRKHG  538



>ref|XP_002276467.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Vitis vinifera]
Length=540

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/513 (75%), Positives = 446/513 (87%), Gaps = 3/513 (1%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK+R W+QREALP EPKCVICGRYGEYICDETDDDICSLECK  LL R+ KSR P   PP
Sbjct  27    VKERCWDQREALPGEPKCVICGRYGEYICDETDDDICSLECKQTLLCRVAKSRLPVVLPP  86

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPR  1666
             P R P TD+C+YVRD   KS S+ L   Q E+LRR+L I V+GD    PI+SF SC++P+
Sbjct  87    PKRLPTTDECFYVRDSGDKSGSQSLTGSQTEMLRRRLEICVRGDFDLSPILSFSSCNLPQ  146

Query  1665  KLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLAC  1486
             KLL N+EAAGYE+PTPVQMQAIPAAL+G++LLVSA+TGSGKT SFL+PIV+    +    
Sbjct  147   KLLQNIEAAGYEIPTPVQMQAIPAALVGKNLLVSADTGSGKTASFLVPIVSRCTSIRPDH  206

Query  1485  SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLI  1306
             S  ++ PLAM+L PTRELC+Q+EEQAK+LGKG+PFKTALVVGGDAM RQL+R++ GV LI
Sbjct  207   SPNQKNPLAMVLTPTRELCMQVEEQAKLLGKGLPFKTALVVGGDAMPRQLHRIQQGVELI  266

Query  1305  VGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATI  1126
             VGTPGRLIDLL+K EIELD V M V+DEVDCML+RGF +QVMQI+RALSQPQ+LMYSATI
Sbjct  267   VGTPGRLIDLLSKHEIELDDVFMLVLDEVDCMLERGFRDQVMQIYRALSQPQVLMYSATI  326

Query  1125  SREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPV  946
             S+EVEK+ASSMAK + VISVG+ N+PN AVKQLAIWVESKQKKQKLFDILTSKQH+ PPV
Sbjct  327   SQEVEKVASSMAKDIIVISVGKSNRPNIAVKQLAIWVESKQKKQKLFDILTSKQHFTPPV  386

Query  945   IVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGR  766
             +VFVGSRLGADLL+ AITI+TGLKA+SIHGEKSMK+RREI+ SFLVG+VPV+VATGVL R
Sbjct  387   VVFVGSRLGADLLTEAITITTGLKALSIHGEKSMKERREIMSSFLVGEVPVMVATGVLSR  446

Query  765   GVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSS  586
             GVDLLSV+QVIVFDMPNSIKEYVHQIGRASR+GEEGT+I+F+NEEN+ LFPELVEILKSS
Sbjct  447   GVDLLSVRQVIVFDMPNSIKEYVHQIGRASRLGEEGTAILFLNEENRNLFPELVEILKSS  506

Query  585   GAAIPSELANSKYSVGSFSVGR---HQKRRKYG  496
             GAAIP ELANS+Y +GS +VGR    QK+RK+G
Sbjct  507   GAAIPRELANSRYRLGSVNVGRGQIRQKKRKHG  539



>ref|XP_011080220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Sesamum indicum]
 ref|XP_011080221.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Sesamum indicum]
 ref|XP_011080222.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Sesamum indicum]
Length=529

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/533 (72%), Positives = 456/533 (86%), Gaps = 12/533 (2%)
 Frame = -1

Query  2088  ETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             ETS+ AA ++  P     + +VK+R W+QREALP EP+C+ICGRYGEYICDETDDDICSL
Sbjct  6     ETSM-AADDNQAP-----EDDVKERCWDQREALPGEPQCIICGRYGEYICDETDDDICSL  59

Query  1908  ECKTILLSRIEKSRKPTPC--PPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKL  1735
             ECK  LLSR+ K    + C  PP VR PA D+CYYV+D +  S+ + L++ Q ELLRRKL
Sbjct  60    ECKRTLLSRVAKLEASSTCAQPPTVRLPAVDECYYVQDGNNVSQPQLLSNSQTELLRRKL  119

Query  1734  NIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAET  1555
              I V+GD V  PI+SFGSC++P+KLL NLEAAGYEMPTPVQMQAIP+AL+GRS+LV AET
Sbjct  120   EISVRGDRVPEPILSFGSCNLPQKLLQNLEAAGYEMPTPVQMQAIPSALIGRSMLVLAET  179

Query  1554  GSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKT  1375
             GSGKT SFL+PIV+   K+         KPLAM+L PTRELCIQ+EEQAKVLGKG+PFKT
Sbjct  180   GSGKTCSFLVPIVSYCAKVK----NNPWKPLAMVLTPTRELCIQVEEQAKVLGKGLPFKT  235

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
             ALVVGGDAMA Q+YR++ GVS+IVGTPGRLIDLLTK +  LDS+S+ V+DEVDCM+QRGF
Sbjct  236   ALVVGGDAMAGQVYRIQQGVSMIVGTPGRLIDLLTKHDFGLDSISILVLDEVDCMIQRGF  295

Query  1194  HEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
              EQVMQIF+ALSQPQ+LMYSAT+++EVE++A SM K LT ISVG+ N PN AVKQL IWV
Sbjct  296   REQVMQIFQALSQPQVLMYSATVTKEVERIAGSMVKDLTFISVGKPNNPNEAVKQLVIWV  355

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             ES +KKQKLFDILTSKQH+KPPV+VFVGSRLGADLLS AITI+TG+KA+SIHGEK+ K+R
Sbjct  356   ESNKKKQKLFDILTSKQHFKPPVVVFVGSRLGADLLSEAITITTGVKALSIHGEKTTKER  415

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
             R+ILRSFLVG+V VIVATGVLGRGVDLLSVKQVIVFDMPNS+KEYVHQIGRASRMG+EG 
Sbjct  416   RDILRSFLVGEVDVIVATGVLGRGVDLLSVKQVIVFDMPNSMKEYVHQIGRASRMGKEGM  475

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             ++VF+NEENKKLFPELV+ILKSSGAAIP ELANS+Y+V S S G++QK+RK+G
Sbjct  476   AMVFVNEENKKLFPELVQILKSSGAAIPRELANSRYTVHSLSAGKYQKKRKHG  528



>emb|CDP11098.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 439/498 (88%), Gaps = 0/498 (0%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             +   ++PS S + ++VK+R W+QREALP EP+CVICGRYGEYICDET+DDICS+ECK IL
Sbjct  6     SANCSEPSASAAGNDVKQRCWDQREALPGEPRCVICGRYGEYICDETNDDICSVECKRIL  65

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             L RI KS+ P PCP PV+ PATD+CYYVR+ + KSE+  L+SDQ ELLRRKL I ++GDL
Sbjct  66    LDRIAKSQPPVPCPSPVKLPATDECYYVREGNDKSEAGSLSSDQVELLRRKLEISIRGDL  125

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V  PI+SF SC++P KLL NLE AG+EMPTPVQMQAIP+AL+G++LLVSAETGSGK+GSF
Sbjct  126   VPAPILSFPSCNLPEKLLQNLEVAGFEMPTPVQMQAIPSALIGQNLLVSAETGSGKSGSF  185

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             L+PIV+   K N      ++KPLAM+L PTRELCIQ+EEQAK+ GKG+PFKTALVVGGDA
Sbjct  186   LVPIVSYCAKFNADKPHGERKPLAMVLTPTRELCIQVEEQAKLFGKGLPFKTALVVGGDA  245

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             MA QLYR++ G+SLIVGTPGRLIDLL K +IELDSVS+ V+DEVD ML+RGFHEQVMQIF
Sbjct  246   MAGQLYRIQQGISLIVGTPGRLIDLLAKHDIELDSVSILVVDEVDSMLERGFHEQVMQIF  305

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             RALSQPQ+LMYSATI ++V+KMA+SM K LT+I+VG+ NKP GAVKQ+ IWV+SKQKKQK
Sbjct  306   RALSQPQVLMYSATIPKDVQKMANSMVKDLTIIAVGKPNKPTGAVKQVVIWVDSKQKKQK  365

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             LFDILTSKQH+KPPV+VFV SR+GADLLS AI I+TG+KAVSIHGEKSMK+RREIL+SFL
Sbjct  366   LFDILTSKQHFKPPVVVFVSSRIGADLLSEAIGITTGIKAVSIHGEKSMKERREILKSFL  425

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
             VG+V VIVATGVLGRG+DLL VKQVIVFDMPNSIKEYVHQIGRASR+GEEG+++VF+NEE
Sbjct  426   VGEVLVIVATGVLGRGIDLLHVKQVIVFDMPNSIKEYVHQIGRASRLGEEGSAMVFVNEE  485

Query  630   NKKLFPELVEILKSSGAA  577
             NK LF +LV+ILKSSGAA
Sbjct  486   NKNLFRDLVQILKSSGAA  503



>ref|XP_010276751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Nelumbo nucifera]
Length=540

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/510 (70%), Positives = 435/510 (85%), Gaps = 0/510 (0%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK+RS +QREAL  EP CVICGRYGEYICDETDDDICS+ECK +LL R+ KS+KP   PP
Sbjct  31    VKERSSDQREALSGEPSCVICGRYGEYICDETDDDICSMECKQVLLLRLAKSQKPLDRPP  90

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPR  1666
              VR P TD+C+YVRD   ++E +CL+  Q E LRRK+ I VKG+ V PPI+SF SC++P 
Sbjct  91    AVRLPTTDECFYVRDGVNETEYQCLSGYQIESLRRKIEIKVKGESVPPPILSFSSCNLPE  150

Query  1665  KLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLAC  1486
             K+  NLE AGYE+PTPVQMQAIPAAL+G++LLVSA+TGSGKT SFL+PI++      L  
Sbjct  151   KIQHNLELAGYEIPTPVQMQAIPAALIGKNLLVSADTGSGKTASFLVPIISRCANFRLKY  210

Query  1485  SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLI  1306
                +++PLAM++ PTRELC+Q+EEQAK+LGKG+PFKTALVVGGDAMA+Q+YR++ GV LI
Sbjct  211   PSDRKRPLAMVMEPTRELCVQVEEQAKLLGKGLPFKTALVVGGDAMAKQIYRIQQGVELI  270

Query  1305  VGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATI  1126
             VGTPGRLIDLLTK +IELD VS+ V+DEVDCMLQRGF +QVMQ+F+AL+QPQ+LMYSATI
Sbjct  271   VGTPGRLIDLLTKHDIELDEVSVLVLDEVDCMLQRGFRDQVMQVFQALTQPQVLMYSATI  330

Query  1125  SREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPV  946
               EVEKMA+S+AK L  +S G+ N+PN +VKQ+ IWVESKQKKQKLFDIL SKQH+ PPV
Sbjct  331   PPEVEKMANSIAKDLVFVSAGKPNRPNESVKQVVIWVESKQKKQKLFDILMSKQHFMPPV  390

Query  945   IVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGR  766
             +VFV SRLGADLLS AIT++TG++A+SIHGEK MK+RRE L+ FL G+V VIVATGVLGR
Sbjct  391   VVFVASRLGADLLSEAITVTTGIRALSIHGEKPMKERRETLKLFLTGEVSVIVATGVLGR  450

Query  765   GVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSS  586
             GVDLL VKQVIVFDMPNS+KEYVHQIGR+SR+GEEGT+IVF+NEENK LF ELVE+L+SS
Sbjct  451   GVDLLRVKQVIVFDMPNSMKEYVHQIGRSSRLGEEGTAIVFVNEENKNLFRELVEVLRSS  510

Query  585   GAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             GAA+P ELANS+Y++ S+S GR  K+RK+G
Sbjct  511   GAAVPRELANSRYTMASYSAGRALKKRKHG  540



>ref|XP_011033696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Populus euphratica]
 ref|XP_011033697.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Populus euphratica]
Length=525

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/533 (69%), Positives = 435/533 (82%), Gaps = 8/533 (2%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             M T +V     ++ +G D    VKK S +QREALP EP CV+CGRYGEYICD+T+ DICS
Sbjct  1     MSTPLVNELTVSEAAGDD----VKKTSRDQREALPGEPICVVCGRYGEYICDQTESDICS  56

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK  LL R   +  P   P P R  ATD+C+YVRD    SES  L SDQ ELLRRKL 
Sbjct  57    LECKQTLLGRAADAHLPAGHPLPKRLAATDECFYVRD----SESLPLTSDQTELLRRKLE  112

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I VKGD V  PI+SF SC++P KLL N++  GY+MPTP+QMQ I AAL G+SLL SA+TG
Sbjct  113   IHVKGDSVPDPILSFSSCNLPEKLLHNIQTLGYDMPTPIQMQGIAAALTGKSLLASADTG  172

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKT SFL+P+V+           + +KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTA
Sbjct  173   SGKTASFLVPVVSRCATFRHGNLSKSKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTA  232

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LV+GGDAM RQLYR++ GV LIVGTPGRLIDLL K +IELD +   V+DEVDCMLQ+GF 
Sbjct  233   LVIGGDAMPRQLYRIQQGVELIVGTPGRLIDLLAKHDIELDDIMTLVLDEVDCMLQKGFR  292

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             +QVMQIFRALSQPQ+LMYSAT+S+EVEKMASSMAK L  +S+GQ N+P+ AVKQLAIWVE
Sbjct  293   DQVMQIFRALSQPQVLMYSATMSQEVEKMASSMAKDLIFVSIGQPNRPSNAVKQLAIWVE  352

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SKQKKQKLFDIL SKQH+ PP IV+VGSR+GADLLS AIT++TGLKA+SIHGEKSMK+RR
Sbjct  353   SKQKKQKLFDILMSKQHFLPPSIVYVGSRIGADLLSNAITVTTGLKALSIHGEKSMKERR  412

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI++SFLVG+VP++VATGVLGRGVDLL V+QVIVFDMPNSIKEYVHQIGRASRMGE+GTS
Sbjct  413   EIMKSFLVGEVPLVVATGVLGRGVDLLGVRQVIVFDMPNSIKEYVHQIGRASRMGEDGTS  472

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             IVF+NEEN+ LFP+LVE+LKSSGA IP EL NS+Y   SF +G+ Q++RKYG+
Sbjct  473   IVFVNEENRNLFPDLVEVLKSSGAVIPRELVNSRYVKRSFPIGKGQRKRKYGS  525



>ref|XP_007215032.1| hypothetical protein PRUPE_ppa004297mg [Prunus persica]
 gb|EMJ16231.1| hypothetical protein PRUPE_ppa004297mg [Prunus persica]
Length=517

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/502 (71%), Positives = 427/502 (85%), Gaps = 0/502 (0%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+ +VK+RS +QRE LP EPKCVIC RYGEYICD+TDDDICSLECK  +L R+  ++ P 
Sbjct  15    SEDKVKERSRDQREPLPGEPKCVICNRYGEYICDQTDDDICSLECKQTVLCRVANTQLPV  74

Query  1857  PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSC  1678
               PPP R  ATD+C+YVRD   +S S   +SDQ ELLR +L I VKGDLV PPI+SF SC
Sbjct  75    NLPPPKRLTATDECFYVRDSGSQSGSVFFSSDQTELLRSRLEIHVKGDLVPPPILSFSSC  134

Query  1677  DVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKL  1498
             + P+KLL N+EAAG+EMPTPVQMQAIPAAL G+SLLVSAETGSGKT SFL+PIV      
Sbjct  135   NFPQKLLQNIEAAGFEMPTPVQMQAIPAALSGKSLLVSAETGSGKTASFLVPIVYLCANF  194

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHG  1318
                    ++KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQL+R++ G
Sbjct  195   RFEQFRDRKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQLHRIQQG  254

Query  1317  VSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMY  1138
             V LIVGTPGRLIDLLTK +I+LD V +F +DEVDCM QRGF +QVMQIFRALSQPQ+L+Y
Sbjct  255   VELIVGTPGRLIDLLTKNDIQLDDVKIFGLDEVDCMFQRGFRDQVMQIFRALSQPQVLLY  314

Query  1137  SATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHY  958
             SAT+S+++E M SSMAK + V+SVG+ N+PN  VKQL IWVESKQKKQKLFDIL SKQH+
Sbjct  315   SATVSQDIENMVSSMAKDVVVVSVGKPNRPNKVVKQLPIWVESKQKKQKLFDILMSKQHF  374

Query  957   KPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATG  778
              PPV+V+VGSRLGADLLS AIT++ G+KA+SIHGEKSMK+RR+I+RSF++G+VPVIVATG
Sbjct  375   MPPVVVYVGSRLGADLLSNAITVTIGVKALSIHGEKSMKERRDIMRSFIMGEVPVIVATG  434

Query  777   VLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEI  598
             +LGRGVDL+ V+QVI+FDMPNS+KEYVHQIGRASR+GEEGT+IVF++EENK LFP+LVEI
Sbjct  435   ILGRGVDLVGVRQVILFDMPNSMKEYVHQIGRASRLGEEGTAIVFVSEENKNLFPDLVEI  494

Query  597   LKSSGAAIPSELANSKYSVGSF  532
             L+SSGAAIP EL NS+Y   SF
Sbjct  495   LRSSGAAIPRELVNSRYMTNSF  516



>ref|XP_008231214.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Prunus mume]
Length=537

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/518 (69%), Positives = 434/518 (84%), Gaps = 2/518 (0%)
 Frame = -1

Query  2046  GSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSR  1867
             G+    +VK+RS +QRE LP EPKCVIC RYGEYICD+TDDDICSLECK  +L R+  ++
Sbjct  19    GNQVTDKVKERSRDQREPLPGEPKCVICNRYGEYICDQTDDDICSLECKRTVLCRVANTQ  78

Query  1866  KPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSF  1687
              P   PPP R  ATD+C+YVRD   +S S   +SDQ ELLR +L I VKGDLV PPI+SF
Sbjct  79    LPVNLPPPKRLTATDECFYVRDSGSQSGSVFFSSDQTELLRSRLEIHVKGDLVPPPILSF  138

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
              SC+ P+KLL N+EAAG+EMPTPVQMQAIPAAL G+SLLVSAETGSGKT SFL+P+V   
Sbjct  139   SSCNFPQKLLQNIEAAGFEMPTPVQMQAIPAALSGKSLLVSAETGSGKTASFLVPVVNLC  198

Query  1506  VKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRV  1327
                       ++KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQL+R+
Sbjct  199   ANFRFEQFRDRKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQLHRI  258

Query  1326  EHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQI  1147
             + GV LIVGTPGRLIDLL K +I+LD V +F +DEVDCM QRGF +QVMQIFRALSQPQ+
Sbjct  259   QQGVELIVGTPGRLIDLLKKNDIQLDDVKIFALDEVDCMFQRGFRDQVMQIFRALSQPQV  318

Query  1146  LMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSK  967
             L+YSAT+S+++E M SSMAK + V+SVG+ N+PN  VKQL IWVESKQKKQKLFDIL SK
Sbjct  319   LLYSATVSQDIENMVSSMAKDVAVVSVGKPNRPNKVVKQLPIWVESKQKKQKLFDILMSK  378

Query  966   QHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIV  787
             QH+ PPV+V+VGSRLGADLLS AIT++ G+KA+SIHGEKSMK+RR+I+RSFL+G+VPVIV
Sbjct  379   QHFMPPVVVYVGSRLGADLLSNAITVTVGVKALSIHGEKSMKERRDIMRSFLMGEVPVIV  438

Query  786   ATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPEL  607
             ATG+LGRGVDL+ V+QVI+FDMPNS+KEYVHQIGRASR+GEEGT+IVF++EENK LFP+L
Sbjct  439   ATGILGRGVDLVGVRQVILFDMPNSMKEYVHQIGRASRLGEEGTAIVFVSEENKNLFPDL  498

Query  606   VEILKSSGAAIPSELANSKYSVGS--FSVGRHQKRRKY  499
             VEIL+SSGAAIP EL NS++   +  FS G  QK+RK+
Sbjct  499   VEILRSSGAAIPRELVNSRHMTVTRPFSNGGGQKKRKH  536



>ref|XP_002512794.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF49297.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=514

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/519 (71%), Positives = 435/519 (84%), Gaps = 10/519 (2%)
 Frame = -1

Query  2049  SGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             +GSD  S+VKK S EQREAL  EPKCV+CGRYGEYICDETDDDICSLECK ILL  + KS
Sbjct  6     AGSDGASDVKKTSREQREALQGEPKCVLCGRYGEYICDETDDDICSLECKQILLGGVGKS  65

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                   PPP R  ATD+C+YVR++   S    L +DQ ELLRR L I VKG+LV  PI+S
Sbjct  66    DISVGIPPPRRLAATDECFYVRENGTSS----LTNDQTELLRRTLEIHVKGELVPDPILS  121

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC++P+KLL NLEAAGY++PTPVQMQAIP AL G+SLL SA+TGSGKT S+L+PI+++
Sbjct  122   FSSCNLPQKLLLNLEAAGYDLPTPVQMQAIPTALSGKSLLASADTGSGKTASYLVPIISS  181

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                  L  S  + KPLAM+L PTRELCIQ+E+QAK+ GKG+PFKTALVVGGDAMA QLYR
Sbjct  182   CASYRLQHSSDR-KPLAMVLTPTRELCIQVEDQAKLFGKGLPFKTALVVGGDAMAGQLYR  240

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLLTK +IELD++ +FVIDEVDCMLQRGF +QVMQIF ALSQPQ
Sbjct  241   IQQGVELIVGTPGRLIDLLTKHDIELDNMIIFVIDEVDCMLQRGFRDQVMQIFWALSQPQ  300

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             +L+YSAT+++EVEKMASSMAK + ++S+GQ N+P+ AVKQLAIWVE KQKKQKLFDIL S
Sbjct  301   VLLYSATVTQEVEKMASSMAKDMALVSIGQPNRPSKAVKQLAIWVEPKQKKQKLFDILMS  360

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AIT++TG K++SIHGEKSMK+RREI++SFLVG+V VI
Sbjct  361   KQHFMPPAVVYVGSRLGADLLSNAITVTTGWKSLSIHGEKSMKERREIMKSFLVGEVTVI  420

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATGVLGRGVDL  V+QVI+FDMPNSIKEY+HQIGRASRMGE G +IVF+NEENK LFPE
Sbjct  421   VATGVLGRGVDLFGVRQVIIFDMPNSIKEYIHQIGRASRMGEGGIAIVFVNEENKNLFPE  480

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
              +E+LKSS A IP ELANS+Y     SVG+ QK+RKYG+
Sbjct  481   FIEVLKSSAAVIPRELANSRY-----SVGKGQKKRKYGS  514



>ref|XP_002320399.1| hypothetical protein POPTR_0014s13620g [Populus trichocarpa]
 gb|EEE98714.1| hypothetical protein POPTR_0014s13620g [Populus trichocarpa]
Length=524

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/533 (69%), Positives = 435/533 (82%), Gaps = 9/533 (2%)
 Frame = -1

Query  2091  METSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             M T +V     ++ +G D    VKK S +QREALP EP CV+CGRYGEYICD+TD DICS
Sbjct  1     MSTPLVDGLTVSEAAGDD----VKKTSRDQREALPGEPICVVCGRYGEYICDQTDSDICS  56

Query  1911  LECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             LECK  LL R   +  P   P P R  ATD+C+YVRD    SES  L SDQ ELLRRKL 
Sbjct  57    LECKQTLLGRAADTHLPVGHPLPKRLAATDECFYVRD----SESP-LTSDQTELLRRKLE  111

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I VKGD V  PI+SF SC++P KLL N++  GY+MPTP+QMQ I AAL G+SLL SA+TG
Sbjct  112   IHVKGDSVPDPILSFSSCNLPEKLLHNIQTLGYDMPTPIQMQGIAAALTGKSLLASADTG  171

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTA  1372
             SGKT SFL+P+V+           + +KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTA
Sbjct  172   SGKTASFLVPVVSRCATFRHGNISKSKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTA  231

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             LV+GGDAM RQLYR++ GV LIVGTPGRLIDLL K +IELD + + V+DEVDCMLQ+GF 
Sbjct  232   LVIGGDAMPRQLYRIQQGVELIVGTPGRLIDLLAKHDIELDDIMILVLDEVDCMLQQGFR  291

Query  1191  EQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             +QVMQIFRALSQPQ+LMYSAT+S+EVEKMASSMAK L  +S+GQ N+P+ AVKQLAIWVE
Sbjct  292   DQVMQIFRALSQPQVLMYSATMSQEVEKMASSMAKDLIFVSIGQPNRPSKAVKQLAIWVE  351

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
             SKQKKQKLFDIL SKQH+ PP IV+VGSR+GADLLS AIT++TGLKA+SIHGEKSMK+RR
Sbjct  352   SKQKKQKLFDILMSKQHFLPPSIVYVGSRIGADLLSNAITVTTGLKALSIHGEKSMKERR  411

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             EI++SFLVG+VP++VATGVLGRGVDLL V+QVIVFDMPN IKEYVHQIGRASRMGE+GTS
Sbjct  412   EIMKSFLVGEVPLVVATGVLGRGVDLLGVRQVIVFDMPNCIKEYVHQIGRASRMGEDGTS  471

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             IVF+NEEN+ LFP+LVE+LKSSGA IP EL NS+Y   SF +G+ Q++RKYG+
Sbjct  472   IVFVNEENRNLFPDLVEVLKSSGAVIPRELVNSRYVKRSFPMGKGQRKRKYGS  524



>gb|KDO63488.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
 gb|KDO63489.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
 gb|KDO63490.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
 gb|KDO63491.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
 gb|KDO63492.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
Length=533

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/516 (70%), Positives = 437/516 (85%), Gaps = 3/516 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS S+VK+ S +QREALP+EPKCVICGRYGEYICDETDDD+CSLECK  LL R+  + + 
Sbjct  17    DSQSDVKEWSKDQREALPEEPKCVICGRYGEYICDETDDDVCSLECKQKLLCRVANANRG  76

Query  1860  TPCPPPV---RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 PP    R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+S
Sbjct  77    MRVVPPPPPERLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILS  136

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC + +KLL N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++ 
Sbjct  137   FSSCSLSQKLLQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQ  196

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                + L  S+ ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR
Sbjct  197   CANIRLHHSQNQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYR  256

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQ
Sbjct  257   IQQGVELIVGTPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQ  316

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             ILMYSATIS+EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL S
Sbjct  317   ILMYSATISQEVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMS  376

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVI
Sbjct  377   KQHFTPPAVVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVI  436

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATG+LGRGV+LL V+QVI+FDMPNSIKEYVHQIGRAS+MG+EGT+IVF+NEENK LF E
Sbjct  437   VATGILGRGVELLGVRQVIIFDMPNSIKEYVHQIGRASQMGDEGTAIVFVNEENKNLFQE  496

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             LV+ILKSSGA IP EL NS+Y+VGSFS G+  K+RK
Sbjct  497   LVDILKSSGAGIPRELINSRYTVGSFSSGKGFKKRK  532



>ref|XP_006446872.1| hypothetical protein CICLE_v10017882mg [Citrus clementina]
 gb|ESR60112.1| hypothetical protein CICLE_v10017882mg [Citrus clementina]
Length=533

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/516 (70%), Positives = 436/516 (84%), Gaps = 3/516 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS S+VK+ S +QREALP+EPKCVICGRYGEYICDETDDD+CSLECK  LL R+  + + 
Sbjct  17    DSQSDVKEWSKDQREALPEEPKCVICGRYGEYICDETDDDVCSLECKQKLLCRVANANRG  76

Query  1860  TPCPPPV---RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 PP    R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+S
Sbjct  77    MRVVPPPPPERLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILS  136

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC + +KLL N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++ 
Sbjct  137   FSSCSLSQKLLQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQ  196

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                + L  S+ ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR
Sbjct  197   CANIRLHHSQNQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYR  256

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRALS PQ
Sbjct  257   IQQGVELIVGTPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRALSLPQ  316

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             ILMYSATIS+EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL S
Sbjct  317   ILMYSATISQEVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMS  376

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RS LVG+VPVI
Sbjct  377   KQHFTPPAVVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSLLVGEVPVI  436

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATG+LGRGV+LL V+QVI+FDMPNSIKEYVHQIGRAS+MG+EGT+IVF+NEENK LF E
Sbjct  437   VATGILGRGVELLGVRQVIIFDMPNSIKEYVHQIGRASQMGDEGTAIVFVNEENKNLFQE  496

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             LV+ILKSSGA IP EL NS+Y+VGSFS G+  K+RK
Sbjct  497   LVDILKSSGAGIPRELINSRYTVGSFSSGKGFKKRK  532



>ref|XP_006468941.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Citrus sinensis]
Length=533

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/516 (70%), Positives = 436/516 (84%), Gaps = 3/516 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS S+VK+ S +QREALP+EPKCVICGRYGEYICDETDDD+CSLECK  LL R+  + + 
Sbjct  17    DSQSDVKEWSKDQREALPEEPKCVICGRYGEYICDETDDDVCSLECKQKLLCRVANANRG  76

Query  1860  TPCPPPV---RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 PP    R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+S
Sbjct  77    MRVVPPPPPERLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILS  136

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC + +KLL N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++ 
Sbjct  137   FSSCSLSQKLLQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQ  196

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                + L  S+ ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR
Sbjct  197   CANIRLHHSQNQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYR  256

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQ
Sbjct  257   IQQGVELIVGTPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQ  316

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             ILMYSATIS+EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL S
Sbjct  317   ILMYSATISQEVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMS  376

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVI
Sbjct  377   KQHFTPPAVVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVI  436

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATG+LGRGV+LL V+ VI+FDMPNSIKEYVHQIGRAS+MGEEGT+IVF+NEENK LF E
Sbjct  437   VATGILGRGVELLGVRLVIIFDMPNSIKEYVHQIGRASQMGEEGTAIVFVNEENKNLFQE  496

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             LV+ILKSSGA IP EL NS+Y+VGSFS G+  K+RK
Sbjct  497   LVDILKSSGAGIPRELINSRYTVGSFSSGKGFKKRK  532



>gb|KDP41892.1| hypothetical protein JCGZ_26910 [Jatropha curcas]
Length=544

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/530 (70%), Positives = 440/530 (83%), Gaps = 3/530 (1%)
 Frame = -1

Query  2073  AATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTI  1894
             A    +Q +GSD+  +VKK + EQREAL  EPKCVICGRYGEYICDETDDDICSLECK  
Sbjct  15    AVVSFDQFTGSDAADDVKKTAREQREALSGEPKCVICGRYGEYICDETDDDICSLECKQT  74

Query  1893  LLSRIEKSRKPT-PCPPPVRFPATDDCYYVRDD--DKKSESKCLASDQAELLRRKLNIVV  1723
             LL ++ K++    P  P VR  ATD+C+YVR+   D KS    L +DQ ELLRRKL I V
Sbjct  75    LLRKVVKTQVSVGPSAPAVRLAATDECFYVRESESDDKSGPLSLTNDQTELLRRKLEIYV  134

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             KG LV  PI+SF SC++P +LL NL AAGY+MPTPVQMQAIP AL G+SLL SA TGSGK
Sbjct  135   KGKLVPDPILSFSSCNLPLQLLQNLAAAGYDMPTPVQMQAIPTALGGKSLLASANTGSGK  194

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVV  1363
             T S+L+ IV+      L  S   +KPLAM+L PTRELCIQ+E+QAK+LGKG+PFKTALVV
Sbjct  195   TASYLVSIVSRCADFRLQHSSEYRKPLAMVLTPTRELCIQVEDQAKLLGKGLPFKTALVV  254

Query  1362  GGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQV  1183
             GGDAMA QLYR++ GV LIVGTPGRLIDLL K +I LD + +FV+DEVDCMLQRGF +QV
Sbjct  255   GGDAMAGQLYRIQQGVELIVGTPGRLIDLLIKHDIGLDELMIFVLDEVDCMLQRGFRDQV  314

Query  1182  MQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
             MQIFRALSQPQ+LMYSATI++E+EKM SS+AK + ++S+G+ NKP+ AVKQLAIWVESKQ
Sbjct  315   MQIFRALSQPQVLMYSATITQEIEKMGSSIAKDMVIVSIGEPNKPSKAVKQLAIWVESKQ  374

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KKQKLFDIL SKQH+ PP +V+VGSRLGADLLS AIT++TGLKA+S+HGEK MK+RREI+
Sbjct  375   KKQKLFDILMSKQHFMPPAVVYVGSRLGADLLSNAITVTTGLKALSLHGEKPMKERREIM  434

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             RSFLVG+V VIVATG+LGRGVDLL V+QVIVFDMPNSIKEYVHQIGRASRMGEEGT+IVF
Sbjct  435   RSFLVGEVSVIVATGILGRGVDLLGVRQVIVFDMPNSIKEYVHQIGRASRMGEEGTAIVF  494

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             +NEENK LF E +E+L+SSGA IP ELANS+Y+V S+ VG+ +++RKYG+
Sbjct  495   VNEENKNLFTEFIEVLRSSGAVIPRELANSRYTVRSYPVGKGRRKRKYGS  544



>ref|XP_004303760.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=526

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/517 (70%), Positives = 434/517 (84%), Gaps = 4/517 (1%)
 Frame = -1

Query  2049  SGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             S  D + EVK+RS +QRE LP EPKCVICGRYGEYICD+TDDDICSLECK  LLSR+  S
Sbjct  13    STDDVNDEVKERSRDQREPLPGEPKCVICGRYGEYICDQTDDDICSLECKQTLLSRVTNS  72

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +      PP R PA D+C+YVRD   +  +  L   Q ELLR++L+I VKGD+   PI+S
Sbjct  73    QLAVSQCPPKRLPANDECFYVRDAGGQYGTSVLPDGQTELLRKRLDIHVKGDIAPGPILS  132

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC++P+KL+ N+EAAGYEMPTPVQMQAIPAAL G++LLVSA+TGSGKT SFLIPIV+ 
Sbjct  133   FASCNLPQKLVQNIEAAGYEMPTPVQMQAIPAALSGKNLLVSADTGSGKTASFLIPIVSC  192

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                        ++KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAM RQL+R
Sbjct  193   CSHFRFEHLTGEKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMPRQLFR  252

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL   +IEL+ V +FV+DEVDCMLQRGF +QVMQIFRALSQPQ
Sbjct  253   IQQGVELIVGTPGRLIDLLANHDIELEDVRIFVLDEVDCMLQRGFRDQVMQIFRALSQPQ  312

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             +L+YSAT S+++EKM SSM+K +TVISVG+ N+PN AVKQ+ IWVESKQKKQKLFDIL S
Sbjct  313   VLLYSATTSQDIEKMVSSMSKDVTVISVGKPNRPNKAVKQVPIWVESKQKKQKLFDILMS  372

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+V SRLGADLLS AI ++TG+KA+SIHGEKSMK+RR++++SFLVGDVPVI
Sbjct  373   KQHFMPPAVVYVASRLGADLLSNAIRVTTGVKALSIHGEKSMKERRDVMKSFLVGDVPVI  432

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATGVLGRG+DLLSV+QVIVFDMPNSI EYVHQIGRASR+GEEGT+IVF+ +ENKKLFPE
Sbjct  433   VATGVLGRGLDLLSVRQVIVFDMPNSINEYVHQIGRASRLGEEGTAIVFVCQENKKLFPE  492

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             LVE+L+SSGAAIP EL  S+    S+++GR QK+RK+
Sbjct  493   LVEMLRSSGAAIPRELVRSQ----SYTIGRGQKKRKH  525



>ref|XP_008341198.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Malus domestica]
Length=532

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/512 (71%), Positives = 436/512 (85%), Gaps = 0/512 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D +VK+RS +QREALP EPKCVIC RYGEYIC +TDDDICSLECK  LL ++     P  
Sbjct  20    DDKVKERSRDQREALPGEPKCVICNRYGEYICHQTDDDICSLECKQTLLCKVVVPHLPLN  79

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
              PPP   PATD+C+YVRD   +S S+ L++D  +LLR +L I VKGDLV  PI+SF SC+
Sbjct  80    LPPPKTLPATDECFYVRDSGAQSRSQFLSADHTDLLRTRLGIHVKGDLVPTPILSFSSCN  139

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
              P+KLL N+EAAG+E+PTPVQMQAIPAAL G+SLLVSAETGSGKT SFL+PIV+    L 
Sbjct  140   CPQKLLQNIEAAGFELPTPVQMQAIPAALSGKSLLVSAETGSGKTASFLVPIVSLCANLR  199

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
                S  +++PLAM+L PTRELCIQ+EEQAK+LG+G+PFKTALVVGGDAMARQL+R++ GV
Sbjct  200   FQQSTDQKRPLAMVLTPTRELCIQVEEQAKLLGRGLPFKTALVVGGDAMARQLHRLQQGV  259

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LIVGTPGRLIDLLTK +IELD V +F +DEVDCMLQRGF +QVMQIFRALSQPQ+L+YS
Sbjct  260   ELIVGTPGRLIDLLTKNDIELDDVRIFALDEVDCMLQRGFRDQVMQIFRALSQPQVLLYS  319

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             AT+S ++EKMAS MAK + V+ VG  N+PN AVKQL IWVESKQKKQKLFDIL SKQH+ 
Sbjct  320   ATVSPDIEKMASCMAKDVAVVFVGNPNRPNKAVKQLPIWVESKQKKQKLFDILMSKQHFM  379

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PPV+V+VGSRLGADLLS AIT++TG+KA+SIHGEKSMK+RR+I+ SFL+G+VPVIVATG+
Sbjct  380   PPVVVYVGSRLGADLLSSAITVTTGVKALSIHGEKSMKERRDIMSSFLMGEVPVIVATGI  439

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRGVDLLSV+QVIVFDMPNS+KEYVHQIGRASR+GEEGT+IVF++EENK LFPELVE+L
Sbjct  440   LGRGVDLLSVRQVIVFDMPNSVKEYVHQIGRASRLGEEGTAIVFVSEENKNLFPELVEVL  499

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             +SSGAAIP EL NS+Y    +S+G  Q++RK+
Sbjct  500   RSSGAAIPRELVNSRYMARPYSIGGGQRKRKH  531



>ref|XP_004303761.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=517

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/514 (70%), Positives = 432/514 (84%), Gaps = 4/514 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             D   EVK+RS +QRE LP EPKCVICGRYGEYICD+TDDDICSLECK  LLSR+  S+  
Sbjct  7     DGQYEVKERSRDQREPLPGEPKCVICGRYGEYICDQTDDDICSLECKQTLLSRVTNSQLA  66

Query  1860  TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGS  1681
                 PP R PA D+C+YVRD   +  +  L   Q ELLR++L+I VKGD+   PI+SF S
Sbjct  67    VSQCPPKRLPANDECFYVRDAGGQYGTSVLPDGQTELLRKRLDIHVKGDIAPGPILSFAS  126

Query  1680  CDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVK  1501
             C++P+KL+ N+EAAGYEMPTPVQMQAIPAAL G++LLVSA+TGSGKT SFLIPIV+    
Sbjct  127   CNLPQKLVQNIEAAGYEMPTPVQMQAIPAALSGKNLLVSADTGSGKTASFLIPIVSCCSH  186

Query  1500  LNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEH  1321
                     ++KPLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAM RQL+R++ 
Sbjct  187   FRFEHLTGEKKPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMPRQLFRIQQ  246

Query  1320  GVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILM  1141
             GV LIVGTPGRLIDLL   +IEL+ V +FV+DEVDCMLQRGF +QVMQIFRALSQPQ+L+
Sbjct  247   GVELIVGTPGRLIDLLANHDIELEDVRIFVLDEVDCMLQRGFRDQVMQIFRALSQPQVLL  306

Query  1140  YSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQH  961
             YSAT S+++EKM SSM+K +TVISVG+ N+PN AVKQ+ IWVESKQKKQKLFDIL SKQH
Sbjct  307   YSATTSQDIEKMVSSMSKDVTVISVGKPNRPNKAVKQVPIWVESKQKKQKLFDILMSKQH  366

Query  960   YKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVAT  781
             + PP +V+V SRLGADLLS AI ++TG+KA+SIHGEKSMK+RR++++SFLVGDVPVIVAT
Sbjct  367   FMPPAVVYVASRLGADLLSNAIRVTTGVKALSIHGEKSMKERRDVMKSFLVGDVPVIVAT  426

Query  780   GVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVE  601
             GVLGRG+DLLSV+QVIVFDMPNSI EYVHQIGRASR+GEEGT+IVF+ +ENKKLFPELVE
Sbjct  427   GVLGRGLDLLSVRQVIVFDMPNSINEYVHQIGRASRLGEEGTAIVFVCQENKKLFPELVE  486

Query  600   ILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             +L+SSGAAIP EL  S+    S+++GR QK+RK+
Sbjct  487   MLRSSGAAIPRELVRSQ----SYTIGRGQKKRKH  516



>gb|KHN00644.1| DEAD-box ATP-dependent RNA helicase 41 [Glycine soja]
Length=528

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/524 (69%), Positives = 439/524 (84%), Gaps = 11/524 (2%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             AT+++ P+  D++ EVK RS +QR ALP EPKC+ICGRYGEYICDETDDD+CSLECK  L
Sbjct  14    ATDTDAPN--DAEDEVKLRSRDQRLALPGEPKCIICGRYGEYICDETDDDVCSLECKQAL  71

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             L RI KS  P    PP R PA D+C+YV+D D +S +  +ASD    LR+KL+I VKGD+
Sbjct  72    LCRIAKSSSP----PPKRIPAADECFYVKDADYESGTASMASD----LRKKLDIHVKGDV  123

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V+P ++SF +C++P KLL N+EAAGYEMPTPVQMQAIPAAL G+S+L+ A+TGSGK+ SF
Sbjct  124   VAP-VLSFSACNLPDKLLHNIEAAGYEMPTPVQMQAIPAALTGKSMLLLADTGSGKSASF  182

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             LIPIV+            K+ PLA++L PTRELC+Q+EE AK+LGKGMPFKTALVVGGDA
Sbjct  183   LIPIVSRCAIHRRQYVSDKKNPLALVLTPTRELCMQVEEHAKLLGKGMPFKTALVVGGDA  242

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             MA QL+R++ GV LIVGTPGRL+DLLTK EI+LD V  FV+DEVDCMLQRGF +QVMQI+
Sbjct  243   MAGQLHRIQQGVELIVGTPGRLVDLLTKHEIDLDDVMTFVVDEVDCMLQRGFRDQVMQIY  302

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             RALSQPQ+LMYSAT+S ++EKM +++AK   VISVG+ N PN AVKQLAIWVESK+KKQK
Sbjct  303   RALSQPQVLMYSATMSNDLEKMINTLAKGTVVISVGEPNTPNKAVKQLAIWVESKEKKQK  362

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             LF+IL SK+H+KPPV+V+VGSRLGADLL+ AIT++TG+KAVSIHGEKSMK+RRE ++S L
Sbjct  363   LFEILASKKHFKPPVVVYVGSRLGADLLANAITVATGIKAVSIHGEKSMKERRETMQSLL  422

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
             VG+VPV+VATGVLGRGVDLL V+QVIVFDMPN+IKEYVHQIGRASRMGEEG  IVF+NEE
Sbjct  423   VGEVPVVVATGVLGRGVDLLGVRQVIVFDMPNNIKEYVHQIGRASRMGEEGQGIVFVNEE  482

Query  630   NKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             NK +F EL+E+LKS GAA+P ELANS+Y+ G FS G+  K+RK+
Sbjct  483   NKNIFSELIEVLKSGGAAVPRELANSRYATGVFSGGKGSKKRKH  526



>ref|XP_003519940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Glycine max]
Length=528

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/524 (69%), Positives = 438/524 (84%), Gaps = 11/524 (2%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             AT+++ P+  D++ EVK RS +QR ALP EPKC+ICGRYGEYICDETDDD+CSLECK  L
Sbjct  14    ATDTDAPN--DAEDEVKLRSRDQRLALPGEPKCIICGRYGEYICDETDDDVCSLECKQAL  71

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             L RI KS  P    PP R PA D+C+YV+D D +S +  +ASD    LR+KL+I VKGD+
Sbjct  72    LCRIAKSSSP----PPKRIPAADECFYVKDADYESGTASMASD----LRKKLDIHVKGDV  123

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V+P ++SF +C++P KLL N+EAAGYEMPTPVQMQAIPAAL G+S+L+ A+TGSGK+ SF
Sbjct  124   VAP-VLSFSACNLPDKLLHNIEAAGYEMPTPVQMQAIPAALTGKSMLLLADTGSGKSASF  182

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             LIPIV+            K+ PLA++L PTRELC+Q+EE AK+LGKGMPFKTALVVGGDA
Sbjct  183   LIPIVSRCAIHRRQYVSDKKNPLALVLTPTRELCMQVEEHAKLLGKGMPFKTALVVGGDA  242

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             MA QL+R++ GV LIVGTPGRL+DLLTK EI+LD V  FV+DEVDCMLQRGF +QVMQI+
Sbjct  243   MAGQLHRIQQGVELIVGTPGRLVDLLTKHEIDLDDVMTFVVDEVDCMLQRGFRDQVMQIY  302

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             RALSQPQ+LMYSAT+S ++EKM +++ K   VISVG+ N PN AVKQLAIWVESK+KKQK
Sbjct  303   RALSQPQVLMYSATMSNDLEKMINTLVKGTVVISVGEPNTPNKAVKQLAIWVESKEKKQK  362

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             LF+IL SK+H+KPPV+V+VGSRLGADLL+ AIT+STG+KAVSIHGEKSMK+RRE ++S L
Sbjct  363   LFEILESKKHFKPPVVVYVGSRLGADLLANAITVSTGIKAVSIHGEKSMKERRETMQSLL  422

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
             VG+VPV+VATGVLGRGVDLL V+QVIVFDMPN+IKEYVHQIGRASRMGEEG  IVF+NEE
Sbjct  423   VGEVPVVVATGVLGRGVDLLGVRQVIVFDMPNNIKEYVHQIGRASRMGEEGQGIVFVNEE  482

Query  630   NKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             NK +F EL+E+LKS GAA+P ELANS+Y+ G FS G+  K+RK+
Sbjct  483   NKNIFAELIEVLKSGGAAVPRELANSRYATGVFSGGKGSKKRKH  526



>ref|XP_009378069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Pyrus x bretschneideri]
Length=532

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/512 (70%), Positives = 433/512 (85%), Gaps = 0/512 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D +VK+RS +QREALP EPKCVIC RYGEYIC +TDDDICSLECK  LL ++     P  
Sbjct  20    DDKVKERSRDQREALPGEPKCVICNRYGEYICHQTDDDICSLECKQTLLCKVVVPHLPLN  79

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
              PP    PATD+C+YVRD   +S S+ L++D  +LLR +L I V GDLV  PI+SF SC+
Sbjct  80    LPPLKTLPATDECFYVRDSGAQSRSQFLSADHTDLLRTRLGIHVTGDLVPTPILSFSSCN  139

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
              P+KLL N+EAAG+E+PTPVQMQAIPAAL G+SLLVSAETGSGKT SFL+PIV+      
Sbjct  140   CPQKLLQNIEAAGFELPTPVQMQAIPAALSGKSLLVSAETGSGKTASFLVPIVSLCANFR  199

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
                S  +++PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQL+R++ GV
Sbjct  200   FQQSADQKRPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQLHRLQQGV  259

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LIVGTPGRLIDLLTK +IELD V +F +DEVDCMLQRGF +QVMQIFRALS+PQ+L+YS
Sbjct  260   ELIVGTPGRLIDLLTKNDIELDDVRIFALDEVDCMLQRGFRDQVMQIFRALSRPQVLLYS  319

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             AT+S ++EKMAS MAK + V+ VG  N+PN AVKQL IWVESKQKKQKLFDIL SKQH+ 
Sbjct  320   ATVSPDIEKMASCMAKDVAVVFVGNPNRPNKAVKQLPIWVESKQKKQKLFDILMSKQHFM  379

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PPV+V+VGSRLGADLLS AIT++TG+KA+SIHGEKSMK+RR+I+ SFL+G+VPVIVATG+
Sbjct  380   PPVVVYVGSRLGADLLSSAITVTTGVKALSIHGEKSMKERRDIMSSFLMGEVPVIVATGI  439

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRGVDLLSV+QVIVFDMPNS+KEYVHQIGRASR+GEEGT+IVF++EENK LFPELVE+L
Sbjct  440   LGRGVDLLSVRQVIVFDMPNSVKEYVHQIGRASRLGEEGTAIVFVSEENKNLFPELVEVL  499

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             +SSGAAIP EL NS+Y    +S+G  Q++RK+
Sbjct  500   RSSGAAIPRELVNSRYMACPYSIGGGQRKRKH  531



>gb|KEH25620.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=538

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/533 (68%), Positives = 441/533 (83%), Gaps = 6/533 (1%)
 Frame = -1

Query  2088  ETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             + S + +  +N P+  D+ ++VK  S +QR+ALP EP+C++CGRYGEYICDETDDD+CSL
Sbjct  8     DPSKIQSLSTNSPN--DAGNDVKVSSKDQRDALPGEPQCIVCGRYGEYICDETDDDVCSL  65

Query  1908  ECKTILLSRIEKSRKPTPC-PPPVRFPATDDCYYVRDDDKKSESKCLASD--QAELLRRK  1738
             ECK  +LSRI KS     C PPP + PA D+C YVRD D  S +  L  D  QAELLR+K
Sbjct  66    ECKQSVLSRISKSSSSVGCLPPPKKLPAADECIYVRDTDNISGTPSLGGDHVQAELLRKK  125

Query  1737  LNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAE  1558
             L+I VKG +VS P+MSF SC++P KLL N+EAAGYEMPTPVQMQAIPAAL+G+++LV A+
Sbjct  126   LDIHVKG-VVSAPVMSFASCNLPDKLLQNIEAAGYEMPTPVQMQAIPAALVGKNMLVLAD  184

Query  1557  TGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFK  1378
             TGSGK+ SFLIPI++      L      +KPLAM+L PTREL IQ+EE AK+LGKG+PFK
Sbjct  185   TGSGKSASFLIPIISRCASHRLMYVSDNKKPLAMVLTPTRELSIQVEEHAKLLGKGLPFK  244

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             TALVVGGDAMARQLYR++ GV LIVGTPGRL+DLLTK EI+LD V+ FV+DEVDCMLQRG
Sbjct  245   TALVVGGDAMARQLYRIQQGVELIVGTPGRLVDLLTKNEIDLDDVTTFVVDEVDCMLQRG  304

Query  1197  FHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
             F +QV+QIF ALSQPQ+LMYSAT S  +EKMA+SMAK   VI+VG+ N+PN AVKQLAIW
Sbjct  305   FRDQVLQIFTALSQPQVLMYSATTSDSLEKMANSMAKDTVVITVGEPNRPNKAVKQLAIW  364

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VESKQKKQKLFDIL S++H+KPPV+++VGSRLGADLL+ AIT+STG+KAVSIHGEKSM +
Sbjct  365   VESKQKKQKLFDILKSQKHFKPPVVIYVGSRLGADLLANAITVSTGVKAVSIHGEKSMTE  424

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             RREI++SF+VG+ PV+VATGVLGRGVDLL V+QVIVFDMPNSI EYVHQIGRASRMGEEG
Sbjct  425   RREIMQSFMVGEFPVVVATGVLGRGVDLLGVRQVIVFDMPNSINEYVHQIGRASRMGEEG  484

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
              +IVF+N+ENK +FPELV++LKS  AAIP EL NS+Y+   FS G+  K+RK+
Sbjct  485   QAIVFVNDENKNVFPELVDVLKSGAAAIPRELINSQYTTRVFSGGKGSKKRKH  537



>ref|XP_003548927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Glycine max]
Length=528

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/523 (68%), Positives = 436/523 (83%), Gaps = 11/523 (2%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             T++  P+  D + +VK RS +QR ALP EPKC+ICGRYGEYICDETDDD+CSLECK  LL
Sbjct  15    TDAEAPN--DVEDDVKLRSRDQRLALPGEPKCIICGRYGEYICDETDDDVCSLECKQALL  72

Query  1887  SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLV  1708
              RI KS  P    PP   PA D+C+YVRD D KS +  + SD    LR+KL+I VKGD+V
Sbjct  73    CRIAKSLSP----PPKTIPAADECFYVRDSDFKSGTVSMGSD----LRKKLDIRVKGDVV  124

Query  1707  SPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFL  1528
             +P ++SF +C++P KLL N+EAAGYEMPTPVQMQAIPAAL G+S+LV A+TGSGK+ SFL
Sbjct  125   AP-VLSFSACNLPDKLLHNIEAAGYEMPTPVQMQAIPAALTGKSMLVLADTGSGKSASFL  183

Query  1527  IPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAM  1348
             IPIV+  V         K+KPLAM+L PTRELCIQ+EE AK+LGKG+PFKTALVVGGDAM
Sbjct  184   IPIVSRCVIHRRQYFSGKKKPLAMVLTPTRELCIQVEEHAKLLGKGLPFKTALVVGGDAM  243

Query  1347  ARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFR  1168
             A QL+R++ GV LIVGTPGRL+DLL K EI+LD V  FV+DEVDCMLQRGF +QVMQI+R
Sbjct  244   AGQLHRIQQGVELIVGTPGRLVDLLMKHEIDLDDVMTFVVDEVDCMLQRGFRDQVMQIYR  303

Query  1167  ALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKL  988
             ALSQPQ+LMYSAT+S ++EKM +++AK + V+S+G+ N PN AVKQLAIWVESKQKKQKL
Sbjct  304   ALSQPQVLMYSATMSNDLEKMINTLAKGMVVMSIGEPNTPNKAVKQLAIWVESKQKKQKL  363

Query  987   FDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLV  808
             F+IL SK+H+KPPV+V+VGSRLGADLL+ AIT++TG+KAVSIHGEKSMK+RRE ++SFLV
Sbjct  364   FEILASKKHFKPPVVVYVGSRLGADLLANAITVATGIKAVSIHGEKSMKERRETMQSFLV  423

Query  807   GDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEEN  628
             G+VPV+VATGVLGRGVDLL V+QVIVFDMPN+IKEYVHQIGRASRMGEEG  IVF+NEEN
Sbjct  424   GEVPVVVATGVLGRGVDLLGVRQVIVFDMPNNIKEYVHQIGRASRMGEEGQGIVFVNEEN  483

Query  627   KKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             K +F EL+++LKS GAA+P ELANS+Y+   FS G+  K+RK+
Sbjct  484   KNVFAELIDVLKSGGAAVPRELANSRYATRVFSGGKGSKKRKH  526



>ref|XP_004489746.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Cicer 
arietinum]
Length=530

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/536 (67%), Positives = 438/536 (82%), Gaps = 15/536 (3%)
 Frame = -1

Query  2088  ETSIVAATESNQPSGSDSDS--EVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDIC  1915
             +++ +    SN PS + +D+  +VK  S +QREALP EPKC++CGRYGEYICDETDDD+C
Sbjct  3     DSNFINDDPSNIPSDATNDAGNDVKLSSKDQREALPGEPKCIVCGRYGEYICDETDDDVC  62

Query  1914  SLECKTILLSRIEKSRKPTPC----PPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             SLECK  +L RI KS   + C    P P + PA D+C+YVRD D       L  DQAELL
Sbjct  63    SLECKQSVLCRISKS---SSCIGGLPAPKKLPAADECFYVRDSDYS-----LVDDQAELL  114

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             R+KL+I VKG +V  P++SF SC +P KLL N+EAAGYEMPTPVQMQAIPAALMG+++LV
Sbjct  115   RKKLDIHVKG-VVMAPVLSFTSCSLPEKLLHNIEAAGYEMPTPVQMQAIPAALMGKNMLV  173

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
              A+TGSGK+ SFLIPIV+            K+KPLAM+L PTRELCIQ+EE AK+LGKG+
Sbjct  174   LADTGSGKSASFLIPIVSRCATHRFTYVSDKKKPLAMVLTPTRELCIQVEEHAKLLGKGL  233

Query  1386  PFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
             PFKTALVVGGDAMARQLYR++ GV LIVGTPGRL+DLL K EI+LD ++ FV+DEVDCML
Sbjct  234   PFKTALVVGGDAMARQLYRIQQGVELIVGTPGRLVDLLMKHEIDLDDITTFVVDEVDCML  293

Query  1206  QRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
             QRGF EQV+QIF ALSQPQ+LMYSAT+S  +EKMA+S+AK + VI+VG+ NKPN AVKQL
Sbjct  294   QRGFREQVLQIFTALSQPQVLMYSATMSDGLEKMANSLAKDMAVITVGEPNKPNKAVKQL  353

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
             AIWVESKQKKQKLFDILTS++H+KPPV+++VGSRLGADLL+ AIT+ TG+ AVSIHGEKS
Sbjct  354   AIWVESKQKKQKLFDILTSQKHFKPPVVIYVGSRLGADLLANAITVVTGVNAVSIHGEKS  413

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
             M +RREI++SF+VG+ PV+VATGVLGRGVDLL V+QVIVFDMPNSIKEYVHQIGRASRMG
Sbjct  414   MTERREIMQSFMVGEFPVVVATGVLGRGVDLLGVRQVIVFDMPNSIKEYVHQIGRASRMG  473

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             EEG +IVF+N+ENK +F ELV++L+S  AA+P EL NS+++   FS G   K+RK+
Sbjct  474   EEGQAIVFVNDENKNVFAELVDVLRSGQAAVPRELINSQHTTRFFSGGNGSKKRKH  529



>ref|XP_010685097.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010685098.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Beta 
vulgaris subsp. vulgaris]
Length=535

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/521 (67%), Positives = 432/521 (83%), Gaps = 3/521 (1%)
 Frame = -1

Query  2049  SGSDSDS--EVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE  1876
             +G+D D+  EVK R W+QREA P EP C ICGRYGEYICDETDDDICSL+CK ILL RI 
Sbjct  16    AGTDEDNADEVKVRCWDQREAEPGEPCCAICGRYGEYICDETDDDICSLQCKKILLERIA  75

Query  1875  KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPI  1696
             KS+ P+  P   R P +D+C+YVRD ++ S S+ L+ ++  LLR +L+I V+   V PP+
Sbjct  76    KSKFPSSLPVQKRLPTSDECFYVRDTERGSSSRLLSDEETALLRERLHISVRCGSVLPPV  135

Query  1695  MSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIV  1516
             +SF SCD+P KLL N+E+  +E+PTPVQMQAIPAAL G SLLVSAETGSGKT S+LIPI+
Sbjct  136   LSFSSCDLPVKLLQNIESMEFELPTPVQMQAIPAALNGNSLLVSAETGSGKTASYLIPII  195

Query  1515  ANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQL  1336
                   +      K+KPLAM+L PTRELC+Q+EE+AK+LGKG+PFKTALV+GGDAMA Q+
Sbjct  196   TRCANFSRG-QLNKRKPLAMVLTPTRELCVQVEEEAKLLGKGLPFKTALVIGGDAMAGQV  254

Query  1335  YRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQ  1156
             YR++ GV LIVGTPGRLIDLLTK +IELDS+SMFV+DEVDCMLQRGF +QVMQ+FRALS 
Sbjct  255   YRIQQGVELIVGTPGRLIDLLTKHDIELDSISMFVVDEVDCMLQRGFRDQVMQLFRALSC  314

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
             PQ+LM+SAT+S EVEKM+ SMAK L V+ VG+ NK N AVKQ+AIWVESK KKQKLFDIL
Sbjct  315   PQVLMFSATLSAEVEKMSHSMAKALAVVFVGKPNKANLAVKQIAIWVESKHKKQKLFDIL  374

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
              SKQHY+PPV+VFV SRLGADLL+ AI I+T +KA+SIHGEKSM +RREI+R FL+G+V 
Sbjct  375   MSKQHYRPPVVVFVASRLGADLLAEAINITTRVKALSIHGEKSMSERREIIRCFLMGEVS  434

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+VATG+LGRGVDL+SV+QVIVFDMPNS+KEY+H IGRASR GEEG +IVFINEENKK+F
Sbjct  435   VLVATGLLGRGVDLVSVRQVIVFDMPNSMKEYIHLIGRASRRGEEGNAIVFINEENKKVF  494

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             PELV++LKSS AA+P ELANS+++    S+ + +K+RK+G 
Sbjct  495   PELVDVLKSSRAAVPKELANSRFTTYLVSMSKSRKKRKHGA  535



>ref|XP_010688944.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
41-like [Beta vulgaris subsp. vulgaris]
Length=557

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/515 (69%), Positives = 429/515 (83%), Gaps = 7/515 (1%)
 Frame = -1

Query  2028  EVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCP  1849
             EVK R W+QREA P EP C ICGRYGEYICDETDDDICSL+CK ILL RI KS+ P+  P
Sbjct  47    EVKVRCWDQREAEPGEPCCAICGRYGEYICDETDDDICSLQCKKILLERIAKSKFPSSLP  106

Query  1848  PPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVP  1669
                R P +D+C+YVRD ++ S S+ L+ ++  LLR +L+I V+   V PP+ SF SCD+P
Sbjct  107   VQKRLPTSDECFYVRDTERGSSSRLLSDEETALLRERLHISVRYGSVLPPVFSFSSCDLP  166

Query  1668  RKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIV---ANTVKL  1498
              KLL N+E+ G+E+PTPVQMQAIPAAL G SLLVSAETGSGKT S+LIPI+   AN  + 
Sbjct  167   VKLLQNIESMGFELPTPVQMQAIPAALNGNSLLVSAETGSGKTASYLIPIITRCANFSRD  226

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHG  1318
              L     K+KPLAM+L PT ELC+Q+EE+AK+LGKG+PFKTALV+GGDAMA Q+YR++ G
Sbjct  227   QL----NKRKPLAMVLTPTXELCVQVEEEAKLLGKGLPFKTALVIGGDAMAGQVYRIQQG  282

Query  1317  VSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMY  1138
             V LIVGTPGRLIDLLTK +IELDS+SMFV+DEVDCMLQRGF +QVMQ+FRALS PQ+LM+
Sbjct  283   VELIVGTPGRLIDLLTKHDIELDSISMFVVDEVDCMLQRGFRDQVMQLFRALSCPQVLMF  342

Query  1137  SATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHY  958
             SAT+S EVEKM+ SMAK L V+ VG+ NK N AVKQ+A+WVESK KKQKLFDIL SKQHY
Sbjct  343   SATLSAEVEKMSHSMAKALAVVFVGKPNKANLAVKQIAVWVESKHKKQKLFDILMSKQHY  402

Query  957   KPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATG  778
             +PPV+VFV SRLGADLL+ AI I+T +KA+SIHGEKSM +RREI+R FL+G+V V+VATG
Sbjct  403   RPPVVVFVASRLGADLLAEAINITTRVKALSIHGEKSMSERREIIRCFLMGEVSVLVATG  462

Query  777   VLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEI  598
             +LGRGVDL+SV+QVIVFDMPNS+KEYVH IGRASR GEEG +IVFINEE+KK+FPELV++
Sbjct  463   LLGRGVDLVSVRQVIVFDMPNSMKEYVHLIGRASRRGEEGNAIVFINEESKKVFPELVDV  522

Query  597   LKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             LKSSGAA+P ELANS+Y+    S+ + QK+RK+G 
Sbjct  523   LKSSGAAVPKELANSRYTTYLVSMSKSQKKRKHGA  557



>ref|XP_007032088.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY03014.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=538

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/501 (70%), Positives = 422/501 (84%), Gaps = 1/501 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D+ VKK S EQR+AL +EPKCVICGRYGEY+CDETDDDICSLECK  LLS I  S  P  
Sbjct  24    DNYVKKSSTEQRDALAEEPKCVICGRYGEYVCDETDDDICSLECKQTLLSGIANSLLPVG  83

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
                  R PATD+C+YVRD   KS  + L  DQAELLR+KL I VKGD++  PI++F SC 
Sbjct  84    PSSTQRLPATDECFYVRDSVDKSGFQFLTGDQAELLRKKLEIHVKGDVIPAPIVAFSSCA  143

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P+KLL N+E AGY MPTPVQMQ IPAAL G+SLLVSA+TGSGKT SFLIPI+++     
Sbjct  144   LPQKLLQNIETAGYGMPTPVQMQVIPAALDGKSLLVSADTGSGKTASFLIPIISHCANFR  203

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
              +     +KP+A++L PTRELCIQ+E+ AK+LGKG+PFKTALVVGGD MARQLYR++ GV
Sbjct  204   RSNFSNHKKPIAVVLTPTRELCIQVEDNAKLLGKGLPFKTALVVGGDPMARQLYRIQQGV  263

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LI+GTPGRLIDLLTK ++EL+ V +F +DEVDC+LQRGF +QVMQIFRALSQPQ+LMYS
Sbjct  264   ELIIGTPGRLIDLLTKHDVELNDVKIFGLDEVDCILQRGFRDQVMQIFRALSQPQVLMYS  323

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             ATIS+++EK+AS MAK +TV+S+G+ N+PN AVKQL IWVES +KKQKLFDIL SK H+ 
Sbjct  324   ATISQDIEKIASFMAKDVTVVSIGKPNRPNKAVKQLPIWVESNKKKQKLFDILRSK-HFT  382

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP++V+VGSR+GADLLS AIT+STG+KA+S+HGEKSM +RREILR FLVG+V VIV+TGV
Sbjct  383   PPIVVYVGSRVGADLLSNAITVSTGIKALSLHGEKSMNERREILRLFLVGEVSVIVSTGV  442

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+D L V+QVIVFDMP+SIKEYVHQIGRASR+GEEGT+IVF+NEENK LFPELV+IL
Sbjct  443   LGRGIDFLGVRQVIVFDMPSSIKEYVHQIGRASRLGEEGTAIVFVNEENKNLFPELVDIL  502

Query  594   KSSGAAIPSELANSKYSVGSF  532
             KSSGA IP EL+NS+Y+V SF
Sbjct  503   KSSGAVIPQELSNSRYTVVSF  523



>ref|XP_010037052.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Eucalyptus grandis]
 ref|XP_010037053.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Eucalyptus grandis]
 ref|XP_010037054.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW48686.1| hypothetical protein EUGRSUZ_K02338 [Eucalyptus grandis]
Length=535

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/535 (65%), Positives = 437/535 (82%), Gaps = 6/535 (1%)
 Frame = -1

Query  2106  GSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETD  1927
             G+ K  E S V AT +++PS +     VK+RS +QR A P +PKCV+CGRYGEYICDET+
Sbjct  4     GASKDCEQSSVDATNTDEPSDA-----VKERSRDQRLAFPGDPKCVMCGRYGEYICDETE  58

Query  1926  DDICSLECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             DDICSLECK  LLSRI  S +        + P  D+CYYV+D + K+ S+ L SDQ+E+L
Sbjct  59    DDICSLECKRTLLSRISNSSRGGHTSLK-KLPTVDECYYVKDGNDKTGSQSLPSDQSEVL  117

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             R++L I VKG+ V  PI+SF SC +P+KLL+N+E++GYEMPTPVQMQAIPAAL G+SLLV
Sbjct  118   RKRLGIHVKGNSVPAPILSFASCPLPQKLLENIESSGYEMPTPVQMQAIPAALTGKSLLV  177

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
             SA+TGSGKT SFL+P++      +L  S   ++P A++L PTRELCIQ+EEQAK+LGKG+
Sbjct  178   SADTGSGKTASFLVPVITYCANNSLQNSSNGRRPRAIVLEPTRELCIQVEEQAKMLGKGL  237

Query  1386  PFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
             PFKTALVVGGD MA QLYR++ GV LIVGTPGRLIDLLTK +IELD + +FV+DEVDCML
Sbjct  238   PFKTALVVGGDPMAGQLYRIQEGVELIVGTPGRLIDLLTKHDIELDDIMIFVLDEVDCML  297

Query  1206  QRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
             QRGF +QVMQIFRALSQPQ+LMYSATIS EVEKMA +M K +TV+SVG+ N  N AVK +
Sbjct  298   QRGFRDQVMQIFRALSQPQLLMYSATISPEVEKMAGTMVKDVTVVSVGKPNTSNKAVKHI  357

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
             AIWVE+KQKKQKLFD+L SKQH+KPP +V+VGSRLGADLL+ AI + TG+KA+S+HGEKS
Sbjct  358   AIWVETKQKKQKLFDVLMSKQHFKPPAVVYVGSRLGADLLADAIAVKTGMKALSMHGEKS  417

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
             MK+RREI++ F +G+ PVIVATG+LGRGVDLL V+QVI+FDMPNSIKEYVHQ+GRAS++G
Sbjct  418   MKERREIMQLFFMGECPVIVATGILGRGVDLLGVRQVIIFDMPNSIKEYVHQVGRASKLG  477

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             EEGT++VF+NEENK + P+LVE+L++S A IP EL NS+Y+    S G+ QK+RK
Sbjct  478   EEGTAVVFVNEENKNVLPDLVELLRASSAPIPRELLNSQYTRSVASAGKGQKKRK  532



>ref|XP_010037048.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010037049.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010037050.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010037051.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Eucalyptus grandis]
Length=559

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/535 (65%), Positives = 437/535 (82%), Gaps = 6/535 (1%)
 Frame = -1

Query  2106  GSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETD  1927
             G+ K  E S V AT +++PS +     VK+RS +QR A P +PKCV+CGRYGEYICDET+
Sbjct  28    GASKDCEQSSVDATNTDEPSDA-----VKERSRDQRLAFPGDPKCVMCGRYGEYICDETE  82

Query  1926  DDICSLECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             DDICSLECK  LLSRI  S +        + P  D+CYYV+D + K+ S+ L SDQ+E+L
Sbjct  83    DDICSLECKRTLLSRISNSSRGGHTSLK-KLPTVDECYYVKDGNDKTGSQSLPSDQSEVL  141

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             R++L I VKG+ V  PI+SF SC +P+KLL+N+E++GYEMPTPVQMQAIPAAL G+SLLV
Sbjct  142   RKRLGIHVKGNSVPAPILSFASCPLPQKLLENIESSGYEMPTPVQMQAIPAALTGKSLLV  201

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
             SA+TGSGKT SFL+P++      +L  S   ++P A++L PTRELCIQ+EEQAK+LGKG+
Sbjct  202   SADTGSGKTASFLVPVITYCANNSLQNSSNGRRPRAIVLEPTRELCIQVEEQAKMLGKGL  261

Query  1386  PFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
             PFKTALVVGGD MA QLYR++ GV LIVGTPGRLIDLLTK +IELD + +FV+DEVDCML
Sbjct  262   PFKTALVVGGDPMAGQLYRIQEGVELIVGTPGRLIDLLTKHDIELDDIMIFVLDEVDCML  321

Query  1206  QRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
             QRGF +QVMQIFRALSQPQ+LMYSATIS EVEKMA +M K +TV+SVG+ N  N AVK +
Sbjct  322   QRGFRDQVMQIFRALSQPQLLMYSATISPEVEKMAGTMVKDVTVVSVGKPNTSNKAVKHI  381

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
             AIWVE+KQKKQKLFD+L SKQH+KPP +V+VGSRLGADLL+ AI + TG+KA+S+HGEKS
Sbjct  382   AIWVETKQKKQKLFDVLMSKQHFKPPAVVYVGSRLGADLLADAIAVKTGMKALSMHGEKS  441

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
             MK+RREI++ F +G+ PVIVATG+LGRGVDLL V+QVI+FDMPNSIKEYVHQ+GRAS++G
Sbjct  442   MKERREIMQLFFMGECPVIVATGILGRGVDLLGVRQVIIFDMPNSIKEYVHQVGRASKLG  501

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             EEGT++VF+NEENK + P+LVE+L++S A IP EL NS+Y+    S G+ QK+RK
Sbjct  502   EEGTAVVFVNEENKNVLPDLVELLRASSAPIPRELLNSQYTRSVASAGKGQKKRK  556



>ref|XP_007151689.1| hypothetical protein PHAVU_004G067700g [Phaseolus vulgaris]
 gb|ESW23683.1| hypothetical protein PHAVU_004G067700g [Phaseolus vulgaris]
Length=534

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/524 (67%), Positives = 432/524 (82%), Gaps = 7/524 (1%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             ATE++ P  +    +VK RS +QR AL  EPKCVICGRYGEYICDETDDD+CSLECK  L
Sbjct  14    ATEADAPEDAGEGEDVKLRSRDQRLALQGEPKCVICGRYGEYICDETDDDVCSLECKQAL  73

Query  1890  LSRIEKSRKP-TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD  1714
             L RI KS  P     PP + P  D+C+YV D D KS +  +ASD    LR KL+I VKGD
Sbjct  74    LCRIAKSLAPFGSLLPPEKIPIADECFYVSDADNKSGTAPMASD----LRTKLDIHVKGD  129

Query  1713  LVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGS  1534
             +V+P ++SF +C++P KLL N+EAAGY MPTPVQMQAIPAAL G+++LV A TGSGK+ S
Sbjct  130   VVAP-VLSFSACNLPDKLLHNIEAAGYYMPTPVQMQAIPAALTGKNVLVLANTGSGKSAS  188

Query  1533  FLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGD  1354
             FLIPIV+  V ++      ++KPL M+L PTRELCIQ+EE AK+LGKG+PFKTALVVGG+
Sbjct  189   FLIPIVSRCV-IHRRQYVSEKKPLVMVLTPTRELCIQVEEHAKMLGKGLPFKTALVVGGE  247

Query  1353  AMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQI  1174
             AMA QLYR++ GV LIVGTPGRL+DLL K EI+LD V  FV+DEVDCMLQRGF +QVM+I
Sbjct  248   AMAGQLYRIQQGVELIVGTPGRLVDLLMKHEIDLDDVMTFVVDEVDCMLQRGFRDQVMKI  307

Query  1173  FRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQ  994
             +RALSQPQ+LMYSAT+S ++EKM +++AK   VISVG+ N+ N AVKQLAIWVESKQKKQ
Sbjct  308   YRALSQPQVLMYSATMSNDLEKMINTLAKGTVVISVGEPNRANKAVKQLAIWVESKQKKQ  367

Query  993   KLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSF  814
             KLFDIL +K+H+KPPV+V+VGSRLGADLL+ AIT++TG+KAVSIHGEKSMK+RREI++SF
Sbjct  368   KLFDILATKKHFKPPVVVYVGSRLGADLLANAITVATGIKAVSIHGEKSMKERREIMQSF  427

Query  813   LVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINE  634
              +G+VPV+VATGVLGRG+DLL V+QVIVFDMPNSIKEYVHQIGRASRMGEEG  IVF+NE
Sbjct  428   CMGEVPVVVATGVLGRGIDLLGVRQVIVFDMPNSIKEYVHQIGRASRMGEEGEGIVFVNE  487

Query  633   ENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             ENK +F +L+++LKS GAA+P ELANS+Y+ G FS G+  K+RK
Sbjct  488   ENKNVFADLIDVLKSGGAAVPRELANSRYTTGFFSGGKASKKRK  531



>gb|KDO63487.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
Length=533

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/490 (71%), Positives = 417/490 (85%), Gaps = 3/490 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS S+VK+ S +QREALP+EPKCVICGRYGEYICDETDDD+CSLECK  LL R+  + + 
Sbjct  17    DSQSDVKEWSKDQREALPEEPKCVICGRYGEYICDETDDDVCSLECKQKLLCRVANANRG  76

Query  1860  TPCPPPV---RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 PP    R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+S
Sbjct  77    MRVVPPPPPERLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILS  136

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC + +KLL N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++ 
Sbjct  137   FSSCSLSQKLLQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQ  196

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                + L  S+ ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR
Sbjct  197   CANIRLHHSQNQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYR  256

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQ
Sbjct  257   IQQGVELIVGTPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQ  316

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             ILMYSATIS+EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL S
Sbjct  317   ILMYSATISQEVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMS  376

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVI
Sbjct  377   KQHFTPPAVVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVI  436

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATG+LGRGV+LL V+QVI+FDMPNSIKEYVHQIGRAS+MG+EGT+IVF+NEENK LF E
Sbjct  437   VATGILGRGVELLGVRQVIIFDMPNSIKEYVHQIGRASQMGDEGTAIVFVNEENKNLFQE  496

Query  609   LVEILKSSGA  580
             LV+ILKSSGA
Sbjct  497   LVDILKSSGA  506



>ref|XP_006468942.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Citrus sinensis]
Length=533

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/490 (71%), Positives = 416/490 (85%), Gaps = 3/490 (1%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS S+VK+ S +QREALP+EPKCVICGRYGEYICDETDDD+CSLECK  LL R+  + + 
Sbjct  17    DSQSDVKEWSKDQREALPEEPKCVICGRYGEYICDETDDDVCSLECKQKLLCRVANANRG  76

Query  1860  TPCPPPV---RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 PP    R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+S
Sbjct  77    MRVVPPPPPERLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILS  136

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC + +KLL N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++ 
Sbjct  137   FSSCSLSQKLLQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQ  196

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
                + L  S+ ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR
Sbjct  197   CANIRLHHSQNQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYR  256

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LIVGTPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQ
Sbjct  257   IQQGVELIVGTPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQ  316

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             ILMYSATIS+EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL S
Sbjct  317   ILMYSATISQEVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMS  376

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             KQH+ PP +V+VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVI
Sbjct  377   KQHFTPPAVVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVI  436

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             VATG+LGRGV+LL V+ VI+FDMPNSIKEYVHQIGRAS+MGEEGT+IVF+NEENK LF E
Sbjct  437   VATGILGRGVELLGVRLVIIFDMPNSIKEYVHQIGRASQMGEEGTAIVFVNEENKNLFQE  496

Query  609   LVEILKSSGA  580
             LV+ILKSSGA
Sbjct  497   LVDILKSSGA  506



>ref|XP_007032087.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY03013.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=543

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/491 (70%), Positives = 413/491 (84%), Gaps = 1/491 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D+ VKK S EQR+AL +EPKCVICGRYGEY+CDETDDDICSLECK  LLS I  S  P  
Sbjct  24    DNYVKKSSTEQRDALAEEPKCVICGRYGEYVCDETDDDICSLECKQTLLSGIANSLLPVG  83

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
                  R PATD+C+YVRD   KS  + L  DQAELLR+KL I VKGD++  PI++F SC 
Sbjct  84    PSSTQRLPATDECFYVRDSVDKSGFQFLTGDQAELLRKKLEIHVKGDVIPAPIVAFSSCA  143

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P+KLL N+E AGY MPTPVQMQ IPAAL G+SLLVSA+TGSGKT SFLIPI+++     
Sbjct  144   LPQKLLQNIETAGYGMPTPVQMQVIPAALDGKSLLVSADTGSGKTASFLIPIISHCANFR  203

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
              +     +KP+A++L PTRELCIQ+E+ AK+LGKG+PFKTALVVGGD MARQLYR++ GV
Sbjct  204   RSNFSNHKKPIAVVLTPTRELCIQVEDNAKLLGKGLPFKTALVVGGDPMARQLYRIQQGV  263

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LI+GTPGRLIDLLTK ++EL+ V +F +DEVDC+LQRGF +QVMQIFRALSQPQ+LMYS
Sbjct  264   ELIIGTPGRLIDLLTKHDVELNDVKIFGLDEVDCILQRGFRDQVMQIFRALSQPQVLMYS  323

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             ATIS+++EK+AS MAK +TV+S+G+ N+PN AVKQL IWVES +KKQKLFDIL SK H+ 
Sbjct  324   ATISQDIEKIASFMAKDVTVVSIGKPNRPNKAVKQLPIWVESNKKKQKLFDILRSK-HFT  382

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP++V+VGSR+GADLLS AIT+STG+KA+S+HGEKSM +RREILR FLVG+V VIV+TGV
Sbjct  383   PPIVVYVGSRVGADLLSNAITVSTGIKALSLHGEKSMNERREILRLFLVGEVSVIVSTGV  442

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+D L V+QVIVFDMP+SIKEYVHQIGRASR+GEEGT+IVF+NEENK LFPELV+IL
Sbjct  443   LGRGIDFLGVRQVIVFDMPSSIKEYVHQIGRASRLGEEGTAIVFVNEENKNLFPELVDIL  502

Query  594   KSSGAAIPSEL  562
             KSSGA IP EL
Sbjct  503   KSSGAVIPQEL  513



>gb|KHG21940.1| DEAD-box ATP-dependent RNA helicase 41 -like protein [Gossypium 
arboreum]
Length=535

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/513 (68%), Positives = 424/513 (83%), Gaps = 2/513 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D +VK  S +QR+AL DEPKCVICGRYGEY+CDETDDDICSLECK  +L R+  S  P  
Sbjct  24    DDDVKLNSKDQRDALADEPKCVICGRYGEYVCDETDDDICSLECKQAILLRVANSL-PVC  82

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
                  R PATD+C+YVRD   +S S  L  DQAELLR KL I VKG ++  P+++F SC 
Sbjct  83    SSSTQRLPATDECFYVRDSVDRSGSPSLTCDQAELLRNKLEIHVKGGVIPAPVLAFSSCG  142

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P+KLL N+E AGY +PTPVQMQ IPAAL GRSLLVSA+TGSGKT SFLIPI++   KL 
Sbjct  143   LPQKLLQNIETAGYVIPTPVQMQVIPAALDGRSLLVSADTGSGKTASFLIPIISLCAKLY  202

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
                +   +KPLA++L PTREL IQ+E+QAK+LGKG+PFKTALVVGGD +ARQLYR++ GV
Sbjct  203   PNNNSNIRKPLAVVLTPTRELGIQVEDQAKLLGKGLPFKTALVVGGDPIARQLYRIQQGV  262

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LI+GTPGRLID+LTK++IEL  V +F +DEVDCMLQRGF +QVMQIFRALSQPQ+LMYS
Sbjct  263   ELIIGTPGRLIDILTKQDIELTDVKIFGLDEVDCMLQRGFRDQVMQIFRALSQPQLLMYS  322

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             ATIS++VEK+AS MA  +  +S+G+ ++P+ AVKQLAIWVESKQKKQKLFDIL SK H++
Sbjct  323   ATISQDVEKIASCMATDIVSVSIGKPSRPSRAVKQLAIWVESKQKKQKLFDILRSK-HFR  381

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP +V+VGSR GADLLS AIT +TG+KA+SIHG KSMK+RREI+R FLVG+V V+V+TG+
Sbjct  382   PPAVVYVGSRAGADLLSDAITATTGIKALSIHGTKSMKERREIMRMFLVGEVSVVVSTGI  441

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+DLL+V+QVIVFDMPNSIKEYVHQIGRASR+GEEG +IVF+N+E+KKL PE V+IL
Sbjct  442   LGRGIDLLAVRQVIVFDMPNSIKEYVHQIGRASRLGEEGNAIVFVNDEDKKLIPEFVDIL  501

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             KSSGA IP EL NS+Y+V S   G++ K+RKYG
Sbjct  502   KSSGAIIPRELGNSRYNVVSLPSGKNFKKRKYG  534



>ref|XP_010930326.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Elaeis guineensis]
Length=537

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/512 (66%), Positives = 432/512 (84%), Gaps = 3/512 (1%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT-PCP  1849
             VK+R  EQREALP EP+C ICGRYGEYICDETDDDICS ECK+ LL+R+  ++KPT  C 
Sbjct  28    VKERCQEQREALPGEPRCAICGRYGEYICDETDDDICSKECKSTLLARLASTQKPTLVCN  87

Query  1848  PPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVP  1669
              PVR P +D+C+YVR D++ + S+ L++DQ E LR K+ I +KG+ V  P++SF SC++P
Sbjct  88    RPVRVPVSDECFYVRADNRPN-SESLSTDQTESLRSKIGICIKGNSVPAPVLSFSSCNLP  146

Query  1668  RKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLA  1489
             +KL  NLE+AGY +PTPVQMQ IPAAL+ R++LVSA+TGSGKT SFL+PIV++   + L 
Sbjct  147   QKLEQNLESAGYLIPTPVQMQTIPAALVNRNILVSADTGSGKTASFLVPIVSHCSYIRLQ  206

Query  1488  CSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSL  1309
                 ++ PLAM+LAPTRE+C+Q+EEQAKVLGKG+PFKTALV+GGDAMA Q+YR++ GV L
Sbjct  207   HLAEQKGPLAMVLAPTREICVQVEEQAKVLGKGLPFKTALVIGGDAMAGQVYRIQKGVEL  266

Query  1308  IVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSAT  1129
             IVGTPGRLIDLLTK +I+L+ VS+ V+DEVD MLQ+GF +QVMQIF+ALS+PQ+LM+SAT
Sbjct  267   IVGTPGRLIDLLTKHDIDLNEVSVLVLDEVDSMLQKGFRDQVMQIFQALSRPQVLMFSAT  326

Query  1128  ISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPP  949
             IS EVE+MASSMA+ L  ++ G+ N+P+ +VKQ+ IWVESKQKKQKLF+IL SKQH+KPP
Sbjct  327   ISEEVERMASSMARDLIHVTCGKPNRPSKSVKQVVIWVESKQKKQKLFEILMSKQHFKPP  386

Query  948   VIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLG  769
             ++VFVGSRLGADLL+ AIT+ TGLKA+SIHGEKSMKDRR+ +R FL G+  ++V+TGVLG
Sbjct  387   IVVFVGSRLGADLLAEAITVVTGLKALSIHGEKSMKDRRDNMRLFLTGETSILVSTGVLG  446

Query  768   RGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKS  589
             RGVD+L V+QVI+FDMP+S+ EYVHQ+GRASRMGEEG +IVF+NEE+KKLF ELV+ LKS
Sbjct  447   RGVDMLKVQQVIIFDMPSSMAEYVHQVGRASRMGEEGVAIVFVNEEDKKLFRELVQYLKS  506

Query  588   SGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             +GAA+P +LANS+YSVG   +   QK RKYG+
Sbjct  507   AGAAVPQKLANSRYSVGPSPLSSRQK-RKYGS  537



>ref|XP_008801313.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Phoenix 
dactylifera]
 ref|XP_008801322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Phoenix 
dactylifera]
 ref|XP_008801331.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Phoenix 
dactylifera]
Length=532

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/512 (67%), Positives = 428/512 (84%), Gaps = 7/512 (1%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT-PCP  1849
             VK+R  EQREALP EP+C ICGRYGEYICDETDDDICS ECK+ LL+R+  ++KP     
Sbjct  25    VKERCQEQREALPGEPRCAICGRYGEYICDETDDDICSKECKSTLLARLASTQKPALDHS  84

Query  1848  PPVRFPATDDCYYVRDDDK-KSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDV  1672
              PV+ P +D+C+YVRDD++  SES    +DQ E LR K+ I +KG+ V  PI+SF SC++
Sbjct  85    HPVKLPVSDECFYVRDDNRPNSES----TDQIESLRSKIGICIKGNSVPAPILSFSSCNL  140

Query  1671  PRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNL  1492
             P+KL  NLE+AGY +PTPVQMQ IPAAL+ R++LVSA+TGSGKT SFL+PIV++   + L
Sbjct  141   PQKLEQNLESAGYLIPTPVQMQTIPAALIKRNMLVSADTGSGKTASFLVPIVSHCSNIRL  200

Query  1491  ACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVS  1312
                  ++ PLAM+LAPTRE+C+Q+EEQAKVLGKG+PFKTALV+GGDAMA Q+YR++ GV 
Sbjct  201   QHLAEQKGPLAMVLAPTREICVQVEEQAKVLGKGLPFKTALVIGGDAMAGQVYRIQKGVE  260

Query  1311  LIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSA  1132
             LIVGTPGRLIDLLTK +I L+ VS+ V+DEVD MLQ+GF +QVMQIF+ALSQPQ+LM+SA
Sbjct  261   LIVGTPGRLIDLLTKHDINLNEVSVLVLDEVDSMLQKGFRDQVMQIFQALSQPQVLMFSA  320

Query  1131  TISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKP  952
             TIS EVEKMASSMA+ L  +  G+ ++P+ +VKQ+ IWVESKQKKQKLF+IL SKQH+KP
Sbjct  321   TISEEVEKMASSMARDLIHVICGKPSRPSKSVKQVVIWVESKQKKQKLFEILMSKQHFKP  380

Query  951   PVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVL  772
             P+++FVGSRLGADLL+ AIT+ TGLKA+SIHGEKSMKDRR+ LR FL G++ V+V+TGVL
Sbjct  381   PIVLFVGSRLGADLLAEAITVVTGLKALSIHGEKSMKDRRDSLRLFLTGEISVLVSTGVL  440

Query  771   GRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILK  592
             GRGVDLL V+QVIVFDMP+S+ EYVHQ+GRASRMGEEG +IVF+NEE++KLF ELV+ LK
Sbjct  441   GRGVDLLKVRQVIVFDMPSSMAEYVHQVGRASRMGEEGVAIVFVNEEDRKLFRELVQYLK  500

Query  591   SSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             SSGAA+P ELANS+YSVG F +   QK RKYG
Sbjct  501   SSGAAVPRELANSRYSVGPFPLSSRQK-RKYG  531



>ref|XP_010660645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X3 
[Vitis vinifera]
 ref|XP_010660646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X3 
[Vitis vinifera]
Length=474

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/465 (74%), Positives = 403/465 (87%), Gaps = 3/465 (1%)
 Frame = -1

Query  1881  IEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSP  1702
             + KSR P   PPP R P TD+C+YVRD   KS S+ L   Q E+LRR+L I V+GD    
Sbjct  9     VAKSRLPVVLPPPKRLPTTDECFYVRDSGDKSGSQSLTGSQTEMLRRRLEICVRGDFDLS  68

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+SF SC++P+KLL N+EAAGYE+PTPVQMQAIPAAL+G++LLVSA+TGSGKT SFL+P
Sbjct  69    PILSFSSCNLPQKLLQNIEAAGYEIPTPVQMQAIPAALVGKNLLVSADTGSGKTASFLVP  128

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMAR  1342
             IV+    +    S  ++ PLAM+L PTRELC+Q+EEQAK+LGKG+PFKTALVVGGDAM R
Sbjct  129   IVSRCTSIRPDHSPNQKNPLAMVLTPTRELCMQVEEQAKLLGKGLPFKTALVVGGDAMPR  188

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             QL+R++ GV LIVGTPGRLIDLL+K EIELD V M V+DEVDCML+RGF +QVMQI+RAL
Sbjct  189   QLHRIQQGVELIVGTPGRLIDLLSKHEIELDDVFMLVLDEVDCMLERGFRDQVMQIYRAL  248

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
             SQPQ+LMYSATIS+EVEK+ASSMAK + VISVG+ N+PN AVKQLAIWVESKQKKQKLFD
Sbjct  249   SQPQVLMYSATISQEVEKVASSMAKDIIVISVGKSNRPNIAVKQLAIWVESKQKKQKLFD  308

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             ILTSKQH+ PPV+VFVGSRLGADLL+ AITI+TGLKA+SIHGEKSMK+RREI+ SFLVG+
Sbjct  309   ILTSKQHFTPPVVVFVGSRLGADLLTEAITITTGLKALSIHGEKSMKERREIMSSFLVGE  368

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             VPV+VATGVL RGVDLLSV+QVIVFDMPNSIKEYVHQIGRASR+GEEGT+I+F+NEEN+ 
Sbjct  369   VPVMVATGVLSRGVDLLSVRQVIVFDMPNSIKEYVHQIGRASRLGEEGTAILFLNEENRN  428

Query  621   LFPELVEILKSSGAAIPSELANSKYSVGSFSVGR---HQKRRKYG  496
             LFPELVEILKSSGAAIP ELANS+Y +GS +VGR    QK+RK+G
Sbjct  429   LFPELVEILKSSGAAIPRELANSRYRLGSVNVGRGQIRQKKRKHG  473



>ref|XP_004167588.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Cucumis 
sativus]
Length=532

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/512 (65%), Positives = 411/512 (80%), Gaps = 4/512 (1%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             +S VK +  EQREA P EPKCV+CGRYGEYICDETDDD+CS+ECK  +L ++  +  P  
Sbjct  24    ESPVKVKCIEQREAFPGEPKCVVCGRYGEYICDETDDDVCSMECKQSVLRKVANTMAPDK  83

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
              P   R PA D+C+YV++ +  S   C   +Q E+LR+KL I +KGDL   PI+SF   +
Sbjct  84    APSK-RLPAADECFYVKESNYSSSLTC---EQTEMLRKKLGISIKGDLDCAPILSFSFGN  139

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P+KL  NLE AGYEMPTPVQMQAIPAA +G++LLVSAETGSGKT S+L+PIV+   +  
Sbjct  140   LPQKLFQNLETAGYEMPTPVQMQAIPAACLGKNLLVSAETGSGKTVSYLVPIVSYCARAR  199

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
             L C   ++KPLAM+L PTRELCIQ+E+QAK+LGKGMPFKTALVVGGDA+A QL+R++ GV
Sbjct  200   LECFHGEKKPLAMVLTPTRELCIQVEQQAKLLGKGMPFKTALVVGGDALAGQLHRIQQGV  259

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LIV TPGRL+DLLTK +IELD V  FV+DEVDC+LQ+GF +QV+QIFRALS PQILMY+
Sbjct  260   ELIVATPGRLVDLLTKHDIELDEVRTFVLDEVDCLLQKGFRDQVLQIFRALSVPQILMYT  319

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             AT S EVEKMA SM     +IS    NKP  A+KQ+ IWVESK KKQKLFDILTSKQH+ 
Sbjct  320   ATPSPEVEKMAKSMGDGTVIISTSMSNKPTKALKQVVIWVESKNKKQKLFDILTSKQHFM  379

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP++V+VGSRLGADLLS AIT++TG+ A+SIHG KSMK+RRE +RSF++G+V V+VATG+
Sbjct  380   PPLVVYVGSRLGADLLSNAITVTTGINALSIHGHKSMKERREAMRSFIMGEVQVMVATGI  439

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+DLL V+QVI+FDMPNSIKEYVHQIGRASR+GEEG +IVF+NEENK LF +LVE L
Sbjct  440   LGRGMDLLCVRQVIIFDMPNSIKEYVHQIGRASRLGEEGKAIVFVNEENKNLFQDLVETL  499

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             KSSGA IP EL NS ++  S    ++QK+RKY
Sbjct  500   KSSGAPIPRELLNSHHTANSSYRAKNQKKRKY  531



>ref|XP_009417077.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Musa acuminata 
subsp. malaccensis]
Length=538

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/535 (64%), Positives = 430/535 (80%), Gaps = 7/535 (1%)
 Frame = -1

Query  2085  TSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
              S     E+    G   +  VK+R  +QREALP EP+CVICGRYGEYICD TDDDICS+E
Sbjct  7     ASTADCAEAVDIGGDAEECPVKQRCQQQREALPGEPRCVICGRYGEYICDLTDDDICSIE  66

Query  1905  CKTILLSRIEKSRKPTP-CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             CKTILLSR EK+  P P     V+ P  D+C+YVRD+D+   S  L S Q + LR K+ +
Sbjct  67    CKTILLSRHEKAHNPAPKLTHHVKIPIKDECFYVRDNDRGG-SGGLTSIQIDSLRSKIGL  125

Query  1728  V---VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAE  1558
                 VKG  V  P++SF SCD+P KL +NLE AGY +PTP+QMQAIPAAL  R+LLVSA+
Sbjct  126   CIKGVKGASVPAPVLSFSSCDLPEKLENNLETAGYVIPTPIQMQAIPAALDNRNLLVSAD  185

Query  1557  TGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFK  1378
             TGSGKT SFL+P+++    + L C    + PLAM+LAPTRELCIQ+E++AK+LGKG+PFK
Sbjct  186   TGSGKTASFLVPVISRCSGIRLRCVTELRNPLAMVLAPTRELCIQVEKEAKILGKGLPFK  245

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             TALVVGGD +A Q+YR+++GV LIVGTPGRLIDLLTK +IEL+ VS+ V+DEVDC++QRG
Sbjct  246   TALVVGGDPLAGQVYRIQNGVELIVGTPGRLIDLLTKHDIELNEVSVLVLDEVDCIMQRG  305

Query  1197  FHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
             F +QVMQI +ALSQPQ+LM+SAT+SREVE+MASS+AKH+  IS G  + P+ +VKQ+ IW
Sbjct  306   FRDQVMQIVQALSQPQVLMFSATVSREVERMASSIAKHIICISAGNPSTPSSSVKQVIIW  365

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VESK+KKQKLF+IL SKQH+KPPV+VFVGSRLGADLLS AI  +TG+KA+SIHGEK+MK+
Sbjct  366   VESKKKKQKLFEILMSKQHFKPPVVVFVGSRLGADLLSEAICTATGIKALSIHGEKTMKE  425

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             RRE L+ FL G+V ++V+TGVLGRGVDLL V QVI+FDMPNS++EYVHQ+GRASRMGEEG
Sbjct  426   RRESLQLFLTGEVSILVSTGVLGRGVDLLKVHQVIMFDMPNSMEEYVHQVGRASRMGEEG  485

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYGT  493
             T+I F+NEE+KKLF ELV+ LKS GAAIP ELANSKY +G++    HQK+RK+G+
Sbjct  486   TAIAFVNEEDKKLFRELVQNLKSIGAAIPRELANSKY-LGAYP-SSHQKKRKFGS  538



>ref|XP_008449976.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Cucumis melo]
Length=532

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/512 (65%), Positives = 411/512 (80%), Gaps = 3/512 (1%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             +S VK +  EQREA P EPKCV+CGRYGEYICDETDDD+CS+ECK  +L ++  S  P  
Sbjct  23    ESAVKVKCNEQREAFPGEPKCVVCGRYGEYICDETDDDVCSMECKQSVLCKVANSMAPDK  82

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
              PP  R PA D+C+YV++ +    S  L  +Q E+LR+KL I +KGDL   PI+SF   D
Sbjct  83    -PPSKRLPAADECFYVKESNYSGSS--LTCEQTEMLRKKLGISIKGDLDCAPILSFSFGD  139

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P KLL NLE AGYEMPTPVQMQAIPAA +G++LLVSAETGSGKT S+L+PIV+   +  
Sbjct  140   LPEKLLQNLETAGYEMPTPVQMQAIPAACLGKNLLVSAETGSGKTMSYLVPIVSYCTRAR  199

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
             L C   ++KPLAM+L PTRELCIQ+E+QAK+LGKGMPFKTALVVGGDA+A QL+R++ GV
Sbjct  200   LECFRGEKKPLAMVLTPTRELCIQVEQQAKLLGKGMPFKTALVVGGDALAGQLHRIQQGV  259

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LIV TPGRL+DLLTK +IELD +  FV+DEVDC+LQ+GF +QV+QIFRALS PQILMY+
Sbjct  260   ELIVATPGRLVDLLTKHDIELDEMRTFVLDEVDCLLQKGFRDQVLQIFRALSGPQILMYT  319

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             AT S EVEKMA SM     ++S    NKP  A+KQ+ IWVESK KKQKLFDILTSKQH+ 
Sbjct  320   ATTSPEVEKMAKSMGDGTVIMSTSMSNKPTKALKQVVIWVESKNKKQKLFDILTSKQHFM  379

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP++V+VGSRLGADLLS AIT++TG+KA+SIHG KSMK+RRE ++SF++G+V V+VATG+
Sbjct  380   PPLVVYVGSRLGADLLSNAITVTTGIKALSIHGHKSMKERREAMKSFIMGEVQVMVATGI  439

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+DLL V+QVI+FDMPNSIKEYVHQIGRASR+G EG +IVF+N ENK LF +LVE L
Sbjct  440   LGRGMDLLCVRQVIIFDMPNSIKEYVHQIGRASRLGGEGKAIVFVNGENKNLFQDLVETL  499

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             KSSGA IP EL NS ++  S    ++QK+RKY
Sbjct  500   KSSGAPIPRELLNSHHTANSSYRAKNQKKRKY  531



>ref|XP_004145645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Cucumis 
sativus]
 gb|KGN57687.1| hypothetical protein Csa_3G252460 [Cucumis sativus]
Length=532

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/512 (65%), Positives = 410/512 (80%), Gaps = 4/512 (1%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             +S VK +  EQREA P EPKCV+CGRYGEYICDETDDD+CS+ECK  +L ++  +  P  
Sbjct  24    ESPVKVKCIEQREAFPGEPKCVVCGRYGEYICDETDDDVCSMECKQSVLRKVANTMAPDK  83

Query  1854  CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
              P   R PA D+C+YV++ +      C   +Q E+LR+KL I +KGDL   PI+SF   +
Sbjct  84    APSK-RLPAADECFYVKESNYSGSLTC---EQTEMLRKKLGISIKGDLDCAPILSFSFGN  139

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P+KL  NLE AGYEMPTPVQMQAIPAA +G++LLVSAETGSGKT S+L+PIV+   +  
Sbjct  140   LPQKLFQNLETAGYEMPTPVQMQAIPAACLGKNLLVSAETGSGKTVSYLVPIVSYCARAC  199

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGV  1315
             L C   ++KPLAM+L PTRELCIQ+E+QAK+LGKGMPFKTALVVGGDA+A QL+R++ GV
Sbjct  200   LECFHGEKKPLAMVLTPTRELCIQVEQQAKLLGKGMPFKTALVVGGDALAGQLHRIQQGV  259

Query  1314  SLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYS  1135
              LIV TPGRL+DLLTK +IELD V  FV+DEVDC+LQ+GF +QV+QIFRALS PQILMY+
Sbjct  260   ELIVATPGRLVDLLTKHDIELDEVRTFVLDEVDCLLQKGFRDQVLQIFRALSVPQILMYT  319

Query  1134  ATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYK  955
             AT S EVEKMA SM     +IS    NKP  A+KQ+ IWVESK KKQKLFDILTSKQH+ 
Sbjct  320   ATPSPEVEKMAKSMGDGTVIISTSMSNKPTKALKQVVIWVESKNKKQKLFDILTSKQHFM  379

Query  954   PPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGV  775
             PP++V+VGSRLGADLLS AIT++TG+ A+SIHG KSMK+RRE +RSF++G+V V+VATG+
Sbjct  380   PPLVVYVGSRLGADLLSNAITVTTGINALSIHGHKSMKERREAMRSFIMGEVQVMVATGI  439

Query  774   LGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEIL  595
             LGRG+DLL V+QVI+FDMPNSIKEYVHQIGRASR+GEEG +IVF+NEENK LF +LVE L
Sbjct  440   LGRGMDLLCVRQVIIFDMPNSIKEYVHQIGRASRLGEEGKAIVFVNEENKNLFQDLVETL  499

Query  594   KSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             KSSGA IP EL NS ++  S    ++QK+RKY
Sbjct  500   KSSGAPIPRELLNSHHTANSSYRAKNQKKRKY  531



>gb|KDO63493.1| hypothetical protein CISIN_1g009490mg [Citrus sinensis]
Length=472

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/446 (71%), Positives = 385/446 (86%), Gaps = 0/446 (0%)
 Frame = -1

Query  1839  RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKL  1660
             R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+SF SC + +KL
Sbjct  26    RLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILSFSSCSLSQKL  85

Query  1659  LDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSE  1480
             L N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++    + L  S+
Sbjct  86    LQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQCANIRLHHSQ  145

Query  1479  RKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVG  1300
              ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR++ GV LIVG
Sbjct  146   NQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYRIQQGVELIVG  205

Query  1299  TPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISR  1120
             TPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQILMYSATIS+
Sbjct  206   TPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQILMYSATISQ  265

Query  1119  EVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIV  940
             EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL SKQH+ PP +V
Sbjct  266   EVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMSKQHFTPPAVV  325

Query  939   FVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGV  760
             +VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVIVATG+LGRGV
Sbjct  326   YVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVIVATGILGRGV  385

Query  759   DLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGA  580
             +LL V+QVI+FDMPNSIKEYVHQIGRAS+MG+EGT+IVF+NEENK LF ELV+ILKSSGA
Sbjct  386   ELLGVRQVIIFDMPNSIKEYVHQIGRASQMGDEGTAIVFVNEENKNLFQELVDILKSSGA  445

Query  579   AIPSELANSKYSVGSFSVGRHQKRRK  502
              IP EL NS+Y+VGSFS G+  K+RK
Sbjct  446   GIPRELINSRYTVGSFSSGKGFKKRK  471



>ref|XP_002453503.1| hypothetical protein SORBIDRAFT_04g006980 [Sorghum bicolor]
 gb|EES06479.1| hypothetical protein SORBIDRAFT_04g006980 [Sorghum bicolor]
Length=539

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/539 (60%), Positives = 427/539 (79%), Gaps = 13/539 (2%)
 Frame = -1

Query  2118  NHSSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             N S+GSF      +V+++++N+      D  VK+R +EQREALP EP+CV+CGRYGEYIC
Sbjct  6     NQSAGSF------VVSSSDNNELE----DLPVKERCFEQREALPGEPRCVVCGRYGEYIC  55

Query  1938  DETDDDICSLECKTILLSRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
             D+TDDDICS+ECKTILL+RI    KP       V  P  D+ + ++D +  +    LA  
Sbjct  56    DQTDDDICSVECKTILLARIAAKTKPAVKAAKRVNLPLGDESFCIKDINFPN-IPTLADS  114

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             +   LR KL+I VKGD V  PIM F +C +P KL+ NLE AGY MPTPVQMQ IPA++  
Sbjct  115   RISSLRTKLDICVKGDAVPDPIMCFSACGLPEKLVHNLETAGYCMPTPVQMQVIPASMSN  174

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             RSLLVSA+TGSGKT SFLIPI+A+  ++    S   Q PLA++LAPTRELC+Q+EEQAKV
Sbjct  175   RSLLVSADTGSGKTASFLIPIIAHCSQVRSQESTSNQGPLAIVLAPTRELCLQVEEQAKV  234

Query  1401  LGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDE  1222
             LGKG+PFKTALVVGGD + +Q+YR+E+G+ LIVGTPGRLIDLL K  ++L  VS+FV+DE
Sbjct  235   LGKGLPFKTALVVGGDPLPQQIYRIENGIELIVGTPGRLIDLLMKHNVDLTYVSVFVLDE  294

Query  1221  VDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNG  1042
             VDC+L+RGF +Q MQIF++LSQPQ++M+SAT+  EVEKM++S+AK++  IS G  N+P  
Sbjct  295   VDCLLERGFRDQAMQIFQSLSQPQVMMFSATLHSEVEKMSNSLAKNVISISCGNPNRPTK  354

Query  1041  AVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSI  862
             +VKQ+ IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSI
Sbjct  355   SVKQVVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSI  414

Query  861   HGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGR  682
             HGEK+MK+RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GR
Sbjct  415   HGEKTMKERRENLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDIPNSIDEYIHQVGR  474

Query  681   ASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ASRMGEEG ++VF+NEE++++F ELV++LK++GA IP ELANS+Y+ G + VG  +KR+
Sbjct  475   ASRMGEEGMAVVFVNEEDRRIFKELVQVLKTAGAPIPRELANSRYTAGVY-VGSERKRK  532



>ref|XP_006468943.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X3 [Citrus sinensis]
Length=472

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/446 (71%), Positives = 384/446 (86%), Gaps = 0/446 (0%)
 Frame = -1

Query  1839  RFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKL  1660
             R PATD+C+YVR+ D+ S  + L   Q + LR++L I VKGD V  PI+SF SC + +KL
Sbjct  26    RLPATDECFYVRESDENSGFQSLTIGQTDSLRKRLEINVKGDAVPAPILSFSSCSLSQKL  85

Query  1659  LDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSE  1480
             L N+EAAGY+MPTPVQMQAIP+AL G+SLLVSA TGSGKT SFL+P+++    + L  S+
Sbjct  86    LQNIEAAGYDMPTPVQMQAIPSALSGKSLLVSANTGSGKTASFLVPVISQCANIRLHHSQ  145

Query  1479  RKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVG  1300
              ++ PLAM+L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMARQ+YR++ GV LIVG
Sbjct  146   NQKNPLAMVLTPTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMARQVYRIQQGVELIVG  205

Query  1299  TPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISR  1120
             TPGRLIDLL K +IELD + MFV+DEVDCMLQRGF +QVMQIFRA+S PQILMYSATIS+
Sbjct  206   TPGRLIDLLMKHDIELDDIRMFVLDEVDCMLQRGFRDQVMQIFRAISLPQILMYSATISQ  265

Query  1119  EVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIV  940
             EVEKM+SS++K + V+SVG+ N PN AVKQLAIWVES +KKQKLFDIL SKQH+ PP +V
Sbjct  266   EVEKMSSSISKDIVVVSVGKPNMPNKAVKQLAIWVESNKKKQKLFDILMSKQHFTPPAVV  325

Query  939   FVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGV  760
             +VGSRLGADLLS AI+++TG+KA+SIHGEK MK+RREI+RSFLVG+VPVIVATG+LGRGV
Sbjct  326   YVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVIVATGILGRGV  385

Query  759   DLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGA  580
             +LL V+ VI+FDMPNSIKEYVHQIGRAS+MGEEGT+IVF+NEENK LF ELV+ILKSSGA
Sbjct  386   ELLGVRLVIIFDMPNSIKEYVHQIGRASQMGEEGTAIVFVNEENKNLFQELVDILKSSGA  445

Query  579   AIPSELANSKYSVGSFSVGRHQKRRK  502
              IP EL NS+Y+VGSFS G+  K+RK
Sbjct  446   GIPRELINSRYTVGSFSSGKGFKKRK  471



>ref|XP_010042550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like, partial 
[Eucalyptus grandis]
Length=498

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/484 (66%), Positives = 399/484 (82%), Gaps = 6/484 (1%)
 Frame = -1

Query  2097  KAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDI  1918
             K  E S V AT +++PS +     VK+RS +QR A P +PKCV+CGRYGEYICDET+DDI
Sbjct  21    KDCEQSSVDATNTDEPSDA-----VKERSRDQRLAFPGDPKCVMCGRYGEYICDETEDDI  75

Query  1917  CSLECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRK  1738
             CSLECK  LLSRI  S +        + P  D+C+YV+D + K+ S+ L SDQ+E+LR++
Sbjct  76    CSLECKRTLLSRISNSSRGGHTSLK-KLPTVDECFYVKDGNDKTGSQSLPSDQSEVLRKR  134

Query  1737  LNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAE  1558
             L I VKG+ +  PI+SF SC +P+KLL+N+E++GYEMPTPVQMQAIPAAL G+SLLVSA+
Sbjct  135   LGIHVKGNSIPAPILSFASCPLPQKLLENIESSGYEMPTPVQMQAIPAALTGKSLLVSAD  194

Query  1557  TGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFK  1378
             TGSGKT SFL+P++      +L  S   ++P A++L PTRELCIQ+EEQAK+LGKG+PFK
Sbjct  195   TGSGKTASFLVPVITYCANNSLQNSSNGRRPRAIVLEPTRELCIQVEEQAKMLGKGLPFK  254

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             TALVVGGD MA QLYR++ GV LIVGTPGRLIDLLTK +IELD + +FV+DEVDCMLQRG
Sbjct  255   TALVVGGDPMAGQLYRIQEGVELIVGTPGRLIDLLTKHDIELDDIMIFVLDEVDCMLQRG  314

Query  1197  FHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
             F +QVMQIFRALSQPQ+LMYSATIS EVEKMA +M K +TV+SVG+ N  N AVK +AIW
Sbjct  315   FRDQVMQIFRALSQPQLLMYSATISPEVEKMAGTMVKDVTVVSVGKPNTSNKAVKHIAIW  374

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE+KQKKQKLFD+L SKQH+KPP +V+VGSRLGADLL+ AI + TG+KA+S+HGEKSMK+
Sbjct  375   VETKQKKQKLFDVLMSKQHFKPPAVVYVGSRLGADLLADAIAVKTGMKALSMHGEKSMKE  434

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             RREI++ F +G+ PVIVATG+LGRGVDLL V+QVI+FDMPNSIKEYVHQ+GRAS++GEEG
Sbjct  435   RREIMQLFFMGECPVIVATGILGRGVDLLGVRQVIIFDMPNSIKEYVHQVGRASKLGEEG  494

Query  657   TSIV  646
             T++V
Sbjct  495   TAVV  498



>ref|NP_974208.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
 ref|NP_001030621.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
 sp|Q3EBD3.1|RH41_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis 
thaliana]
 gb|AEE73756.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
 gb|AEE73758.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
Length=505

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/522 (62%), Positives = 414/522 (79%), Gaps = 28/522 (5%)
 Frame = -1

Query  2052  PSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK  1873
             P  SD    VK++S +QR  L  EPKCVIC RYGEYICDET+DD+CSLECK  LL R++ 
Sbjct  8     PHNSDV---VKQKSIDQRAPLSGEPKCVICSRYGEYICDETNDDVCSLECKQALLRRVDS  64

Query  1872  SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD--LVSPP  1699
             +R          FPATD+C+YVRD          +S  A+LLRRKL+I V+G    V PP
Sbjct  65    ARV---------FPATDECFYVRDPGS-------SSHDAQLLRRKLDIHVQGQGSAVPPP  108

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             +++F SC +P KLL NLE AGY+ PTP+QMQAIPAAL G+SLL SA+TGSGKT SFL+PI
Sbjct  109   VLTFTSCGLPPKLLLNLETAGYDFPTPIQMQAIPAALTGKSLLASADTGSGKTASFLVPI  168

Query  1518  VAN-TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMAR  1342
             ++  T   +   S++++ PLAM+LAPTRELC+Q+E+QAK+LGKG+PFKTALVVGGD M+ 
Sbjct  169   ISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFKTALVVGGDPMSG  228

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             QLYR++ GV LI+GTPGR++DLL+K  IELD++  FV+DEVDCMLQRGF +QVMQIF+AL
Sbjct  229   QLYRIQQGVELIIGTPGRVVDLLSKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQAL  288

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
             SQPQ+L++SATISREVEK+  S+AK + ++S+G  NKPN AV QLAIWV++KQKKQKLFD
Sbjct  289   SQPQVLLFSATISREVEKVGGSLAKEIILVSIGNPNKPNKAVNQLAIWVDAKQKKQKLFD  348

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL S+ H+KPP +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL G+
Sbjct  349   ILRSQNHFKPPAVVYVSSRVGADLLANAITVVTGVKALSIHGEKPMKERRDVMGSFLGGE  408

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             VPV+V+TGVLGRGVDLL V+QVIVFDMP++IKEY+H IGRASRMGE+GT+IVF+NE+++ 
Sbjct  409   VPVLVSTGVLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTAIVFVNEDDRN  468

Query  621   LFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             LFP+LV  LKSSGAAIP EL N        S   H K+R+ G
Sbjct  469   LFPDLVAALKSSGAAIPKELINLT------SREMHNKKRRVG  504



>ref|XP_004951531.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X1 [Setaria italica]
 ref|XP_004951532.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Setaria italica]
Length=539

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/535 (60%), Positives = 424/535 (79%), Gaps = 7/535 (1%)
 Frame = -1

Query  2106  GSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETD  1927
             G  +A +  +V+A+++N+      D  VK+R +EQREALP EP+CV+CGRYGEYICDETD
Sbjct  4     GENQAADNLLVSASDNNELQ----DLPVKERCFEQREALPGEPRCVVCGRYGEYICDETD  59

Query  1926  DDICSLECKTILLSRIE-KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAEL  1750
             DDICS+ECKTILL+R+  K++        V  P  D+ + ++D +   +   LA  +   
Sbjct  60    DDICSVECKTILLARVAAKTKSAVKAAKRVNLPLGDESFCIKDTNF-PDIPTLADRRISA  118

Query  1749  LRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLL  1570
             LR KL+I VKGD V  PIM F SC +P KL+ NLE AGY MPTPVQMQ IPA++  RSLL
Sbjct  119   LRSKLDICVKGDAVPDPIMCFSSCGLPEKLVHNLETAGYCMPTPVQMQVIPASMSNRSLL  178

Query  1569  VSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKG  1390
             VSA+TGSGKT SFLIPI+A+  ++       K+ PLA++LAPTRELC+Q+EEQAKVLGKG
Sbjct  179   VSADTGSGKTASFLIPIIAHCSQVRSQECTSKRGPLAIVLAPTRELCLQVEEQAKVLGKG  238

Query  1389  MPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCM  1210
             +PFKTALVVGGD +A+Q+YR+E+G+ LIVG+PGRLIDLL K  ++L  VS+FV+DEVDC+
Sbjct  239   LPFKTALVVGGDPLAQQIYRIENGIELIVGSPGRLIDLLMKHNVDLTDVSVFVLDEVDCL  298

Query  1209  LQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             LQRGF +Q +QIF++LS PQ++M+SAT+  EVEKM++S+AK +  IS G  ++PN +VKQ
Sbjct  299   LQRGFRDQALQIFQSLSNPQVMMFSATLHSEVEKMSNSLAKAVIRISCGNPSRPNKSVKQ  358

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSIHGEK
Sbjct  359   VVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSIHGEK  418

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +M +RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GRASRM
Sbjct  419   TMNERRESLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDIPNSIDEYIHQVGRASRM  478

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             GEEG +IVF+NEE++++F ELV +LK++GA +P ELANS+Y+ G  S+G  +KR+
Sbjct  479   GEEGMAIVFVNEEDRRIFKELVPVLKTAGAPVPRELANSRYTAG-VSLGCERKRK  532



>ref|XP_002884245.1| DEAD/DEAH box helicase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60504.1| DEAD/DEAH box helicase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/521 (62%), Positives = 405/521 (78%), Gaps = 27/521 (5%)
 Frame = -1

Query  2052  PSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK  1873
             P  SD    VK++S +QR  LP EPKCVIC RYGEYICDET+DD+CSLECK  LL R++K
Sbjct  8     PHNSDV---VKQKSIDQRAPLPGEPKCVICSRYGEYICDETNDDVCSLECKQTLLRRVDK  64

Query  1872  SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD--LVSPP  1699
             +           FPATD+C+YVRD          +   A+LLRRKL+I V+G    V PP
Sbjct  65    A---------TVFPATDECFYVRDPGS-------SFPDAQLLRRKLDIHVQGQEATVPPP  108

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             +++F SC +P KLL NLE AGY+ PTP+QMQAIPAAL G SLL SA+TGSGKT SFL+PI
Sbjct  109   VLTFASCGLPPKLLLNLETAGYDFPTPIQMQAIPAALSGNSLLASADTGSGKTASFLVPI  168

Query  1518  VANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQ  1339
             ++            ++ PLAM+LAPTRELC+QIE QAKVLGKG+PFKTALVVGGD M+ Q
Sbjct  169   ISRCTTYRSEHPSDQRNPLAMVLAPTRELCVQIENQAKVLGKGLPFKTALVVGGDPMSGQ  228

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALS  1159
             LYR++ GV LI+GTPGR++DLL K  IELD++  FV+DEVDCMLQRGF + VMQIF+ALS
Sbjct  229   LYRIQQGVELIIGTPGRVVDLLVKHAIELDNIMTFVLDEVDCMLQRGFRDLVMQIFQALS  288

Query  1158  QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDI  979
             QPQ+L++SAT+SREVEK+  S+AK + ++S+G  NKPN AV QLAIWV++KQKKQKLFDI
Sbjct  289   QPQVLLFSATVSREVEKVGGSLAKEIILVSIGNPNKPNKAVNQLAIWVDAKQKKQKLFDI  348

Query  978   LTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDV  799
             L S+ H+KPP +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL GDV
Sbjct  349   LRSQNHFKPPAVVYVSSRVGADLLANAITVVTGVKALSIHGEKPMKERRDVMGSFLGGDV  408

Query  798   PVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKL  619
             PV+V+TGVLGRGVDLL V+QVIVFDMP++IKEY+H IGRASRMGE+GT+I+F+NEE++ L
Sbjct  409   PVLVSTGVLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTAILFVNEEDRNL  468

Query  618   FPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             FP+LV  LKSSGAAIP EL N        S   H K+R+ G
Sbjct  469   FPDLVAALKSSGAAIPKELINLT------SKEMHNKKRRVG  503



>gb|AFW70669.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW70670.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=539

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/539 (60%), Positives = 422/539 (78%), Gaps = 13/539 (2%)
 Frame = -1

Query  2118  NHSSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             N S+ SF      +V+++++N+      D  VK+R +EQREALP EP+CV+CGRYGEYIC
Sbjct  6     NQSADSF------VVSSSDNNELE----DLPVKERCFEQREALPGEPRCVVCGRYGEYIC  55

Query  1938  DETDDDICSLECKTILLSRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
             D+TDDDICS+ECKTILLSRI    KP       V  P  D+ + ++D +  +    LA  
Sbjct  56    DQTDDDICSVECKTILLSRIVAKTKPAVKAAKRVNLPLGDESFCIKDINFPN-ILTLADS  114

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             +   LR KL+I VKGD V  PIM F +C +P KL+ NLE AGY MPTPVQMQ IPA++  
Sbjct  115   RISSLRSKLDICVKGDAVPDPIMCFSACGLPEKLVHNLETAGYCMPTPVQMQVIPASMSN  174

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             RSLLVSA+TGSGKT SFLIPI+A+  +L        Q PLA++LAPTRELC+Q+EEQAKV
Sbjct  175   RSLLVSADTGSGKTASFLIPIIAHCSRLRSQECTGNQGPLAIVLAPTRELCLQVEEQAKV  234

Query  1401  LGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDE  1222
             LGKG+PFKTAL+VGGD + +Q+YR+E+GV LIVGTPGRLIDLL K  ++L  VS+FV+DE
Sbjct  235   LGKGLPFKTALIVGGDPLPQQIYRIENGVELIVGTPGRLIDLLMKHNVDLTYVSVFVLDE  294

Query  1221  VDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNG  1042
             VDC+L+RGF +Q MQIF++LS PQ++M+SATI  EVEKM++S+A ++  IS G  N+PN 
Sbjct  295   VDCLLERGFRDQAMQIFQSLSHPQVMMFSATIHSEVEKMSNSLANNVISISCGNPNRPNK  354

Query  1041  AVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSI  862
              VKQ+ IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSI
Sbjct  355   LVKQVVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSI  414

Query  861   HGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGR  682
             HGEK+M +RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GR
Sbjct  415   HGEKTMIERRENLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDLPNSIDEYIHQVGR  474

Query  681   ASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ASRMGEEG ++VF+NEE++++F ELV++LK++GA IP E+ANS+Y+ G + VG  +KR+
Sbjct  475   ASRMGEEGMAVVFVNEEDRRIFKELVQVLKTAGAPIPREIANSRYTAGVY-VGSERKRK  532



>ref|XP_008645381.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X3 
[Zea mays]
Length=536

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/539 (60%), Positives = 422/539 (78%), Gaps = 13/539 (2%)
 Frame = -1

Query  2118  NHSSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             N S+ SF      +V+++++N+      D  VK+R +EQREALP EP+CV+CGRYGEYIC
Sbjct  6     NQSADSF------VVSSSDNNELE----DLPVKERCFEQREALPGEPRCVVCGRYGEYIC  55

Query  1938  DETDDDICSLECKTILLSRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
             D+TDDDICS+ECKTILLSRI    KP       V  P  D+ + ++D +  +    LA  
Sbjct  56    DQTDDDICSVECKTILLSRIVAKTKPAVKAAKRVNLPLGDESFCIKDINFPN-ILTLADS  114

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             +   LR KL+I VKGD V  PIM F +C +P KL+ NLE AGY MPTPVQMQ IPA++  
Sbjct  115   RISSLRSKLDICVKGDAVPDPIMCFSACGLPEKLVHNLETAGYCMPTPVQMQVIPASMSN  174

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             RSLLVSA+TGSGKT SFLIPI+A+  +L        Q PLA++LAPTRELC+Q+EEQAKV
Sbjct  175   RSLLVSADTGSGKTASFLIPIIAHCSRLRSQECTGNQGPLAIVLAPTRELCLQVEEQAKV  234

Query  1401  LGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDE  1222
             LGKG+PFKTAL+VGGD + +Q+YR+E+GV LIVGTPGRLIDLL K  ++L  VS+FV+DE
Sbjct  235   LGKGLPFKTALIVGGDPLPQQIYRIENGVELIVGTPGRLIDLLMKHNVDLTYVSVFVLDE  294

Query  1221  VDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNG  1042
             VDC+L+RGF +Q MQIF++LS PQ++M+SATI  EVEKM++S+A ++  IS G  N+PN 
Sbjct  295   VDCLLERGFRDQAMQIFQSLSHPQVMMFSATIHSEVEKMSNSLANNVISISCGNPNRPNK  354

Query  1041  AVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSI  862
              VKQ+ IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSI
Sbjct  355   LVKQVVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSI  414

Query  861   HGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGR  682
             HGEK+M +RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GR
Sbjct  415   HGEKTMIERRENLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDLPNSIDEYIHQVGR  474

Query  681   ASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ASRMGEEG ++VF+NEE++++F ELV++LK++GA IP E+ANS+Y+ G + VG  +KR+
Sbjct  475   ASRMGEEGMAVVFVNEEDRRIFKELVQVLKTAGAPIPREIANSRYTAGVY-VGSERKRK  532



>dbj|BAH19831.1| AT3G02065 [Arabidopsis thaliana]
Length=505

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/522 (62%), Positives = 414/522 (79%), Gaps = 28/522 (5%)
 Frame = -1

Query  2052  PSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK  1873
             P  SD    VK++S +QR  L  EPKCVIC RYGEYICDET+DD+CSLECK  LL R++ 
Sbjct  8     PHNSDV---VKQKSIDQRAPLSGEPKCVICSRYGEYICDETNDDVCSLECKQALLRRVDS  64

Query  1872  SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG--DLVSPP  1699
             +R          FPATD+C+YVRD          +S  A+LLRRKL+I V+G    V PP
Sbjct  65    ARV---------FPATDECFYVRDPGS-------SSHDAQLLRRKLDIHVQGQGSAVPPP  108

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             +++F SC +P KLL NLE AGY+ PTP+QMQAIPAAL G+SLL SA+TGSGKT SFL+PI
Sbjct  109   VLTFTSCGLPPKLLLNLETAGYDFPTPIQMQAIPAALTGKSLLASADTGSGKTASFLVPI  168

Query  1518  VAN-TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMAR  1342
             ++  T   +   S++++ PLAM+LAPTRELC+Q+E+QAK+LGKG+PFKTALVVGGD M+ 
Sbjct  169   ISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFKTALVVGGDPMSG  228

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             QLYR++ GV LI+GTPGR++DLL+K  IELD++  FV+DEVDCMLQRGF +QVMQIF+AL
Sbjct  229   QLYRIQQGVELIIGTPGRVVDLLSKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQAL  288

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
             SQPQ+L++SATISREVEK+  S+AK + ++S+G  NKP+ AV QLAIWV++KQKKQKLFD
Sbjct  289   SQPQVLLFSATISREVEKVGGSLAKEIILVSIGNPNKPDKAVNQLAIWVDAKQKKQKLFD  348

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL S+ H+KPP +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL G+
Sbjct  349   ILRSQNHFKPPAVVYVSSRVGADLLANAITVVTGVKALSIHGEKPMKERRDVMGSFLGGE  408

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             VPV+V+TGVLGRGVDLL V+QVIVFDMP++IKEY+H IGRASRMGE+GT+IVF+NE+++ 
Sbjct  409   VPVLVSTGVLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTTIVFVNEDDRN  468

Query  621   LFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             LFP+LV  LKSSGAAIP EL N        S   H K+R+ G
Sbjct  469   LFPDLVAALKSSGAAIPKELINLT------SREMHNKKRRVG  504



>ref|XP_008645376.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Zea mays]
 ref|XP_008645377.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Zea mays]
 ref|XP_008645378.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Zea mays]
 ref|XP_008645379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X1 
[Zea mays]
Length=563

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/569 (58%), Positives = 433/569 (76%), Gaps = 16/569 (3%)
 Frame = -1

Query  2118  NHSSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             N S+ SF      +V+++++N+      D  VK+R +EQREALP EP+CV+CGRYGEYIC
Sbjct  6     NQSADSF------VVSSSDNNELE----DLPVKERCFEQREALPGEPRCVVCGRYGEYIC  55

Query  1938  DETDDDICSLECKTILLSRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
             D+TDDDICS+ECKTILLSRI    KP       V  P  D+ + ++D +  +    LA  
Sbjct  56    DQTDDDICSVECKTILLSRIVAKTKPAVKAAKRVNLPLGDESFCIKDINFPN-ILTLADS  114

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             +   LR KL+I VKGD V  PIM F +C +P KL+ NLE AGY MPTPVQMQ IPA++  
Sbjct  115   RISSLRSKLDICVKGDAVPDPIMCFSACGLPEKLVHNLETAGYCMPTPVQMQVIPASMSN  174

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             RSLLVSA+TGSGKT SFLIPI+A+  +L        Q PLA++LAPTRELC+Q+EEQAKV
Sbjct  175   RSLLVSADTGSGKTASFLIPIIAHCSRLRSQECTGNQGPLAIVLAPTRELCLQVEEQAKV  234

Query  1401  LGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDE  1222
             LGKG+PFKTAL+VGGD + +Q+YR+E+GV LIVGTPGRLIDLL K  ++L  VS+FV+DE
Sbjct  235   LGKGLPFKTALIVGGDPLPQQIYRIENGVELIVGTPGRLIDLLMKHNVDLTYVSVFVLDE  294

Query  1221  VDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNG  1042
             VDC+L+RGF +Q MQIF++LS PQ++M+SATI  EVEKM++S+A ++  IS G  N+PN 
Sbjct  295   VDCLLERGFRDQAMQIFQSLSHPQVMMFSATIHSEVEKMSNSLANNVISISCGNPNRPNK  354

Query  1041  AVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSI  862
              VKQ+ IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSI
Sbjct  355   LVKQVVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSI  414

Query  861   HGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGR  682
             HGEK+M +RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GR
Sbjct  415   HGEKTMIERRENLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDLPNSIDEYIHQVGR  474

Query  681   ASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             ASRMGEEG ++VF+NEE++++F ELV++LK++GA IP E+ANS+Y+ G + VG  +KR+ 
Sbjct  475   ASRMGEEGMAVVFVNEEDRRIFKELVQVLKTAGAPIPREIANSRYTAGVY-VGSERKRKL  533

Query  501   YGT*SRFICFISCTPILILV---QFSKIT  424
                  R   F+     ++L    +FS IT
Sbjct  534   SSRFGRINVFLERLLAIVLSAKRRFSGIT  562



>ref|XP_008645380.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X2 
[Zea mays]
Length=553

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/539 (60%), Positives = 422/539 (78%), Gaps = 13/539 (2%)
 Frame = -1

Query  2118  NHSSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             N S+ SF      +V+++++N+      D  VK+R +EQREALP EP+CV+CGRYGEYIC
Sbjct  6     NQSADSF------VVSSSDNNELE----DLPVKERCFEQREALPGEPRCVVCGRYGEYIC  55

Query  1938  DETDDDICSLECKTILLSRIEKSRKP-TPCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
             D+TDDDICS+ECKTILLSRI    KP       V  P  D+ + ++D +  +    LA  
Sbjct  56    DQTDDDICSVECKTILLSRIVAKTKPAVKAAKRVNLPLGDESFCIKDINFPN-ILTLADS  114

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             +   LR KL+I VKGD V  PIM F +C +P KL+ NLE AGY MPTPVQMQ IPA++  
Sbjct  115   RISSLRSKLDICVKGDAVPDPIMCFSACGLPEKLVHNLETAGYCMPTPVQMQVIPASMSN  174

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             RSLLVSA+TGSGKT SFLIPI+A+  +L        Q PLA++LAPTRELC+Q+EEQAKV
Sbjct  175   RSLLVSADTGSGKTASFLIPIIAHCSRLRSQECTGNQGPLAIVLAPTRELCLQVEEQAKV  234

Query  1401  LGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDE  1222
             LGKG+PFKTAL+VGGD + +Q+YR+E+GV LIVGTPGRLIDLL K  ++L  VS+FV+DE
Sbjct  235   LGKGLPFKTALIVGGDPLPQQIYRIENGVELIVGTPGRLIDLLMKHNVDLTYVSVFVLDE  294

Query  1221  VDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNG  1042
             VDC+L+RGF +Q MQIF++LS PQ++M+SATI  EVEKM++S+A ++  IS G  N+PN 
Sbjct  295   VDCLLERGFRDQAMQIFQSLSHPQVMMFSATIHSEVEKMSNSLANNVISISCGNPNRPNK  354

Query  1041  AVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSI  862
              VKQ+ IWVESK+KKQK+F+I+ SKQH+KPP +VFV SR+GADLLS AIT++TGL+ VSI
Sbjct  355   LVKQVVIWVESKKKKQKIFEIMKSKQHFKPPAVVFVSSRVGADLLSEAITVATGLEVVSI  414

Query  861   HGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGR  682
             HGEK+M +RRE LR FL G+V V+V+TGVLGRG+DLL V+QVI+FD+PNSI EY+HQ+GR
Sbjct  415   HGEKTMIERRENLRRFLTGEVSVVVSTGVLGRGMDLLKVRQVILFDLPNSIDEYIHQVGR  474

Query  681   ASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ASRMGEEG ++VF+NEE++++F ELV++LK++GA IP E+ANS+Y+ G + VG  +KR+
Sbjct  475   ASRMGEEGMAVVFVNEEDRRIFKELVQVLKTAGAPIPREIANSRYTAGVY-VGSERKRK  532



>sp|Q0E2Z7.2|RH41_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 41 [Oryza sativa 
Japonica Group]
 dbj|BAD15860.1| putative DEAD box [Oryza sativa Japonica Group]
 dbj|BAG92939.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99943.1| unnamed protein product [Oryza sativa Japonica Group]
Length=536

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/522 (62%), Positives = 413/522 (79%), Gaps = 5/522 (1%)
 Frame = -1

Query  2061  SNQPSGSDS--DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             S QP   +   +S VK+R +EQREAL  EP+CVICGRYGEYICD+TDDDICS+ECKTILL
Sbjct  13    SAQPGNGNELEESSVKERCFEQREALVGEPRCVICGRYGEYICDQTDDDICSVECKTILL  72

Query  1887  SRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             S++    +P       V  P  D+ + +RD++   +   +   Q   LR KL+I VKG+ 
Sbjct  73    SKLSAETRPVVKAAKRVNLPVGDESFCIRDENF-PKIPSMHDGQIASLRSKLDICVKGED  131

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V  PIM F S  +P KL+ NLEAAGY MPTPVQMQ IP+++  RSLLVSA+TGSGKT SF
Sbjct  132   VPDPIMCFSSSGLPEKLVLNLEAAGYVMPTPVQMQVIPSSICNRSLLVSADTGSGKTASF  191

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             L+PI+A+   +       KQ PLA++LAPTRELC+Q+EEQAKVLGKG+PFKTALVVGGD 
Sbjct  192   LVPIIAHCSHVRSERCTDKQGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKTALVVGGDP  251

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +A+Q+YR+E+G+ LIVGTPGRLIDLL K  ++L+ V +FV+DEVDC+L+RGF +QVMQIF
Sbjct  252   LAQQIYRIENGIELIVGTPGRLIDLLMKHNVDLNKVDVFVLDEVDCLLERGFRDQVMQIF  311

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             +ALS PQ++M+SAT++ EVEKM++S+AK+   IS G  ++PN +VKQ+ IWVESKQKKQK
Sbjct  312   QALSHPQVMMFSATVNSEVEKMSNSLAKNAIHISCGNPSRPNKSVKQVVIWVESKQKKQK  371

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             +F+I+TSKQH+KPP +VFV SR+GADLLS AIT++TGLK VSIHG+K+M +RRE LR FL
Sbjct  372   IFEIMTSKQHFKPPAVVFVSSRIGADLLSEAITVATGLKVVSIHGDKTMNERRESLRRFL  431

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
              G+V V+V TGVLGRG+DLL V+QVI+FDMPNSI EYVHQ+GRASRMG EG +IVF+NEE
Sbjct  432   TGEVSVVVCTGVLGRGMDLLKVRQVILFDMPNSIDEYVHQVGRASRMGVEGMAIVFVNEE  491

Query  630   NKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ++ LF ELV+ILK++GA IP ELANSKY+ G   +G  +KR+
Sbjct  492   DRNLFRELVQILKTAGAPIPRELANSKYTTG-IPLGGGKKRK  532



>gb|EEE56516.1| hypothetical protein OsJ_05798 [Oryza sativa Japonica Group]
Length=648

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/522 (62%), Positives = 413/522 (79%), Gaps = 5/522 (1%)
 Frame = -1

Query  2061  SNQPSGSDS--DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             S QP   +   +S VK+R +EQREAL  EP+CVICGRYGEYICD+TDDDICS+ECKTILL
Sbjct  58    SAQPGNGNELEESSVKERCFEQREALVGEPRCVICGRYGEYICDQTDDDICSVECKTILL  117

Query  1887  SRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             S++    +P       V  P  D+ + +RD++   +   +   Q   LR KL+I VKG+ 
Sbjct  118   SKLSAETRPVVKAAKRVNLPVGDESFCIRDENF-PKIPSMHDGQIASLRSKLDICVKGED  176

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V  PIM F S  +P KL+ NLEAAGY MPTPVQMQ IP+++  RSLLVSA+TGSGKT SF
Sbjct  177   VPDPIMCFSSSGLPEKLVLNLEAAGYVMPTPVQMQVIPSSICNRSLLVSADTGSGKTASF  236

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             L+PI+A+   +       KQ PLA++LAPTRELC+Q+EEQAKVLGKG+PFKTALVVGGD 
Sbjct  237   LVPIIAHCSHVRSERCTDKQGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKTALVVGGDP  296

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +A+Q+YR+E+G+ LIVGTPGRLIDLL K  ++L+ V +FV+DEVDC+L+RGF +QVMQIF
Sbjct  297   LAQQIYRIENGIELIVGTPGRLIDLLMKHNVDLNKVDVFVLDEVDCLLERGFRDQVMQIF  356

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             +ALS PQ++M+SAT++ EVEKM++S+AK+   IS G  ++PN +VKQ+ IWVESKQKKQK
Sbjct  357   QALSHPQVMMFSATVNSEVEKMSNSLAKNAIHISCGNPSRPNKSVKQVVIWVESKQKKQK  416

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             +F+I+TSKQH+KPP +VFV SR+GADLLS AIT++TGLK VSIHG+K+M +RRE LR FL
Sbjct  417   IFEIMTSKQHFKPPAVVFVSSRIGADLLSEAITVATGLKVVSIHGDKTMNERRESLRRFL  476

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
              G+V V+V TGVLGRG+DLL V+QVI+FDMPNSI EYVHQ+GRASRMG EG +IVF+NEE
Sbjct  477   TGEVSVVVCTGVLGRGMDLLKVRQVILFDMPNSIDEYVHQVGRASRMGVEGMAIVFVNEE  536

Query  630   NKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ++ LF ELV+ILK++GA IP ELANSKY+ G   +G  +KR+
Sbjct  537   DRNLFRELVQILKTAGAPIPRELANSKYTTG-IPLGGGKKRK  577



>gb|EEC72698.1| hypothetical protein OsI_06281 [Oryza sativa Indica Group]
Length=648

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/522 (62%), Positives = 413/522 (79%), Gaps = 5/522 (1%)
 Frame = -1

Query  2061  SNQPSGSDS--DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             S QP   +   +S VK+R +EQREAL  EP+CVICGRYGEYICD+TDDDICS+ECKTILL
Sbjct  58    SAQPGNGNELEESSVKERCFEQREALVGEPRCVICGRYGEYICDQTDDDICSVECKTILL  117

Query  1887  SRIEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDL  1711
             S++    +P       V  P  D+ + +RD++   +   +   Q   LR KL+I VKG+ 
Sbjct  118   SKLSAETRPVVKAAKRVNLPVGDESFCIRDENF-PKIPSMHDGQIASLRSKLDICVKGED  176

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V  PIM F S  +P KL+ NLEAAGY MPTPVQMQ IP+++  RSLLVSA+TGSGKT SF
Sbjct  177   VPDPIMCFSSSGLPEKLVLNLEAAGYVMPTPVQMQVIPSSICNRSLLVSADTGSGKTASF  236

Query  1530  LIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDA  1351
             L+PI+A+   +       KQ PLA++LAPTRELC+Q+EEQAKVLGKG+PFKTALVVGGD 
Sbjct  237   LVPIIAHCSHVRSERCTDKQGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKTALVVGGDP  296

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +A+Q+YR+E+G+ LIVGTPGRLIDLL K  ++L+ V +FV+DEVDC+L+RGF +QVMQIF
Sbjct  297   LAQQIYRIENGIELIVGTPGRLIDLLMKHNVDLNKVDVFVLDEVDCLLERGFRDQVMQIF  356

Query  1170  RALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQK  991
             +ALS PQ++M+SAT++ EVEKM++S+AK+   IS G  ++PN +VKQ+ IWVESKQKKQK
Sbjct  357   QALSHPQVMMFSATVNSEVEKMSNSLAKNAIHISCGNPSRPNKSVKQVVIWVESKQKKQK  416

Query  990   LFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFL  811
             +F+I+TSKQH+KPP +VFV SR+GADLLS AIT++TGLK VSIHG+K+M +RRE LR FL
Sbjct  417   IFEIMTSKQHFKPPAVVFVSSRIGADLLSEAITVATGLKVVSIHGDKTMNERRESLRRFL  476

Query  810   VGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEE  631
              G+V V+V TGVLGRG+DLL V+QVI+FDMPNSI EYVHQ+GRASRMG EG +IVF+NEE
Sbjct  477   TGEVSVVVCTGVLGRGMDLLKVRQVILFDMPNSIDEYVHQVGRASRMGVEGMAIVFVNEE  536

Query  630   NKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             ++ LF ELV+ILK++GA IP ELANSKY+ G   +G  +KR+
Sbjct  537   DRNLFRELVQILKTAGAPIPRELANSKYTTG-IPLGGGKKRK  577



>ref|XP_006647045.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like [Oryza 
brachyantha]
Length=539

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/520 (61%), Positives = 412/520 (79%), Gaps = 5/520 (1%)
 Frame = -1

Query  2055  QPSGSDS--DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSR  1882
             QP+  +   +S +K+R +EQREAL  EP+CVICGRYGEYICD+TDDDICS+ECKTILLSR
Sbjct  15    QPANCNELEESPIKERCFEQREALLGEPRCVICGRYGEYICDQTDDDICSVECKTILLSR  74

Query  1881  IEKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVS  1705
             +    KP       V  P  D+ + +RD +   +   +   Q   LR KL+I VKG+ V 
Sbjct  75    LSAETKPAVKAVKRVNLPVGDESFCIRDKNF-PKIPSMHDGQISSLRSKLDIRVKGEDVP  133

Query  1704  PPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLI  1525
              PIM F S  +P +L+ NLEAAGY MPTPVQMQ IPA++  RSLLVSA+TGSGKT SFL+
Sbjct  134   DPIMCFSSSGLPERLVLNLEAAGYVMPTPVQMQVIPASICNRSLLVSADTGSGKTASFLV  193

Query  1524  PIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMA  1345
             PI+A+  +  L     KQ PLA++LAPTRELC+Q+EEQAKVL KG+PFKTALVVGGD +A
Sbjct  194   PIIAHCSQARLHECTDKQGPLAIVLAPTRELCLQVEEQAKVLAKGLPFKTALVVGGDPLA  253

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRA  1165
             +Q+YR+E+G+ LIVGTPGRLIDLL K   +L++VS+FV+DEVDC+L+RGF +Q MQIF+A
Sbjct  254   QQIYRIENGIELIVGTPGRLIDLLMKHNADLNNVSIFVLDEVDCLLERGFRDQAMQIFQA  313

Query  1164  LSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLF  985
             LS PQ++M+SAT++ EVEKM++S+A+++  IS G  +KPN +VKQ+ IWVESKQKKQKLF
Sbjct  314   LSHPQVMMFSATVNSEVEKMSNSLARNVIHISCGNPSKPNNSVKQVVIWVESKQKKQKLF  373

Query  984   DILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVG  805
             +I+TSKQH+KPP +VFV SR+GADLLS  IT++TGL+ +SIHG+K+M +RRE LR FL G
Sbjct  374   EIMTSKQHFKPPAVVFVNSRVGADLLSEVITVATGLEVLSIHGDKTMNERRESLRRFLKG  433

Query  804   DVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENK  625
             +V V+V TGVLGRG+DLL V+QVI+FDMPNSI EYVHQ+GRASRMG EG +IVF+N+E++
Sbjct  434   EVSVVVCTGVLGRGMDLLKVRQVILFDMPNSINEYVHQVGRASRMGVEGMAIVFVNDEDR  493

Query  624   KLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
              LF ELV+++K++GA IP ELANSKY+ G   +G  +KR+
Sbjct  494   NLFRELVQVMKTAGAPIPRELANSKYTTG-IPLGSGKKRK  532



>ref|XP_006408578.1| hypothetical protein EUTSA_v10020567mg [Eutrema salsugineum]
 ref|XP_006408579.1| hypothetical protein EUTSA_v10020567mg [Eutrema salsugineum]
 gb|ESQ50031.1| hypothetical protein EUTSA_v10020567mg [Eutrema salsugineum]
 gb|ESQ50032.1| hypothetical protein EUTSA_v10020567mg [Eutrema salsugineum]
Length=502

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/510 (61%), Positives = 404/510 (79%), Gaps = 22/510 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             +K++S +QR  L  EP CVICGRYGEYICDE++DDICSL+CK  +L+R++ +R       
Sbjct  14    IKQKSIDQRPPLLGEPICVICGRYGEYICDESNDDICSLQCKQTVLTRVDNTRV------  67

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPR  1666
                FPATD+C+YVR+          +   A+LLR KL+I V+G LV PP+++F SC +P 
Sbjct  68    ---FPATDECFYVREPGS-------SFTDAQLLRSKLDIHVQGALVPPPVLTFSSCGLPP  117

Query  1665  KLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLAC  1486
             KLL NLE AGY+ PTP+QMQAIPAAL G+SLL SA+TGSGKT SFL+PIV+   +     
Sbjct  118   KLLLNLETAGYDFPTPIQMQAIPAALSGKSLLASADTGSGKTASFLVPIVSRCTRYRSEH  177

Query  1485  SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLI  1306
                ++ PLAM+LAPTRELC+Q+E QAK+LGKG+PFKTALVVGGD M+ QLYR++ GV LI
Sbjct  178   PSDQKSPLAMVLAPTRELCVQVEYQAKMLGKGLPFKTALVVGGDPMSGQLYRIQQGVELI  237

Query  1305  VGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATI  1126
             +GTPGR +DLLTK  I+LDS++MFV+DEVDC+LQRGF +QVMQIF AL QPQ+L++SAT+
Sbjct  238   IGTPGRFVDLLTKHAIKLDSITMFVLDEVDCLLQRGFRDQVMQIFWALPQPQVLLFSATL  297

Query  1125  SREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPV  946
             SREVEK+  S+AK + ++++G+ N+PN AV QLAIWV++KQKKQKLF+IL S+ H+KPP 
Sbjct  298   SREVEKVGGSLAKEMVLVTIGKSNRPNKAVNQLAIWVDAKQKKQKLFEILRSQNHFKPPA  357

Query  945   IVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGR  766
             +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL G+VPV+V+TGVLGR
Sbjct  358   VVYVSSRVGADLLANAITVVTGIKALSIHGEKPMKERRDVMGSFLGGEVPVLVSTGVLGR  417

Query  765   GVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSS  586
             GVDLL V+QVIVFDMPN+IKEY+H IGRASRMG++G++I+F+NE+++ LFP+L   LKS 
Sbjct  418   GVDLLVVRQVIVFDMPNTIKEYIHVIGRASRMGDQGSAILFVNEDSRNLFPDLAAALKSC  477

Query  585   GAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             GAAIP EL N        S   H K+R+ G
Sbjct  478   GAAIPKELINFT------SKEMHNKKRRVG  501



>ref|XP_010553222.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Tarenaya hassleriana]
 ref|XP_010553231.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Tarenaya hassleriana]
Length=497

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/507 (63%), Positives = 399/507 (79%), Gaps = 27/507 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             +K++S +QR  LP +PKCVIC RYGEYICDETDDDICSLECK  LL R+E          
Sbjct  15    IKQKSVDQRAPLPGDPKCVICSRYGEYICDETDDDICSLECKQRLLRRLEA---------  65

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPR  1666
                 P +D+C+YVRDDD          D A+LLR ++ I VKG  V PP +SF S  +P 
Sbjct  66    ---IPVSDECFYVRDDD----------DDAQLLRSRIEIDVKGGTVPPPALSFDSFGLPS  112

Query  1665  KLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLAC  1486
              L  NLE AGY +PTP+QMQAIPAAL G++LLVSA TGSGKT SFL+PIV+         
Sbjct  113   MLRLNLETAGYRIPTPIQMQAIPAALTGKNLLVSASTGSGKTVSFLVPIVSRCASFRSEH  172

Query  1485  SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLI  1306
                 +  LA++L PTRELCIQ+EEQAK+LGKG+PFKTALVVGGD M+RQLYR++ GV LI
Sbjct  173   PSVPKGLLAIVLTPTRELCIQVEEQAKMLGKGLPFKTALVVGGDPMSRQLYRIQQGVELI  232

Query  1305  VGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATI  1126
             + TPGRLIDLLTK +IELD V+MFV+DEVDC+LQRGF +QVMQIFRALSQPQ+L+YSATI
Sbjct  233   IATPGRLIDLLTKHDIELDHVTMFVLDEVDCLLQRGFRDQVMQIFRALSQPQVLLYSATI  292

Query  1125  SREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPV  946
             S+EVEK+A+S++K +  +SVG+ N+P+ AV+QL IWVE+K+KKQKLF+IL S+ HYKPP 
Sbjct  293   SKEVEKVAASLSKDMIEVSVGEPNRPSKAVRQLTIWVETKRKKQKLFEILRSQNHYKPPA  352

Query  945   IVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGR  766
             +V+V SR+GADLL+ AIT  TG++A+SIHGEK MKDRR+++  FL G+VPV+V+TG+LGR
Sbjct  353   VVYVSSRIGADLLAEAITTVTGIRALSIHGEKLMKDRRDLMGLFLSGEVPVLVSTGILGR  412

Query  765   GVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSS  586
             GVDLL V+QVIVFDMP++I+EY+HQIGRASR+GEEGT+I+F+NEEN+ LFP+LV ILKS 
Sbjct  413   GVDLLGVRQVIVFDMPDTIEEYIHQIGRASRIGEEGTAILFVNEENRNLFPDLVAILKSY  472

Query  585   GAAIPSELANSKYSVGSFSVGRHQKRR  505
             GA IP EL+N      S   GR++KRR
Sbjct  473   GAPIPRELSN----FASMK-GRNKKRR  494



>ref|XP_006299543.1| hypothetical protein CARUB_v10015716mg, partial [Capsella rubella]
 gb|EOA32441.1| hypothetical protein CARUB_v10015716mg, partial [Capsella rubella]
Length=492

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/492 (62%), Positives = 396/492 (80%), Gaps = 18/492 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK++S +QR  L  EPKCVIC RYGEYICDET+DD+CSLECK  LL R++ +R       
Sbjct  2     VKQKSIDQRAPLSWEPKCVICSRYGEYICDETNDDVCSLECKQTLLRRVDNARV------  55

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD--LVSPPIMSFGSCDV  1672
                FPATD+C+YVRD          +   AELLRRKL I V+G    V PP+++F SC +
Sbjct  56    ---FPATDECFYVRDTGS-------SFPDAELLRRKLEIHVQGQGAAVPPPVLTFTSCGL  105

Query  1671  PRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNL  1492
             P KLL NLE AGY+ PTP+QMQAIPAAL G+SLL SA+TGSGKT SFL+PI++       
Sbjct  106   PPKLLLNLETAGYDFPTPIQMQAIPAALSGKSLLASADTGSGKTASFLVPIISRCTTYRS  165

Query  1491  ACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVS  1312
                  ++ P+AM+LAPTRELC+Q+E+QAK+LGKG+PFKTALVVGGD M+ QLYR++ GV 
Sbjct  166   EYPSDQRSPMAMVLAPTRELCVQVEDQAKMLGKGLPFKTALVVGGDPMSGQLYRIQQGVE  225

Query  1311  LIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSA  1132
             LI+GTPGR++DLL K  IELD++  FV+DEVDCMLQRGF +QVMQIF+ALS+PQ+L++SA
Sbjct  226   LIIGTPGRVVDLLAKHAIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQALSEPQVLLFSA  285

Query  1131  TISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKP  952
             T+S EV+++  S+AK + ++S+G+ NKPN AV QLAIWV++KQKKQKLF+IL S++H+KP
Sbjct  286   TVSNEVKRVGGSLAKEIILVSIGKANKPNKAVNQLAIWVDAKQKKQKLFEILRSQKHFKP  345

Query  951   PVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVL  772
             P +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL G+V V+V+TGVL
Sbjct  346   PAVVYVSSRVGADLLANAITVVTGIKALSIHGEKPMKERRDVMGSFLSGEVSVLVSTGVL  405

Query  771   GRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILK  592
             GRGVDLL V+QVIVFDMPN+I+EY+H IGRASRMGE+GT+I+F+NE+++ LFP+L+  LK
Sbjct  406   GRGVDLLVVRQVIVFDMPNTIREYIHVIGRASRMGEKGTAILFVNEDDRNLFPDLIAALK  465

Query  591   SSGAAIPSELAN  556
             SSGAAIP EL N
Sbjct  466   SSGAAIPKELIN  477



>ref|XP_006852211.1| hypothetical protein AMTR_s00049p00131010 [Amborella trichopoda]
 gb|ERN13678.1| hypothetical protein AMTR_s00049p00131010 [Amborella trichopoda]
Length=535

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/518 (61%), Positives = 400/518 (77%), Gaps = 2/518 (0%)
 Frame = -1

Query  2049  SGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             S  D +S +K RS +QR AL  EP+CVICGRYGEYICDETDDDICS ECK ILL RI  S
Sbjct  17    SDGDEESPIKDRSCDQRGALQGEPRCVICGRYGEYICDETDDDICSKECKQILLKRIRSS  76

Query  1869  R-KPT-PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPI  1696
               KP  P P  ++  A D+C YV D  ++     L S+Q + LR K +I V G  V  PI
Sbjct  77    SPKPIGPSPTVIKLTALDECVYVSDIMQQCSDSSLTSNQIDSLRNKNDIRVLGSSVPAPI  136

Query  1695  MSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIV  1516
             +SF  C++P+KL DNLE+ GY++PTP+QMQ IPAAL+GR+LLV A+TGSGKT S+LIPI+
Sbjct  137   VSFSDCNLPQKLQDNLESLGYDIPTPIQMQVIPAALLGRNLLVLAQTGSGKTASYLIPII  196

Query  1515  ANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQL  1336
             +    +       +++PLA++LAPTRELC Q+EEQAK  GKG+PFKTAL+VGG+ MA Q 
Sbjct  197   SKCYTVRRQRLLDQKRPLAIVLAPTRELCAQVEEQAKAFGKGLPFKTALIVGGNPMASQA  256

Query  1335  YRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQ  1156
             YRV  G+ LIV TPGRL+DLL K E ELD V   VIDEVDCML++GF +QVMQI RALS+
Sbjct  257   YRVGKGIELIVATPGRLVDLLIKHEFELDEVRTLVIDEVDCMLEKGFLDQVMQIVRALSR  316

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
             PQI+M SAT+ REVEK++ SMA+ + VI+VG++N+P+  V+Q+ IWVE+K+KKQKLF IL
Sbjct  317   PQIVMISATLPREVEKLSKSMAEDIVVITVGKVNRPSDTVRQVVIWVETKEKKQKLFQIL  376

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
              S++H+KPP +VFVGSR GADLL+ AI +STGL+A SIHGEK M++RRE LR FL+G++ 
Sbjct  377   KSEKHFKPPAVVFVGSRFGADLLAEAIRVSTGLRASSIHGEKGMRERRESLRMFLLGEMS  436

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             VIVATGVLGRG+DL+ V+QVI+FDMPNS+ EYVH IGRASR+GE G +IVF+NEE+K LF
Sbjct  437   VIVATGVLGRGMDLMGVRQVIIFDMPNSVPEYVHLIGRASRLGEAGEAIVFVNEEDKSLF  496

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              + V +LK SGA IP ELANS +S  S+ VG  QK+RK
Sbjct  497   KDFVRMLKQSGAIIPRELANSPHSQASYQVGSRQKKRK  534



>gb|EMT32669.1| DEAD-box ATP-dependent RNA helicase 41 [Aegilops tauschii]
Length=541

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/511 (63%), Positives = 411/511 (80%), Gaps = 3/511 (1%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRK-PT  1858
             D  VK+R +EQREALP EP+CVICGRYGEYICD+TDDDICS+ECKT LL+RI    K P 
Sbjct  26    DLRVKERCFEQREALPGEPRCVICGRYGEYICDQTDDDICSVECKTALLARIAAETKIPV  85

Query  1857  PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSC  1678
               P  V+ P  D+ + VRD++   +   L + Q   LR KL+I VKG+ +  PIM F SC
Sbjct  86    KAPARVKVPFGDESFCVRDNNF-PDIPSLHASQIASLRNKLDICVKGEAIPDPIMCFSSC  144

Query  1677  DVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKL  1498
              +P KL+ NL+AAGY MPTPVQMQ IPA++  RSLLVSA+TGSGKT SFL+PI+A+  + 
Sbjct  145   GLPEKLVHNLDAAGYTMPTPVQMQVIPASISNRSLLVSADTGSGKTASFLVPIIAHCSRR  204

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHG  1318
              L  SE K+ PLA++LAPTRELC+Q+E+QAKVLGKG+PFKTALVVGGD +A+Q+YR+E+G
Sbjct  205   ELQQSESKRGPLAIVLAPTRELCLQVEDQAKVLGKGLPFKTALVVGGDPLAQQIYRIENG  264

Query  1317  VSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMY  1138
             V LIVGTPGRLIDLL K  ++L  VS+FV+DEVDC+L+RGF +Q MQIFRALS PQ++M+
Sbjct  265   VELIVGTPGRLIDLLMKHNVDLTDVSVFVLDEVDCLLERGFRDQAMQIFRALSCPQVMMF  324

Query  1137  SATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHY  958
             SATI  E+EK+++S+  ++  IS G   KPN +V+Q+ IWVESKQKKQK+F+I+ SKQH+
Sbjct  325   SATIHPEIEKLSNSLLNNMIHISCGNPGKPNKSVRQVVIWVESKQKKQKIFEIIKSKQHF  384

Query  957   KPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATG  778
             KPP +VFV SR+GADLLS AIT +TGL+ +SIHGEK+MK+RRE LR FL G+V V+V TG
Sbjct  385   KPPAVVFVSSRVGADLLSEAITAATGLEVISIHGEKTMKERRERLRRFLTGEVSVVVCTG  444

Query  777   VLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEI  598
             VLGRG+DL+ V QVI+FDMPNSI EY+HQ+GRASRMG+EG +IVF+NEE++KLF EL ++
Sbjct  445   VLGRGMDLVKVHQVILFDMPNSIDEYIHQVGRASRMGKEGVAIVFVNEEDRKLFGELAQV  504

Query  597   LKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             LK++GA IP EL+NSK++  S S+G  +KR+
Sbjct  505   LKTAGAPIPRELSNSKFT-SSVSLGTDRKRK  534



>ref|XP_010496403.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Camelina sativa]
Length=513

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/492 (63%), Positives = 396/492 (80%), Gaps = 10/492 (2%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK++S +QR  L  EPKCVIC RYGEYICDET+DD+CSLECK  LL RI+ + +      
Sbjct  14    VKQKSIDQRAPLSGEPKCVICNRYGEYICDETNDDVCSLECKETLLRRIDNATRVVDNAA  73

Query  1845  PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD--LVSPPIMSFGSCDV  1672
              V FPATD+C+YVR+          + D A++LRRKL I V+G    V PP ++F SC +
Sbjct  74    RV-FPATDECFYVREPGS-------SFDDAQMLRRKLEIHVQGQGAAVPPPALTFTSCGL  125

Query  1671  PRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNL  1492
             P KLL NLE AGY+ PTP+QMQAIPAAL G+S+L SA+TGSGKT SFL+PI++       
Sbjct  126   PPKLLLNLETAGYDFPTPIQMQAIPAALSGKSVLASADTGSGKTASFLVPIISRCTTYRS  185

Query  1491  ACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVS  1312
                  ++ PLAM+LAPTRELC+Q+E+QAK+LGKG+PFKTALVVGGD M+ QLYR++ GV 
Sbjct  186   EYPSDQRCPLAMVLAPTRELCVQVEDQAKMLGKGLPFKTALVVGGDPMSGQLYRIQQGVE  245

Query  1311  LIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSA  1132
             LI+GTPGR++DLL K  IE+D++ MFV+DEVDCMLQRGF +QVMQIF+ALSQPQ+L++SA
Sbjct  246   LIIGTPGRVVDLLAKHTIEVDNIMMFVLDEVDCMLQRGFRDQVMQIFQALSQPQVLLFSA  305

Query  1131  TISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKP  952
             T+S EVEK+  S+AK +  +S+G+ NKPN AV QLAIWV++KQKKQKLF+IL S+ H+ P
Sbjct  306   TVSSEVEKVGGSLAKEIISVSIGKPNKPNKAVNQLAIWVDAKQKKQKLFEILRSQNHFNP  365

Query  951   PVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVL  772
             P +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK MK+RR+++ SFL G+VPV+V+TGVL
Sbjct  366   PAVVYVSSRVGADLLANAITVVTGIKALSIHGEKPMKERRDVMGSFLGGEVPVLVSTGVL  425

Query  771   GRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILK  592
             GRGVDLL V+QVIVFDMP++IKEY+H IGRASRMGE+GT+I+F+NE+++ LFP+LV  LK
Sbjct  426   GRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTAILFVNEDDRNLFPDLVAALK  485

Query  591   SSGAAIPSELAN  556
             SSGAAIP EL N
Sbjct  486   SSGAAIPKELIN  497



>emb|CDY28661.1| BnaCnng05470D [Brassica napus]
Length=502

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/516 (61%), Positives = 401/516 (78%), Gaps = 27/516 (5%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             SD  +K++S +QR  LP EPKCVIC RYGEYICDET+DDICSLECK  LL   +K+R   
Sbjct  11    SDGGIKQKSIDQRSPLPGEPKCVICCRYGEYICDETNDDICSLECKQTLL---KKTRV--  65

Query  1857  PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAEL-LRRKLNIVVKGDLVSPPIMSFGS  1681
                    FPATD+C+YV            ++D   L LR KL+I V+G  V PP++SF S
Sbjct  66    -------FPATDECFYVGSS---------STDYYSLRLRSKLDIHVQGAAVPPPVLSFTS  109

Query  1680  CDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVK  1501
             C +P KLL NLE AGY+ PTP+QMQA+PAAL G SLL SA TGSGKT SFL+PIV+   +
Sbjct  110   CGLPPKLLLNLETAGYDFPTPIQMQAVPAALSGSSLLASAHTGSGKTASFLVPIVSRCAR  169

Query  1500  L-NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVE  1324
               +   S   + PLA++LAPTRELC+Q+E QAK+LGKG+PFKTALVVGGD M+ QLYR+ 
Sbjct  170   FRSEHPSSDPRNPLALVLAPTRELCVQVEAQAKMLGKGLPFKTALVVGGDPMSGQLYRIH  229

Query  1323  HGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQIL  1144
              GV LI+GTPGRL+DLL K  IEL+ V MFV+DEVDCMLQRGF +QVMQIFRALSQPQ+L
Sbjct  230   QGVELIIGTPGRLVDLLAKHTIELEDVMMFVLDEVDCMLQRGFIDQVMQIFRALSQPQVL  289

Query  1143  MYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQ  964
             ++SAT+SREVEK+  S+AK + ++S+G+ N P+ AVKQLAIWV++KQKKQKLF+ILTS+ 
Sbjct  290   LFSATVSREVEKVGGSLAKEMILVSIGKPNTPSKAVKQLAIWVDAKQKKQKLFEILTSQN  349

Query  963   HYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVA  784
             H+KPP +V+V SR GADLL+ AIT+ TG+KA+SIHGEK M++RR+++ SFL G+VP++V+
Sbjct  350   HFKPPAVVYVSSRAGADLLANAITVVTGIKALSIHGEKPMRERRDVMGSFLGGEVPLLVS  409

Query  783   TGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELV  604
             TGVLGRGVDLL V+QVIVFDMPN+IKEY+H IGRASRMG++G++I+F+NEE+K LFP+LV
Sbjct  410   TGVLGRGVDLLVVRQVIVFDMPNTIKEYIHVIGRASRMGDQGSAILFVNEESKHLFPDLV  469

Query  603   EILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
               LKS GAAIP +L     S+ S       K+R+ G
Sbjct  470   VALKSCGAAIPKQLT----SLTSSREMHSNKKRRVG  501



>ref|XP_009124827.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Brassica rapa]
Length=502

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/516 (61%), Positives = 401/516 (78%), Gaps = 27/516 (5%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             SD  +K++S +QR  LP EPKCVIC RYGEYICDET+DDICSLECK  LL   +K+R   
Sbjct  11    SDGGIKQKSIDQRSPLPGEPKCVICCRYGEYICDETNDDICSLECKQTLL---KKTRV--  65

Query  1857  PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAEL-LRRKLNIVVKGDLVSPPIMSFGS  1681
                    FPATD+C+YV            ++D   L LR KL+I V+G  V PP++SF S
Sbjct  66    -------FPATDECFYVGSS---------STDYYSLRLRSKLDIHVQGAAVPPPVLSFTS  109

Query  1680  CDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVK  1501
             C +P KLL NLE AGY+ PTP+QMQAIPAAL G SLL SA TGSGKT SFL+PIV+   +
Sbjct  110   CGLPPKLLLNLETAGYDFPTPIQMQAIPAALSGSSLLASAHTGSGKTASFLVPIVSRCAR  169

Query  1500  L-NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVE  1324
               +   S   + PLA++LAPTRELC+Q+E QAK+LGKG+PFKTALVVGGD M+ QLYR+ 
Sbjct  170   FRSEHPSSDPRNPLALVLAPTRELCVQVEAQAKMLGKGLPFKTALVVGGDPMSGQLYRIH  229

Query  1323  HGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQIL  1144
              GV LI+GTPGRL+DLL K  IEL+ V MFV+DEVDCMLQRGF +QVMQIFRALSQPQ+L
Sbjct  230   QGVELIIGTPGRLVDLLAKHTIELEDVMMFVLDEVDCMLQRGFIDQVMQIFRALSQPQVL  289

Query  1143  MYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQ  964
             ++SAT+SREVEK+  S+AK + ++S+G+ N P+ AVKQLAIWV++KQKKQKLF+ILTS+ 
Sbjct  290   LFSATVSREVEKVGGSLAKEMILVSIGKPNTPSKAVKQLAIWVDAKQKKQKLFEILTSQN  349

Query  963   HYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVA  784
             H+KPP +V+V SR GADLL+ AIT+ TG+KA+SIHGEK M++RR+++ SFL G+VP++V+
Sbjct  350   HFKPPAVVYVSSRAGADLLANAITVVTGIKALSIHGEKPMRERRDVMGSFLGGEVPLLVS  409

Query  783   TGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELV  604
             TGVLGRGVDLL V+QVIVFDMPN+IKEY+H IGRASRMG++G++I+F+NEE++ LFP+LV
Sbjct  410   TGVLGRGVDLLVVRQVIVFDMPNTIKEYIHVIGRASRMGDQGSAILFVNEESRHLFPDLV  469

Query  603   EILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
               LKS GAAIP +L     S+ S       K+R+ G
Sbjct  470   VALKSCGAAIPKQLT----SLTSSREMHSNKKRRVG  501



>ref|XP_010316002.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 isoform X3 
[Solanum lycopersicum]
Length=379

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/378 (82%), Positives = 346/378 (92%), Gaps = 0/378 (0%)
 Frame = -1

Query  1629  MPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMIL  1450
             MPTPVQMQAIPAAL  +SLLVSAETGSGKTGSFLIPIV+   K N      +Q+PLAM+L
Sbjct  1     MPTPVQMQAIPAALARQSLLVSAETGSGKTGSFLIPIVSQCAKFNEEHFPNQQQPLAMVL  60

Query  1449  APTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLT  1270
              PTRELCIQ+E+QAKVLGKG+PFKTALVVGGDAMA QL+R++ GVSLIVGTPGRLIDLLT
Sbjct  61    TPTRELCIQVEDQAKVLGKGLPFKTALVVGGDAMAGQLHRIQQGVSLIVGTPGRLIDLLT  120

Query  1269  KREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMA  1090
             K EIELD++S+ V+DEVDCMLQRGF EQVMQIF ALSQPQ+LMYSATI ++VEKMASSMA
Sbjct  121   KHEIELDTISILVLDEVDCMLQRGFREQVMQIFTALSQPQVLMYSATIPKDVEKMASSMA  180

Query  1089  KHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADL  910
             K +TVISVG+ NKPN +VKQLAIWV+SK+KKQKLFDIL SKQHYKPPVIVFV SRLGADL
Sbjct  181   KKVTVISVGKPNKPNQSVKQLAIWVDSKRKKQKLFDILMSKQHYKPPVIVFVDSRLGADL  240

Query  909   LSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIV  730
             LS AIT+STGLKA+SIHGEKSMKDRREI+RSFLVG++PVIVATGVL RG+DLL+VKQVIV
Sbjct  241   LSEAITVSTGLKALSIHGEKSMKDRREIVRSFLVGEIPVIVATGVLSRGIDLLTVKQVIV  300

Query  729   FDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSK  550
             FDMPNSIKEYVHQ+GRASRMGEEGTSIVF+NEENKKLFP+LVE LK+SGAAIP ELANS+
Sbjct  301   FDMPNSIKEYVHQVGRASRMGEEGTSIVFVNEENKKLFPQLVEALKTSGAAIPRELANSR  360

Query  549   YSVGSFSVGRHQKRRKYG  496
             YSVGSFS GR QK+RK G
Sbjct  361   YSVGSFSAGRGQKKRKLG  378



>ref|XP_010233998.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41 [Brachypodium 
distachyon]
Length=539

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/512 (63%), Positives = 407/512 (79%), Gaps = 5/512 (1%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTP  1855
             D  VK+R  EQREALP EP+CVICGRYGEYICD+TDDDICS+ECKT LL+RI    KP P
Sbjct  24    DLRVKERCIEQREALPGEPRCVICGRYGEYICDQTDDDICSVECKTSLLARIAAKTKP-P  82

Query  1854  CPPPVRF--PATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGS  1681
                PVR   P  D+ + VRD++   +   L + Q   LR KL+I VKG+ +  P+M F S
Sbjct  83    VKAPVRVDVPFGDESFCVRDNNF-PDIPSLRASQIASLRTKLDICVKGEAIPDPVMCFSS  141

Query  1680  CDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVK  1501
             C +P KL+ NLE AGY MPTPVQMQ I A+L  RSLLVSA+TGSGKT SFL+PI+A+  +
Sbjct  142   CGLPEKLVHNLETAGYTMPTPVQMQVISASLSDRSLLVSADTGSGKTVSFLVPIIAHCSR  201

Query  1500  LNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEH  1321
                     K+ PLA++LAPTRELC+Q+EEQAKVLGKG+PFKTALVVGGD +A+Q+YR+E+
Sbjct  202   GRSEQCTSKRGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKTALVVGGDPLAQQIYRIEN  261

Query  1320  GVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILM  1141
             G+ LIVGTPGRLIDLL K  ++LD VS+FV+DEVDC+L+RGF +Q MQIFRALS+PQ++M
Sbjct  262   GIELIVGTPGRLIDLLMKHNVDLDDVSVFVLDEVDCLLERGFRDQAMQIFRALSRPQVMM  321

Query  1140  YSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQH  961
             +SATI  EVEK+++SMA ++  IS G  N+PN +VKQ+ IWVE+KQKKQK+ +I+ SKQH
Sbjct  322   FSATIHSEVEKLSNSMANNMIHISCGNPNRPNKSVKQVVIWVETKQKKQKILEIMKSKQH  381

Query  960   YKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVAT  781
             +KPP ++FV SR+GADLLS A+T + GL+ +SIHGEK+MK+RRE LR FL G+V V+V T
Sbjct  382   FKPPAVIFVSSRVGADLLSEALTAAIGLEVISIHGEKTMKERRERLRRFLTGEVSVVVCT  441

Query  780   GVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVE  601
             GVLGRG+DLL V QVI+FDMPNSI EYVHQ+GRASRMGEEG +IVF+NEE++KLF EL +
Sbjct  442   GVLGRGMDLLKVCQVILFDMPNSIDEYVHQVGRASRMGEEGKAIVFVNEEDRKLFRELAQ  501

Query  600   ILKSSGAAIPSELANSKYSVGSFSVGRHQKRR  505
             +LK++GA IP ELA+S Y+ G  S+G  +KR+
Sbjct  502   VLKTAGAPIPRELASSNYTSG-ISLGIDRKRK  532



>gb|KFK43866.1| hypothetical protein AALP_AA1G184200 [Arabis alpina]
Length=504

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/518 (59%), Positives = 395/518 (76%), Gaps = 33/518 (6%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             DS   +K++S +QR+ LPDEP+CVICGRYGEYICD+T+DD+CSL+CK  L +R+      
Sbjct  16    DSTDGIKQKSIDQRDPLPDEPQCVICGRYGEYICDKTNDDVCSLQCKHTLNTRL------  69

Query  1860  TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG---DLVSPPIMS  1690
                     FPATD+C+YVR+          + + A+ LR K +I V+G     V PP++S
Sbjct  70    --------FPATDECFYVREPGA-------SFNDAQFLRTKFDIHVQGGGSQHVPPPVLS  114

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F SC +P KLL NL+ AGYE PTP+QMQAIP AL G+S+LVSA TGSGKT SFL+PIV+ 
Sbjct  115   FHSCGLPPKLLLNLQTAGYEFPTPIQMQAIPVALTGKSMLVSAATGSGKTASFLLPIVSR  174

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYR  1330
             +          ++ PLA++LAPTRELC+Q+E QAK+LGKG+PFKTALVVGGD M+ QLYR
Sbjct  175   SASFRSEHPSEQRSPLALVLAPTRELCVQVEHQAKILGKGLPFKTALVVGGDPMSGQLYR  234

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQ  1150
             ++ GV LI+GTPGRL+ LLTK  I+LD V  FV+DEVDCML+RGF +QVMQIFRALSQPQ
Sbjct  235   IQQGVELIIGTPGRLLGLLTKHAIQLDYVMTFVLDEVDCMLERGFRDQVMQIFRALSQPQ  294

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
             +L++SAT+SREVEK+  S+AK +  +SVG+ N PN  V QLA+WV++KQKKQKLF+IL S
Sbjct  295   VLLFSATLSREVEKVGGSLAKEMVSVSVGKPNIPNKTVNQLAVWVDAKQKKQKLFEILKS  354

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             + H+KPP +V+V SR+GADLL+ AIT+ TG+KA+SIHGEK M +RR+++ SFL G+VPV+
Sbjct  355   QNHFKPPAVVYVSSRVGADLLANAITVVTGIKALSIHGEKPMAERRDVMGSFLAGEVPVL  414

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             V+TGVLGRGVDLL VKQVIVFDMP +IKEY+H IGRAS+M   GT+ +F+NEEN+ LFP+
Sbjct  415   VSTGVLGRGVDLLVVKQVIVFDMPKTIKEYIHVIGRASKM---GTAFLFVNEENRNLFPD  471

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKYG  496
             LVE LKS GAAIP +L N        S   H K+R+ G
Sbjct  472   LVEALKSCGAAIPKQLINLT------SREMHNKKRRVG  503



>ref|XP_006599421.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Glycine max]
 ref|XP_006599422.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X3 [Glycine max]
 gb|KHN13408.1| DEAD-box ATP-dependent RNA helicase 41 [Glycine soja]
Length=422

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/417 (71%), Positives = 364/417 (87%), Gaps = 1/417 (0%)
 Frame = -1

Query  1749  LRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLL  1570
             LR+KL+I VKGD+V+P ++SF +C++P KLL N+EAAGYEMPTPVQMQAIPAAL G+S+L
Sbjct  5     LRKKLDIRVKGDVVAP-VLSFSACNLPDKLLHNIEAAGYEMPTPVQMQAIPAALTGKSML  63

Query  1569  VSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKG  1390
             V A+TGSGK+ SFLIPIV+  V         K+KPLAM+L PTRELCIQ+EE AK+LGKG
Sbjct  64    VLADTGSGKSASFLIPIVSRCVIHRRQYFSGKKKPLAMVLTPTRELCIQVEEHAKLLGKG  123

Query  1389  MPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCM  1210
             +PFKTALVVGGDAMA QL+R++ GV LIVGTPGRL+DLL K EI+LD V  FV+DEVDCM
Sbjct  124   LPFKTALVVGGDAMAGQLHRIQQGVELIVGTPGRLVDLLMKHEIDLDDVMTFVVDEVDCM  183

Query  1209  LQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             LQRGF +QVMQI+RALSQPQ+LMYSAT+S ++EKM +++AK + V+S+G+ N PN AVKQ
Sbjct  184   LQRGFRDQVMQIYRALSQPQVLMYSATMSNDLEKMINTLAKGMVVMSIGEPNTPNKAVKQ  243

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             LAIWVESKQKKQKLF+IL SK+H+KPPV+V+VGSRLGADLL+ AIT++TG+KAVSIHGEK
Sbjct  244   LAIWVESKQKKQKLFEILASKKHFKPPVVVYVGSRLGADLLANAITVATGIKAVSIHGEK  303

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             SMK+RRE ++SFLVG+VPV+VATGVLGRGVDLL V+QVIVFDMPN+IKEYVHQIGRASRM
Sbjct  304   SMKERRETMQSFLVGEVPVVVATGVLGRGVDLLGVRQVIVFDMPNNIKEYVHQIGRASRM  363

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRKY  499
             GEEG  IVF+NEENK +F EL+++LKS GAA+P ELANS+Y+   FS G+  K+RK+
Sbjct  364   GEEGQGIVFVNEENKNVFAELIDVLKSGGAAVPRELANSRYATRVFSGGKGSKKRKH  420



>ref|XP_006574743.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 41-like isoform 
X2 [Glycine max]
Length=422

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/425 (71%), Positives = 365/425 (86%), Gaps = 5/425 (1%)
 Frame = -1

Query  1773  LASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPA  1594
             +ASD    LR+KL+I VKGD+V+P ++SF +C++P KLL N+EAAGYEMPTPVQMQAIPA
Sbjct  1     MASD----LRKKLDIHVKGDVVAP-VLSFSACNLPDKLLHNIEAAGYEMPTPVQMQAIPA  55

Query  1593  ALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEE  1414
             AL G+S+L+ A+TGSGK+ SFLIPIV+            K+ PLA++L PTRELC+Q+EE
Sbjct  56    ALTGKSMLLLADTGSGKSASFLIPIVSRCAIHRRQYVSDKKNPLALVLTPTRELCMQVEE  115

Query  1413  QAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
              AK+LGKGMPFKTALVVGGDAMA QL+R++ GV LIVGTPGRL+DLLTK EI+LD V  F
Sbjct  116   HAKLLGKGMPFKTALVVGGDAMAGQLHRIQQGVELIVGTPGRLVDLLTKHEIDLDDVMTF  175

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLN  1054
             V+DEVDCMLQRGF +QVMQI+RALSQPQ+LMYSAT+S ++EKM +++ K   VISVG+ N
Sbjct  176   VVDEVDCMLQRGFRDQVMQIYRALSQPQVLMYSATMSNDLEKMINTLVKGTVVISVGEPN  235

Query  1053  KPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLK  874
              PN AVKQLAIWVESK+KKQKLF+IL SK+H+KPPV+V+VGSRLGADLL+ AIT+STG+K
Sbjct  236   TPNKAVKQLAIWVESKEKKQKLFEILESKKHFKPPVVVYVGSRLGADLLANAITVSTGIK  295

Query  873   AVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVH  694
             AVSIHGEKSMK+RRE ++S LVG+VPV+VATGVLGRGVDLL V+QVIVFDMPN+IKEYVH
Sbjct  296   AVSIHGEKSMKERRETMQSLLVGEVPVVVATGVLGRGVDLLGVRQVIVFDMPNNIKEYVH  355

Query  693   QIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQ  514
             QIGRASRMGEEG  IVF+NEENK +F EL+E+LKS GAA+P ELANS+Y+ G FS G+  
Sbjct  356   QIGRASRMGEEGQGIVFVNEENKNIFAELIEVLKSGGAAVPRELANSRYATGVFSGGKGS  415

Query  513   KRRKY  499
             K+RK+
Sbjct  416   KKRKH  420



>gb|AFN53706.1| putative dead box ATP-dependent RNA helicase [Linum usitatissimum]
Length=1272

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 383/487 (79%), Gaps = 23/487 (5%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSR-IEKSRK  1864
             D   EVKK S +QR AL  EPKCVICGRYGEYICDETDDD+CSLECK ++L+R I K R 
Sbjct  315   DESDEVKKSSRQQRLALQGEPKCVICGRYGEYICDETDDDVCSLECKQVVLARTIAKDR-  373

Query  1863  PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGD-LVSPPIMSF  1687
                    +   A D+C+YVRD      S  L +DQ    R+KL+I VKGD  V PP++SF
Sbjct  374   -GSISNRIVVSAKDECFYVRD------SMSLTADQTVTSRKKLDIHVKGDDTVPPPMLSF  426

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
              S ++P KLL N+E+AG+++PTPVQMQAIP  L G+SLL SAETGSGKT SFL+PI+   
Sbjct  427   SSWNLPSKLLQNIESAGFDVPTPVQMQAIPIGLSGKSLLASAETGSGKTASFLVPIIT--  484

Query  1506  VKLNLACSERKQ-----KPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMAR  1342
                   C  R Q     KPL ++L PTRELCIQ+E+QAK+LGKG+ FKTALVVGGDAMA 
Sbjct  485   ------CCSRHQNLNRKKPLGIVLTPTRELCIQVEDQAKLLGKGLLFKTALVVGGDAMAG  538

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             Q++R++ GV LIV TPGRLIDLLTK +IELD V MFV+DEVD MLQ GF +QVMQIF +L
Sbjct  539   QVHRLQQGVELIVATPGRLIDLLTKHDIELDEVKMFVVDEVDYMLQSGFRDQVMQIFVSL  598

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
             +QPQ+LMYSATIS EVEK+ASSM K +  IS+G  N+P+ AVKQLAIWVE+KQKKQKLFD
Sbjct  599   AQPQVLMYSATISEEVEKLASSMIKEIVSISIGLRNRPSMAVKQLAIWVETKQKKQKLFD  658

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL SKQH+ PP +V+VGSRLGADLLS AIT+ TGLKA+SIHGEK MK+RREI+ +FL+G+
Sbjct  659   ILLSKQHFVPPAVVYVGSRLGADLLSNAITVRTGLKALSIHGEKPMKERREIMAAFLMGE  718

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
              PVIV+TGVLGRG+DLL V+QVIVFDMPNSI+EYVH IGRASRMGEEG +I FINEENK 
Sbjct  719   APVIVSTGVLGRGMDLLGVRQVIVFDMPNSIEEYVHMIGRASRMGEEGKAIAFINEENKT  778

Query  621   LFPELVE  601
             +F E VE
Sbjct  779   IFSEFVE  785



>ref|XP_007151688.1| hypothetical protein PHAVU_004G067700g [Phaseolus vulgaris]
 gb|ESW23682.1| hypothetical protein PHAVU_004G067700g [Phaseolus vulgaris]
Length=421

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/424 (70%), Positives = 365/424 (86%), Gaps = 6/424 (1%)
 Frame = -1

Query  1773  LASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPA  1594
             +ASD    LR KL+I VKGD+V+P ++SF +C++P KLL N+EAAGY MPTPVQMQAIPA
Sbjct  1     MASD----LRTKLDIHVKGDVVAP-VLSFSACNLPDKLLHNIEAAGYYMPTPVQMQAIPA  55

Query  1593  ALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEE  1414
             AL G+++LV A TGSGK+ SFLIPIV+  V ++      ++KPL M+L PTRELCIQ+EE
Sbjct  56    ALTGKNVLVLANTGSGKSASFLIPIVSRCV-IHRRQYVSEKKPLVMVLTPTRELCIQVEE  114

Query  1413  QAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
              AK+LGKG+PFKTALVVGG+AMA QLYR++ GV LIVGTPGRL+DLL K EI+LD V  F
Sbjct  115   HAKMLGKGLPFKTALVVGGEAMAGQLYRIQQGVELIVGTPGRLVDLLMKHEIDLDDVMTF  174

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLN  1054
             V+DEVDCMLQRGF +QVM+I+RALSQPQ+LMYSAT+S ++EKM +++AK   VISVG+ N
Sbjct  175   VVDEVDCMLQRGFRDQVMKIYRALSQPQVLMYSATMSNDLEKMINTLAKGTVVISVGEPN  234

Query  1053  KPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLK  874
             + N AVKQLAIWVESKQKKQKLFDIL +K+H+KPPV+V+VGSRLGADLL+ AIT++TG+K
Sbjct  235   RANKAVKQLAIWVESKQKKQKLFDILATKKHFKPPVVVYVGSRLGADLLANAITVATGIK  294

Query  873   AVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVH  694
             AVSIHGEKSMK+RREI++SF +G+VPV+VATGVLGRG+DLL V+QVIVFDMPNSIKEYVH
Sbjct  295   AVSIHGEKSMKERREIMQSFCMGEVPVVVATGVLGRGIDLLGVRQVIVFDMPNSIKEYVH  354

Query  693   QIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQ  514
             QIGRASRMGEEG  IVF+NEENK +F +L+++LKS GAA+P ELANS+Y+ G FS G+  
Sbjct  355   QIGRASRMGEEGEGIVFVNEENKNVFADLIDVLKSGGAAVPRELANSRYTTGFFSGGKAS  414

Query  513   KRRK  502
             K+RK
Sbjct  415   KKRK  418



>gb|EYU46329.1| hypothetical protein MIMGU_mgv1a008399mg [Erythranthe guttata]
Length=375

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/378 (76%), Positives = 341/378 (90%), Gaps = 4/378 (1%)
 Frame = -1

Query  1629  MPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMIL  1450
             MPTPVQMQAIP+AL+GRS+LVSAETGSGKT SFL+P+V    K         Q PLAM+L
Sbjct  1     MPTPVQMQAIPSALIGRSMLVSAETGSGKTCSFLVPVVDYCTKFK----NNPQTPLAMVL  56

Query  1449  APTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLT  1270
             APTRELCIQ+EEQAK+LGKG+PFKTALVVGGDAMA Q++R++ GVS+IVGTPGRLIDLLT
Sbjct  57    APTRELCIQVEEQAKLLGKGLPFKTALVVGGDAMAGQVHRIKQGVSMIVGTPGRLIDLLT  116

Query  1269  KREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMA  1090
             K + E+D++ + V+DEVDCM+QRGF EQVMQIF+ALSQPQ+LMYSAT+S+EVEK+A SMA
Sbjct  117   KHDFEMDTIKILVLDEVDCMIQRGFREQVMQIFQALSQPQVLMYSATVSKEVEKVAGSMA  176

Query  1089  KHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADL  910
             K LT++SVG+ NKP+GAV+QLAIWVES +KKQKLFDILTSKQH+KPPV+VFVGSR+GADL
Sbjct  177   KDLTIVSVGRPNKPSGAVRQLAIWVESNKKKQKLFDILTSKQHFKPPVVVFVGSRIGADL  236

Query  909   LSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIV  730
             LS AIT+ TG++A+SIHGEK MK+RR+++RSFLVG+V VIVATGVLGRGVDLLSV+QVIV
Sbjct  237   LSEAITMKTGVRALSIHGEKKMKERRDVVRSFLVGEVSVIVATGVLGRGVDLLSVRQVIV  296

Query  729   FDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSK  550
             FDMPNS KEYVH IGRASRMGE+G +IVF+NEENKK+FPELV+IL+SSGAAIP ELANS+
Sbjct  297   FDMPNSTKEYVHMIGRASRMGEDGAAIVFVNEENKKIFPELVDILESSGAAIPRELANSR  356

Query  549   YSVGSFSVGRHQKRRKYG  496
              +V SFSVGR QK+RK+G
Sbjct  357   RAVNSFSVGRAQKKRKHG  374



>gb|EMS56659.1| DEAD-box ATP-dependent RNA helicase 41 [Triticum urartu]
Length=487

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 365/457 (80%), Gaps = 2/457 (0%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRK-PT  1858
             D  VK+R +EQREALP EP+CVICGRYGEYICD+TDDDICS+ECKT LL+RI    K P 
Sbjct  26    DLRVKERCFEQREALPGEPRCVICGRYGEYICDQTDDDICSVECKTALLARIAAETKIPV  85

Query  1857  PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSC  1678
               P  ++ P  D+ + VRD++   +   L + Q   LR KL+I VKG+ +  PIM F SC
Sbjct  86    KAPARIKVPFGDESFCVRDNNF-PDIPSLHASQIVSLRNKLDICVKGEAIPDPIMCFSSC  144

Query  1677  DVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKL  1498
              +P KL+ NL+AAGY MPTPVQMQ IPA++  RSLLVSA+TGSGKT SFL+PI+A+    
Sbjct  145   GLPEKLVHNLDAAGYTMPTPVQMQVIPASISNRSLLVSADTGSGKTASFLVPIIAHCSWR  204

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHG  1318
              L   E K+ PLA++LAPTRELC+Q+E+QAKVLGKG+PFKTALVVGGD +A+Q+YR+E+G
Sbjct  205   ELQQCESKRGPLAIVLAPTRELCLQVEDQAKVLGKGLPFKTALVVGGDPLAQQIYRIENG  264

Query  1317  VSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMY  1138
             V LIVGTPGRLIDLL K  ++L  VS+FV+DEVDC+L+RGF +Q MQIFRALS PQ++M+
Sbjct  265   VELIVGTPGRLIDLLMKHNVDLTDVSVFVLDEVDCLLERGFRDQAMQIFRALSCPQVMMF  324

Query  1137  SATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHY  958
             SATI  E+EK+++S++ ++  IS G   KPN +V+Q+ IWVESKQKKQK+F+I+ SKQH+
Sbjct  325   SATIHSEIEKLSNSLSNNMIHISCGNPGKPNKSVRQVVIWVESKQKKQKIFEIIKSKQHF  384

Query  957   KPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATG  778
             KPP +VFV SR+GADLLS AIT +TGL+ +SIHGEK+M++RRE LR FL G+V V+V TG
Sbjct  385   KPPAVVFVSSRVGADLLSEAITAATGLEVISIHGEKTMEERRERLRRFLTGEVSVVVCTG  444

Query  777   VLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
             VLGRG+DLL V QVI+FDMPNSI EY+HQ+GR SRMG
Sbjct  445   VLGRGMDLLKVHQVILFDMPNSIDEYIHQVGRTSRMG  481



>ref|XP_001763680.1| predicted protein [Physcomitrella patens]
 gb|EDQ71570.1| predicted protein [Physcomitrella patens]
Length=549

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 377/523 (72%), Gaps = 18/523 (3%)
 Frame = -1

Query  2034  DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS-RKPT  1858
             D  VK+RS +QR+  P EP CV+C RYGEYICD TDDDICSLECK  +L+ I  + +   
Sbjct  13    DQAVKQRSSQQRQPEPGEPVCVVCCRYGEYICDATDDDICSLECKAAILAEINSTPQAAC  72

Query  1857  PCPPPVRFPA-------TDDCYYVRDDDKK--------SESKCLASDQAELLRRKLNIVV  1723
               P P R           D+C  V D   K        S S+ L+ +Q   L + + + V
Sbjct  73    DAPKPERKVVHLSTEGLQDECIVVTDKGNKLPEWAPDESVSR-LSKEQVNALLQGIEVSV  131

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             KG+    PI+ F  C    KL  NLEAAGYE PTPVQMQ IPAAL GR +LVSAETGSGK
Sbjct  132   KGEDAPRPILQFADCKFLPKLQGNLEAAGYETPTPVQMQTIPAALKGRDVLVSAETGSGK  191

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVV  1363
             T SFL+PI+     + +     ++KPLAM+LAPTRELC Q+EEQAKVL KG+PFKTALVV
Sbjct  192   TASFLLPIIMRCCLIRIHGLSEREKPLAMVLAPTRELCAQVEEQAKVLAKGLPFKTALVV  251

Query  1362  GGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKRE-IELDSVSMFVIDEVDCMLQRGFHEQ  1186
             GGDAM +Q++R++ GV LI+GTPGRLIDLL+K + + L  V +  +DEVDC+L+ GF +Q
Sbjct  252   GGDAMPQQVHRIKQGVELIIGTPGRLIDLLSKHDDLTLQGVCILALDEVDCLLESGFRDQ  311

Query  1185  VMQIFRALSQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESK  1006
             V+Q+ +AL+ PQILMYSATI   +E+ +SS+ K+  +ISVG   +PN AV Q+ +WVE+K
Sbjct  312   VLQLVQALAMPQILMYSATILPAIERFSSSLLKNPLIISVGTPRQPNRAVHQIILWVETK  371

Query  1005  QKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREI  826
              KK+KLF+IL S+ HY+PPV+VFV SR+G+DLL+ AI   TG++A S+HGEKS+KDRRE 
Sbjct  372   NKKKKLFEILKSRVHYRPPVVVFVNSRMGSDLLAEAIRTVTGIQARSLHGEKSIKDRRET  431

Query  825   LRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIV  646
             L++FL+G++PVIVATGVLGRG+DLL V QVI+FD P+SI+EY+H IGRASR+   G+++V
Sbjct  432   LKNFLMGEIPVIVATGVLGRGLDLLRVTQVIIFDFPSSIEEYIHMIGRASRLSNAGSAMV  491

Query  645   FINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRH  517
             F+N+E+K LF ELV +LK+S   +P EL NS Y + ++++  +
Sbjct  492   FVNDESKALFKELVALLKASRTVVPRELLNSPYLLSTYALAYN  534



>ref|XP_002979867.1| hypothetical protein SELMODRAFT_111217, partial [Selaginella 
moellendorffii]
 gb|EFJ19269.1| hypothetical protein SELMODRAFT_111217, partial [Selaginella 
moellendorffii]
Length=500

 Score =   531 bits (1367),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 264/497 (53%), Positives = 352/497 (71%), Gaps = 27/497 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK+R  EQR A   EP+C +C R+GEYICDET DD+CSLECK +++   E          
Sbjct  1     VKERCVEQRNAGDGEPRCAVCERFGEYICDETGDDVCSLECKKVVVRYKE----------  50

Query  1845  PVRFPATDDCYYVRDD----DKKSESKCLASDQAELLRRKLNIVVKGDLVSPP---IMSF  1687
                   T + +  R++    D++S +  L+   A  LR  + + V+G+  +PP   I+ F
Sbjct  51    -----LTSNSHKARNEQWEIDQESITGGLSIQDALALRESIGVSVRGEGGAPPRPPILDF  105

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
             G C    +L++NL +AGYE PTP+QMQ +PAAL GR LLVS+ TGSGKT SFL+PI+A  
Sbjct  106   GQCGFAPRLMENLSSAGYEAPTPIQMQVLPAALAGRDLLVSSHTGSGKTLSFLLPIIARC  165

Query  1506  VKLNLAC----SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQ  1339
              K+         E  + PLAM+L PTREL  Q+E+ AK+L KG+PFKTALVVGGD M +Q
Sbjct  166   CKIRRGGPDEDDETSRPPLAMVLTPTRELSSQVEDHAKILAKGLPFKTALVVGGDVMPQQ  225

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKRE-IELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             +YR+  GV LIVGTPGRL+D+L++ E + L  VS+ V+DEVDCML+RGF EQVMQI RAL
Sbjct  226   VYRIRKGVELIVGTPGRLLDVLSRHEDVNLAKVSVLVLDEVDCMLERGFREQVMQIVRAL  285

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
               PQ++++SAT+  E+EK A+S+AK L VIS G    P GAV+Q  +WVE+K KK+KLFD
Sbjct  286   PTPQMMLFSATVPPEIEKFATSIAKSLMVISAGPPGAPTGAVQQTVVWVETKNKKKKLFD  345

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL S   ++PP +VFV SRLGA+LL  AI+  T L+  S+HG K+MK+RRE+L+SFLVG 
Sbjct  346   ILQSSSRFQPPGVVFVNSRLGAELLGDAISKVTKLRCASLHGHKAMKERREVLKSFLVGS  405

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             + VIVATGVLGRG+DLL   QVI+FDMPN+++EY HQ+GRASR+ E GT+I FIN E+K 
Sbjct  406   LDVIVATGVLGRGLDLLRATQVIIFDMPNTVQEYTHQLGRASRLDEPGTAIAFINNESKA  465

Query  621   LFPELVEILKSSGAAIP  571
             LF +L ++ +S+G A+P
Sbjct  466   LFQQLAQLSRSAGVALP  482



>ref|NP_850499.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
 gb|AAL38348.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65071.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73757.1| DEAD-box ATP-dependent RNA helicase 41 [Arabidopsis thaliana]
Length=368

 Score =   519 bits (1336),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 247/373 (66%), Positives = 315/373 (84%), Gaps = 7/373 (2%)
 Frame = -1

Query  1611  MQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN-TVKLNLACSERKQKPLAMILAPTRE  1435
             MQAIPAAL G+SLL SA+TGSGKT SFL+PI++  T   +   S++++ PLAM+LAPTRE
Sbjct  1     MQAIPAALTGKSLLASADTGSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRE  60

Query  1434  LCIQIEEQAKVLGKGMPFKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIE  1255
             LC+Q+E+QAK+LGKG+PFKTALVVGGD M+ QLYR++ GV LI+GTPGR++DLL+K  IE
Sbjct  61    LCVQVEDQAKMLGKGLPFKTALVVGGDPMSGQLYRIQQGVELIIGTPGRVVDLLSKHTIE  120

Query  1254  LDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQPQILMYSATISREVEKMASSMAKHLTV  1075
             LD++  FV+DEVDCMLQRGF +QVMQIF+ALSQPQ+L++SATISREVEK+  S+AK + +
Sbjct  121   LDNIMTFVLDEVDCMLQRGFRDQVMQIFQALSQPQVLLFSATISREVEKVGGSLAKEIIL  180

Query  1074  ISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAI  895
             +S+G  NKPN AV QLAIWV++KQKKQKLFDIL S+ H+KPP +V+V SR+GADLL+ AI
Sbjct  181   VSIGNPNKPNKAVNQLAIWVDAKQKKQKLFDILRSQNHFKPPAVVYVSSRVGADLLANAI  240

Query  894   TISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPN  715
             T+ TG+KA+SIHGEK MK+RR+++ SFL G+VPV+V+TGVLGRGVDLL V+QVIVFDMP+
Sbjct  241   TVVTGVKALSIHGEKPMKERRDVMGSFLGGEVPVLVSTGVLGRGVDLLVVRQVIVFDMPS  300

Query  714   SIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGS  535
             +IKEY+H IGRASRMGE+GT+IVF+NE+++ LFP+LV  LKSSGAAIP EL N       
Sbjct  301   TIKEYIHVIGRASRMGEKGTAIVFVNEDDRNLFPDLVAALKSSGAAIPKELINLT-----  355

Query  534   FSVGRHQKRRKYG  496
              S   H K+R+ G
Sbjct  356   -SREMHNKKRRVG  367



>ref|XP_002988436.1| hypothetical protein SELMODRAFT_127995, partial [Selaginella 
moellendorffii]
 gb|EFJ10526.1| hypothetical protein SELMODRAFT_127995, partial [Selaginella 
moellendorffii]
Length=497

 Score =   523 bits (1348),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 264/497 (53%), Positives = 352/497 (71%), Gaps = 27/497 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK+R  EQR A   EP+C +CGR+GEYICDET DD+CSLECK +++   E          
Sbjct  1     VKERCVEQRNAGDGEPRCAVCGRFGEYICDETGDDVCSLECKKVVVRYKE----------  50

Query  1845  PVRFPATDDCYYVRDD----DKKSESKCLASDQAELLRRKLNIVVKGDLVSPP---IMSF  1687
                   T + +  R++    D++S +  L+  +A  LR  + + V+G   +PP   I+ F
Sbjct  51    -----LTSNSHKARNEQWEIDQESITGGLSIQEALALRESIGVSVRGGGGAPPPPPILDF  105

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
             G C    +L++NL +AGYE PTP+QMQ +PAAL GR LLVS+ TGSGKT SFL+PI+A  
Sbjct  106   GQCGFAPRLMENLSSAGYEAPTPIQMQVLPAALAGRDLLVSSHTGSGKTLSFLLPIIARC  165

Query  1506  VKLNLAC----SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQ  1339
              K+         E  + PLAM+L PTREL  Q+E+ AK+L KG+PFKTALVVGGD M +Q
Sbjct  166   CKIRSGGPDEDDETSRPPLAMVLTPTRELSSQVEDHAKILAKGLPFKTALVVGGDVMPQQ  225

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKRE-IELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
              YR+  GV LIVGTPGRL+D+L++ E + L  VS+ V+DEVDCML+RGF EQVMQI RAL
Sbjct  226   AYRIRKGVELIVGTPGRLLDVLSRHEDVNLAKVSVLVLDEVDCMLERGFREQVMQIVRAL  285

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
               PQ++++SAT+  E+EK A+S+AK L VIS G    P GAV+Q  +WVE+K KK+KLFD
Sbjct  286   PTPQVMLFSATVPPEIEKFATSIAKSLMVISAGPPGAPTGAVQQTVVWVETKNKKKKLFD  345

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
              L S   ++PP +VFV SRLGA+LL+ AI+  T L+  S+HG K+MK+RRE+L+SFLVG 
Sbjct  346   FLQSSSRFQPPGVVFVNSRLGAELLADAISKVTKLRCASLHGHKAMKERREVLKSFLVGS  405

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             + VIVATGVLGRG+DLL   QVI+FDMPN+++EY HQ+GRASR+ E GT+I FIN E+K 
Sbjct  406   LDVIVATGVLGRGLDLLRATQVIIFDMPNTVQEYTHQLGRASRLDEPGTAIAFINNESKA  465

Query  621   LFPELVEILKSSGAAIP  571
             LF +L ++ +S+G A+P
Sbjct  466   LFQQLAQLSRSAGVALP  482



>ref|XP_005961576.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pantholops 
hodgsonii]
Length=620

 Score =   456 bits (1172),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 236/536 (44%), Positives = 335/536 (63%), Gaps = 39/536 (7%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G   +  VK  S  QR+A P EP CV+CGRYGEY+CDETD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLPEEPVKSFSKTQRQAEPGEPVCVVCGRYGEYVCDETDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P P  +  T+  +  R          L  DQ E LR
Sbjct  138   LQVRGAEAASQPSRPQKAGSEPAAPGPAPYVYTEHAFVAR----------LREDQIETLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGQGVPRPIVDFEHCGFPEALNRNLKASGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++   +        + + P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVIVRALS-------QSKSPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG  +  Q +R+   + +I+ TPGRL+D++ +R +EL S+ + V+DE D ML
Sbjct  301   CLRTALLVGGLPVPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++AS +      I+ G+ N+P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTILASATIPASVEQLASQLLHDPVAITAGERNRPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLQSASVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+  L   L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQTERKSTLEGLLEGDYDVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             G  GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H +RRK
Sbjct  541   GRHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHDQRRK  588



>ref|XP_002914657.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like [Ailuropoda 
melanoleuca]
 gb|EFB26794.1| hypothetical protein PANDA_002576 [Ailuropoda melanoleuca]
Length=620

 Score =   453 bits (1166),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 235/503 (47%), Positives = 333/503 (66%), Gaps = 15/503 (3%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +      + +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSDPQKVDSGPEPPLNAFYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DEVD ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGMKIVVVDEVDTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS + ++   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILASATIPTSIEQLASQLLRNPVRIVTGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQHGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKY  547
              ++ + +K +G+ +P +L NS Y
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY  581



>ref|XP_004458141.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
1 [Dasypus novemcinctus]
 ref|XP_004458142.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
2 [Dasypus novemcinctus]
Length=619

 Score =   452 bits (1162),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 334/518 (64%), Gaps = 15/518 (3%)
 Frame = -1

Query  2082  SIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLEC  1903
             + V   E      S S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLEC
Sbjct  72    TYVTGHEQGVKDSSLSEEPVKSFSKTQRWADPGEPVCVVCGRYGEYICDKTDEDVCSLEC  131

Query  1902  KTILLSRIEKSRKPTPCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKL  1735
             K   L ++ +  +      P +  +      + +YV  +     +  L  DQ E L+R+L
Sbjct  132   KAKHLLQVNEKEETLKLSNPQKADSKPESPLNTFYVYREHPFIMN--LQKDQVENLKRQL  189

Query  1734  NIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAET  1555
              I+V+G  V+ PI+ F  C  P  L DNL+ +GYE+PTP+QMQ IP  L+GR +L SA+T
Sbjct  190   GILVQGQEVTRPIIDFEHCGFPEALNDNLKKSGYEVPTPIQMQMIPVGLLGRDVLASADT  249

Query  1554  GSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FK  1378
             GSGKT +FL+P++        A  E K  P A+IL PTREL IQIE QAK L  G+P  K
Sbjct  250   GSGKTAAFLLPVIIR------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMK  302

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             T L+VGG  +  QLYR++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ G
Sbjct  303   TVLLVGGLPLPPQLYRLQQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMG  362

Query  1197  FHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAI  1021
             F +QV+ I   +    Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +
Sbjct  363   FQQQVLDILENIPNDCQTILVSATIPTNIEQLASQLLHNPVRIITGEKNLPCSNVRQIIL  422

Query  1020  WVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMK  841
             WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ SIH EKS  
Sbjct  423   WVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVQKITGLKSTSIHSEKSQI  482

Query  840   DRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEE  661
             +R+ IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ 
Sbjct  483   ERKNILKGLLEGDYEVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQIGRVGRLGQN  542

Query  660   GTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             GT+I FIN  +K+ F ++V+ +K +G+ +P +L NS Y
Sbjct  543   GTAITFINNNSKRHFWDIVKRVKPTGSILPPQLLNSPY  580



>ref|XP_004392784.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Odobenus 
rosmarus divergens]
Length=620

 Score =   452 bits (1162),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 337/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +      + +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSDPQKGDSGPESPLNAFYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
             T+     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   TL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGIKIIVVDEADTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKSILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLITVKLVVNFDMPSSMDEYVHQVGRVGRLGQHGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_008683324.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Ursus maritimus]
Length=620

 Score =   451 bits (1161),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +      D +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSDPQKVDSGPEPPLDAFYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  +++ V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGMNIVVVDEADTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E +AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPASIEHLASQLLHNPVRIVTGEKNLPCPSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQHGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_004625377.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Octodon 
degus]
Length=620

 Score =   451 bits (1161),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 245/544 (45%), Positives = 345/544 (63%), Gaps = 28/544 (5%)
 Frame = -1

Query  2109  SGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDET  1930
             S + +  E S+VA  E N+ +    +  VK  S  QR A P EP CV+CGRYGEYICD+T
Sbjct  65    SPAHQVAEVSLVAP-EQNEKASPAFEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKT  123

Query  1929  DDDICSLECKTILLSRIEKSRKPTPCPPPVR------FPATDDCYYVRDDDKKSESKCLA  1768
             D+D+CSLECK   L +++   +      P        +P T   +YV        S  L 
Sbjct  124   DEDVCSLECKAKHLLQVKGKEEKLNLSSPQNAGSEPGYPLT--AFYVYRQHPFISS--LQ  179

Query  1767  SDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAAL  1588
              DQ E L+++L I V+G  V+ PI+ F  CD P  L  NL+ +GYE+PTP+QMQ IP  L
Sbjct  180   EDQIEHLKQQLGISVQGQEVTRPIIDFEHCDFPEALNHNLKKSGYEVPTPIQMQMIPVGL  239

Query  1587  MGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQA  1408
             +GR +L SA+TGSGKT +FL+P++        A +E K  P A+IL PTREL IQIE QA
Sbjct  240   LGRDILASADTGSGKTAAFLLPVIMR------ALAESK-TPSALILTPTRELAIQIERQA  292

Query  1407  KVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFV  1231
             K L  G+P  KT L+VGG  +  QLYR+   V +I+ TPGRL+D++ +  +EL  + + V
Sbjct  293   KELMSGLPHMKTVLLVGGLPLPPQLYRLRQHVKVIIATPGRLLDIIKQNAVELSGIKITV  352

Query  1230  IDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLN  1054
             +DE D ML+ GF +QV+ I   +    Q ++ SATI   +E++AS +  +   I  G+ N
Sbjct  353   VDEADTMLKMGFQQQVLDILENIPNDCQTVLASATIPASIEQLASQLLHNPVRIITGEKN  412

Query  1053  KPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLK  874
              P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK
Sbjct  413   LPCPSVRQIILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLK  472

Query  873   AVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVH  694
             + +IH EKS  +R++IL+  L GD  V+V+TGVLGRG+DL+SV  V+ FDMP+S+ EYVH
Sbjct  473   STAIHSEKSQVERKDILKGLLEGDYEVVVSTGVLGRGLDLVSVMLVVNFDMPSSMDEYVH  532

Query  693   QIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQ  514
             QIGR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H 
Sbjct  533   QIGRVGRLGQNGTAITFINNSSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHD  584

Query  513   KRRK  502
             ++RK
Sbjct  585   QKRK  588



>ref|XP_003410253.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Loxodonta africana]
Length=619

 Score =   451 bits (1160),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 333/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CVICGRYGEYICD+TD+D+CSLECK   L ++    EK 
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVICGRYGEYICDQTDEDVCSLECKAKHLLQVKEQEEKG  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +  +P        +    +YV  +     S  L  DQ E L+++L IVV+G  V+ PI+ 
Sbjct  147   KLSSPQKADSEAESPLSAFYVYKEHPFILS--LEEDQIEHLKQQLGIVVQGQEVTRPIVE  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPEALSHNLKKSGYEVPTPIQMQMIPVGLQGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +          + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ALF-------EDRSPSALILTPTRELAIQIERQAKELMSGLPHMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL SV + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLRQRVKVIIATPGRLLDIIKQSAVELCSVKIVVVDEADTMLKMGFQQQVLDILENVPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS + ++   IS G+ N P   V+Q+ +W+E   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSMEQLASQLLQNPVRISTGEKNLPCSNVRQIILWIEEPSKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK +SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKCISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQRGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G  +P +L NS Y         H ++RK
Sbjct  558   WDITKRVKPTGTILPPQLLNSPY--------LHDQKRK  587



>ref|XP_005622331.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X4 [Canis lupus familiaris]
Length=620

 Score =   451 bits (1159),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 339/522 (65%), Gaps = 24/522 (5%)
 Frame = -1

Query  2046  GSD-SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             GSD S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++ 
Sbjct  84    GSDLSEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEK  143

Query  1869  RKPTPCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSP  1702
              +      P +  +      +  YV  +     +  L  DQ E L+R+L IVV+G  V+ 
Sbjct  144   EERLKLSAPHKANSEPESPLNTLYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTR  201

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P
Sbjct  202   PIIDFEHCGFPEALNHNLKTSGYEVPTPIQMQMIPVGLLGRDVLASADTGSGKTAAFLLP  261

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMA  1345
             ++   +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  + 
Sbjct  262   VITRAL-----CESKT--PSALILTPTRELAIQIENQAKELMSGLPRMKTVLLVGGLPLP  314

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRA  1165
              QLYR+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   
Sbjct  315   PQLYRLRQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILEH  374

Query  1164  L-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKL  988
             + +  Q ++ SATI   +E++AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KL
Sbjct  375   VPNDSQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKL  434

Query  987   FDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLV  808
             F+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L 
Sbjct  435   FEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLE  494

Query  807   GDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEEN  628
             GD  V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +
Sbjct  495   GDYEVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNS  554

Query  627   KKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  555   KRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_008828488.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Nannospalax 
galili]
 ref|XP_008828489.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Nannospalax 
galili]
Length=620

 Score =   450 bits (1158),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/519 (45%), Positives = 334/519 (64%), Gaps = 25/519 (5%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRRAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEML  147

Query  1857  PCPPPVRFPAT-----DDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIM  1693
                 P +  +      D  Y  R+         L  DQ E L+++L I V+G  V+ PI+
Sbjct  148   KLSSPQKGASEPESPLDAVYIYREHPFIVN---LQEDQIENLKQQLGISVQGQEVTRPII  204

Query  1692  SFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVA  1513
              F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++ 
Sbjct  205   DFEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIT  264

Query  1512  NTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQL  1336
              T+          + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QL
Sbjct  265   RTLF-------EDKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQL  317

Query  1335  YRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQ  1156
             YR+   V +I+ TPGRL+D++ +  + L+S+ + V+DE D ML+ GF +QV+ I   +S 
Sbjct  318   YRLRQHVKVIIATPGRLLDIIKQNSVALNSIKIVVVDEADTMLKMGFQQQVLDILENISD  377

Query  1155  P-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDI  979
               Q ++ SATI   +E++A  +      I+ G+ N P  +V+Q+ +WVE   KK+KLF+I
Sbjct  378   DCQTILVSATIPGGIEQLAGQLLHDPVRITTGEKNLPCASVRQIVLWVEDPAKKKKLFEI  437

Query  978   LTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDV  799
             L  K+ ++PPV+VFV  +LGADLLS A+   TGLK+ SIH EKS  +RR IL+  L GD 
Sbjct  438   LNDKKLFRPPVLVFVDCKLGADLLSDAVQKITGLKSTSIHSEKSQVERRNILKGLLEGDY  497

Query  798   PVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKL  619
              V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+L
Sbjct  498   EVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRL  557

Query  618   FPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             F ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  558   FWDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  588



>ref|XP_005622329.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Canis lupus familiaris]
 ref|XP_005622330.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Canis lupus familiaris]
 ref|XP_537128.3| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoformX1 
[Canis lupus familiaris]
Length=623

 Score =   450 bits (1158),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 339/522 (65%), Gaps = 24/522 (5%)
 Frame = -1

Query  2046  GSD-SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             GSD S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++ 
Sbjct  84    GSDLSEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEK  143

Query  1869  RKPTPCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSP  1702
              +      P +  +      +  YV  +     +  L  DQ E L+R+L IVV+G  V+ 
Sbjct  144   EERLKLSAPHKANSEPESPLNTLYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTR  201

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P
Sbjct  202   PIIDFEHCGFPEALNHNLKTSGYEVPTPIQMQMIPVGLLGRDVLASADTGSGKTAAFLLP  261

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMA  1345
             ++   +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  + 
Sbjct  262   VITRAL-----CESKT--PSALILTPTRELAIQIENQAKELMSGLPRMKTVLLVGGLPLP  314

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRA  1165
              QLYR+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   
Sbjct  315   PQLYRLRQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILEH  374

Query  1164  L-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKL  988
             + +  Q ++ SATI   +E++AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KL
Sbjct  375   VPNDSQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKL  434

Query  987   FDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLV  808
             F+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L 
Sbjct  435   FEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLE  494

Query  807   GDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEEN  628
             GD  V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +
Sbjct  495   GDYEVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNS  554

Query  627   KKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  555   KRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_004756299.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Mustela putorius furo]
 ref|XP_004756300.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Mustela putorius furo]
 ref|XP_004788558.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Mustela putorius furo]
 ref|XP_004788559.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Mustela putorius furo]
Length=617

 Score =   449 bits (1156),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 236/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  85    SEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  144

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +      + +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  145   KLSDPHKVDSGPESPLNAFYVYREHPFISN--LQEDQIENLKRQLGIVVQGQDVTRPIID  202

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  203   FEHCGFPEALNLNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  262

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  263   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPHMKTVLLVGGLPLPPQLY  315

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  316   RLRQHVKVIIATPGRLLDIIKQSSVELRGIKIVVVDEADTMLKMGFQQQVLDILENVPND  375

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS + ++   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  376   CQTILVSATIPASIEQLASQLLQNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  435

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  436   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  495

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  496   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQHGTAITFINNNSKRLF  555

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  556   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  585



>ref|XP_002717721.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Oryctolagus cuniculus]
 ref|XP_008266897.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Oryctolagus cuniculus]
 ref|XP_008266898.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Oryctolagus cuniculus]
 ref|XP_008266899.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Oryctolagus cuniculus]
Length=620

 Score =   449 bits (1155),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 240/521 (46%), Positives = 334/521 (64%), Gaps = 23/521 (4%)
 Frame = -1

Query  2046  GSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-EKS  1870
             G  ++  VK  S  QR A P EP CV+CGRYGEYICDETD+D+CSLECK   L  + +K 
Sbjct  85    GHPAEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICDETDEDVCSLECKAKHLLHVRDKG  144

Query  1869  RKPTPCPPPVRFPATDD---CYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPP  1699
               P P       P  D      YV  +     S  L  DQ E LR +L I V+G  V  P
Sbjct  145   GTPAPSSAQEADPEADPTPPAPYVYKEHPFILS--LHEDQVEHLRLQLGISVEGQGVPRP  202

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             I+ F  C  P  L  NL+ AGYE+PTPVQMQ +P  L+GR +L SA+TGSGKT +FL+P+
Sbjct  203   IIDFEHCGFPEALNHNLKTAGYEVPTPVQMQMLPVGLLGRDILASADTGSGKTAAFLLPV  262

Query  1518  VANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMAR  1342
             +   +    +C      P A+IL PTREL +QIE QAK L +G+P  +T L+VGG  M  
Sbjct  263   IVRAL-CESSC------PSALILTPTRELAVQIERQAKELMRGLPCMRTVLLVGGLPMPP  315

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             QLYR+   V +I+ TPGRL+D++ +  ++L  + + V+DE D ML+ GF +QV+ +  ++
Sbjct  316   QLYRLRQRVKVIIATPGRLLDIIKQSSVDLRGIKIVVVDEADTMLKMGFQQQVLDVLESV  375

Query  1161  -SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLF  985
              S  Q L+ SATI   +E+++S +      IS G+ N P  +V+Q+ +WVE   KK+KLF
Sbjct  376   PSDCQTLLVSATIPASIEQLSSQLLHDPVRISTGEKNLPCPSVRQIVLWVEDPAKKKKLF  435

Query  984   DILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVG  805
             +IL  ++ +KPPV+VFV  +LGADLLS A+   T L++VS+H EKS  +RR IL+  L G
Sbjct  436   EILNDRKLFKPPVLVFVDCKLGADLLSDAVQKVTALRSVSVHSEKSQTERRSILQGLLEG  495

Query  804   DVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENK  625
             D  V+V+TGVLGRG+DL+SVK V+ FDMP S+ EYVHQ+GR  R+G++GT+I FIN  +K
Sbjct  496   DYDVVVSTGVLGRGLDLISVKLVVNFDMPPSMDEYVHQVGRVGRLGQQGTAITFINNNSK  555

Query  624   KLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +LF ++ + +K +G+ +P +L NS Y         H++RRK
Sbjct  556   RLFWDVAKRVKPTGSLLPPQLLNSPY--------LHEQRRK  588



>ref|XP_007522130.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Erinaceus 
europaeus]
Length=619

 Score =   449 bits (1155),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 239/519 (46%), Positives = 333/519 (64%), Gaps = 25/519 (5%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKV  147

Query  1857  PCPPPVRFPAT-----DDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIM  1693
                 P    A         Y  R+    S    L  DQ E L+++L I V+G  V+ PI+
Sbjct  148   QVSSPQEADAEPGSLLSALYVYREHPFIS---SLHEDQIENLKQQLGISVQGQDVTRPII  204

Query  1692  SFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVA  1513
              F  C  P  L  NL+ +GYE+PTPVQMQ IP  L+GR +L SA+TGSGKT +FL+P++ 
Sbjct  205   DFEHCGFPETLNHNLKKSGYEVPTPVQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIL  264

Query  1512  NTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQL  1336
              T+  + A       P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QL
Sbjct  265   RTLFESNA-------PSALILTPTRELAIQIERQAKELMSGLPHMKTVLLVGGLPLPPQL  317

Query  1335  YRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-S  1159
             YR+   V +I+ TPGRL+D++ +  +EL ++ + V+DE D ML+ GF +QV+ I   + S
Sbjct  318   YRLRQHVKVIIATPGRLLDIINQSSVELSNIKIVVVDEADTMLKMGFQQQVLDILEKVPS  377

Query  1158  QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDI  979
               Q ++ SATI   +E +A+ +  +   I+ G+ N P   V+Q+ +WVE   KK+KLF+I
Sbjct  378   DCQTILVSATIPASIEHLANQLLHNPVRITAGEKNLPCANVRQIILWVEDPAKKKKLFEI  437

Query  978   LTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDV  799
             L  K+ +KPPV+VFV  +LGADLLS A+   T LK+VSIH EKS  +R+ IL+  L GD 
Sbjct  438   LNDKKLFKPPVLVFVDCKLGADLLSEAVQKITSLKSVSIHSEKSQIERKNILKGLLEGDY  497

Query  798   PVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKL  619
              V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GTSI FIN  +K+L
Sbjct  498   EVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTSITFINNNSKRL  557

Query  618   FPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             F ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   FWDVAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_007939290.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Orycteropus 
afer afer]
Length=621

 Score =   449 bits (1154),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 236/518 (46%), Positives = 337/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  90    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKG  149

Query  1857  PCPPPVRFPATDDC----YYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +  +C    +YV  +     +  L  DQ E L+++L IVV+G  V+ PI+ 
Sbjct  150   KLSSPQKADSGPECPLSAFYVYKEHPFILN--LQEDQIEHLKQQLGIVVQGQEVTRPIIE  207

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  208   FEHCGFPENLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  267

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE+QAK L  G+P  KT L+VGG  +  QLY
Sbjct  268   ------ALFEDK-TPSALILTPTRELAIQIEKQAKELMSGLPRMKTVLLVGGLPLPPQLY  320

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D +L+ GF +QV+ I   +   
Sbjct  321   RLRQHVKVIIATPGRLLDIIKQSSVELCDIKIVVVDEADTLLKMGFQQQVLDILENVPND  380

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I+ G+ N P   V+Q+ +W+E   KK+KLF+IL
Sbjct  381   CQTILVSATIPTSMEQLASQLLHNPVRITTGEKNLPCSNVRQIILWIEEPSKKKKLFEIL  440

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  441   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQVERQSILKGLLEGDYE  500

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  501   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQRGTAITFINNNSKRLF  560

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G  +P +L NS Y         H ++RK
Sbjct  561   WDIAKRVKPTGTILPPQLLNSPY--------LHDQKRK  590



>ref|XP_007086500.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Panthera 
tigris altaica]
Length=620

 Score =   448 bits (1153),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 236/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    E+ 
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +  +P        A  + +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSSPQKADSEPEAPLNAFYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNLNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGIKIVVVDEADTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++ S +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPASIEQLGSQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDRKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_003999408.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Felis catus]
Length=620

 Score =   448 bits (1153),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 236/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    E+ 
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +  +P        A  + +YV  +     +  L  DQ E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSSPQKADSEPEAPLNAFYVYKEHPFILN--LQEDQIENLKRQLGIVVQGQDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNLNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGIKIVVVDEADTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++ S +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPTSIEQLGSQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDRKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|NP_001179318.1| probable ATP-dependent RNA helicase DDX59 [Bos taurus]
 ref|XP_005217401.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Bos taurus]
 ref|XP_005217402.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Bos taurus]
 ref|XP_005217403.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Bos taurus]
 tpg|DAA21028.1| TPA: DEAD (Asp-Glu-Ala-Asp) box polypeptide 59-like [Bos taurus]
Length=620

 Score =   448 bits (1152),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 232/521 (45%), Positives = 329/521 (63%), Gaps = 31/521 (6%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G   +  VK  S  QR+A P EP CV+CGRYGEY+CDETD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLPEEPVKSFSKTQRQAEPGEPICVVCGRYGEYVCDETDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P P  +  T+  +             L  DQ E LR
Sbjct  138   LQVRGVEAASEPSRPQKAGSEPAAPGPAPYVYTEHAFVSH----------LREDQIENLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGRGVPRPIVDFEHCGFPEALNRNLKASGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++       L    + + P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVI-------LRALSQSKSPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG     Q +R+   + +I+ TPGRL+D++ +R +EL S+ + V+DE D ML
Sbjct  301   CLRTALLVGGLPAPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++A  + +    I+ G+ N P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTVLASATIPASVEQLACQLLRDPVAITAGERNLPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+ IL+  L GD  V+V+TGVLGRG+DL+ VK V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQMERKNILKGLLEGDYDVVVSTGVLGRGLDLVGVKLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  541   GQHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  581



>ref|XP_004028162.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
1 [Gorilla gorilla gorilla]
Length=619

 Score =   447 bits (1150),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_006078494.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Bubalus bubalis]
 ref|XP_006078495.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Bubalus bubalis]
 ref|XP_006078496.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Bubalus bubalis]
Length=620

 Score =   447 bits (1150),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 231/521 (44%), Positives = 330/521 (63%), Gaps = 31/521 (6%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G   +  VK  S  QR+A P EP CV+CGRYGEY+CDETD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLPEEPVKSFSKTQRQAEPGEPICVVCGRYGEYVCDETDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P    +  T+  +             L  DQ E LR
Sbjct  138   LQVRGAEAVSEPSRPQKAGSEPAAPGLAPYVYTEHAFVAH----------LREDQIENLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGRGVPRPIVDFEHCGFPEALNRNLKASGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++   +        + + P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVIVRAL-------SQSKSPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG     Q +R+   + +I+ TPGRL+D++ +R +EL S+ + V+DE D ML
Sbjct  301   CLRTALLVGGLPAPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++A  + +    I+ G+ N P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTVLASATIPASVEQLACQLLRDPVAITAGERNLPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+++L+  L GD  V+V+TGVLGRGVDL+SVK V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQMERKDVLKGLLEGDYDVVVSTGVLGRGVDLVSVKLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  541   GQHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  581



>ref|NP_001026895.2| probable ATP-dependent RNA helicase DDX59 [Homo sapiens]
 sp|Q5T1V6.1|DDX59_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DDX59; AltName: 
Full=DEAD box protein 59; AltName: Full=Zinc finger HIT 
domain-containing protein 5 [Homo sapiens]
Length=619

 Score =   447 bits (1150),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_003264573.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
1 [Nomascus leucogenys]
Length=619

 Score =   447 bits (1150),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKQEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPHKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLFVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_006740550.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Leptonychotes 
weddellii]
Length=620

 Score =   447 bits (1150),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 235/518 (45%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEERL  147

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P +  +      + +YV  +     +  L  +Q E L+R+L IVV+G  V+ PI+ 
Sbjct  148   KLSDPQKADSGPESPLNAFYVYKEHPFILN--LQENQIENLKRQLGIVVQGVDVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVITR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +     C  +   P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   AL-----CESKT--PSALILTPTRELAIQIESQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLRQHVKVIIATPGRLLDIIKQSSVELRGIKIVVVDEADTMLKMGFQQQVLDILENVPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTVLVSATIPTSIEQLASQLLHNPVRIITGEKNLPCSSVRQIILWVEEPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSIHSEKSQTERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLITVKLVVNFDMPSSMDEYVHQVGRVGRLGQHGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_005909327.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Bos mutus]
 gb|ELR46448.1| Putative ATP-dependent RNA helicase DDX59 [Bos mutus]
Length=620

 Score =   447 bits (1149),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 331/521 (64%), Gaps = 31/521 (6%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G  ++  VK  S  QR+A P EP CV+CGRYGEY+CD+TD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLAEEPVKSFSKTQRQAEPGEPICVVCGRYGEYVCDDTDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P P  +  T+  +             L  DQ + LR
Sbjct  138   LQVRGVEAASEPSRPQKAGSEPAAPGPAPYVYTEHAFISH----------LREDQIDNLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGRGVPRPIVDFEHCGFPEALNRNLKASGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++       L    + + P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVI-------LRALSQSKSPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG     Q +R+   + +I+ TPGRL+D++ +R +EL S+++ V+DE D ML
Sbjct  301   CLRTALLVGGLPAPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSINIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++A  + +    I+ G+ N P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTVLASATIPASVEQLACQLLRDPVAITAGERNLPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+ IL+  L GD  V+V+TGVLGRG+DL+ VK V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQMERKNILKGLLEGDYDVVVSTGVLGRGLDLVGVKLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  541   GQHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  581



>ref|XP_005653853.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Sus scrofa]
 ref|XP_005653854.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Sus scrofa]
 ref|XP_005653855.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Sus scrofa]
Length=607

 Score =   446 bits (1148),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 237/522 (45%), Positives = 333/522 (64%), Gaps = 41/522 (8%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI---EKSRKP--  1861
             VK  S  QR A P EP CV+CGR+GEYICDETD+D+CSLECK   L ++   E+ R+P  
Sbjct  81    VKSFSKTQRWAEPGEPVCVVCGRFGEYICDETDEDVCSLECKAKHLLQVRAAEEQREPPQ  140

Query  1860  -------TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSP  1702
                     PCP    +  T+  +             L  DQ E LR +L IVV+G  V  
Sbjct  141   EGSSEPGAPCP--ASYVYTEHAFISN----------LREDQIENLRGQLGIVVEGRGVPR  188

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+ FG C  P  L  NL+ AGYE+PTP+QMQ IP  L+GR LL SA+TGSGKT +FL+P
Sbjct  189   PIIDFGHCGFPETLNFNLKTAGYEVPTPIQMQMIPVGLLGRDLLASADTGSGKTAAFLLP  248

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMA  1345
             ++   +        + + P A++L PTREL IQIE QAK L  G+P  +TAL+VGG    
Sbjct  249   VITRALV-------QSKAPSALVLTPTRELAIQIERQAKELMGGLPRMRTALLVGGLPAP  301

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRA  1165
              QL+R+   V +I+ TPGRL+D++ +  ++L ++ + V+DE D ML+ GF EQV+ +   
Sbjct  302   PQLHRLRQRVQVIIATPGRLLDIMKQSSVDLGNIKIVVVDEADTMLKMGFQEQVLDVLEN  361

Query  1164  LSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKL  988
             + Q  Q ++ SATI   +E++AS +      +  G+ N P  +V+Q+ +WVE   KK+KL
Sbjct  362   VPQDCQTILVSATIPTRIEQLASRLLHDPVRVLAGEKNLPCPSVRQIVLWVEEPAKKKKL  421

Query  987   FDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLV  808
             F+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+ IL   L 
Sbjct  422   FEILNDKKLFKPPVLVFVDCKLGADLLSEAVEKITGLKSTSMHSEKSQIERKTILEGLLE  481

Query  807   GDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEEN  628
             GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +
Sbjct  482   GDYDVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNS  541

Query  627   KKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             K+LF ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  542   KRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHEQKRK  575



>ref|XP_001143546.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pan troglodytes]
Length=619

 Score =   447 bits (1149),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENVPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_005029220.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Anas platyrhynchos]
 ref|XP_005029221.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X4 [Anas platyrhynchos]
 gb|EOA94600.1| Putative ATP-dependent RNA helicase DDX59, partial [Anas platyrhynchos]
Length=626

 Score =   447 bits (1149),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 238/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  D   E  +K  S  QR A P EP CV+CGRYGEYICD+TD+DICSLECK   
Sbjct  82    KDNQNTNEDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDICSLECKAKH  141

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +I+      KS +PT           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  142   LLQIQEKEKKLKSDQPTKAESQAEADLLNTPYFYKD---HSFILGLQDEQVENLKLQLGI  198

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              ++G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  199   AIQGQQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  258

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  259   GKTAAFLLPVIMKVLK-------EAETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  311

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  312   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQNSVQLHGIKIVVVDEVDTMLKMGFQ  371

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +      I+VG+ N+P   V+Q+ +WV
Sbjct  372   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHDFVRITVGEKNRPCSNVRQIILWV  431

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R
Sbjct  432   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVER  491

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
               +L+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  492   TAVLQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  551

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  552   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  595



>ref|XP_009281451.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Aptenodytes 
forsteri]
 gb|KFM10149.1| putative ATP-dependent RNA helicase DDX59 [Aptenodytes forsteri]
Length=624

 Score =   447 bits (1149),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 237/516 (46%), Positives = 332/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T           D  Y+ RD    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKEKKLKSDQLTKAESQAETHLLDTPYFYRD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPAGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_003893385.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Papio anubis]
 ref|XP_009188776.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Papio anubis]
 ref|XP_009188783.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Papio anubis]
Length=620

 Score =   446 bits (1148),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 336/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLQQQVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   YQTILVSATIPSSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQMERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_010829376.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Bison bison 
bison]
 ref|XP_010829377.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Bison bison 
bison]
 ref|XP_010829378.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Bison bison 
bison]
Length=620

 Score =   446 bits (1148),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 330/521 (63%), Gaps = 31/521 (6%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G  ++  VK  S  QR+A P EP CV+CGRYGEY+CD+TD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLAEEPVKSFSKTQRQAEPGEPICVVCGRYGEYVCDDTDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P P  +  T+  +             L  DQ + LR
Sbjct  138   LQVRGVEAASEPSRPQKAGSEPAAPGPAPYVYTEHAFISH----------LREDQIDNLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGRGVPRPIVDFEHCGFPEALNRNLKASGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++       L    + + P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVI-------LRALSQSKSPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG     Q +R+   + +I+ TPGRL+D++ +R +EL S+ + V+DE D ML
Sbjct  301   CLRTALLVGGLPAPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++A  + +    I+ G+ N P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTVLASATIPASVEQLACQLLRDPVAITAGERNLPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+ IL+  L GD  V+V+TGVLGRG+DL+ VK V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQMERKNILKGLLEGDYDVVVSTGVLGRGLDLVGVKLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  541   GQHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  581



>gb|EHH50682.1| hypothetical protein EGM_01547 [Macaca fascicularis]
Length=620

 Score =   446 bits (1148),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 235/518 (45%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDRTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +        + + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ALF-------KSKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLQQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   YQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_005423763.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Geospiza 
fortis]
Length=622

 Score =   446 bits (1147),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/545 (44%), Positives = 339/545 (62%), Gaps = 28/545 (5%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDE  1933
             ++  F    T +   +++ +  GS  +  +K  S  QR A P EP CV+CGRYGEYICDE
Sbjct  67    AAADFGVTNTPLAKDSQNTEDDGS-LEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDE  125

Query  1932  TDDDICSLECKTILLSRIEKSRK------PTPCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             TD+D+CSLECK   L + +   K       T C        T   Y+ +D    S    L
Sbjct  126   TDEDVCSLECKAKHLLQTQAKEKQLTSDQATDCQAEAHLLNTP--YFYKD---HSFILGL  180

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               +Q E L+ +L I V+G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  
Sbjct  181   QEEQVENLKLQLGIAVQGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVG  240

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQ  1411
             L+GR +L SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE Q
Sbjct  241   LLGRDILASADTGSGKTAAFLLPVIMKVLK-------ETETPCALILAPTRELAIQIERQ  293

Query  1410  AKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
             AK L  G+P  +TAL+VGG  +  QL+R+   V +I+ TPGRL+++L +  ++L  + + 
Sbjct  294   AKELMVGLPNMRTALLVGGLPLPPQLHRLRQSVKVIIATPGRLLEILKQSSVQLHGIKII  353

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQL  1057
             V+DEVD ML+ GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G  
Sbjct  354   VVDEVDTMLKMGFQQQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGDK  413

Query  1056  NKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGL  877
             N P   V+Q+ +WVE   KK+KLF+IL   + +KPPV+VFV  +LGADLLS A+   TGL
Sbjct  414   NLPCSNVRQIILWVEEPSKKKKLFEILNDNKLFKPPVLVFVDCKLGADLLSDAVHKITGL  473

Query  876   KAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYV  697
             +  ++H EKS  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYV
Sbjct  474   QCTAMHSEKSQGERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYV  533

Query  696   HQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRH  517
             HQ+GRA R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          
Sbjct  534   HQVGRAGRLGHNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HD  586

Query  516   QKRRK  502
             QKRR+
Sbjct  587   QKRRE  591



>ref|XP_010360968.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Rhinopithecus roxellana]
Length=620

 Score =   446 bits (1147),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 337/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLQQLVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   YQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCASVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_004439030.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Ceratotherium 
simum simum]
Length=616

 Score =   446 bits (1146),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 240/536 (45%), Positives = 339/536 (63%), Gaps = 26/536 (5%)
 Frame = -1

Query  2088  ETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             E  +V   +  + SG   +  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSL
Sbjct  68    EVGVVGPEQGAEDSGL-VEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSL  126

Query  1908  ECKTILLSRIEKSRKPTPCPPPVRFPATDD-----CYYVRDDDKKSESKCLASDQAELLR  1744
             ECK   L R+++  +      P +  +  +      Y  R+    +    L  DQ E L+
Sbjct  127   ECKAKHLLRVQEEEEKLKLSSPQKADSEPESPLRAVYVYREHPFIAN---LQEDQVENLK  183

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I+V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L S
Sbjct  184   RQLGILVQGRDVPRPIIDFEHCGFPEALNHNLKTSGYEVPTPIQMQMIPVGLLGRDVLAS  243

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P+V        A SE K  P A+IL PTREL IQIE QAK L  G+P
Sbjct  244   ADTGSGKTAAFLLPVVIR------ALSESK-TPSALILTPTRELAIQIERQAKELMSGLP  296

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               KT L+VGG  +  QL+R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML
Sbjct  297   RMKTVLLVGGLPLPPQLHRLRQLVKVIIATPGRLLDIIKQNSVELCGIKIVVVDEADTML  356

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ I   +    Q ++ SATI   +E++A  +  +   +  G+ N P   V+Q
Sbjct  357   KMGFQQQVLDILENVPHDCQTILVSATIPASIEQLAGQLLHNPVRVITGEKNLPCSTVRQ  416

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EK
Sbjct  417   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKSISIHSEK  476

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             S  +R+ IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+
Sbjct  477   SQMERKNILKGLLEGDYEVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRL  536

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  537   GQNGTAITFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  584



>ref|XP_010147610.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Eurypyga 
helias]
 gb|KFW03101.1| putative ATP-dependent RNA helicase DDX59 [Eurypyga helias]
Length=624

 Score =   446 bits (1147),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 240/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS SE  +K  S  QR A P EP CV CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KGNQNTDKDSASEEPIKSFSKSQRWAEPGEPVCVACGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIEKSRKP------TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +  +KP      T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQDRKKPLKSDQLTKAESEAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMTGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLDILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I+VG+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITVGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>gb|AAH41801.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Homo sapiens]
 gb|AIC57250.1| DDX59, partial [synthetic construct]
Length=619

 Score =   446 bits (1146),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK +SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKRISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_005540405.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Macaca fascicularis]
 ref|XP_005540406.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Macaca fascicularis]
 gb|EHH22058.1| hypothetical protein EGK_05248 [Macaca mulatta]
Length=620

 Score =   446 bits (1146),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDRTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLQQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   YQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_005029219.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Anas platyrhynchos]
Length=641

 Score =   446 bits (1148),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 238/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  D   E  +K  S  QR A P EP CV+CGRYGEYICD+TD+DICSLECK   
Sbjct  97    KDNQNTNEDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDICSLECKAKH  156

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +I+      KS +PT           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  157   LLQIQEKEKKLKSDQPTKAESQAEADLLNTPYFYKD---HSFILGLQDEQVENLKLQLGI  213

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              ++G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  214   AIQGQQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  273

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  274   GKTAAFLLPVIMKVLK-------EAETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  326

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  327   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQNSVQLHGIKIVVVDEVDTMLKMGFQ  386

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +      I+VG+ N+P   V+Q+ +WV
Sbjct  387   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHDFVRITVGEKNRPCSNVRQIILWV  446

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R
Sbjct  447   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVER  506

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
               +L+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  507   TAVLQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  566

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  567   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  610



>ref|XP_006107799.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Myotis 
lucifugus]
Length=602

 Score =   445 bits (1144),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 242/530 (46%), Positives = 332/530 (63%), Gaps = 22/530 (4%)
 Frame = -1

Query  2073  AATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-  1897
             A  E     G  SD  VK  S  QR A P EP CV+CGRYGEYICDETD+D+CSLECK  
Sbjct  58    AGPEPGARDGLPSDEPVKSFSKTQRPAEPGEPVCVVCGRYGEYICDETDEDVCSLECKAK  117

Query  1896  -ILLSRIEKSRKPTPCPPPVRFPATDDCY--YVRDDDKKSESKCLASDQAELLRRKLNIV  1726
              +L  + ++ R     PP    P+       YV  +     S  L  DQ E LR +L I 
Sbjct  118   HLLQVKEKEERSALSGPPGAGSPSQAPLLTPYVYQEHPFIAS--LGEDQVENLRHQLGIC  175

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V  PI+ F  C  P  L  NL AAGYE+PTP+QMQ  P  L+GR +L SA+TGSG
Sbjct  176   VQGRAVPRPIVDFEHCAFPETLSLNLTAAGYEVPTPIQMQMTPVGLLGRDILASADTGSG  235

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   + L   C      P A+IL PTREL IQIE QAK L KG+P  KTAL
Sbjct  236   KTAAFLLPVIMRAL-LEGTC------PSALILTPTRELAIQIERQAKELMKGLPHMKTAL  288

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG  +  QL+R+   V +++ TPGRL+D++ +  ++L  V + V+DE D ML+ GF +
Sbjct  289   LVGGLPLPPQLHRLRQHVKVVIATPGRLLDIMKQSSVQLRGVKIAVVDEADTMLKMGFQQ  348

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ +   +    Q ++ SATI   +E++A  + +    I+ G+ N P   V+Q+ +WVE
Sbjct  349   QVLDVLEHVPHDCQTVLVSATIPASIEQLAGQLLRDPVRITAGEKNLPCPHVRQIVLWVE  408

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ ++PPV+VFV  RLGADLLS A+   TGL++VS+H EK   +RR
Sbjct  409   EPAKKKKLFEILNDKKLFQPPVLVFVDCRLGADLLSEAVQKVTGLRSVSMHSEKPQAERR  468

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL   L G   V+V+TGVLGRG+DL+ VK V+ FDMP+S+ EYVHQ+GR  R+G++GT+
Sbjct  469   SILEGLLGGAHEVVVSTGVLGRGLDLVRVKLVVNFDMPSSMDEYVHQVGRVGRLGQKGTA  528

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +K +G  +P +L NS Y        R Q+RR+
Sbjct  529   ITFINNNSKRLFWDVAKRVKPTGTLLPPQLLNSPYL-------RDQQRRE  571



>ref|XP_003498919.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cricetulus 
griseus]
 ref|XP_007632787.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cricetulus 
griseus]
 ref|XP_007633955.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cricetulus 
griseus]
 ref|XP_007633956.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cricetulus 
griseus]
Length=617

 Score =   445 bits (1145),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 240/543 (44%), Positives = 343/543 (63%), Gaps = 24/543 (4%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDE  1933
             +S S +  E S+V   E     G+ S+  VK  S  QR A P EP CV+CGRYGEYICD+
Sbjct  61    ASPSSQLAEVSLVGP-EQGVKDGAPSEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDK  119

Query  1932  TDDDICSLECKTILLSRIEKSRKPTPCPPPVRFPATD----DCYYVRDDDKKSESKCLAS  1765
             TD+D+CSLECK   L ++++ ++      P R  +      D +YV  +     +  L  
Sbjct  120   TDEDVCSLECKAKHLLQVKEEKESLKASSPQRAASEPESPLDAFYVYKEHPFIVT--LRE  177

Query  1764  DQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALM  1585
             DQ E L+++L I V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+
Sbjct  178   DQIETLKQQLGISVQGQEVARPIIDFEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLL  237

Query  1584  GRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAK  1405
             GR +L SA+TGSGKT +FL+P++        A  E K  P A+IL PTREL IQIE QAK
Sbjct  238   GRDILASADTGSGKTAAFLLPVIIR------ALLEDK-TPSALILTPTRELAIQIERQAK  290

Query  1404  VLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVI  1228
              L  G+P  KT L+VGG  +  QL+R+   V +I+ TPGRL+D++ +  + L  + + V+
Sbjct  291   ELMSGLPRMKTVLLVGGLPLPPQLHRLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVV  350

Query  1227  DEVDCMLQRGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNK  1051
             DE D ML+ GF +QV+ +      + Q ++ SATI   +E+ A  +  +   I  G  N 
Sbjct  351   DEADTMLKMGFQQQVLDVLENTPGERQTILVSATIPGSIEQFADQLLHNPVRIITGDKNL  410

Query  1050  PNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKA  871
             P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL +
Sbjct  411   PCPSVRQIILWVEDPGKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLNS  470

Query  870   VSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQ  691
              SIH EKS  +RR+IL+  L GD  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ
Sbjct  471   TSIHSEKSQVERRDILKGLLEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQ  530

Query  690   IGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQK  511
             +GR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H++
Sbjct  531   VGRVGRLGQNGTAITFINNNSKRLFWDVAKRVKPTGSILPPQLLNSPY--------LHEQ  582

Query  510   RRK  502
             +RK
Sbjct  583   KRK  585



>ref|XP_009817773.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Gavia stellata]
Length=624

 Score =   445 bits (1145),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 241/531 (45%), Positives = 339/531 (64%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT--  1897
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1896  ILLSRIE----KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             +LLS+ +    KS K T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLLSQEKEKKLKSDKLTKAESQAETHLLNTPYFYQD---HSFILGLRDEQVENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETEAPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRLI++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLIEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILENISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPXSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_004375372.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Trichechus 
manatus latirostris]
Length=618

 Score =   445 bits (1144),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/517 (45%), Positives = 332/517 (64%), Gaps = 22/517 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRK--  1864
             S+  VK  S  QR A P EP CVICGRYGEYICD+T++D+CSLECK   L   EK  K  
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVICGRYGEYICDKTEEDVCSLECKAKHLQVKEKEEKGK  146

Query  1863  -PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSF  1687
               +P        +    +Y+  +     +  L  DQ E L+++L IVV+G  V+ PI+ F
Sbjct  147   LSSPQKADSESESLFSAFYIYKEHPFILN--LQEDQIEHLKQQLGIVVQGQEVTRPIIEF  204

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
               C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++   
Sbjct  205   EHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIRA  264

Query  1506  VKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYR  1330
             +          + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLYR
Sbjct  265   LL-------EDRTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLYR  317

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-  1153
             +   V +I+ TPGRL+D++ +  +EL ++ + V+DE D ML+ GF +QV+ I   +    
Sbjct  318   LRQRVKVIIATPGRLLDIIKQSAVELCNIKIVVVDEADTMLKMGFQQQVLDILENVPNDC  377

Query  1152  QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILT  973
             Q ++ SATI   +E++AS +  +   I+ G+ N P   V+Q+ +W+E   KK+KLF+IL 
Sbjct  378   QTILVSATIPTSMEQLASQLLHNPVRITTGEKNLPCSNVRQIILWIEEPSKKKKLFEILN  437

Query  972   SKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPV  793
              K+ +KPPV+VFV  RLGADLLS A+   TGLK++S+H EKS  +R+ IL+  L GD  V
Sbjct  438   DKKLFKPPVLVFVDCRLGADLLSEAVQKITGLKSISVHSEKSQIERKNILKGLLEGDYEV  497

Query  792   IVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFP  613
             +V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF 
Sbjct  498   VVSTGVLGRGLDLINVKLVVNFDMPSSMDEYVHQVGRVGRLGQRGTAITFINNNSKRLFW  557

Query  612   ELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             ++ + +K +G  +P +L NS Y         H ++RK
Sbjct  558   DITKRVKPTGTILPPQLLNSPY--------LHDQKRK  586



>ref|XP_006155512.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Tupaia chinensis]
 ref|XP_006155513.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Tupaia chinensis]
 ref|XP_006155514.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Tupaia chinensis]
 ref|XP_006155515.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X4 [Tupaia chinensis]
Length=620

 Score =   445 bits (1144),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 243/537 (45%), Positives = 340/537 (63%), Gaps = 28/537 (5%)
 Frame = -1

Query  2088  ETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             E S+V + + +Q S   ++  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSL
Sbjct  72    EVSLVGSEQGSQDS-HPAEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSL  130

Query  1908  ECKTILLSRI-EKSRK-----PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             ECK   L ++ EK  K     P    P   FP   +  YV  +     +  L  DQ E L
Sbjct  131   ECKAKHLLQVKEKEEKLKLSSPQEAGPEPVFPL--NALYVYKEHPFILN--LREDQIENL  186

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             +++L I V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTPVQMQ IP  L+GR +L 
Sbjct  187   KQQLGISVQGQQVARPIIDFEHCGFPEALNLNLKKSGYEVPTPVQMQMIPVGLLGRDILA  246

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
             SA+TGSGKT +FL+P++   +          Q P A++L PTREL IQIE QAK L  G+
Sbjct  247   SADTGSGKTAAFLLPVIIRALF-------ESQTPSALVLTPTRELAIQIERQAKELMSGL  299

Query  1386  P-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCM  1210
             P  KT L+VGG  +  QL+R+   V +IV TPGRL+D++ +  +EL  + + V+DE D M
Sbjct  300   PRMKTVLLVGGLPLPPQLHRLRQHVKVIVATPGRLLDIIKQGSVELHGIKIVVVDEADTM  359

Query  1209  LQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVK  1033
             L+ GF +QV+ I   +    Q ++ SATI   +E++A+ +      I+ G  N P   V+
Sbjct  360   LKMGFQQQVLDILENVPNDCQTILVSATIPTSIEQLANRLLHDPVRITTGGKNLPCSNVR  419

Query  1032  QLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGE  853
             Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ SIH E
Sbjct  420   QIILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVEKITGLKSTSIHSE  479

Query  852   KSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASR  673
             KS  +R+ IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R
Sbjct  480   KSQTERKNILKGLLEGDYEVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGR  539

Query  672   MGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  540   LGQNGTAITFINNNSKRLFWDVAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_007421698.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Python 
bivittatus]
Length=621

 Score =   445 bits (1144),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 346/535 (65%), Gaps = 25/535 (5%)
 Frame = -1

Query  2082  SIVAATES---NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             S +A TES   N      ++  +K  S  QR     EP CV+CGRYGEYICD+TD+D+CS
Sbjct  72    SALALTESELGNNEGCCATEEPIKSFSKTQRWPQSGEPVCVVCGRYGEYICDKTDEDVCS  131

Query  1911  LECKTILLSRI---EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRR  1741
             LECK   L ++   E+S KPT        P   D  Y  ++++   S  L  +Q E L++
Sbjct  132   LECKAKHLLQVKGEEESSKPTKNEKANSQPIFLDAAYAYEENEFLLS--LQDEQIESLKQ  189

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I V+G  V+ PI+ FG C  P  L  NL+ AGYE+PTPVQMQ IP  L GR ++ +A
Sbjct  190   QLGITVQGQGVARPIVEFGHCGFPEILSGNLKKAGYEVPTPVQMQMIPVGLQGRDIVATA  249

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P++       +  SE      A+IL PTREL IQIE+QAK L  G+P 
Sbjct  250   DTGSGKTAAFLLPVI-------IKASEETNTLSALILTPTRELAIQIEKQAKELMIGLPN  302

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +T L+VGG  +  QL+R++  V +I+ TPGRL ++L +  I+L ++ + VIDEVD ML+
Sbjct  303   MRTVLLVGGLPLPPQLHRLKQNVKVIIATPGRLQEILKQCSIQLHNIKIVVIDEVDTMLK  362

Query  1203  RGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV++I   + +  Q ++ SAT+   +E++A+ + ++   I+VG+ N P  +V+Q+
Sbjct  363   MGFQQQVLEILENIPNDHQTILVSATMPLSIEQLANRLLQNPVKITVGEKNLPCSSVRQI  422

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +W+E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H EKS
Sbjct  423   ILWIEEPSKKKKLFEILNDKKLFKPPVLVFVECKLGADLLSNAVHKITGLQSTSMHAEKS  482

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R  IL+  L G   V+V+TGVLGRG+DL+++K V+ FDMP+S+ EYVHQ+GRA R+G
Sbjct  483   QSERTAILQGLLQGKYEVVVSTGVLGRGLDLVNIKLVVNFDMPSSMDEYVHQVGRAGRLG  542

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
               GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y         H ++RK
Sbjct  543   HSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQKRK  589



>ref|XP_005375200.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Chinchilla lanigera]
 ref|XP_005375201.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Chinchilla lanigera]
Length=620

 Score =   444 bits (1143),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 239/532 (45%), Positives = 337/532 (63%), Gaps = 30/532 (6%)
 Frame = -1

Query  2103  SFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDD  1924
             + + +E  +VA  E N+ +    +  VK  S  QR A P EP CV+CGRYGEYICD+TD+
Sbjct  67    AHQVVEVGLVAP-EQNEKNSPPFEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDE  125

Query  1923  DICSLECKTILLSRI-EKSRK----------PTPCPPPVRFPATDDCYYVRDDDKKSESK  1777
             D+CSLECK   L ++ EK  K            P  P   F    +  ++ D        
Sbjct  126   DVCSLECKAKHLLQVKEKEEKLNLSDVHNAGSEPESPLTAFYVYREHPFISD--------  177

Query  1776  CLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIP  1597
              L  DQ E L+++L I V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP
Sbjct  178   -LQEDQIENLKQQLGISVQGQEVTRPIIDFEHCGFPEALNHNLKKSGYEVPTPIQMQMIP  236

Query  1596  AALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIE  1417
               L+GR ++ SA+TGSGKT +FL+P++        A  E K  P A+IL PTREL IQIE
Sbjct  237   VGLLGRDIVASADTGSGKTAAFLLPVIIR------ALPESK-TPSAVILTPTRELAIQIE  289

Query  1416  EQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVS  1240
              QAK L  G+P  +T L+VGG  +  QLYR+   V +I+ TPGRL+D++ +  +EL  + 
Sbjct  290   RQAKELMSGLPRMRTVLLVGGLPLPPQLYRLRQHVKVIIATPGRLLDIIKQNAVELSGIK  349

Query  1239  MFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVG  1063
             + V+DE D ML+ GF +QV+ I   +    Q ++ SATI   +E++AS +  +   I  G
Sbjct  350   IVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPASIEQLASQLLHNPVRIVTG  409

Query  1062  QLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITIST  883
             + N P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   T
Sbjct  410   EKNLPCPSVRQIVLWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKIT  469

Query  882   GLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKE  703
             GLK+ SIH EKS  +R+ IL+  L GD  V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ E
Sbjct  470   GLKSTSIHSEKSQIERKSILKGLLEGDYEVVVSTGVLGRGLDLVSVRLVVNFDMPSSMDE  529

Query  702   YVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             YVHQIGR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  530   YVHQIGRVGRLGQNGTAITFINNSSKRLFWDIAKRIKPTGSILPPQLLNSPY  581



>ref|XP_004312578.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Tursiops 
truncatus]
Length=621

 Score =   444 bits (1143),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 237/530 (45%), Positives = 332/530 (63%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI---  1879
             DSD     VK  S  QR+A P EP CV+CGRYGEYIC+ETD+D+CSLECK   L ++   
Sbjct  85    DSDLLEEPVKSFSKTQRQAEPGEPVCVVCGRYGEYICNETDEDVCSLECKAKHLLQVRGA  144

Query  1878  ---------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
                      +K+      P P  +  T+  +             L  DQ E LRR+L IV
Sbjct  145   EALLAPGGPQKAGSEPAAPHPASYVYTEHAFISN----------LREDQIENLRRQLGIV  194

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ +P  L+GR +L SA+TGSG
Sbjct  195   VQGPGVPRPIIDFEHCGFPEALNLNLKTSGYEIPTPIQMQMVPLGLLGRDVLASADTGSG  254

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +        + + P A+IL PTREL IQIE QAK L  G+P  +TAL
Sbjct  255   KTAAFLLPVIMRALF-------QSKMPSALILTPTRELAIQIEHQAKELMSGLPRMRTAL  307

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     QL+R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +
Sbjct  308   LVGGLPAPPQLHRLRQRVQVIIATPGRLLDIIKQSAVELGGIKIVVVDEADTMLKMGFQQ  367

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ +   + +  Q L+ SATI   +E++AS + +    I  G+ N P   V+Q+ +WVE
Sbjct  368   QVLDVLENVPRDCQTLLASATIPASIEQLASQLLRDPVRIITGEKNLPCSNVRQIVLWVE  427

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+
Sbjct  428   EPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSEKSQPERK  487

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP S+ EYVHQ+GR  R+G+ GT+
Sbjct  488   NILKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPPSMDEYVHQVGRVGRLGQNGTA  547

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H +RRK
Sbjct  548   ITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHDQRRK  589



>ref|XP_005029218.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Anas platyrhynchos]
Length=702

 Score =   447 bits (1150),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 331/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  D   E  +K  S  QR A P EP CV+CGRYGEYICD+TD+DICSLECK   
Sbjct  158   KDNQNTNEDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDICSLECKAKH  217

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +I+      KS +PT           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  218   LLQIQEKEKKLKSDQPTKAESQAEADLLNTPYFYKD---HSFILGLQDEQVENLKLQLGI  274

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              ++G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  275   AIQGQQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  334

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  335   GKTAAFLLPVIMKVLK-------EAETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  387

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  388   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQNSVQLHGIKIVVVDEVDTMLKMGFQ  447

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +      I+VG+ N+P   V+Q+ +WV
Sbjct  448   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHDFVRITVGEKNRPCSNVRQIILWV  507

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R
Sbjct  508   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVER  567

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
               +L+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  568   TAVLQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  627

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  628   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  663



>ref|XP_003938296.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Saimiri boliviensis boliviensis]
Length=620

 Score =   444 bits (1143),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE-KSRKP  1861
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++E K  K 
Sbjct  88    SEEPVKSFSKTQRWPEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVEEKEEKS  147

Query  1860  TPCPP---PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
               C P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLCNPQKAACESESAPNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ AGYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEVLNRNLKKAGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  ERK  P A+IL PTREL IQIE QAK L  G+P  KTAL+VGG  +  QLY
Sbjct  266   ------ALFERK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTALLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D+  +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLQQHVKVIIATPGRLLDIRKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +K PV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKSPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDFE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_001493676.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Equus caballus]
Length=616

 Score =   444 bits (1142),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 239/521 (46%), Positives = 329/521 (63%), Gaps = 29/521 (6%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-ILLSRIEKSRKP  1861
             S+  VK  S  QR A P EP CV+CGRYGEYICD TD+D+CSLECK   LL+  E+  K 
Sbjct  84    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDRTDEDVCSLECKARHLLTVQEEEEKL  143

Query  1860  TPCPP------PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPP  1699
                 P      P   P     Y      +      L  DQ E L+R+L IVV+G  V  P
Sbjct  144   KLGGPQGADSEPASLPQAGYVY-----KEHPFISNLQGDQIENLKRQLGIVVQGRDVPRP  198

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             I+ F  C  P  L  NL+ AGYE+PTP+QMQ +P  L+GR +L SA+TGSGKT +FL+P+
Sbjct  199   IIDFEHCGFPEALNHNLKEAGYEVPTPIQMQMVPVGLLGRDILASADTGSGKTAAFLLPV  258

Query  1518  VANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMAR  1342
             +       L      + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  
Sbjct  259   I-------LRALLESKTPAALILTPTRELAIQIERQAKELMTGLPRMKTVLLVGGLPLPP  311

Query  1341  QLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL  1162
             QL+R+   V +I+ TPGRL+D++ +  ++L  + + V+DE D ML+ GF +QV+ +   +
Sbjct  312   QLHRLRQHVKVIIATPGRLLDIIKQNAVDLCGIKIVVVDEADTMLKMGFQQQVLDVLENV  371

Query  1161  SQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLF  985
              Q  Q ++ SATI   +E++A  +  +   I  G+ N P  +V+Q+ +W+E   KK+KLF
Sbjct  372   PQDCQTILVSATIPTSIEQLAGQLLHNPVRIVTGEKNLPCSSVRQIILWIEEPAKKKKLF  431

Query  984   DILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVG  805
             +IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +RR IL+  L G
Sbjct  432   EILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKSVSIHSEKSQTERRNILKGLLEG  491

Query  804   DVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENK  625
             D  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K
Sbjct  492   DYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSK  551

Query  624   KLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  552   RLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  584



>ref|XP_005885059.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Myotis brandtii]
 ref|XP_005885060.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Myotis brandtii]
 gb|EPQ19454.1| Putative ATP-dependent RNA helicase DDX59 [Myotis brandtii]
Length=598

 Score =   443 bits (1140),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 247/550 (45%), Positives = 341/550 (62%), Gaps = 26/550 (5%)
 Frame = -1

Query  2121  FNHSSGS-FKAMETSIVAATESNQPSGSDS---DSEVKKRSWEQREALPDEPKCVICGRY  1954
             +   SGS   A+ T   AA    Q    DS   D  VK  +  QR A P EP CV+CGRY
Sbjct  34    WEEGSGSPADAVPTGDAAAAHRPQAGARDSLPSDEPVKSFAKTQRPAEPGEPVCVVCGRY  93

Query  1953  GEYICDETDDDICSLECKTILLSRI----EKSRKPTPCPPPVRFPATDDCYYVRDDDKKS  1786
             GEYICDETD+D+CSLECK   L ++    E+S    P     +  A     YV  +    
Sbjct  94    GEYICDETDEDVCSLECKAKHLLQVKEKEERSALSGPRGADSQPQAPLLTPYVYQEHPFI  153

Query  1785  ESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQ  1606
              S  L  DQ E LR +L I V+G  V+ PI+ F  C  P  L  NL+AAGYE+PTP+QMQ
Sbjct  154   AS--LGEDQVENLRHQLGICVQGRAVARPIVDFDHCAFPETLSLNLKAAGYEVPTPIQMQ  211

Query  1605  AIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCI  1426
               P  L+GR +L SA+TGSGKT +FL+P++   + L   C      P A+IL PTREL I
Sbjct  212   MTPVGLLGRDILASADTGSGKTAAFLLPVIMRAL-LEGTC------PSALILTPTRELAI  264

Query  1425  QIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELD  1249
             QIE QAK L KG+P  KTAL+VGG  +  QL+R+   V +++ TPGRL+D++ +  ++L 
Sbjct  265   QIERQAKELMKGLPRMKTALLVGGLPLPPQLHRLRQHVKVVIATPGRLLDIMKQSSVQLR  324

Query  1248  SVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVI  1072
              V + V+DE D ML+ GF +QV+ +   +    Q ++ SATI   +E++A  + +    I
Sbjct  325   GVKIAVVDEADTMLKMGFQQQVLDVLEHVPHDCQTVLVSATIPASIEQLAGQLLRDPVRI  384

Query  1071  SVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAIT  892
             + G+ N P   V+Q+ +WVE   KK+KLF+IL  K+ ++PPV+VFV  RLGADLLS A+ 
Sbjct  385   TAGEKNLPCPHVRQIVLWVEEPAKKKKLFEILNDKKLFQPPVLVFVDCRLGADLLSKAVQ  444

Query  891   ISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNS  712
               TGL++VS+H EK   +RR IL   L G   V+V+TGVLGRG+DL+ VK V+ FDMP+S
Sbjct  445   KVTGLRSVSMHSEKPQAERRSILEGLLGGAHEVVVSTGVLGRGLDLVRVKLVVNFDMPSS  504

Query  711   IKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSF  532
             + EYVHQ+GR  R+G++GT+I FIN  +K+LF ++ + +K +G  +P +L NS Y     
Sbjct  505   MDEYVHQVGRVGRLGQKGTAITFINNNSKRLFWDVAKRVKPTGTLLPPQLLNSPYL----  560

Query  531   SVGRHQKRRK  502
                R Q+RR+
Sbjct  561   ---RDQQRRE  567



>emb|CAL38423.1| hypothetical protein [synthetic construct]
 dbj|BAG72520.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [synthetic construct]
Length=619

 Score =   444 bits (1142),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK +SIH EK   +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKRISIHSEKPQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_009987672.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Tauraco 
erythrolophus]
 gb|KFV02909.1| putative ATP-dependent RNA helicase DDX59 [Tauraco erythrolophus]
Length=624

 Score =   444 bits (1142),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 238/531 (45%), Positives = 338/531 (64%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T   P       +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEREKKLKSDQLTKAEPQAGSHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVEGQHVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------EMETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +++ TPGRL+++L +  ++L  V + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQNVKVVIATPGRLLEILKQSSVQLHGVKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEGISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_004578843.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Ochotona 
princeps]
Length=620

 Score =   444 bits (1141),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 235/531 (44%), Positives = 338/531 (64%), Gaps = 28/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDS---DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTI  1894
             E   P   DS   D  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK  
Sbjct  76    EGPHPGTKDSHPADEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAK  135

Query  1893  LLSRIEKSRKPTPCPPPVRF-----PATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
              L R++   +P     P +       A    Y  R+    +    L   Q   L+++L I
Sbjct  136   HLLRVKGMGEPGEASGPHQAGPELASAPHTAYAYREHPFIAS---LHEGQVANLKQQLGI  192

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
             VV G  V  PI+ F  C  P  L  NL+ AGYE+PTP+QMQ +P  L+GR +L SA+TGS
Sbjct  193   VVHGHKVPRPIIEFEHCGFPEALNHNLKRAGYEVPTPIQMQLMPVGLLGRDILASADTGS  252

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +     C      P A+IL PTREL IQIE+QAK L  G+P  KT 
Sbjct  253   GKTAAFLLPVIMRAL-----CE--STSPCALILTPTRELAIQIEKQAKELMNGLPRMKTV  305

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QLYR+   V +I+ TPGRL+D++ +  +EL  + + VIDE D ML+ GF 
Sbjct  306   LLVGGLPLPPQLYRLRQHVKVIIATPGRLLDIIKQNSVELHGIKIVVIDEADTMLKMGFQ  365

Query  1191  EQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I  ++    Q ++ SATI   +E++++ + +    ++ G+ + P  +V+Q+ +WV
Sbjct  366   QQVLDILESVPGDCQTILVSATIPASIEQLSNQLLQDPVRVTAGEKSVPCASVRQIVLWV  425

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF++L  ++ +KPPV+VFV  +LGADLLS A+   TGLK+VS+H EKS  +R
Sbjct  426   EDPAKKRKLFEVLNDRKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSVSMHSEKSQTER  485

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
             + IL+  L G+  V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G++GT
Sbjct  486   KNILQGLLEGNYDVVVSTGVLGRGLDLVSVRLVVNFDMPSSMDEYVHQVGRVGRLGQQGT  545

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +K+LF ++V+ +K +G+ +P +L NS Y         H++RRK
Sbjct  546   AITFINNNSKRLFWDVVKRVKPTGSLLPPQLLNSPY--------LHEQRRK  588



>ref|XP_008567804.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Galeopterus 
variegatus]
 ref|XP_008567805.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Galeopterus 
variegatus]
Length=619

 Score =   444 bits (1141),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 230/518 (44%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++  +  
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVQEKEEKL  146

Query  1857  PCPPPVRF-PATD---DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P R  P  +   + +YV  +     +  L  +Q E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSSPQRADPEPESALNAFYVYKEHPFILN--LQENQVENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +          Q P A++L PTREL +QIE QAK L  G+P  KT L+VGG  +  QL+
Sbjct  265   ALF-------ESQAPSALVLTPTRELAVQIERQAKELMSGLPRMKTVLLVGGLPLPPQLH  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLRQHVKVIIATPGRLLDIIKQSSVELSGIKIVVVDEADTMLKMGFQQQVLDILENVPDD  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++ S +  +   I  G+ N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLTSQLLDNPVRIITGEKNLPCSSVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSEKSQTERKNILKGLLEGDYD  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_005073490.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Mesocricetus 
auratus]
Length=618

 Score =   443 bits (1140),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 338/542 (62%), Gaps = 23/542 (4%)
 Frame = -1

Query  2109  SGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDET  1930
             S S +  E  +V   +  + S   S+  VK  S  QR A P EP CV+CGRYGEYICD+T
Sbjct  62    SPSSQLAEVCLVGPEQGVKDSSVPSEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKT  121

Query  1929  DDDICSLECKTILLSRIEKSRKPTPCPPPVRFPATD----DCYYVRDDDKKSESKCLASD  1762
             D+D+CSLECK   L R ++  +      P R  +      D  YV  +     +  L  D
Sbjct  122   DEDVCSLECKAKHLLRAKEEEESLKASSPQRAASEPESPLDASYVYKEHPFIVT--LRED  179

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             Q E L+++L I V+G  V+ PI+ F  C  P  L  NL+ +GY++PTP+QMQ IP  L+G
Sbjct  180   QIETLKQQLGISVQGQEVARPIIDFEHCGFPETLNQNLKKSGYDVPTPIQMQMIPVGLLG  239

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             R +L SA+TGSGKT +FL+P++   +          Q P A+IL PTREL IQIE QAK 
Sbjct  240   RDILASADTGSGKTAAFLLPVIIRALL-------EDQTPSALILTPTRELAIQIERQAKE  292

Query  1401  LGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVID  1225
             L  G+P  KT L+VGG  +  QL+R+   V +I+ TPGRL+D++ +  + L  + + V+D
Sbjct  293   LMSGLPRMKTVLLVGGLPLPPQLHRLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVD  352

Query  1224  EVDCMLQRGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKP  1048
             E D ML+ GF +QV+ +   +    Q ++ SATI   +E++A  +  +   I  G  N P
Sbjct  353   EADTMLKMGFQQQVLDVLENIPGDCQTILVSATIPGSIEQLADQLLHNPVRIITGDKNLP  412

Query  1047  NGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAV  868
               +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL + 
Sbjct  413   CPSVRQIILWVEDPGKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLNST  472

Query  867   SIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQI  688
             SIH EKS  +RR+IL+  L GD  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+
Sbjct  473   SIHSEKSQVERRDILKGLLEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQV  532

Query  687   GRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKR  508
             GR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H++R
Sbjct  533   GRVGRLGQNGTAITFINNNSKRLFWDVAKRVKPTGSILPPQLLNSPY--------LHEQR  584

Query  507   RK  502
             RK
Sbjct  585   RK  586



>emb|CAL38329.1| hypothetical protein [synthetic construct]
Length=619

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +F +P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFPLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK +SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKRISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_007987210.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Chlorocebus sabaeus]
Length=620

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 335/518 (65%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+   KT L+VGG  +  QLY
Sbjct  266   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLARMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLQQHVKVIIATPGRLLDIIKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   YQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_007456195.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Lipotes 
vexillifer]
Length=621

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 332/530 (63%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKS  1870
             DSD     VK  S  QR+A P EP CV+CGRYGEYIC+ETD+D+CSLECK   L ++   
Sbjct  85    DSDLLEEPVKSFSKTQRQAEPGEPVCVVCGRYGEYICNETDEDVCSLECKAKHLLQVSGV  144

Query  1869  RKP------------TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
              +P               P P  +  T+  +             L  DQ E LRR+L IV
Sbjct  145   EEPLALGGPQKAGSEPAAPRPASYVYTEHAFISN----------LREDQIENLRRQLGIV  194

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V  PI+ F  C  P  L  NL+A+GYE+PTP+QMQ +P  L+GR +L SA+TGSG
Sbjct  195   VQGPGVPRPIVDFEHCGFPEALNLNLKASGYEVPTPIQMQMVPLGLLGRDVLASADTGSG  254

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +        + + P A++L PTREL IQIE QAK L  G+P  +TAL
Sbjct  255   KTAAFLLPVIMRALF-------QSKMPSALVLTPTRELAIQIERQAKELMSGLPRMRTAL  307

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     QL+R+   V +++ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +
Sbjct  308   LVGGLPAPPQLHRLRQRVQVVIATPGRLLDIIKQSSVELGGIKIVVVDEADTMLKMGFQQ  367

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ +   + +  Q L+ SATI   +E++AS + +    I  G  N P   V+Q+ +WVE
Sbjct  368   QVLDVLENVPRDCQTLLASATIPASIEQLASQLLRDPVRIIAGGENLPCSNVRQVVLWVE  427

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+
Sbjct  428   EPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSMHSEKSQPERK  487

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP S+ EYVHQ+GR  R+G+ GT+
Sbjct  488   NILKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPPSMDEYVHQVGRVGRLGQNGTA  547

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H++RRK
Sbjct  548   ITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHEQRRK  589



>ref|XP_002760671.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Callithrix jacchus]
Length=620

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR     EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  88    SEEPVKSFSKTQRWPEAGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  148   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  ERK  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ------ALFERK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLQQHVKVIIATPGRLLDIMKQSSVELCGIKIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPTSIEQLASQLLHNPVRIITGEENLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDFE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_010713962.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Meleagris 
gallopavo]
Length=625

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 232/516 (45%), Positives = 334/516 (65%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  81    KDNQNTTEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  140

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDC------YYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +I++  +        R  + ++       Y+ +D    S    L  +Q E L+ +L I
Sbjct  141   LLQIQEKEEKLKSHHLARGGSQEETHLLNTPYFYKD---HSFILGLRDEQVENLKLQLGI  197

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              ++G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGS
Sbjct  198   AIQGQQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGS  257

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +        + + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  258   GKTAAFLLPVIMKVLN-------KTETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  310

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  311   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILRQSSVQLHGIKIVVVDEVDTMLKMGFQ  370

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I + +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  371   QQVLDILQDISHDHQTILVSATIPVGIEHLANQLLHNFVRIAIGEKNLPCSNVRQIILWV  430

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R
Sbjct  431   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVER  490

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
               IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  491   TAILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  550

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  551   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  586



>ref|XP_009490544.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pelecanus 
crispus]
 gb|KFQ57858.1| putative ATP-dependent RNA helicase DDX59 [Pelecanus crispus]
Length=624

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 240/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  D+ SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDTSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKEKKLKSDQLTKAKSQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMSGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QLYR++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLYRLKQNVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I VG+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHNHQTILVSATIPVGIEHLANQLLHNFVRIIVGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EDPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_004285456.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Orcinus 
orca]
Length=621

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 333/530 (63%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI---  1879
             DSD     VK  S  QR+A P EP CV+CGRYGEYIC+ETD+D+CSLECK   L ++   
Sbjct  85    DSDLLEEPVKSFSKTQRQAEPGEPVCVVCGRYGEYICNETDEDVCSLECKAKHLLQVRGA  144

Query  1878  ---------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
                      +K+      P P  +  T+  +             L  DQ E LR++L IV
Sbjct  145   EALLAPGGPQKAGSEPAAPHPASYVYTEHAFISN----------LREDQIENLRQQLGIV  194

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ +P  L+GR +L SA+TGSG
Sbjct  195   VQGPGVPRPIIDFEHCGFPEALNLNLKTSGYEIPTPIQMQMVPLGLLGRDVLASADTGSG  254

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +        + + P A+IL PTREL IQIE QAK L  G+P  +TAL
Sbjct  255   KTAAFLLPVIMRALF-------QSKMPSALILTPTRELAIQIEHQAKELMSGLPHMRTAL  307

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     QL+R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +
Sbjct  308   LVGGLPAPPQLHRLRQRVQVIIATPGRLLDIIKQSAVELGGIKIVVVDEADTMLKMGFQQ  367

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ +   + +  Q L+ SATI   +E++AS + +    I  G+ N P   V+Q+ +WVE
Sbjct  368   QVLDVLENVPRDCQTLLASATIPASIEQLASQLLRDPVRIITGEENLPCSNVRQIVLWVE  427

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL+ K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+
Sbjct  428   EPAKKKKLFEILSDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSEKSQPERK  487

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP S+ EYVHQ+GR  R+G+ GT+
Sbjct  488   NILKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPPSMDEYVHQVGRVGRLGQNGTA  547

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H +RRK
Sbjct  548   ITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHDQRRK  589



>ref|XP_004013983.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Ovis aries]
Length=620

 Score =   442 bits (1138),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 233/536 (43%), Positives = 331/536 (62%), Gaps = 39/536 (7%)
 Frame = -1

Query  2067  TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             +E    +G   +  VK  S  QR+A P EP CV+CGRYGEY+CDETD+D+CSLECK   L
Sbjct  78    SEPGTQAGDLPEEPVKSFSKTQRQAEPGEPVCVVCGRYGEYVCDETDEDVCSLECKAKHL  137

Query  1887  ------------SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
                         SR +K+      P P  +  T+  +             L  DQ E LR
Sbjct  138   LQVRGAEAASQPSRPQKAGSEPAAPGPAPYVYTEHAFVAH----------LREDQIETLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L I V+G  V  PI+ F  C  P       +  GYE+PTP+QMQ IP  L+GR +L S
Sbjct  188   RQLGITVRGRGVPRPIVDFEHCGFPPAPNPQPQGPGYEVPTPIQMQMIPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++        A S+ K  P  ++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVIVR------ALSQSK-SPSGLVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG  +  Q +R+   + +I+ TPGRL+D++ +R +EL S+ + V+DE D ML
Sbjct  301   CLRTALLVGGLPVPPQRHRLRQRIQVIIATPGRLLDIIKQRSVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   L    Q ++ SATI   VE++AS +      I+ G+ N+P  +V+Q
Sbjct  361   KMGFQQQVLDVLEQLPHDCQTILASATIPASVEQLASQLLHDPVAITAGERNRPCPSVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H +K
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLQSASVHSDK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             +  +R+  L   L GD  V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+
Sbjct  481   TQTERKSTLEGLLEGDYDVVVSTGVLGRGLDLVSVRLVVNFDMPSSMDEYVHQIGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H +RRK
Sbjct  541   GQHGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY--------LHDQRRK  588



>ref|NP_001177749.1| probable ATP-dependent RNA helicase DDX59 isoform 1 [Rattus norvegicus]
 gb|EDM09659.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Rattus norvegicus]
Length=619

 Score =   442 bits (1137),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 234/518 (45%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI---EKSR  1867
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++   E S 
Sbjct  87    SEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEEEGSL  146

Query  1866  KPTPCPPPVRFPATD-DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             KP+        P +  D +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ 
Sbjct  147   KPSSPQGAASEPESPLDAFYVYKEHPFIVA--LRDDQIETLKQQLGISVQGQEVARPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L +G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALPEDK-TPSALILTPTRELAIQIERQAKELMRGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  V +++ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ +     S 
Sbjct  318   RLQQHVKVVIATPGRLLDIIEQSSVSLSGIKIVVVDEADTMLKMGFQQQVLDVLEHTPSD  377

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   ++++A  +  +   I  G  N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTVLVSATIPDSIDQLADQLLHNPVRIVTGDKNLPCSSVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RREIL+  L GD  
Sbjct  438   NDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLSSTSIHSEKSQVERREILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TG+LGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGILGRGLDLVNVKLVVNFDMPSSLDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  558   WDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  587



>ref|XP_010178862.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Mesitornis 
unicolor]
 gb|KFQ31957.1| putative ATP-dependent RNA helicase DDX59 [Mesitornis unicolor]
Length=624

 Score =   442 bits (1138),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 241/535 (45%), Positives = 338/535 (63%), Gaps = 27/535 (5%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLEC  1903
              A  E N+ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLEC
Sbjct  76    TALGEDNRNTDEDSSSEEPIKSFSKSQRWADPGEPVCVVCGRYGEYICDKTDEDVCSLEC  135

Query  1902  KT-ILLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRR  1741
             K   LL   EK +K      T           +  Y+ +D    S    L  +Q E L+ 
Sbjct  136   KAKHLLQSQEKEKKLKSDQLTEAESQGETHLLNTPYFYKD---HSFILGLQDEQIENLKL  192

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA
Sbjct  193   QLGIAVEGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASA  252

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P 
Sbjct  253   DTGSGKTAAFLLPVIMKVLK-------EAETPSALILAPTRELAIQIERQAKELMAGLPN  305

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +T L+VGG  +  QL+R++  V +I+ TPGRLI++L +  ++L  + + V+DEVD ML+
Sbjct  306   MRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLIEILKQSSVQLHGIKIVVVDEVDTMLK  365

Query  1203  RGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+
Sbjct  366   MGFQQQVLDILEDVSHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQI  425

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS
Sbjct  426   ILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKS  485

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G
Sbjct  486   QVERTDILQGLLHEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLG  545

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
               GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  546   HSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_005498847.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Columba livia]
 gb|EMC79003.1| putative ATP-dependent RNA helicase DDX59 [Columba livia]
Length=624

 Score =   442 bits (1138),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 238/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T              Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQHQEKEKKLKTDQLTKAESQAETHLLTTPYFYKD---HSFILGLQDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQHVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  + +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSIKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_008501518.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Calypte 
anna]
 gb|KFP08135.1| putative ATP-dependent RNA helicase DDX59 [Calypte anna]
Length=625

 Score =   442 bits (1137),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  D+ SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  81    KDNQNTDEDNSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  140

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T           +  Y+ +D    S    L  +Q E LR +L I
Sbjct  141   LLQAQEKGKKLQSDQLTKSESQAETHLLNTPYFYKD---HSFILSLRDEQIENLRIQLGI  197

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  P+M F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  198   AVQGQEVPRPVMEFEHCSFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIMASADTGS  257

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  258   GKTAAFLLPVIMKVLN-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  310

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL++++ +  ++L  + + V+DEVD ML+ GF 
Sbjct  311   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEIIKQSSVQLHGIKIVVVDEVDTMLKMGFQ  370

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  371   QQVLDILEDISHDHQTILVSATIPVSIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  430

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  431   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  490

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TG+LGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  491   TDILQGLLQEKYEVIVSTGILGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  550

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  551   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  594



>ref|XP_010281713.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Phaethon 
lepturus]
 gb|KFQ71922.1| putative ATP-dependent RNA helicase DDX59 [Phaethon lepturus]
Length=624

 Score =   442 bits (1137),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 332/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  D+ SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDNSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKGKKLKSDRLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +       E  + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVL-------EETETPAALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I+VG+ N P   V+Q+ +W+
Sbjct  370   QQVLDILEDISHNHQTILVSATIPVGIEHLANQLLHNFVRITVGEKNLPCSNVRQIILWI  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQQKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_007167312.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007167313.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007167314.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Balaenoptera acutorostrata scammoni]
 ref|XP_007167315.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X4 [Balaenoptera acutorostrata scammoni]
 ref|XP_007167316.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X5 [Balaenoptera acutorostrata scammoni]
Length=619

 Score =   442 bits (1136),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 233/514 (45%), Positives = 326/514 (63%), Gaps = 33/514 (6%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL------  1888
             DSD     VK  S  QR+A P EP CV+CGRYGEYIC+ETD+D+CSLECK   L      
Sbjct  84    DSDLLEEPVKSFSKSQRQAEPGEPVCVVCGRYGEYICNETDEDVCSLECKAKHLQVRGAE  143

Query  1887  -----SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
                     +K+      P P  +  T+  +             L  DQ E LRR+L IVV
Sbjct  144   GQLAPGGPQKAGSEPVAPRPASYVYTEHAFISN----------LREDQIENLRRQLGIVV  193

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ +P  L+GR +L SA+TGSGK
Sbjct  194   QGPGVPRPIIDFEHCGFPEALNLNLKTSGYEVPTPIQMQMVPVGLLGRDVLASADTGSGK  253

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++  ++        + + P A++L PTREL IQIE QAK L  G+P  +TAL+
Sbjct  254   TAAFLLPVIVRSLF-------QSKMPSALVLTPTRELAIQIERQAKELMSGLPHMRTALL  306

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG     QL+R+   V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +Q
Sbjct  307   VGGLPAPPQLHRLRQRVQVIIATPGRLLDIIKQSAVELGGIKIVVVDEADTMLKMGFQQQ  366

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +    Q L+ SATI   +E++AS + +    I  G+ N P   V+Q+ +WVE 
Sbjct  367   VLDILENVPHDCQTLLASATIPASIEQLASQLLRDPVRIIAGEKNLPCSNVRQIVLWVEE  426

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EKS  +R+ 
Sbjct  427   PAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSEKSQPERKN  486

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I
Sbjct  487   ILKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAI  546

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  547   TFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  580



>ref|XP_005498846.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Columba livia]
Length=633

 Score =   442 bits (1137),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 238/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T              Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQHQEKEKKLKTDQLTKAESQAETHLLTTPYFYKD---HSFILGLQDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQHVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  + +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSIKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_009634490.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Egretta 
garzetta]
 gb|KFP13742.1| putative ATP-dependent RNA helicase DDX59 [Egretta garzetta]
Length=624

 Score =   442 bits (1136),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 332/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQFQEKEKKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GY++PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYDVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMVGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  V + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVQLHGVKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCAAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHNGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_004610070.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Sorex araneus]
Length=616

 Score =   441 bits (1134),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 331/519 (64%), Gaps = 25/519 (5%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             ++  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L +++++++  
Sbjct  88    AEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDQTDEDVCSLECKAKHLLQVKETKEKW  147

Query  1857  PCPPPVR-----FPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIM  1693
                 P        P  +  Y  R+    S    L  DQ E L+++L I V+G+ V  PI+
Sbjct  148   KLGHPQEADSEPVPPLEAVYVYREHPFISS---LQEDQVENLKQQLGIAVQGENVGRPII  204

Query  1692  SFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVA  1513
              F  C  P  L  NL+ +GYE+PTP+QMQ IP  L GR LL SA+TGSGKT +FL+P++A
Sbjct  205   DFEHCGFPEALNHNLKESGYEVPTPIQMQMIPVGLQGRDLLASADTGSGKTAAFLLPVIA  264

Query  1512  NTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQL  1336
               +          + P A+IL PTREL IQIE QAK L +G+P  KT L+VGG  +  QL
Sbjct  265   RALF-------ESETPCALILTPTRELAIQIERQAKELMRGLPRMKTVLLVGGLPLPPQL  317

Query  1335  YRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-S  1159
             YR+   V +I+ TPGRL+D+  +  + L S+ + VIDE D ML+ GF +QV+ I   + +
Sbjct  318   YRLRQHVKVIIATPGRLLDITKQSSVRLCSIRIVVIDEADTMLKMGFQQQVLDILENVPT  377

Query  1158  QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDI  979
               Q ++ SATI   +E+++  + ++   I +G+ N P   V+Q+ +WVE   KK+KLF++
Sbjct  378   DCQTILVSATIPASIEQLSGQLLQNPVRIIIGEKNLPCSNVRQIVLWVEEPAKKKKLFEV  437

Query  978   LTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDV  799
             L  ++ +KPPV+VFV  +LGADLLS A+   TGLK+ SIH EKS  +R+ IL   L GD 
Sbjct  438   LNDRKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKSTSIHSEKSQMERKSILEGLLEGDY  497

Query  798   PVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKL  619
              V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+L
Sbjct  498   EVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRL  557

Query  618   FPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             F ++ + +  +G+ +P +L NS Y         H ++RK
Sbjct  558   FWDIAKRVTPTGSLLPPQLVNSPY--------LHDQKRK  588



>ref|XP_010643424.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Fukomys damarensis]
 gb|KFO24428.1| Putative ATP-dependent RNA helicase DDX59 [Fukomys damarensis]
Length=617

 Score =   441 bits (1134),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 243/533 (46%), Positives = 336/533 (63%), Gaps = 27/533 (5%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT  1897
             + A E ++      +  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK 
Sbjct  72    LVAPEQDEKDSPPLEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDQTDEDVCSLECKA  131

Query  1896  ILLSRIEKS------RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKL  1735
               L ++++       R P         P T   Y  R+    S    L  DQ E L+++L
Sbjct  132   KHLLQVKEKEEKLNLRSPQNAESGPESPLTV-LYVYREHPFIS---ALQEDQIENLKQQL  187

Query  1734  NIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAET  1555
              I V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+T
Sbjct  188   GISVQGQEVTRPIIDFEHCGFPDILNHNLKKSGYEVPTPIQMQMIPLGLLGRDILASADT  247

Query  1554  GSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FK  1378
             GSGKT +FL+P++ +      A SE K  P A+IL PTREL IQIE QAK L  G+P  K
Sbjct  248   GSGKTVAFLLPVIIH------ALSESK-TPSALILTPTRELAIQIERQAKELMSGLPRMK  300

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             T L+VGG  M  QLYR+   V +I+ TPGRL+D++ +  + L  +   V+DE D ML+ G
Sbjct  301   TVLLVGGLPMPPQLYRLRQRVKVIIATPGRLLDIIKQNAVALCGIKTVVVDEADTMLKMG  360

Query  1197  FHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAI  1021
             F +QV+ I   + S  Q ++ SATI   +E++A  + ++   I  G+ N P  +V+Q+ +
Sbjct  361   FQQQVLDILENIPSDCQTILASATIPTSIEQLAGQLLRNPVRIITGEKNLPCSSVRQIIL  420

Query  1020  WVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMK  841
             WVE   KK+KLF+IL  K+ +KPPV+VFV  RLGADLLS A+   TGLK+ SIH EKS  
Sbjct  421   WVEDPAKKKKLFEILNDKKLFKPPVLVFVDCRLGADLLSEAVQKITGLKSTSIHSEKSQV  480

Query  840   DRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEE  661
             +R+ IL+  L G   V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ 
Sbjct  481   ERKSILKGLLEGGYEVVVSTGVLGRGLDLVSVRLVVNFDMPSSMDEYVHQIGRVGRLGQN  540

Query  660   GTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             GTSI FIN  +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  541   GTSITFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  585



>ref|XP_002193182.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Taeniopygia 
guttata]
Length=622

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 328/514 (64%), Gaps = 23/514 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L +I+ + K      
Sbjct  95    IKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQIQANEKQLTSDQ  154

Query  1845  PVRFPATDDC----YYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSC  1678
             P    A        Y+ +D    S    L  +Q E L+ +L I V+G  V  PI+ F  C
Sbjct  155   PTDSQAEAHLLSAPYFYKD---HSFILGLQDEQVENLKLQLGIAVQGRQVPRPIVEFEHC  211

Query  1677  DVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKL  1498
               P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++   +K 
Sbjct  212   GFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMKVLK-  270

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEH  1321
                     + P A+ILAPTREL IQIE QAK L  G+P  +T L+VGG  +  QL+R+  
Sbjct  271   ------ETETPSALILAPTRELAIQIESQAKELMAGLPNMRTVLLVGGLPLPPQLHRLRQ  324

Query  1320  GVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QIL  1144
              V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+ I   +S   Q +
Sbjct  325   SVKVIIATPGRLLEILKQSSVQLHGIKIIVVDEVDTMLKMGFQQQVLDILEDISHDHQTI  384

Query  1143  MYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQ  964
             + SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   KK+KLF+IL   +
Sbjct  385   LVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPSKKKKLFEILNDNK  444

Query  963   HYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVA  784
              +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL+  L     VIV+
Sbjct  445   LFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDILQGLLQEKYEVIVS  504

Query  783   TGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELV  604
             TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I FIN  +KKLF ++V
Sbjct  505   TGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAITFINNNSKKLFWDVV  564

Query  603   EILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             + +K +G  +P +L NS Y          QKRR+
Sbjct  565   KRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_005050549.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Ficedula albicollis]
 ref|XP_005050550.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Ficedula albicollis]
 ref|XP_005050551.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Ficedula albicollis]
 ref|XP_005050552.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X4 [Ficedula albicollis]
 ref|XP_005050553.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X5 [Ficedula albicollis]
 ref|XP_005050554.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X6 [Ficedula albicollis]
 ref|XP_005050555.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X7 [Ficedula albicollis]
 ref|XP_005050556.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X8 [Ficedula albicollis]
 ref|XP_005050557.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X9 [Ficedula albicollis]
 ref|XP_005050558.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X10 [Ficedula albicollis]
 ref|XP_005050559.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X11 [Ficedula albicollis]
 ref|XP_005050560.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X12 [Ficedula albicollis]
Length=622

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 235/535 (44%), Positives = 335/535 (63%), Gaps = 32/535 (6%)
 Frame = -1

Query  2061  SNQPSGSDSDSE---------VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             +N P G DS +          +K  S  QR A P EP CV+CGRYGEYIC+ETD+D+CSL
Sbjct  74    ANIPLGKDSQNTEDDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICNETDEDVCSL  133

Query  1908  ECKTILLSRIEKSRKPTPCPPPVRFPAT----DDCYYVRDDDKKSESKCLASDQAELLRR  1741
             ECK   L R +   K      P    A     +  Y+ +D    +    L  +Q   L+ 
Sbjct  134   ECKAKHLLRTQAKEKQLTSDQPADSQAEAHLLNTPYFYKD---HAFILGLQDEQVMNLKL  190

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I V+G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA
Sbjct  191   QLGIAVQGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASA  250

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P 
Sbjct  251   DTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPN  303

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +T L+VGG  +  QL+R++  V +++ TPGRL+++L +  ++L  + + V+DEVD ML+
Sbjct  304   MRTVLLVGGLPLPPQLHRLKQSVKVVIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLK  363

Query  1203  RGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+
Sbjct  364   MGFQQQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQI  423

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS
Sbjct  424   ILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKS  483

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G
Sbjct  484   QVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLG  543

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
               GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  544   HNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_009933150.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Opisthocomus 
hoazin]
 gb|KFR10912.1| putative ATP-dependent RNA helicase DDX59 [Opisthocomus hoazin]
Length=624

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 343/544 (63%), Gaps = 26/544 (5%)
 Frame = -1

Query  2109  SGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDET  1930
             +GS    +T++      N   GS ++  +K  S  QR A P EP CV+CGRYGEYICD+T
Sbjct  68    AGSLDVADTTL-GKDNRNTDEGSSTEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKT  126

Query  1929  DDDICSLECKT--ILLSRIE----KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLA  1768
             D+D+CSLECK   +LLS+ +    KS + T           +  Y+ +D    S    L 
Sbjct  127   DEDVCSLECKARHLLLSQEKEKKLKSDQLTKAESQAETHLPNTPYFYKD---HSFILGLR  183

Query  1767  SDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAAL  1588
              +Q E L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L
Sbjct  184   DEQIENLKLQLGIAVQGQQVPRPIVEFEHCGFPETLNCNLKNSGYEVPTPIQMQMIPVGL  243

Query  1587  MGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQA  1408
             +GR ++ SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QA
Sbjct  244   LGRDIVASADTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQA  296

Query  1407  KVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFV  1231
             K L  G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V
Sbjct  297   KELMAGLPNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHDIKVVV  356

Query  1230  IDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLN  1054
             +DEVD ML+ GF +QV+ I   +    Q ++ SATI   +E +A+ +  +   I++G+ N
Sbjct  357   VDEVDTMLKMGFQQQVLDILEDVPHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKN  416

Query  1053  KPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLK  874
              P   V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+
Sbjct  417   LPCSNVRQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQ  476

Query  873   AVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVH  694
               ++H EKS  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVH
Sbjct  477   CTAMHSEKSQVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVH  536

Query  693   QIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQ  514
             Q+GRA R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          Q
Sbjct  537   QVGRAGRLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQ  589

Query  513   KRRK  502
             KRR+
Sbjct  590   KRRE  593



>ref|XP_009970742.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Tyto alba]
Length=624

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS  E  VK  S  QR A P EP CV+CGRYGEYIC+ETD+D+CSLECK   
Sbjct  80    KDNQNTDGDSSLEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICNETDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQTQAKEKELKSDQFTKAESQAETHLLNTPYFYKD---HSFILGLRDEQVENLKTQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +W+
Sbjct  370   QQVLDILEDISHSHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWI  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLEEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_009911541.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Haliaeetus albicilla]
 ref|XP_010561720.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Haliaeetus 
leucocephalus]
 gb|KFP99648.1| putative ATP-dependent RNA helicase DDX59 [Haliaeetus albicilla]
Length=624

 Score =   441 bits (1133),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSLEEPIKSFSKSQRHAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQTQAKEEKLKSDQLTKAQSQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------EIETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEHISHDHQTILVSATIPVGIENLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_010980505.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Camelus 
dromedarius]
Length=620

 Score =   441 bits (1133),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 236/532 (44%), Positives = 329/532 (62%), Gaps = 46/532 (9%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK-  1873
             DSD     VK  S  QR A P EP CV+CGR+GEY+CD TD+D+CSLECK   L ++E  
Sbjct  84    DSDLPEEPVKSFSKTQRWAQPGEPVCVVCGRFGEYVCDTTDEDVCSLECKARHLLQVEGR  143

Query  1872  -------------SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
                          S    PCP    F  T+  +             L  DQ E LR +L 
Sbjct  144   AGQAEPSGPQEAGSEPAAPCP--AAFVYTEHAFI----------SSLREDQIENLRGQLG  191

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             IVV+G  V+ P++ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L SA+TG
Sbjct  192   IVVQGQGVARPVVDFEHCGFPEALNHNLKASGYEVPTPIQMQMIPVGLLGRDILASADTG  251

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKT  1375
             SGKT +FL+P++       L    + Q P A++L PTREL IQIE QAK L +G+P  +T
Sbjct  252   SGKTAAFLLPVI-------LRALFQSQAPSALVLTPTRELAIQIERQAKELMRGLPGMRT  304

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
              L+VGG     Q +R+   V +I+ TPGRL+D++ +  +EL SV + V+DE D ML+ GF
Sbjct  305   VLLVGGLPAPPQCHRLRQRVQVIIATPGRLLDIIKQSSVELGSVKIVVVDEADTMLKMGF  364

Query  1194  HEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
              +QV  I   +    Q ++ SATI   +E++A  +      I  G+ N P  +V+Q+ +W
Sbjct  365   QQQVFDILENVPHDCQTVLVSATIPASIEQLAGQLLHDPVRIVAGEKNLPCASVRQIVLW  424

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H EKS  +
Sbjct  425   VEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVEKITGLRSTSVHSEKSQTE  484

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             RR +L+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ G
Sbjct  485   RRHVLKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQNG  544

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             T+I FIN  +K+LF ++ + +  +G+ +P +L NS Y         H+++RK
Sbjct  545   TAITFINNSSKRLFWDVAKRVGPTGSLLPPQLLNSPY--------LHEQKRK  588



>ref|XP_009068485.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Acanthisitta 
chloris]
 gb|KFP69788.1| putative ATP-dependent RNA helicase DDX59 [Acanthisitta chloris]
Length=619

 Score =   441 bits (1133),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 236/522 (45%), Positives = 330/522 (63%), Gaps = 20/522 (4%)
 Frame = -1

Query  2055  QPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSR  1882
             Q +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L +
Sbjct  83    QNTAEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQ  142

Query  1881  IEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSP  1702
              ++ +K  P           +  Y   D   S    L  +Q E L+  L I V+G  V  
Sbjct  143   TQEKQKQLPSDQSQAEAHLLNAPYSYKD--HSFILGLQDEQVENLKLHLGIAVQGQQVPR  200

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P
Sbjct  201   PIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLP  260

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMA  1345
             ++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+VGG  + 
Sbjct  261   VIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVGGLPLP  313

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRA  1165
              QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+ I   
Sbjct  314   PQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQVLDILED  373

Query  1164  LSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKL  988
             +S   Q ++ SATI   +E +A+ +      I++G  N P   V+Q+ +WVE   KK+KL
Sbjct  374   ISHDHQTILVSATIPVGIEHLANQLLHDFVRITIGDKNLPCSNVRQIILWVEEPSKKKKL  433

Query  987   FDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLV  808
             F+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL+  L 
Sbjct  434   FEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDILQGLLQ  493

Query  807   GDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEEN  628
                 VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I FIN  +
Sbjct  494   ERYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAITFINNNS  553

Query  627   KKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  554   KKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  588



>ref|XP_003823105.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pan paniscus]
Length=619

 Score =   441 bits (1133),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 333/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+ +F I 
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKSMFLIF  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   QDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  558   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_003792348.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Otolemur 
garnettii]
Length=620

 Score =   440 bits (1132),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 232/518 (45%), Positives = 334/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EK 
Sbjct  88    SEEPIKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKL  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P    +   +    +YV  +     +  L  +Q E L+++L I+V+G  V+ PI+ 
Sbjct  148   KGSEPQKADLEPESPLSAFYVYKEHPFILN--LQENQIENLKQQLGILVQGQEVTRPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCSFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +          + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ALF-------ESRTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +   
Sbjct  319   RLQQHVKVIIATPGRLLDIIKQSCVELCGIRIVVVDEADTMLKMGFQQQVLDILENIPND  378

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++A+ +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPTSIEQLANQLLHNPVRIIAGEKNLPCANVRQIILWVEDPAKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQVERKNILKGLLDGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|NP_080776.1| probable ATP-dependent RNA helicase DDX59 [Mus musculus]
 sp|Q9DBN9.1|DDX59_MOUSE RecName: Full=Probable ATP-dependent RNA helicase DDX59; AltName: 
Full=DEAD box protein 59 [Mus musculus]
 dbj|BAB23601.1| unnamed protein product [Mus musculus]
 gb|AAH23840.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Mus musculus]
Length=619

 Score =   440 bits (1132),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 329/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++     
Sbjct  87    SEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEGEGSL  146

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P R  A      D +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ 
Sbjct  147   RPSSPQRVAAEPESPLDAFYVYKEHPFIVT--LKEDQIETLKQQLGISVQGQDVARPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A SE K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------AFSEDK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R+   V +I+ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ +       
Sbjct  318   RLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVDEADTMLKMGFQQQVLDVLEHTPGD  377

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++   +  +   I  G  N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RR+IL+  L GD  
Sbjct  438   NDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKSQVERRDILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  558   WDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  587



>ref|XP_002609992.1| hypothetical protein BRAFLDRAFT_287272 [Branchiostoma floridae]
 gb|EEN66002.1| hypothetical protein BRAFLDRAFT_287272 [Branchiostoma floridae]
Length=672

 Score =   442 bits (1136),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/514 (44%), Positives = 329/514 (64%), Gaps = 19/514 (4%)
 Frame = -1

Query  2040  DSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKP  1861
             D D  +   S  QR     EP CV+CGRYGEYICD+TD D+CSLECK   L+ +   ++ 
Sbjct  98    DEDEPIVSFSKNQRWPEEGEPVCVMCGRYGEYICDQTDSDVCSLECKAKHLTLVHHQKQY  157

Query  1860  TPCPPPVRFPATDDCYYVRDDDKKSESKCL----------ASDQAELLRRKLNIVVKGDL  1711
                  P +  +T++       +  SE++ L          +++Q E +R++L I V+G  
Sbjct  158   LD---PDQSSSTEESRATVQVNSLSETQNLYKEHVTLSQLSNEQVEEVRKQLGITVRGTD  214

Query  1710  VSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSF  1531
             V  PI+ F  C     +  N+    Y+ PT VQMQ +PA +MGR ++ +A TGSGKT +F
Sbjct  215   VPKPILEFFHCGFNDTVSANMSVVKYDTPTAVQMQVLPAGMMGRDVMAAAPTGSGKTAAF  274

Query  1530  LIPIVANTVKLNLAC----SERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             L+P+V N  +   +       R   PLA+ILAPTRELC+Q+E+QAK L KG+P  +TAL+
Sbjct  275   LLPVVLNVFRTVSSAIGGRDPRWTHPLALILAPTRELCMQVEDQAKQLMKGLPHMRTALL  334

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  Q++R++ GV ++V TPGRL+D+L ++++ L+ V + V+DE+D ML  GF EQ
Sbjct  335   VGGLPLPPQVHRLQQGVQVLVATPGRLLDILHRKDVSLECVEVLVVDELDTMLHLGFREQ  394

Query  1185  VMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V++I  +L SQ Q +M+SATI + +E +ASS+  +   + VGQ + P+ +VKQ  +WVE 
Sbjct  395   VLEIIDSLPSQRQTMMFSATIPQPIETLASSILNNPVYVLVGQASTPSPSVKQTILWVEE  454

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+ LF IL   +HY+PPV+VFV SR+GADLL+ AI     ++A+S+HG+K   +R  
Sbjct  455   NSKKRMLFTILQDPKHYQPPVLVFVDSRMGADLLADAIHKKCNVRALSMHGDKPQSERSA  514

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
              L S L G+V V+VATGVLGRG+DL  V+ VIVFDMP S+ EY+HQIGRA R+G  G ++
Sbjct  515   ALNSLLKGEVDVVVATGVLGRGLDLCRVRLVIVFDMPPSVNEYIHQIGRAGRLGSSGRAM  574

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              FIN  NK LF +L + L      +PS+L NS +
Sbjct  575   AFINNNNKGLFLDLFDTLHPLHMQMPSQLVNSPH  608



>ref|XP_010407564.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Corvus cornix cornix]
 ref|XP_010407565.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Corvus cornix cornix]
 ref|XP_010407566.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Corvus cornix cornix]
Length=622

 Score =   440 bits (1131),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 235/529 (44%), Positives = 336/529 (64%), Gaps = 25/529 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  D   E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRI---EKSRKPTPCP-PPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
             L +    EK  +   C          +  Y+ +D    S    L  +Q E L+ +L I V
Sbjct  140   LLQTQAKEKQLRSDQCTDSQAEAHLLNTPYFYKD---HSFILGLQDEQVENLKLQLGIAV  196

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGK
Sbjct  197   QGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK  256

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+
Sbjct  257   TAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLL  309

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L S+ + V+DEVD ML+ GF +Q
Sbjct  310   VGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHSIKIVVVDEVDTMLKMGFQQQ  369

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +W+E 
Sbjct  370   VLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWIEE  429

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +
Sbjct  430   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTD  489

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+++ EYVHQ+GRA R+G  GT+I
Sbjct  490   ILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSTMDEYVHQVGRAGRLGHSGTAI  549

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_006834224.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chrysochloris 
asiatica]
Length=620

 Score =   440 bits (1131),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 235/518 (45%), Positives = 332/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CVICGRYGEYICD+TD+D+CSLECK   L ++    EK 
Sbjct  88    SEEPVKSFSKTQRWAEPGEPVCVICGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKG  147

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +  +P        +    +YV  +     +  L  DQ E L+++L IVV+G  V+ PI+ 
Sbjct  148   KLSSPHKADSESESPLSAFYVYKEHPFVLN--LQEDQIEHLKQQLGIVVQGQGVTRPIIE  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPETLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  266   ------ALFEDK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R+   V +I+ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ I   + + 
Sbjct  319   RLRQHVKVIIATPGRLLDIMKQSSVVLCGIKIVVVDEADTMLKMGFQQQVLDILENVPNN  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I+ G+ N P   V+Q+ +W+E   KK+KLF+IL
Sbjct  379   CQTILVSATIPASMEQLASQLLHNPVRITTGEKNLPCSNVRQIILWIEEPSKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   T LK++SIH EK   +R+ IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITDLKSISIHSEKPQIERKNILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLINVKLVVNFDMPSSMDEYVHQVGRVGRLGQRGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G  +P +L NS Y         H ++RK
Sbjct  559   WDIAKRVKPTGTILPPQLLNSPY--------LHDQKRK  588



>gb|EDL39547.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 [Mus musculus]
Length=619

 Score =   440 bits (1131),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 329/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++++     
Sbjct  87    SEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEGEGSL  146

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P R  A      D +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ 
Sbjct  147   RPSSPQRAAAEPESPLDAFYVYKEHPFIVT--LKEDQIETLKQQLGISVQGQDVARPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A SE K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------AFSEDK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R+   V +I+ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ +       
Sbjct  318   RLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVDEADTMLKMGFQQQVLDVLEHTPGD  377

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++   +  +   I  G  N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RR+IL+  L GD  
Sbjct  438   NDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKSQVERRDILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  558   WDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  587



>ref|XP_009554086.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cuculus 
canorus]
 gb|KFO72402.1| putative ATP-dependent RNA helicase DDX59 [Cuculus canorus]
Length=620

 Score =   440 bits (1131),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/532 (44%), Positives = 336/532 (63%), Gaps = 21/532 (4%)
 Frame = -1

Query  2085  TSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
              +++   + N    S  +  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLE
Sbjct  75    NTVLGKDDQNTDEDSSLEEPVKSFSKSQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLE  134

Query  1905  CKT--ILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
             CK   +L S+ ++++  +           +  Y+ +D    S    L  +Q E L+ +L 
Sbjct  135   CKAKHLLRSQEKENKLKSNHLTQAESHLLNTPYFYKD---HSFILGLQDEQIENLKLQLG  191

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I V+G  V  PI+ F  C  P  L  NL+  GYE+PTP+QMQ IP  L+GR ++ SA+TG
Sbjct  192   IAVQGQQVPRPIVEFEHCGFPETLNHNLKNCGYEVPTPIQMQMIPVGLLGRDIVASADTG  251

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKT  1375
             SGKT +FL+PI+   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T
Sbjct  252   SGKTAAFLLPIIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRT  304

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
             AL+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF
Sbjct  305   ALLVGGLPLPPQLHRLKQSVKVIIATPGRLMEILKQSSVQLHGIKIVVVDEVDSMLKMGF  364

Query  1194  HEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
              EQV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +W
Sbjct  365   QEQVLDILEGISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILW  424

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +
Sbjct  425   VEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCAAMHSEKSQVE  484

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             R +IL+  L     V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  G
Sbjct  485   RTDILQGLLQDKYEVLVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHNG  544

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             T+I FIN   KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  545   TAITFINNNGKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  589



>ref|XP_009899186.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Picoides 
pubescens]
 gb|KFV67668.1| putative ATP-dependent RNA helicase DDX59 [Picoides pubescens]
Length=623

 Score =   440 bits (1131),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 338/530 (64%), Gaps = 26/530 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + +Q +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD TD+DICSLECK   
Sbjct  80    KDSQNTDEDSTSEEPIKSYSKLQRWAEPGEPVCVVCGRYGEYICDNTDEDICSLECKAKH  139

Query  1890  LSRIEKSRKPTPCPPPVRFPAT-----DDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
             L + + + K           +      ++ Y+ +D    S    L  +Q E L+ +L I 
Sbjct  140   LLQTQANGKKLTSDQLTEEESQAETHLNEPYFYKD---HSFILGLQEEQIENLKLQLGIA  196

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSG
Sbjct  197   VQGQQVPRPIVEFEHCGFPETLNHNLKKSGYEVPTPIQMQMIPVGLLGRDIVASADTGSG  256

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +K         + P A+ILAPTREL IQIE+QAK L  G+P  +T L
Sbjct  257   KTAAFLLPVIMKALK-------ETETPSALILAPTRELAIQIEQQAKELMTGLPNMRTVL  309

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG  +  QL+R++  V +I+ TPGRL+++L +  + L+ V + V+DEVD ML+ GF +
Sbjct  310   LVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVRLNGVKIVVVDEVDTMLKMGFQQ  369

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ I   ++Q  Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE
Sbjct  370   QVLDILEGITQDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVE  429

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EK+  +R 
Sbjct  430   EPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKTQVERT  489

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
             +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+
Sbjct  490   DILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHCGTA  549

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   ITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  592



>ref|XP_005691173.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like, partial 
[Capra hircus]
Length=509

 Score =   436 bits (1120),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 226/502 (45%), Positives = 320/502 (64%), Gaps = 39/502 (8%)
 Frame = -1

Query  1965  CGRYGEYICDETDDDICSLECKTILL------------SRIEKSRKPTPCPPPVRFPATD  1822
             CGRYGEY+CDETD+D+CSLECK   L            SR +K+      P P  +  T+
Sbjct  1     CGRYGEYVCDETDEDVCSLECKAKHLLQVRGAEAASQPSRPQKAGSEPAAPGPAPYVYTE  60

Query  1821  DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEA  1642
               +  R          L  DQ E LRR+L I V+G  V  PI+ F  C  P  L  NL+A
Sbjct  61    HAFVAR----------LREDQIETLRRQLGITVRGRGVPRPIVDFEHCGFPEALNRNLKA  110

Query  1641  AGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPL  1462
             +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++        A S+ K  P 
Sbjct  111   SGYEVPTPIQMQMIPVGLLGRDVLASADTGSGKTAAFLLPVIVR------ALSQSK-SPS  163

Query  1461  AMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRL  1285
              ++L PTREL IQIE QAK L  G+P  +TAL+VGG  +  Q +R+   + +I+ TPGRL
Sbjct  164   GLVLTPTRELAIQIERQAKELMSGLPCLRTALLVGGLPVPPQRHRLRQRIQVIIATPGRL  223

Query  1284  IDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEK  1108
             +D++ +R +EL S+ + V+DE D ML+ GF +QV+ +   L    Q ++ SATI   VE+
Sbjct  224   LDIIKQRSVELGSIKIVVVDEADTMLKMGFQQQVLDVLEQLPHDCQTILASATIPASVEQ  283

Query  1107  MASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGS  928
             +AS + +    I+ G+ N+P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  
Sbjct  284   LASQLLRDPVAITAGERNRPCPSVRQIVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDC  343

Query  927   RLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLS  748
             +LGADLLS A+   TGL++ S+H +K+  +R+  L   L GD  V+V+TGVLGRG+DL+S
Sbjct  344   KLGADLLSEAVQKVTGLQSASVHSDKTQTERKSTLEGLLEGDYDVVVSTGVLGRGLDLVS  403

Query  747   VKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPS  568
             VK V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P 
Sbjct  404   VKLVVNFDMPSSMDEYVHQIGRVGRLGQHGTAITFINNNSKRLFWDIAKHVKPTGSLLPP  463

Query  567   ELANSKYSVGSFSVGRHQKRRK  502
             +L NS Y         H +RRK
Sbjct  464   QLLNSPY--------LHDQRRK  477



>ref|XP_009883094.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Charadrius 
vociferus]
 gb|KGL93167.1| putative ATP-dependent RNA helicase DDX59 [Charadrius vociferus]
Length=624

 Score =   440 bits (1131),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 239/531 (45%), Positives = 334/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ    D  SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNINEDGSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKPTP-----CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K  P               +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKEKKLKPNQLTKAELQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKTSGYEVPTPIQMQMIPVGLLGRDILASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLRGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALS-QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +      I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISYDHQTILVSATIPVGIEHLANQLLHDFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>gb|KFP54935.1| putative ATP-dependent RNA helicase DDX59 [Cathartes aura]
Length=624

 Score =   439 bits (1130),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS  E  +K  S  QR A   EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDSSLEEPIKSFSKSQRWAQSGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQTQEKEKKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++    K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVFK-------ETETPSALILAPTRELAIQIERQAKELMAGLPDMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I  A+S   Q ++ SATI   +E++A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEAISHDHQTILVSATIPVGIEQLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHTGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_005520969.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pseudopodoces 
humilis]
Length=622

 Score =   439 bits (1130),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 327/514 (64%), Gaps = 23/514 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L + +   K      
Sbjct  95    IKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQAQTKEKQLTSDQ  154

Query  1845  PVRFPATDDC----YYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSC  1678
             P    A        Y+ +D    S    L  +Q E L+ +L I V+G  V  PI+ F  C
Sbjct  155   PTDSQAEAHLLNIPYFYKD---HSFILGLQDEQVENLKLQLGIAVQGQQVPRPIVEFEHC  211

Query  1677  DVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKL  1498
               P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++   +K 
Sbjct  212   GFPEALNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMKVLK-  270

Query  1497  NLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEH  1321
                     + P A+ILAPTREL IQIE QAK L  G+P  +T L+VGG  +  QL+R++ 
Sbjct  271   ------EIETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVGGLPLPPQLHRLKQ  324

Query  1320  GVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QIL  1144
              V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+ I   +S   Q +
Sbjct  325   SVKVIIATPGRLLEILKQSSVQLHGIRIVVVDEVDTMLKMGFQQQVLDILEDISHDHQTI  384

Query  1143  MYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQ  964
             + SATI   +E +A+ +      I++G+ N P   V+Q+ +WVE   KK+KLF+IL  K+
Sbjct  385   LVSATIPVGIEHLANELLHSFVRITIGEKNLPCSNVRQIILWVEEPSKKKKLFEILNDKK  444

Query  963   HYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVA  784
              +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL+  L     VIV+
Sbjct  445   LFKPPVLVFVDCKLGADLLSDAVHKITGLQCAAMHSEKSQMERTDILQGLLQEKYEVIVS  504

Query  783   TGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELV  604
             TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I FIN  +KKLF ++V
Sbjct  505   TGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAITFINNNSKKLFWDVV  564

Query  603   EILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             + +K +G  +P +L NS Y          QKRR+
Sbjct  565   KRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_007127728.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Physeter catodon]
Length=619

 Score =   439 bits (1130),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 233/521 (45%), Positives = 326/521 (63%), Gaps = 36/521 (7%)
 Frame = -1

Query  2052  PSGSDSDSE-----VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             P     DSE     VK  S  QREA P EP CV+C RYGEYIC+ETD+D+CSLECK   L
Sbjct  78    PQQRAQDSELLEEPVKSFSKTQREAEPGEPVCVVCRRYGEYICNETDEDVCSLECKAKHL  137

Query  1887  SRI------------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
              ++            +K+      P P  +  T+  +             L  DQ E LR
Sbjct  138   LQVRGAEERLAPGGPQKAGSEPVAPRPASYVYTEHAFISN----------LREDQIENLR  187

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
             R+L IVV+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ +P  L+GR +L S
Sbjct  188   RQLGIVVQGPGVPRPIIDFEHCGFPEALNLNLKTSGYEVPTPIQMQMVPVGLLGRDVLAS  247

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++   +        + + P A++L PTREL IQIE QAK L  G+P
Sbjct  248   ADTGSGKTAAFLLPVIMRALF-------QSRMPSALVLTPTRELAIQIERQAKELMSGLP  300

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +TAL+VGG     QL+R+   V +I+ TPGRL+D++ +  +EL S+ + V+DE D ML
Sbjct  301   CMRTALLVGGLPAPPQLHRLRQRVQVIIATPGRLLDIIKQSAVELGSIKIVVVDEADTML  360

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ +   +    Q L+ SATI   +E++A  +      I  G+ N P   V+Q
Sbjct  361   KMGFQQQVLDVLENVPHDCQTLLASATIPASIEQLAGQLLHDPVRIVAGEKNLPCSNVRQ  420

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+ S+H EK
Sbjct  421   IVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSTSVHSEK  480

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             S  +R+ IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+
Sbjct  481   SQPERKNILKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQVGRVGRL  540

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y
Sbjct  541   GQNGTAITFINNNSKRLFWDIAKRVKPTGSLLPPQLLNSPY  581



>ref|XP_006982482.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Peromyscus 
maniculatus bairdii]
Length=620

 Score =   439 bits (1130),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 238/524 (45%), Positives = 336/524 (64%), Gaps = 26/524 (5%)
 Frame = -1

Query  2046  GSDS---DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-  1879
             G DS   +  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++ 
Sbjct  82    GKDSCPPEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVK  141

Query  1878  --EKSRKPTPCPPPVRFPATD-DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLV  1708
               E+S K +     V  P +  D +YV  +     +  L  DQ E L+++L I V+G  V
Sbjct  142   EEEESLKASSPQRAVSHPESPLDTFYVYKEHPFIVT--LREDQIETLKQQLGISVQGQEV  199

Query  1707  SPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFL  1528
             + PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL
Sbjct  200   ARPIIDFEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFL  259

Query  1527  IPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDA  1351
             +P++        A  E K  P A+IL PTREL IQIE+QAK L  G+P  KT L+VGG  
Sbjct  260   LPVIIR------ALFEDK-TPSALILTPTRELAIQIEKQAKELMSGLPRMKTVLLVGGLP  312

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +  QL+R+   V +I+ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ + 
Sbjct  313   LPPQLHRLRQHVKVIIATPGRLLDIIKQSAVSLSGIKVVVVDEADTMLKMGFQQQVLDVL  372

Query  1170  RAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQ  994
               +    Q ++ SATI   +E++A  +  +   I  G  N P  +V+Q+ +WVE   KK+
Sbjct  373   ENIPGDCQTILVSATIPGSIEQLADQLLHNPVRIVTGDKNLPCPSVRQIILWVEDPGKKK  432

Query  993   KLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSF  814
             KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RR+ L+  
Sbjct  433   KLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLNSTSIHSEKSQVERRDTLKGL  492

Query  813   LVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINE  634
             L GD  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN 
Sbjct  493   LEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINN  552

Query  633   ENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              +K+LF E+ + +K +G+ +P +L NS Y         H+++RK
Sbjct  553   NSKRLFWEVAKRVKPTGSLLPPQLLNSPY--------LHEQKRK  588



>ref|XP_009324443.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pygoscelis 
adeliae]
Length=620

 Score =   439 bits (1129),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 237/527 (45%), Positives = 335/527 (64%), Gaps = 23/527 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQTTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRK-PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
             LL   EK +K  +           D  Y+ RD    S    L  +Q E L+ +L I V+G
Sbjct  140   LLQSQEKEKKLKSDQLTKAETHLLDTPYFYRD---HSFILGLRDEQIENLKLQLGIAVQG  196

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
               V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGKT 
Sbjct  197   QQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGKTA  256

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVG  1360
             +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+VG
Sbjct  257   AFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVG  309

Query  1359  GDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVM  1180
             G  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+
Sbjct  310   GLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQVL  369

Query  1179  QIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
              I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   
Sbjct  370   DILEDISHDHQTILVSATIPAGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPS  429

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL
Sbjct  430   KKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDIL  489

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             +  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ +A R+G   T+I F
Sbjct  490   QGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNKAGRLGHSETAITF  549

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             IN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   INNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  589



>ref|XP_008065299.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Tarsius 
syrichta]
Length=620

 Score =   439 bits (1129),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 335/529 (63%), Gaps = 23/529 (4%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
              +E        S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  77    GSEQGAKDNHPSEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  136

Query  1890  LSRIEKSRKPTPCPPPVRF---PATD-DCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
             L ++++  +      P +    PA+  + +YV  +     +  L  DQ E L+++L I+V
Sbjct  137   LLQVKEKEEKLKLSNPQKANSEPASPWNAFYVYKEHPFISN--LQEDQIENLKQQLGILV  194

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V+ PI+ F  C  P  L  NL+  GYE+PTP+QMQ IP  L+GR ++ SA+TGSGK
Sbjct  195   QGQEVTRPIIDFEHCGFPEVLNHNLKKWGYEVPTPIQMQMIPVGLLGRDIMASADTGSGK  254

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +          + P A+IL PTREL IQIE Q K L  G+P  KT L+
Sbjct  255   TAAFLLPVIMQVLF-------ESKTPSALILTPTRELAIQIERQTKDLMSGLPRMKTVLL  307

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QLYR++  V +I+ TPGRL+D++ +  ++L  + + V+DE D ML+ GF +Q
Sbjct  308   VGGLPLPPQLYRLQQRVKVIIATPGRLLDIIKQSSVKLCGIKIVVVDEADTMLKMGFQQQ  367

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +    Q ++ SATI   +E++A  +  +   I  G+ N P   V+Q+ +WVE 
Sbjct  368   VLDILENVPNDCQTILVSATIPTSIEQLAIQLLHNPVRIITGEKNLPCANVRQIILWVED  427

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS AI   TGLK++SIH EKS  +R+ 
Sbjct  428   PAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAIQKITGLKSISIHSEKSQTERKN  487

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ G +I
Sbjct  488   ILKGLLEGDYEVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGMAI  547

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  548   TFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  588



>ref|XP_005487140.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Zonotrichia albicollis]
 ref|XP_005487141.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Zonotrichia albicollis]
 ref|XP_005487142.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Zonotrichia albicollis]
Length=622

 Score =   439 bits (1129),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 236/535 (44%), Positives = 332/535 (62%), Gaps = 32/535 (6%)
 Frame = -1

Query  2061  SNQPSGSDS---------DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             +N P   DS         +  +K  S  QR A P EP CV+CGRYGEYICDETD+D+CSL
Sbjct  74    ANTPLAQDSRNTEDDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDETDEDVCSL  133

Query  1908  ECKTILLSRIEKSRKPTPCPPPVRFPAT----DDCYYVRDDDKKSESKCLASDQAELLRR  1741
             ECK   L + +   K           A     +  Y+ +D    S    L  +Q E L+ 
Sbjct  134   ECKAKHLLQNQAKEKQLTSDQAADSQAEAHLLNAPYFYKD---HSFILGLQEEQVENLKL  190

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I V+G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA
Sbjct  191   QLGIAVQGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASA  250

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P 
Sbjct  251   DTGSGKTAAFLLPVIMKVLK-------ETETPCALILAPTRELAIQIERQAKELMAGLPN  303

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +TAL+VGG  +  QL+R+   V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+
Sbjct  304   MRTALLVGGLPLPPQLHRLRQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLK  363

Query  1203  RGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G  N P   V+Q+
Sbjct  364   MGFQQQVLDILENISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGDKNLPCSNVRQI  423

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +WVE   KK+KLF+IL   + +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS
Sbjct  424   ILWVEEPSKKKKLFEILNDNKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKS  483

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G
Sbjct  484   QVERSDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLG  543

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
               GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  544   HNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_006213318.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Vicugna 
pacos]
Length=571

 Score =   437 bits (1124),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 333/530 (63%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE-K  1873
             DSD     VK  S  QR A P EP CV+CGR+GEY+CD TD+D+CSLECK   L ++E +
Sbjct  35    DSDLPEEPVKSFSKTQRWAQPGEPVCVVCGRFGEYVCDTTDEDVCSLECKARHLLQVEGR  94

Query  1872  SRKPTP-----------CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
             + +  P            P P  +  T+  +             L  DQ E LR +L IV
Sbjct  95    AGQGEPSGPQEAGSEPAAPRPAAYVYTEHAFI----------SSLREDQIENLRGQLGIV  144

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V+ P++ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L SA+TGSG
Sbjct  145   VQGQGVARPVVDFEHCGFPEALNHNLKASGYEVPTPIQMQMIPVGLLGRDVLASADTGSG  204

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++       L    + + P A++L PTREL IQIE QAK L +G+P  +TAL
Sbjct  205   KTAAFLLPVI-------LRALFQSRAPSALVLTPTRELAIQIERQAKELMRGLPGMRTAL  257

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     Q +R+   V +I+ TPGRL+D++ +  +EL SV + V+DE D ML+ GF +
Sbjct  258   LVGGLPAPPQRHRLRQRVQVIIATPGRLLDIIKQSSVELGSVKIVVVDEADTMLKMGFQQ  317

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV  I   +    Q ++ SATI   +E++A  + +    I  G+ N P  +V+Q+ +WVE
Sbjct  318   QVFDILENVPHDCQTVLVSATIPASIEQLAGQLLRDPVRIVAGEKNLPCASVRQIVLWVE  377

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ ++PPV+VFV  +LGADLLS A+   TGL++ S+H EKS  +RR
Sbjct  378   DPAKKKKLFEILNDKKLFRPPVLVFVDCKLGADLLSEAVEKITGLRSTSVHSEKSQTERR  437

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              +L+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ GT+
Sbjct  438   HVLKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQSGTA  497

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +  +G+ +P +L NS Y         H+++RK
Sbjct  498   ITFINNSSKRLFWDVAKRVGPTGSLLPPQLLNSPYL--------HEQKRK  539



>dbj|BAE21808.1| unnamed protein product [Mus musculus]
Length=619

 Score =   439 bits (1128),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 232/518 (45%), Positives = 328/518 (63%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CS ECK   L ++++     
Sbjct  87    SEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSFECKAKHLLQVKEGEGSL  146

Query  1857  PCPPPVRFPATD----DCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P R  A      D +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ 
Sbjct  147   RPSSPQRVAAEPESPLDAFYVYKEHPFIVT--LKEDQIETLKQQLGISVQGQDVARPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A SE K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------AFSEDK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R+   V +I+ TPGRL+D++ +  + L  + + V+DE D ML+ GF +QV+ +       
Sbjct  318   RLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVDEADTMLKMGFQQQVLDVLEHTPGD  377

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++   +  +   I  G  N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               ++ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RR+IL+  L GD  
Sbjct  438   NDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKSQVERRDILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF
Sbjct  498   VVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLF  557

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  558   WDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  587



>ref|XP_009086718.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Serinus 
canaria]
 ref|XP_009086719.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Serinus 
canaria]
Length=622

 Score =   439 bits (1128),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 236/529 (45%), Positives = 332/529 (63%), Gaps = 25/529 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             E +Q +  D   E  VK  S  QR A P EP CV+CGRYGEYICD+TD+DICSLECK   
Sbjct  80    EDSQNTEDDGSLEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICDQTDEDICSLECKAKH  139

Query  1890  LSRIEKSRKPTPCPPPVRFPA----TDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
             L + +   K           A     +  Y+ +D    S    L  +Q E L+ +L I V
Sbjct  140   LLQSQAKEKQLTSDQATDSQAEAHLHNTPYFYKD---HSFILGLQEEQVENLKLQLGIAV  196

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  +  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGK
Sbjct  197   QGQQIPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK  256

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+
Sbjct  257   TAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIESQAKELMAGLPNMRTVLL  309

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R+   V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +Q
Sbjct  310   VGGLPLPPQLHRLRQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQ  369

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I+VG+ N P   V+Q+ +WVE 
Sbjct  370   VLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITVGEKNLPCSNVRQIILWVEE  429

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL   + +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +
Sbjct  430   PSKKKKLFEILNDNKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTD  489

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I
Sbjct  490   ILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHNGTAI  549

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_422189.2| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X6 [Gallus gallus]
 ref|XP_004943161.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X9 [Gallus gallus]
 ref|XP_004943162.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X10 [Gallus gallus]
Length=625

 Score =   439 bits (1128),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 231/527 (44%), Positives = 333/527 (63%), Gaps = 25/527 (5%)
 Frame = -1

Query  2058  NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI  1879
             N    S S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++
Sbjct  85    NTAEDSSSEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQM  144

Query  1878  EKSRKPTPCPPPVRFPATDD------CYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
             ++  +        +  + ++       Y+ +D    S    L  +Q E L+ +L I ++G
Sbjct  145   QEKEEKLKSAHLAKGESQEESHLLNTAYFYKD---HSFILSLQDEQVENLKLQLGIAIQG  201

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
               V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGKT 
Sbjct  202   QQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGKTA  261

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVG  1360
             +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+P  +T L+VG
Sbjct  262   AFLLPVIMKVLN-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVG  314

Query  1359  GDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVM  1180
             G  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+
Sbjct  315   GLPLPPQLHRLKQSVKVIIATPGRLLEILRQSSVQLHGIKIVVVDEVDTMLKMGFQQQVL  374

Query  1179  QIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
              I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   
Sbjct  375   DILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPS  434

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R  IL
Sbjct  435   KKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVERTAIL  494

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             +  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I F
Sbjct  495   QGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAITF  554

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             IN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  555   INNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  594



>ref|XP_008628441.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Corvus 
brachyrhynchos]
 gb|KFO56510.1| putative ATP-dependent RNA helicase DDX59 [Corvus brachyrhynchos]
Length=622

 Score =   438 bits (1127),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 335/529 (63%), Gaps = 25/529 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  D   E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTDEDGSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRI---EKSRKPTPCP-PPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
             L +    EK  +   C          +  Y+ +D    S    L  +Q E L+ +L I V
Sbjct  140   LLQTQAKEKQLRSDQCTDSQAEAHLLNTPYFYKD---HSFILGLQDEQVENLKLQLGIAV  196

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGK
Sbjct  197   QGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK  256

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +K         + P A+ILAPTREL IQIE Q K L  G+P  +T L+
Sbjct  257   TAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQVKELMAGLPNMRTVLL  309

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L S+ + V+DEVD ML+ GF +Q
Sbjct  310   VGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHSIKIVVVDEVDTMLKMGFQQQ  369

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +W+E 
Sbjct  370   VLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWIEE  429

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +
Sbjct  430   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTD  489

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+++ EYVHQ+GRA R+G  GT+I
Sbjct  490   ILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSTMDEYVHQVGRAGRLGHSGTAI  549

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_010004983.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chaetura 
pelagica]
 gb|KFU96494.1| putative ATP-dependent RNA helicase DDX59 [Chaetura pelagica]
Length=622

 Score =   438 bits (1127),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 335/537 (62%), Gaps = 23/537 (4%)
 Frame = -1

Query  2094  AMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDIC  1915
             ++ ++ +     N   GS S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+DIC
Sbjct  72    SVASTTLGKDNQNTDEGSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDIC  131

Query  1914  SLECKTILLSRIE----KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             SLECK   L + +    KS +             +  Y+ +D    S    L  +Q E L
Sbjct  132   SLECKAKHLLQTQEKELKSDQLAAAESEAETHLLNTPYFYKD---HSFILGLRDEQIENL  188

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             + +L I V+G  V  P++ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ 
Sbjct  189   KLQLGIAVQGQQVPRPVVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLVGRDIVA  248

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
             SA+TGSGKT +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+
Sbjct  249   SADTGSGKTAAFLLPVIMKVLN-------ETETPSALILAPTRELAIQIERQAKELMAGL  301

Query  1386  P-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCM  1210
             P  +T L+VGG  +  QL+R++  V +I+ TPGRL ++L +  + L  + + V+DEVD M
Sbjct  302   PNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLREILKQSSVRLHGIKIVVVDEVDTM  361

Query  1209  LQRGFHEQVMQIFRALS-QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVK  1033
             L+ GF +QV+ I   +S + Q ++ SATI   +E +A+ +      I+VG+ N P   V+
Sbjct  362   LKMGFQQQVLDILEDISHEHQTILVSATIPVGIEHLANQLLHDFVRITVGEKNLPCSHVR  421

Query  1032  QLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGE  853
             Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H E
Sbjct  422   QIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSE  481

Query  852   KSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASR  673
             KS  +R EIL+  L     VIV+TGVLGRG+DL++V+ V+ FDMP+S+ EYVHQ+GRA R
Sbjct  482   KSQGERTEILQGLLQEKYEVIVSTGVLGRGLDLVNVELVVNFDMPSSMDEYVHQVGRAGR  541

Query  672   MGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  542   LGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  591



>ref|XP_009472688.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Nipponia 
nippon]
 gb|KFR08028.1| putative ATP-dependent RNA helicase DDX59 [Nipponia nippon]
Length=624

 Score =   438 bits (1127),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 237/531 (45%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + +Q +  DS SE  +K  S  QR A P EP CV+CGRYGEYICDETD+D+CSLECK   
Sbjct  80    KDSQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDETDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             LL   EK +K      T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKEKKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDVSHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL   + +KPPV+VFV  +LGADLLS A+   TGL+  ++H +KS  +R
Sbjct  430   EEPSKKKKLFEILNDTKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSDKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>gb|KFW68586.1| putative ATP-dependent RNA helicase DDX59 [Pygoscelis adeliae]
Length=620

 Score =   438 bits (1126),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 236/527 (45%), Positives = 335/527 (64%), Gaps = 23/527 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-I  1894
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQTTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1893  LLSRIEKSRK-PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
             LL   EK +K  +           D  Y+ RD    S    L  +Q E L+ +L I V+G
Sbjct  140   LLQSQEKEKKLKSDQLTKAETHLLDTPYFYRD---HSFILGLRDEQIENLKLQLGIAVQG  196

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
               V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGKT 
Sbjct  197   QQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGKTA  256

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVG  1360
             +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+VG
Sbjct  257   AFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVG  309

Query  1359  GDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVM  1180
             G  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+
Sbjct  310   GLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQVL  369

Query  1179  QIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
              I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   
Sbjct  370   DILEDISHDHQTILVSATIPAGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPS  429

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL
Sbjct  430   KKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDIL  489

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             +  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ ++ R+G   T+I F
Sbjct  490   QGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNKSGRLGHSETAITF  549

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             IN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   INNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  589



>ref|XP_010200730.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Colius 
striatus]
 gb|KFP25845.1| putative ATP-dependent RNA helicase DDX59 [Colius striatus]
Length=624

 Score =   438 bits (1126),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 235/523 (45%), Positives = 337/523 (64%), Gaps = 23/523 (4%)
 Frame = -1

Query  2076  VAATES---NQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICS  1912
             VA+T S   NQ +  +S  E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CS
Sbjct  73    VASTTSGKDNQNTAEESSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCS  132

Query  1911  LECKT--ILLSRIE----KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAEL  1750
             LECK   +L S+ +    KS + T           +  Y+ +D    +    L  +Q E 
Sbjct  133   LECKAKHLLQSQTKEGKLKSDELTKAESQAEADLLNTPYFYKD---HAFILGLRDEQIEN  189

Query  1749  LRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLL  1570
             L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++
Sbjct  190   LKLQLGIAVQGHHVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIV  249

Query  1569  VSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKG  1390
              SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G
Sbjct  250   ASADTGSGKTAAFLLPVIMKVLK-------ETEAPSALILAPTRELAIQIERQAKELMAG  302

Query  1389  MP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDC  1213
             +P  +T L+VGG  +  QL+R++  V +I+ TPGRL ++L +  ++L ++ + V+DEVD 
Sbjct  303   LPNMRTVLLVGGLPLPPQLHRLKQNVKVIIATPGRLTEILKQSSVQLHAIKIVVVDEVDT  362

Query  1212  MLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAV  1036
             ML+ GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V
Sbjct  363   MLKMGFQQQVLDILEGISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNV  422

Query  1035  KQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHG  856
             +Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H 
Sbjct  423   RQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVRKITGLQCTAMHS  482

Query  855   EKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRAS  676
             EKS  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA 
Sbjct  483   EKSQVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAG  542

Query  675   RMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  543   RLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>gb|KFZ61480.1| putative ATP-dependent RNA helicase DDX59 [Podiceps cristatus]
Length=624

 Score =   438 bits (1126),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 236/532 (44%), Positives = 334/532 (63%), Gaps = 21/532 (4%)
 Frame = -1

Query  2076  VAATESNQPSGSDS--DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLEC  1903
              A  + NQ +  DS  +  +K  S  QR A P EP CV+CGRYGEYICD+TD D+CSLEC
Sbjct  76    TALGKDNQNTDGDSFLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDKDVCSLEC  135

Query  1902  KT-ILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLA--SDQAELLRRKLN  1732
             K   LL   E+ +   P          + C        K  S  L    DQ E L+ +L 
Sbjct  136   KAKHLLQSQEEEKNLKPDQLTKVESQAETCLLNTPYSYKEHSFILGLRDDQIENLKLQLG  195

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TG
Sbjct  196   IAVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTG  255

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKT  1375
             SGKT +FL+P++   +       +  + P A+ILAPTREL IQIE QAK L  G+P  +T
Sbjct  256   SGKTAAFLLPVIMKVL-------QETETPSALILAPTRELAIQIERQAKELMAGLPNMRT  308

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
              L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF
Sbjct  309   VLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLRGIKIVVVDEVDTMLKMGF  368

Query  1194  HEQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
              +QV+ I   +S   Q ++ SATI   +E +A+ + ++   I++G+ N P   V+Q+ +W
Sbjct  369   QQQVLDILEDISHCHQTILVSATIPVGIEHLANQLLQNFVRITIGEKNLPCSNVRQIILW  428

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +
Sbjct  429   VEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQME  488

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  G
Sbjct  489   RTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSG  548

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             T+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  549   TAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_003474898.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Cavia porcellus]
Length=619

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/516 (46%), Positives = 330/516 (64%), Gaps = 27/516 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-EKSRKPTPCP  1849
             VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++ EK  K   C 
Sbjct  91    VKSFSKTQRWPEPGEPVCVVCGRYGEYICDQTDEDVCSLECKAKHLLQVKEKKEKLNLCC  150

Query  1848  P-----PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFG  1684
             P         P T   +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ F 
Sbjct  151   PQNAGSEPESPLT--TFYVYKEHPFISN--LQEDQIENLKQQLGISVQGQEVTRPIIDFE  206

Query  1683  SCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTV  1504
              CD P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++    
Sbjct  207   HCDFPEALNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIQ--  264

Query  1503  KLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRV  1327
                 A  E K  P A+IL PTREL IQIE+QAK L  G+P  +T L+VGG  +  QLYR+
Sbjct  265   ----ALPESK-TPSALILTPTRELAIQIEKQAKELMSGLPCMRTVLLVGGLPLPPQLYRL  319

Query  1326  EHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-Q  1150
                V +I+ TPGRL+D++ +  +EL  + + V+DE D ML+ GF +QV+ I   +    Q
Sbjct  320   RQRVKVIIATPGRLLDIVKQNAVELSGIKIVVVDEADTMLKMGFQQQVLDILENIPNDCQ  379

Query  1149  ILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTS  970
               + SATI   +E++AS +  +   I  G+      +V+Q+ +WVE   KK+KLF+IL  
Sbjct  380   TXLASATIPASIEQLASQLLHNPVRIVSGEKEPSMSSVRQIILWVEDPAKKKKLFEILND  439

Query  969   KQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVI  790
             K+ +KPPV+VFVG +LGADLLS A+   TGL + SIH EKS  +R+ IL+  L G+  V+
Sbjct  440   KKLFKPPVLVFVGCKLGADLLSEAVQKITGLNSTSIHSEKSQIERKNILKGLLEGEYEVV  499

Query  789   VATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPE  610
             V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+LF +
Sbjct  500   VSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQTGTAITFINNSSKRLFWD  559

Query  609   LVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             + + +K +G+ +P +L NS Y         H ++RK
Sbjct  560   IAKRVKPTGSILPPQLLNSPY--------LHDQKRK  587



>ref|XP_005454017.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X1 [Oreochromis niloticus]
 ref|XP_005454018.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X2 [Oreochromis niloticus]
Length=638

 Score =   438 bits (1127),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/513 (44%), Positives = 331/513 (65%), Gaps = 26/513 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-----------  1879
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L ++           
Sbjct  94    VKSFKKNQRWPEPGEPACVMCGRYGEYICDATDNDVCSLECKASHLVQMGMGTGADAFMQ  153

Query  1878  -EKSR------KPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVK  1720
              +++R         P   P R   ++  Y+ R+D   S    L  +Q + ++++L I  +
Sbjct  154   KDQNRDEMTVQSQQPAADPGRVVESEPGYFYREDRFIS---GLTEEQVQRIKQELGIETQ  210

Query  1719  GDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKT  1540
             G  V+ P++ F  C  P  L  NL+ AGY+ PTPVQMQ +P  L GR ++ SA+TGSGKT
Sbjct  211   GRDVARPVVEFEHCSFPATLSGNLKKAGYDTPTPVQMQMVPVGLTGRDVIASADTGSGKT  270

Query  1539  GSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVV  1363
              +FL+P+V   ++     +     P+A+IL PTREL IQIE QAK L  G+P  +TAL+V
Sbjct  271   VAFLLPVVVRALE---KSAHSVGSPVALILTPTRELAIQIERQAKELVMGLPNMRTALLV  327

Query  1362  GGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQV  1183
             GG  +  QL+R++  + +++ TPGRLI++L ++E++LD V + V+DEVD ML+ GF +QV
Sbjct  328   GGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKELKLDKVKIVVVDEVDTMLKMGFQQQV  387

Query  1182  MQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESK  1006
             +++   +  + Q L+ SATI    E++A+ + +    I++G+ N+P   V+Q+ +WVE  
Sbjct  388   LEVLEQVPEEHQTLLASATIPTGTEELAARLVRDPVRITIGEKNQPCANVRQILLWVEEP  447

Query  1005  QKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREI  826
              KK+KLF+IL   + Y+PPV+VFV S+LGADLL  A+   TGL AV+IH +KS  +R  I
Sbjct  448   SKKKKLFEILNDGKLYQPPVVVFVESKLGADLLCEAVAKVTGLTAVAIHSDKSQWERNRI  507

Query  825   LRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIV  646
             LR  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I 
Sbjct  508   LRGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAIT  567

Query  645   FINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              +N  NK+LF E+V  +K +G+ +P +L NS +
Sbjct  568   LLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPH  600



>ref|XP_005800397.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like [Xiphophorus 
maculatus]
Length=623

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 230/524 (44%), Positives = 331/524 (63%), Gaps = 29/524 (6%)
 Frame = -1

Query  2055  QPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSR  1882
             Q S  D++ E  VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L +
Sbjct  70    QSSSDDAEEEEPVKSFKKSQRWPEPGEPVCVMCGRYGEYICDATDNDVCSLECKANHLLQ  129

Query  1881  I---------------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
             +                  R   P  P V    ++  Y  R+D   S    L  +Q E +
Sbjct  130   MGIRAGDYAFNVKDKNTDGRTSQPHHPAVNLGTSEAGYSYREDPFIS---GLTDEQVERI  186

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             R +L I  +G  V  PI+ F  C  P  L  NL+ AGYE PTPVQMQ +P  L GR ++ 
Sbjct  187   RLELGIKTEGKDVRRPIVEFEHCGFPSLLSGNLKKAGYEAPTPVQMQMVPVGLTGRDVIA  246

Query  1566  SAETGSGKTGSFLIPIVANTVK--LNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGK  1393
             SA+TGSGKT +FL+P+V   ++   +  CS     PL +IL PTREL IQIE QAK L  
Sbjct  247   SADTGSGKTIAFLLPVVVRALEEAAHGICS-----PLGLILTPTRELAIQIERQAKELVM  301

Query  1392  GMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVD  1216
             G+P  +TAL+VGG  +  QL+R++  + +++ TPGRLI++L ++ ++LD V + V+DEVD
Sbjct  302   GIPNMRTALLVGGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKALKLDKVKILVVDEVD  361

Query  1215  CMLQRGFHEQVMQIFRALS-QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGA  1039
              ML+ GF +QV+++   ++ + Q L+ SATI    E++A+ +      I++G+ N+P   
Sbjct  362   TMLKMGFQQQVLEVLEHVTKEHQTLLASATIPAGTEELAARLVHDPVRIAIGEKNQPCAN  421

Query  1038  VKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIH  859
             V+Q+ +WVE   KK+KLF+IL   + ++PPV+VFV  +LGADLL  A+   TGL  V+IH
Sbjct  422   VRQILLWVEEPSKKKKLFEILNDNKLFQPPVVVFVDCKLGADLLCEAVAKVTGLTTVAIH  481

Query  858   GEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRA  679
              +K+ ++R  IL+  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA
Sbjct  482   SDKNQRERNRILKGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRA  541

Query  678   SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              R+G  GT+I F+N  NK+LF E+V  +K +G+ +P +L NS Y
Sbjct  542   GRLGHRGTAITFLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPY  585



>ref|XP_006135453.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Pelodiscus 
sinensis]
Length=628

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 332/529 (63%), Gaps = 40/529 (8%)
 Frame = -1

Query  2043  SDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL--------  1888
             S  D  +K  S  QR A P EPKCV+CGRYGEYICD+TD+DICSLECK   L        
Sbjct  93    SSVDEPIKSFSKSQRWAEPGEPKCVVCGRYGEYICDKTDEDICSLECKAKHLLQAKEKEE  152

Query  1887  -----SRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
                  S ++   KP   P P+   A  +  ++           L  DQ + L+ +L I V
Sbjct  153   SLNSDSLVKIESKPE-APLPITLYAYKEHSFIL---------SLQDDQIKNLKLQLGIAV  202

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
              GD V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA TGSGK
Sbjct  203   HGDGVTRPILEFEHCGFPETLNYNLKNSGYEVPTPIQMQMIPVGLLGRDIVASANTGSGK  262

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +       E  + P A+IL PTREL IQIE QAK L  G+P  +T L+
Sbjct  263   TAAFLLPVIVKAL-------EETKTPSALILTPTRELAIQIERQAKELMIGLPNMRTVLL  315

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DE D ML+ GF +Q
Sbjct  316   VGGLPLPPQLHRLKQTVKVIIATPGRLLDILKQSFVQLHGIKIVVVDEADTMLKMGFQQQ  375

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S+  Q ++ SATI   +E++A+ + ++   IS+G+ N P   V+Q+ +WVE 
Sbjct  376   VLDILENISRDRQTMLVSATIPVGIEQLANQLLQNPVRISIGEKNLPCSNVRQIILWVEE  435

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+ +S+H +KS  +R  
Sbjct  436   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCISMHSDKSQTERIN  495

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQIGRA R+G  GT+I
Sbjct  496   ILQGLFEEKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQIGRAGRLGHNGTAI  555

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +KKLF ++V+ +K +G  +P +L NS Y         H ++RK
Sbjct  556   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQKRK  596



>ref|XP_005348490.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Microtus 
ochrogaster]
Length=620

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 231/518 (45%), Positives = 333/518 (64%), Gaps = 23/518 (4%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPT  1858
             S+  VK  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   L +++   +  
Sbjct  88    SEEPVKSFSKSQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKGEEQSP  147

Query  1857  PCPPPVRFPATDD----CYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
                 P R  +  +     +YV  +     +  L  DQ E L+++L I V+G  V+ PI+ 
Sbjct  148   KASSPQRAASEPETPLGAFYVYREHPFIGT--LREDQIETLKQQLGISVQGQEVARPIID  205

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  206   FEHCGFPETLNQNLKQSGYEVPTPIQMQMIPMGLLGRDILASADTGSGKTAAFLLPVIMR  265

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE+QAK L  G+P  KT L+VGG  +  QL+
Sbjct  266   ------ALFEDK-TPSALILTPTRELAIQIEKQAKELMSGLPRMKTVLLVGGLPLPPQLH  318

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R+   V +I+ TPGRL+D++ +  I L ++ + V+DE D ML+ GF +QV+ +     + 
Sbjct  319   RLRQQVKVIIATPGRLLDIIKQNSISLGAIKIVVVDEADTMLKMGFQQQVLDVLETTPAD  378

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++A  +  +   I  G  N P  +V+Q+ +WVE   KK+KLF+IL
Sbjct  379   CQTILVSATIPGSIEQLAEQLLHNPVRIITGDKNLPCPSVRQIILWVEDPGKKKKLFEIL  438

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGL + SIH EKS  +RR+IL+  L GD  
Sbjct  439   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLHSTSIHSEKSQMERRDILKGLLEGDYE  498

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+V+TGVLGRG+DL++VK V+ FDMP+S+ EY+HQ+GR  R+G++GT+I FIN  +K+LF
Sbjct  499   VVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYIHQVGRVGRLGQDGTAITFINNNSKRLF  558

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              ++ + +K +G+ +P +L NS Y         H+++RK
Sbjct  559   WDVAKRVKPTGSILPPQLLNSPY--------LHEQKRK  588



>ref|XP_009500112.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Phalacrocorax 
carbo]
Length=624

 Score =   437 bits (1125),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 335/536 (63%), Gaps = 25/536 (5%)
 Frame = -1

Query  2085  TSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
             T+ +     N   GS S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLE
Sbjct  75    TTALGKDNQNTDEGSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLE  134

Query  1905  CKT-ILLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
             CK   LL   EK +K      T           +  Y  +D    S    L  +Q E L+
Sbjct  135   CKAKHLLQSQEKEKKLNSDQFTNAESQAETHLLNMPYSYKD---HSFILGLRDEQIENLK  191

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
              +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ S
Sbjct  192   LQLGIAVQGQQVPRPIVEFEHCGFPETLNYNLKNSGYEVPTPIQMQMIPVGLLGRDIVAS  251

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P
Sbjct  252   ADTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLP  304

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML
Sbjct  305   NMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSLQLHGIKIVVVDEVDTML  364

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q
Sbjct  365   KMGFQQQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQ  424

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EK
Sbjct  425   IILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEK  484

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             S  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ GRA R+
Sbjct  485   SQVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQKGRAGRL  544

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  545   GHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_009583110.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Fulmarus 
glacialis]
 gb|KFW11224.1| putative ATP-dependent RNA helicase DDX59 [Fulmarus glacialis]
Length=624

 Score =   437 bits (1124),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS SE  +K  S  QR A P EP C++CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KGNQNTDEDSSSEEPIKSFSKSQRWAEPGEPLCIVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEKEEKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLQDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
               +G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   DAQGQQVPRPIVEFEHCGFPEALNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSAVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ ++PPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFRPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_004685530.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Condylura 
cristata]
Length=618

 Score =   437 bits (1124),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 335/537 (62%), Gaps = 37/537 (7%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT  1897
             + A E      + S+  VK  S  QR A P EP CVICGRYGEYICDETD+D+CSLECK 
Sbjct  75    MGAPEREMKDSNLSEDPVKSFSKTQRWAEPGEPVCVICGRYGEYICDETDEDVCSLECKA  134

Query  1896  ----------ILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELL  1747
                         LS  +K+         V +   +  + +           L   Q + L
Sbjct  135   KHLLKIKEKKEKLSNAQKADSEPESSLNVPYAYKEHPFILN----------LQEAQIQNL  184

Query  1746  RRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLV  1567
             +++L I+V+G  VS PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L 
Sbjct  185   KQQLGILVQGQDVSRPIIDFEHCGFPEPLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILA  244

Query  1566  SAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM  1387
             SA+TGSGKT +FL+P++   +          + P A+IL PTREL IQIE QAK L  G+
Sbjct  245   SADTGSGKTAAFLLPVIIRALL-------ESKTPCALILTPTRELAIQIERQAKELMSGL  297

Query  1386  P-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCM  1210
             P  KT L+VGG  M  QLYR+   V +I+ TPGRL++++ +  +EL ++ + V+DE D M
Sbjct  298   PRMKTVLLVGGLPMPPQLYRLRQYVKVIIATPGRLLEIIKQNSVELCNIKIVVVDEADTM  357

Query  1209  LQRGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVK  1033
             L+ GF +QV+ I   + S  Q ++ SATI   +E++A+ +  +   I  G+ N P  +V+
Sbjct  358   LKMGFQQQVLDILENVPSDCQTVLVSATIPSSMEQLANQLLHNPVRIITGEKNLPCPSVR  417

Query  1032  QLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGE  853
             Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFVG +LGADLLS A+   TGLK+VSIH E
Sbjct  418   QIVLWVEEPAKKKKLFEILNDKKLFKPPVLVFVGCKLGADLLSEAVQKITGLKSVSIHSE  477

Query  852   KSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASR  673
             KS  +R+ IL+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R
Sbjct  478   KSQMERKNILKGLLDGDCEVVVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGR  537

Query  672   MGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +G+ GT+I  IN  +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  538   LGQNGTAITLINNSSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  586



>ref|XP_009668082.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Struthio camelus australis]
 gb|KFV78698.1| putative ATP-dependent RNA helicase DDX59 [Struthio camelus australis]
Length=625

 Score =   437 bits (1124),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 239/547 (44%), Positives = 339/547 (62%), Gaps = 30/547 (5%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             S     A  TS+   ++ NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYIC
Sbjct  68    SPSDLGAASTSL---SKDNQNTDEDSSLEEPIKSFSKSQRWAAPGEPVCVVCGRYGEYIC  124

Query  1938  DETDDDICSLECKTILLSRIEKSRKPTPCPPPVRFPAT------DDCYYVRDDDKKSESK  1777
             D+T++D+CSLECK   L + ++  K        +  +       D  Y  +D    S   
Sbjct  125   DKTEEDVCSLECKAKHLLQAQEKEKNLKSDQLAKAESQAETLQLDTSYSYKD---HSFIL  181

Query  1776  CLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIP  1597
              L  +Q + L+ +L I V G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP
Sbjct  182   GLKDEQVKNLKLQLGIAVLGQQVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIP  241

Query  1596  AALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIE  1417
               L+G+ +L SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE
Sbjct  242   VGLLGKDILASADTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIE  294

Query  1416  EQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVS  1240
              QAK L  G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + 
Sbjct  295   RQAKELMAGLPNMRTVLLVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVQLHGIK  354

Query  1239  MFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVG  1063
             + V+DEVD ML+ GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I +G
Sbjct  355   IVVVDEVDTMLKMGFQQQVLDILENISHDHQTILVSATIPVGIEHLANQLLHNFVRIIIG  414

Query  1062  QLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITIST  883
             + N P   V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   T
Sbjct  415   EKNLPCSNVRQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKIT  474

Query  882   GLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKE  703
             GL+  S+H EKS  +R EIL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ E
Sbjct  475   GLQCTSMHSEKSQVERTEILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDE  534

Query  702   YVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVG  523
             YVHQ+GRA R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y        
Sbjct  535   YVHQVGRAGRLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------  587

Query  522   RHQKRRK  502
               QKRR+
Sbjct  588   HDQKRRE  594



>ref|XP_006892154.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Elephantulus 
edwardii]
Length=613

 Score =   437 bits (1123),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 229/524 (44%), Positives = 333/524 (64%), Gaps = 43/524 (8%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK  S  QR A P EP C++CGRYGEYICD+TD+D+CSLECK   L ++++         
Sbjct  85    VKSFSKAQRWAEPGEPVCIVCGRYGEYICDKTDEDVCSLECKARHLLQVKEKED------  138

Query  1845  PVRFPATDDCYYVRDDDKKSESKC--------------LASDQAELLRRKLNIVVKGDLV  1708
                     +   ++  D + ES                L  DQ E L+++L IVV+G  V
Sbjct  139   ------QGELSSLQKADSEPESSLGAFYDYREHPFILNLQEDQIEHLKQQLGIVVQGQEV  192

Query  1707  SPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFL  1528
               PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL
Sbjct  193   PRPIIEFEHCRFPEALNRNLKQSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFL  252

Query  1527  IPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDA  1351
             +P++   +         ++ P+A+IL PTREL IQIE+QAK L  G+P  KT L+VGG  
Sbjct  253   LPVIIRALF-------AEKTPVALILTPTRELAIQIEKQAKELMSGLPRMKTVLLVGGLP  305

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +  QLYR+   V +I+ TPGRL+D++ +  +EL ++++ V+DE D ML+ GF +QV+ I 
Sbjct  306   LPPQLYRLRQHVKVIIATPGRLLDIIKQSSVELCNINIVVVDEADTMLKMGFQQQVLDIL  365

Query  1170  RALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQ  994
               +    Q ++ SATI   +E++AS +  +   I+ G+ N P   V+Q+ +WVE   KK+
Sbjct  366   ENIPDDCQTILVSATIPASMEQLASQLLHNTVRITTGEENLPCPNVRQIILWVEEPSKKK  425

Query  993   KLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSF  814
             KLF+IL  K+ +KPPV+VFV  RLGADLLS A+   TGL+++S+H EK   +R+ IL+  
Sbjct  426   KLFEILNDKKLFKPPVLVFVDCRLGADLLSEAVQKVTGLQSISMHSEKPQIERKNILKGL  485

Query  813   LVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINE  634
             L GD  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQIGR  R+G+ GT++ FIN 
Sbjct  486   LEGDYDVVVSTGVLGRGLDLINVKLVVNFDMPSSMDEYVHQIGRVGRLGQRGTALTFINN  545

Query  633   ENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              +K+LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  546   NSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  581



>ref|XP_010214505.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Tinamus 
guttatus]
 gb|KGL78294.1| putative ATP-dependent RNA helicase DDX59 [Tinamus guttatus]
Length=620

 Score =   437 bits (1124),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 240/531 (45%), Positives = 331/531 (62%), Gaps = 30/531 (6%)
 Frame = -1

Query  2061  SNQPSGSDS---DSE------VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSL  1909
             +N P G DS   D E      VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSL
Sbjct  78    ANTPLGKDSQNTDEESSLEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSL  137

Query  1908  ECKTILLSRIEKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             ECK   L + ++  K       V      D  Y   D   S    L  +    L+ +L I
Sbjct  138   ECKAKHLLQAQEKLKSDQV---VEAENDLDTTYSYKD--HSFILSLQDEHIRNLKLQLGI  192

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
             VV G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+G+ +L SA+TGS
Sbjct  193   VVLGQQVPRPIIEFEHCGFPETLNRNLKNSGYEVPTPIQMQMIPVGLLGKDILASADTGS  252

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P  +ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  253   GKTAAFLLPVIMKVLK-------ETETPSGLILAPTRELAIQIERQAKELMAGLPNMRTV  305

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  + L  + + V+DEVD ML+ GF 
Sbjct  306   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVRLHGIKIVVVDEVDTMLKMGFQ  365

Query  1191  EQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  366   QQVLDILENISHGHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  425

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+ VS+H EKS  +R
Sbjct  426   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCVSMHSEKSQVER  485

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              EIL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  486   TEILQGLLQKTYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  545

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  546   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  589



>ref|XP_009694569.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Cariama 
cristata]
Length=627

 Score =   437 bits (1124),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 235/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTEEDSSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +++      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQMQAKESKLKSDQLTKAESEGETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +    Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDICHDRQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_010954570.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Camelus 
bactrianus]
 ref|XP_010954571.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Camelus 
bactrianus]
Length=620

 Score =   437 bits (1123),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 330/530 (62%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE--  1876
             DSD     VK  S  QR A P EP CV+CGR+GEY+CD TD+D+CSLECK   L ++E  
Sbjct  84    DSDLPEEPVKSFSKTQRWARPGEPVCVVCGRFGEYVCDTTDEDVCSLECKARHLLQVEGQ  143

Query  1875  ----KSRKPT------PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
                 + R P         P P  +  T+  +             L  DQ E LR +L IV
Sbjct  144   AGQAEPRGPQEAGSEPAAPRPAAYVYTEHAFI----------SSLREDQIENLRGQLGIV  193

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V+ P++ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L SA+TGSG
Sbjct  194   VQGQGVARPVVDFEHCGFPEALNHNLKASGYEVPTPIQMQMIPVGLLGRDILASADTGSG  253

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++       L    + + P A++L PTREL IQIE QAK L +G+P  +T L
Sbjct  254   KTAAFLLPVI-------LRALFQSRAPSALVLTPTRELAIQIERQAKELMRGLPGMRTVL  306

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     Q +R+   + +I+ TPGRL+D++ +  +EL SV + V+DE D ML+ GF +
Sbjct  307   LVGGLPAPPQRHRLRQRIQVIIATPGRLLDIIKQSSVELGSVKIVVVDEADTMLKMGFQQ  366

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV  I   +    Q ++ SATI   +E++A  +      I  G+ N P  +V+Q+ +WVE
Sbjct  367   QVFDILENVPHDCQTVLVSATIPASIEQLAGQLLHDPVRIVAGEKNLPCASVRQIVLWVE  426

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H EKS  +RR
Sbjct  427   DPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVEKITGLRSTSVHSEKSQTERR  486

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              +L+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ GT+
Sbjct  487   HVLKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQNGTA  546

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +  +G+ +P +L NS Y         H+++RK
Sbjct  547   ITFINNSSKRLFWDVAKRVGPTGSLLPPQLLNSPY--------LHEQKRK  588



>gb|KFP63098.1| putative ATP-dependent RNA helicase DDX59, partial [Cariama cristata]
Length=623

 Score =   437 bits (1123),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 235/531 (44%), Positives = 336/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNTEEDSSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L +++      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQMQAKESKLKSDQLTKAESEGETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +    Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDICHDRQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_005148130.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Melopsittacus 
undulatus]
Length=623

 Score =   437 bits (1123),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 331/529 (63%), Gaps = 29/529 (5%)
 Frame = -1

Query  2058  NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-ILLSR  1882
             N   G+  +  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   LL  
Sbjct  83    NTVEGTSLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQT  142

Query  1881  IEKSRK-------PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
              EK  K                 P T   Y+ RD    S    L  +Q E L+ +L I V
Sbjct  143   QEKENKLKSDQLTKAESQSEAHLPNTP--YFYRD---HSFILSLQDEQIENLKLQLGIAV  197

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  +  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGK
Sbjct  198   QGQQIPRPILEFQHCGFPETLNRNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGK  257

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +K         + P A+IL+PTREL IQIE QAK L  G+P  +T L+
Sbjct  258   TAAFLLPVIMKVLK-------ETETPSALILSPTRELAIQIERQAKELMAGLPNMRTVLL  310

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +Q
Sbjct  311   VGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQ  370

Query  1185  VMQIFRALS-QPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE 
Sbjct  371   VLDILEDISVDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEE  430

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +
Sbjct  431   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTD  490

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
              L+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I
Sbjct  491   TLQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAI  550

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  551   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  592



>ref|XP_009668080.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Struthio camelus australis]
Length=643

 Score =   437 bits (1125),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 235/532 (44%), Positives = 334/532 (63%), Gaps = 27/532 (5%)
 Frame = -1

Query  2067  TESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTI  1894
             ++ NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYICD+T++D+CSLECK  
Sbjct  98    SKDNQNTDEDSSLEEPIKSFSKSQRWAAPGEPVCVVCGRYGEYICDKTEEDVCSLECKAK  157

Query  1893  LLSRIEKSRKPTPCPPPVRFPAT------DDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
              L + ++  K        +  +       D  Y  +D    S    L  +Q + L+ +L 
Sbjct  158   HLLQAQEKEKNLKSDQLAKAESQAETLQLDTSYSYKD---HSFILGLKDEQVKNLKLQLG  214

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I V G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+G+ +L SA+TG
Sbjct  215   IAVLGQQVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGKDILASADTG  274

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKT  1375
             SGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T
Sbjct  275   SGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRT  327

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
              L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF
Sbjct  328   VLLVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGF  387

Query  1194  HEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
              +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I +G+ N P   V+Q+ +W
Sbjct  388   QQQVLDILENISHDHQTILVSATIPVGIEHLANQLLHNFVRIIIGEKNLPCSNVRQIILW  447

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +
Sbjct  448   VEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVE  507

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             R EIL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  G
Sbjct  508   RTEILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSG  567

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             T+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  568   TAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  612



>ref|XP_003223658.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Anolis 
carolinensis]
Length=619

 Score =   436 bits (1122),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 224/530 (42%), Positives = 345/530 (65%), Gaps = 22/530 (4%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT  1897
             VA TESN+ + S  +  +K     QR  LP EP CV+CGRYGEYICD+TD+D+CSLECK 
Sbjct  74    VAITESNEENSSLVEEPIKSFCKTQRWPLPGEPVCVVCGRYGEYICDKTDEDVCSLECKA  133

Query  1896  ILLSRIEKSRKPTPCPPPVRF---PATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
               L R+ + ++        +    P+  +  Y  +++    S  L  +Q + L+++L IV
Sbjct  134   KHLLRVREEKENVELAITNKAELPPSFLNGPYAYEENAFVSS--LQDEQIDNLKQQLGIV  191

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G+ ++ PI+ F  C  P  L  NL+ +GYE+PTPVQMQ IP  L+GR ++ +A+TGSG
Sbjct  192   VQGEGIARPIVEFEHCSFPDVLSSNLKKSGYEVPTPVQMQMIPVGLLGRDIVATADTGSG  251

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +          + P A+IL PTREL IQIE+QAK L  G+P  +T L
Sbjct  252   KTAAFLLPVIIKAMG-------EVEAPSALILTPTRELAIQIEKQAKELMVGLPNMRTVL  304

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG  +  QL+R++  V +I+ TPGRL+++L +  +EL ++ + V+DE D ML+ GF +
Sbjct  305   LVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVELHNIKIVVVDEADTMLKMGFQQ  364

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ I   + +  Q ++ SAT+   +E++A+ + ++   I++G+ N+P   V+Q+ +WVE
Sbjct  365   QVLDILENIPRDHQTILVSATMPFGIEQLANRLLQNHVKITIGEKNQPCSNVRQIILWVE  424

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPP++VFV  +LGADLLS A+   TGL+ +S+H +K+  +R 
Sbjct  425   EPSKKKKLFEILNDKKLFKPPILVFVECKLGADLLSDAVHKITGLETISMHADKTQTERN  484

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL+        V+V+TG+LGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+
Sbjct  485   TILQGLFQEKYEVVVSTGILGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTA  544

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +KKLF ++V+ +K +G  +P +L NS Y         H ++RK
Sbjct  545   ITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQKRK  586



>ref|XP_009668081.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Struthio camelus australis]
Length=639

 Score =   437 bits (1124),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 239/547 (44%), Positives = 339/547 (62%), Gaps = 30/547 (5%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYIC  1939
             S     A  TS+   ++ NQ +  DS  E  +K  S  QR A P EP CV+CGRYGEYIC
Sbjct  82    SPSDLGAASTSL---SKDNQNTDEDSSLEEPIKSFSKSQRWAAPGEPVCVVCGRYGEYIC  138

Query  1938  DETDDDICSLECKTILLSRIEKSRKPTPCPPPVRFPAT------DDCYYVRDDDKKSESK  1777
             D+T++D+CSLECK   L + ++  K        +  +       D  Y  +D    S   
Sbjct  139   DKTEEDVCSLECKAKHLLQAQEKEKNLKSDQLAKAESQAETLQLDTSYSYKD---HSFIL  195

Query  1776  CLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIP  1597
              L  +Q + L+ +L I V G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP
Sbjct  196   GLKDEQVKNLKLQLGIAVLGQQVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIP  255

Query  1596  AALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIE  1417
               L+G+ +L SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE
Sbjct  256   VGLLGKDILASADTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIE  308

Query  1416  EQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVS  1240
              QAK L  G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + 
Sbjct  309   RQAKELMAGLPNMRTVLLVGGLPLPPQLHRLKQNVKVIIATPGRLLEILKQSSVQLHGIK  368

Query  1239  MFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVG  1063
             + V+DEVD ML+ GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I +G
Sbjct  369   IVVVDEVDTMLKMGFQQQVLDILENISHDHQTILVSATIPVGIEHLANQLLHNFVRIIIG  428

Query  1062  QLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITIST  883
             + N P   V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   T
Sbjct  429   EKNLPCSNVRQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKIT  488

Query  882   GLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKE  703
             GL+  S+H EKS  +R EIL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ E
Sbjct  489   GLQCTSMHSEKSQVERTEILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDE  548

Query  702   YVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVG  523
             YVHQ+GRA R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y        
Sbjct  549   YVHQVGRAGRLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------  601

Query  522   RHQKRRK  502
               QKRR+
Sbjct  602   HDQKRRE  608



>gb|KFW89466.1| putative ATP-dependent RNA helicase DDX59 [Phalacrocorax carbo]
Length=624

 Score =   436 bits (1122),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 236/536 (44%), Positives = 335/536 (63%), Gaps = 25/536 (5%)
 Frame = -1

Query  2085  TSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
             T+ +     N   GS S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLE
Sbjct  75    TTALGKDNQNTDEGSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLE  134

Query  1905  CKT-ILLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLR  1744
             CK   LL   EK +K      T           +  Y  +D    S    L  +Q E L+
Sbjct  135   CKAKHLLQSQEKEKKLNSDQFTNAESQAETHLLNMPYSYKD---HSFILGLRDEQIENLK  191

Query  1743  RKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVS  1564
              +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ S
Sbjct  192   LQLGIAVQGQQVPRPIVEFEHCGFPETLNYNLKNSGYEVPTPIQMQMIPVGLLGRDIVAS  251

Query  1563  AETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP  1384
             A+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P
Sbjct  252   ADTGSGKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLP  304

Query  1383  -FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCML  1207
               +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML
Sbjct  305   NMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSLQLHGIKIVVVDEVDTML  364

Query  1206  QRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQ  1030
             + GF +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q
Sbjct  365   KMGFQQQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQ  424

Query  1029  LAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEK  850
             + +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EK
Sbjct  425   IILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEK  484

Query  849   SMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRM  670
             S  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ +A R+
Sbjct  485   SQVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNKAGRL  544

Query  669   GEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  545   GHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_002932198.2| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Xenopus 
(Silurana) tropicalis]
Length=689

 Score =   438 bits (1126),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 230/543 (42%), Positives = 338/543 (62%), Gaps = 50/543 (9%)
 Frame = -1

Query  2049  SGSDSDSE-VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK  1873
             S  D+  E VK  S  QR   P +P CVICGRYGEYICD+TD D+CSLECK + + R+  
Sbjct  117   SSEDAHEEAVKSYSKCQRWPFPGDPVCVICGRYGEYICDQTDHDVCSLECKAMDILRVCG  176

Query  1872  SRKPTPC--------PPPVRFPA-------------TDDCYYVRDDDKKSESKC------  1774
             +   TPC        P P+ + A             + +    ++ D  +          
Sbjct  177   ASS-TPCAITDITLSPQPLLYSAIGPLDNSAITSTVSTELTSCQNSDADTSHVTAYNHPM  235

Query  1773  ------------LASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYE  1630
                         L++DQ   LR++L++ V G+ +  PIM F  C  P  L  N++AAGYE
Sbjct  236   PYIYKEHEFISQLSADQINHLRQQLSLSVHGNEMCKPIMEFDHCQFPPVLSSNIKAAGYE  295

Query  1629  MPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMIL  1450
             +PTP+QMQ IP  LMGR +L SA+TGSGKT +FL+P +       + C E+K  P A+IL
Sbjct  296   VPTPIQMQMIPVGLMGRDILASADTGSGKTAAFLLPAI-------IRCLEKKDSPAALIL  348

Query  1449  APTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLL  1273
              PTREL +QIE QAK L +G+P  +TAL+VGG  +  Q++R++ GV +I+ TPGRL++++
Sbjct  349   TPTRELAVQIEGQAKELMRGIPHMRTALLVGGMPLPPQIHRLKQGVQVIIATPGRLLEII  408

Query  1272  TKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASS  1096
              +  + L  + + ++DE D ML+ GF +QV+ I   +    Q ++ SATI   +E     
Sbjct  409   KQDSVNLGDLKILIVDEADTMLKMGFQQQVLDILEVVPHDHQTILVSATIPAGIEAFTKQ  468

Query  1095  MAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGA  916
             + +    I+VG+ N+P   V+Q+ +WVE   KK+KLF+IL   + ++PPV+VFV  RLGA
Sbjct  469   LLQDPVRITVGEKNQPCTNVRQIVLWVEEPSKKKKLFEILNDSKLFQPPVLVFVDCRLGA  528

Query  915   DLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQV  736
             DLLS A++  TGL+ V++H +KS  +R +IL+  L G+  V+V+TGVLGRG+DL++VK V
Sbjct  529   DLLSDAVSKITGLECVAMHSDKSQVERMKILQGLLQGEYDVVVSTGVLGRGLDLVNVKLV  588

Query  735   IVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELAN  556
             + FDMP+S+ EYVHQIGRA R+G  GT+I FIN+ N+ LF +LV+ ++ +G+ +P +L N
Sbjct  589   VNFDMPSSMDEYVHQIGRAGRLGHRGTAITFINKNNRNLFWDLVKRVQPTGSLLPPQLLN  648

Query  555   SKY  547
             S Y
Sbjct  649   SPY  651



>ref|XP_006183991.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Camelus ferus]
Length=625

 Score =   436 bits (1120),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 331/530 (62%), Gaps = 42/530 (8%)
 Frame = -1

Query  2040  DSD---SEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE-K  1873
             DSD     VK  S  QR A P EP CV+CGR+GEY+CD TD+D+CSLECK   L ++E +
Sbjct  89    DSDLPEEPVKSFSKTQRWARPGEPVCVVCGRFGEYVCDTTDEDVCSLECKARHLLQVEGQ  148

Query  1872  SRKPTP-----------CPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
             + +  P            P P  +  T+  +             L  DQ E LR +L IV
Sbjct  149   AGQAEPSGPQEAGSEPAAPRPAAYVYTEHAFI----------SSLREDQIENLRGQLGIV  198

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V+ P++ F  C  P  L  NL+A+GYE+PTP+QMQ IP  L+GR +L SA+TGSG
Sbjct  199   VQGQGVARPVVDFEHCGFPEALNHNLKASGYEVPTPIQMQMIPVGLLGRDILASADTGSG  258

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++       L    + + P A++L PTREL IQIE QAK L +G+P  +T L
Sbjct  259   KTAAFLLPVI-------LRALFQSRAPSALVLTPTRELAIQIERQAKELMRGLPGMRTVL  311

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG     Q +R+   V +I+ TPGRL+D++ +  +EL SV + V+DE D ML+ GF +
Sbjct  312   LVGGLPAPPQRHRLRQRVQVIIATPGRLLDIIKQSSVELGSVKIVVVDEADTMLKMGFQQ  371

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV  I   +    Q ++ SATI   +E++A  +      I  G+ N P  +V+Q+ +WVE
Sbjct  372   QVFDILENVPHDCQTVLVSATIPASIEQLAGQLLHDPVRIVAGEKNLPCASVRQIVLWVE  431

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL++ S+H EKS  +RR
Sbjct  432   DPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVEKITGLRSTSVHSEKSQTERR  491

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              +L+  L GD  V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ GT+
Sbjct  492   HVLKGLLEGDYEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQNGTA  551

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +K+LF ++ + +  +G+ +P +L NS Y         H+++RK
Sbjct  552   ITFINNSSKRLFWDVAKRVGPTGSLLPPQLLNSPY--------LHEQKRK  593



>ref|XP_005730368.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X1 [Pundamilia nyererei]
 ref|XP_005730369.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X2 [Pundamilia nyererei]
Length=634

 Score =   436 bits (1120),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/513 (44%), Positives = 330/513 (64%), Gaps = 26/513 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL--------------  1888
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L              
Sbjct  90    VKSFKKNQRWPGPGEPVCVMCGRYGEYICDATDNDVCSLECKASHLVQMGMGTGADAFMQ  149

Query  1887  ---SRIEKS-RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVK  1720
                +R E++ +   P   P R   ++  Y  R+D   S    L  +Q + ++++L I  +
Sbjct  150   KDQNRHERTVQSQQPAADPGRVVESEPGYSYREDRFIS---GLTEEQVQRIKQELGIETQ  206

Query  1719  GDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKT  1540
             G  V+ P++ F  C  P  L  NL+ AGY+ PTPVQMQ +P  L GR ++ SA+TGSGKT
Sbjct  207   GRDVARPVVEFEHCSFPPTLSGNLKKAGYDTPTPVQMQMVPVGLTGRDVIASADTGSGKT  266

Query  1539  GSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVV  1363
              +FL+P+V   ++     +     P+A+IL PTREL IQIE QAK L  G+P  +TAL+V
Sbjct  267   VAFLLPVVVRALE---KSAHSVGSPVALILTPTRELAIQIERQAKELVMGLPNMRTALLV  323

Query  1362  GGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQV  1183
             GG  +  QL+R++  + +++ TPGRLI++L ++E++LD V + V+DEVD ML+ GF +QV
Sbjct  324   GGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKELKLDKVKIVVVDEVDTMLKMGFQQQV  383

Query  1182  MQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESK  1006
             +++   +  + Q L+ SATI    E++A+ + +    I++G+ N+P   V+Q+ +WVE  
Sbjct  384   LEVLEQVPEEHQTLLASATIPTGTEELAARLVRDPVRITIGEKNQPCANVRQILLWVEEP  443

Query  1005  QKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREI  826
              KK+KLF+IL   + Y+PPV+VFV S+LGADLL  A+   TGL AV+IH +KS  +R  I
Sbjct  444   SKKKKLFEILNDGKLYQPPVVVFVESKLGADLLCEAVAKVTGLTAVAIHSDKSQWERNRI  503

Query  825   LRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIV  646
             LR  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I 
Sbjct  504   LRGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAIT  563

Query  645   FINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              +N  NK+LF E+V  +K +G+ +P +L NS +
Sbjct  564   LLNNNNKRLFLEVVSRVKPTGSILPPQLLNSPH  596



>ref|XP_010140891.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Buceros 
rhinoceros silvestris]
Length=624

 Score =   435 bits (1119),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 327/512 (64%), Gaps = 18/512 (4%)
 Frame = -1

Query  2058  NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI  1879
             N    + S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L +I
Sbjct  84    NSDEETSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQI  143

Query  1878  E------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
             +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I V+G
Sbjct  144   QAKEKKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGIAVQG  200

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
               V  PI+ F  C  P  L  NL+ +GY++PTP+QMQ IP  L+GR ++ SA+TGSGKT 
Sbjct  201   QQVPRPIVEFEHCGFPETLNRNLKNSGYDVPTPIQMQMIPVGLLGRDIVASADTGSGKTA  260

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVG  1360
             +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+P  +T L+VG
Sbjct  261   AFLLPVIVKVLT-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVG  313

Query  1359  GDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVM  1180
             G  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+
Sbjct  314   GLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQVL  373

Query  1179  QIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
              I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   
Sbjct  374   DILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPS  433

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL
Sbjct  434   KKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDIL  493

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             +  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ RA R+G  GT+I F
Sbjct  494   QGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNRAGRLGHSGTAITF  553

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKY  547
             IN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  554   INNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_003767605.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Sarcophilus 
harrisii]
Length=617

 Score =   435 bits (1118),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/539 (44%), Positives = 336/539 (62%), Gaps = 40/539 (7%)
 Frame = -1

Query  2073  AATESNQPSGSDS---DSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLEC  1903
             AA    + S  DS   +  +K  S  QR A P EP CV+CGRYGEYICD+TD D+CSLEC
Sbjct  72    AAVGLGEQSAKDSCVPEEPIKSFSKTQRWAEPGEPVCVVCGRYGEYICDKTDADVCSLEC  131

Query  1902  KT-ILLSRIEKSRK-------PTPCPPPVR--FPATDDCYYVRDDDKKSESKCLASDQAE  1753
             K   LL   EK  K         P PPP+   F   +  + +           L  DQ E
Sbjct  132   KAKHLLQVTEKEEKVKLLKVSSEPEPPPLDALFAYKEHPFILN----------LQDDQVE  181

Query  1752  LLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSL  1573
              L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR +
Sbjct  182   NLKLQLGISVQGQKVPRPIIDFEHCGFPEVLNYNLKKSGYEVPTPIQMQMIPIGLLGRDI  241

Query  1572  LVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGK  1393
             + SA+TGSGKT +FL+P++   ++ N+        P A+IL PTREL IQIE QAK L  
Sbjct  242   VCSADTGSGKTAAFLLPVIIRALEKNIT-------PSALILTPTRELAIQIERQAKELMC  294

Query  1392  GMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVD  1216
             G+P  +T L+VGG  +  QLYR++  V +I+ TPGRL++++ +  +EL+ + + +IDE D
Sbjct  295   GLPNMRTVLLVGGLPLPPQLYRLKQSVKVIIATPGRLLEIMKQSSVELNGIKIVIIDEAD  354

Query  1215  CMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGA  1039
              ML+ GF +QV+ I        Q ++ SATI   +E++A+ +      I +G+ N P   
Sbjct  355   TMLKMGFQQQVLDILENTPHDRQTVLVSATIPASIERLANQLLHDPVRIIIGEKNLPCSN  414

Query  1038  VKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIH  859
             V+Q+ +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL+++S+H
Sbjct  415   VRQIILWVEEPSKKKKLFEILNDEKLFKPPVLVFVDCKLGADLLSDAVHKITGLQSISMH  474

Query  858   GEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRA  679
              +KS  +R  IL+    G+  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA
Sbjct  475   SDKSQVERTRILQGLFQGEYEVVVSTGVLGRGLDLINVKLVVNFDMPSSMDEYVHQVGRA  534

Query  678   SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              R+G  GT+I FIN   KKLF ++V+ +K +G+ +P +L NS Y         H+++RK
Sbjct  535   GRLGHSGTAITFINNNTKKLFLDIVKRVKPTGSILPPQLLNSPY--------LHEQKRK  585



>ref|XP_010164427.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Caprimulgus carolinensis]
Length=627

 Score =   435 bits (1118),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 238/548 (43%), Positives = 343/548 (63%), Gaps = 29/548 (5%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDE  1933
             ++G     +T++    +S    GS S+  +K  S  QR A P EP CV+CGRYGEYICD+
Sbjct  67    AAGDLGVADTTLGKNNQSPD-EGSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDK  125

Query  1932  TDDDICSLECKT-ILLSRIEKSRKP-----TPCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             TD+D+CSLECK   LL   EK RK      T           +  Y+ +D    S    L
Sbjct  126   TDEDVCSLECKAKHLLQAQEKERKLKSDQLTKAGSGAESRLLNTPYFYKD---HSFILGL  182

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               +Q E LR +L I V+G  V  PI+ F  C  P  L +NL+ +GYE+PTP+QMQ IP  
Sbjct  183   RDEQIENLRLQLGIAVQGQQVPRPIVEFEHCGFPETLNNNLKNSGYEVPTPIQMQMIPVG  242

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQ  1411
             L+GR ++ SA+TGSGKT +FL+P++   +K         + P A+ILAPTREL IQIE Q
Sbjct  243   LLGRDIVASADTGSGKTAAFLLPVIMKVLK-------ETEAPSALILAPTRELAIQIERQ  295

Query  1410  AKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
             AK L  G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + 
Sbjct  296   AKELMAGLPNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIV  355

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQL  1057
             V+DEVD ML+ GF +QV+ I   +S   Q ++ SATI   +E +A+ + ++   I++G+ 
Sbjct  356   VVDEVDTMLKMGFQQQVLDILEDISHDHQTILVSATIPVGIEHLANQLLRNFVRITIGEK  415

Query  1056  NKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGL  877
             N P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL
Sbjct  416   NLPCSSVRQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGL  475

Query  876   KAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYV  697
             +  ++H EKS  +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYV
Sbjct  476   QCTAMHSEKSQVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYV  535

Query  696   HQIGRA---SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSV  526
             HQ+ +     R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y       
Sbjct  536   HQVNKXIAKRRLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL------  589

Query  525   GRHQKRRK  502
                QKRR+
Sbjct  590   -HDQKRRE  596



>ref|XP_008405024.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Poecilia 
reticulata]
Length=623

 Score =   434 bits (1117),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 231/532 (43%), Positives = 329/532 (62%), Gaps = 30/532 (6%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSE---VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
              A  ES   S SD   E   VK     QR   P EP CV+CGRYGEYICD TD+D+CSLE
Sbjct  62    TAKXESAAQSSSDDAEEEEPVKSFKKSQRWPEPGEPVCVMCGRYGEYICDATDNDVCSLE  121

Query  1905  CKTILLSRI---------------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             CK   L ++                      P  P +    ++  Y  R+D   S    L
Sbjct  122   CKANHLLQMGIRTGXDAFNFKDKNTDGMTSQPHHPAINLGTSEAGYSYREDPFIS---GL  178

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               +Q E +R +L I  +G  V  PI+ F  C  P  L  NL+ AGYE PTPVQMQ +P  
Sbjct  179   TDEQVERIRLELGIKTEGKDVRRPIVEFEHCGFPSLLSGNLKKAGYEAPTPVQMQMVPVG  238

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVK--LNLACSERKQKPLAMILAPTRELCIQIE  1417
             L GR ++ SA+TGSGKT +FL+P+V   ++   +  CS     PL +IL PTREL IQIE
Sbjct  239   LTGRDVIASADTGSGKTIAFLLPVVVRALEEAAHGVCS-----PLGLILTPTRELAIQIE  293

Query  1416  EQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVS  1240
              QAK L  G+P  +TAL+VGG  +  QL+R++  + +++ TPGRLI++L ++ ++LD V 
Sbjct  294   RQAKELVMGIPNMRTALLVGGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKALKLDKVK  353

Query  1239  MFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVG  1063
             + V+DEVD ML+ GF +QV+++   +++  Q L+ SATI    E +A+ +      I +G
Sbjct  354   ILVVDEVDTMLKMGFQQQVLEVLEHVTEEHQTLLASATIPAGTEDLAARLVHDPVRIVIG  413

Query  1062  QLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITIST  883
             + N+P   V+Q+ +WVE   KK+KLF+IL   + ++PPV+VFV  +LGADLL  A+   T
Sbjct  414   EKNQPCANVRQILLWVEEPSKKKKLFEILNDNKLFQPPVVVFVDCKLGADLLCEAVAKVT  473

Query  882   GLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKE  703
             GL  V+IH +K+ ++R  IL+  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ E
Sbjct  474   GLTTVAIHSDKNQRERNRILKGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDE  533

Query  702   YVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             YVHQ+GRA R+G  GT+I F+N  NK+LF E+V  +K +G+ +P +L NS Y
Sbjct  534   YVHQVGRAGRLGHRGTAITFLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPY  585



>ref|XP_007541498.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Poecilia 
formosa]
Length=623

 Score =   434 bits (1116),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 232/532 (44%), Positives = 330/532 (62%), Gaps = 30/532 (6%)
 Frame = -1

Query  2076  VAATESNQPSGSDSDSE---VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLE  1906
              A  ES   S SD   E   VK     QR   P EP CV+CGRYGEYICD TD+D+CSLE
Sbjct  62    TAKCESAAQSSSDDAEEEEPVKSFKKSQRWPEPGEPVCVMCGRYGEYICDATDNDVCSLE  121

Query  1905  CKTILLSRI---------------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             CK   L ++                  R   P    V    ++  Y  R+D   S    L
Sbjct  122   CKANHLLQMGIKPGHDAFNVKDKNTDGRTSQPHHVAVNLGTSEAGYSYREDPFIS---GL  178

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               +Q E +R +L I  +G  V  PI+ F  C  P  L  NL+ AGYE PTPVQMQ +P  
Sbjct  179   TDEQVERIRLELGIKTEGKDVRRPIVEFEHCGFPSLLSGNLKKAGYEAPTPVQMQMVPVG  238

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVK--LNLACSERKQKPLAMILAPTRELCIQIE  1417
             L GR ++ SA+TGSGKT +FL+P+V   ++   +  CS     PL +IL PTREL IQIE
Sbjct  239   LTGRDVIASADTGSGKTIAFLLPVVVRALEEAAHGVCS-----PLGLILTPTRELAIQIE  293

Query  1416  EQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVS  1240
              QAK L  G+P  +TAL+VGG  +  QL+R++  + +++ TPGRLI++L ++ ++LD V 
Sbjct  294   RQAKELVMGIPNMRTALLVGGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKALKLDKVK  353

Query  1239  MFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVG  1063
             + V+DEVD ML+ GF +QV+++   +++  Q L+ SATI    E +A+ +      I++G
Sbjct  354   ILVVDEVDTMLKMGFQQQVLEVLEHVTEEHQTLLASATIPAGTEDLAARLVHDPVRIAIG  413

Query  1062  QLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITIST  883
             + N+P   V+Q+ +WVE   KK+KLF+IL   + ++PPV+VFV  +LGADLL  A+   T
Sbjct  414   EKNQPCANVRQILLWVEEPSKKKKLFEILNDNKLFQPPVVVFVDCKLGADLLCEAVAKVT  473

Query  882   GLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKE  703
             GL  V+IH +K+ ++R  IL+  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ E
Sbjct  474   GLTTVAIHSDKNQRERNRILKGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDE  533

Query  702   YVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             YVHQ+GRA R+G  GT+I F+N  NK+LF E+V  +K +G+ +P +L NS Y
Sbjct  534   YVHQVGRAGRLGHRGTAITFLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPY  585



>ref|XP_007055261.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chelonia 
mydas]
 gb|EMP40087.1| Putative ATP-dependent RNA helicase DDX59 [Chelonia mydas]
Length=625

 Score =   434 bits (1116),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 235/543 (43%), Positives = 337/543 (62%), Gaps = 30/543 (6%)
 Frame = -1

Query  2100  FKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDD  1921
             F   + S+ +  ++     S  D  +K  S  QR A P EP CV+CGRYGEYICD+TD+D
Sbjct  71    FPFADESLGSDNQNVDEDSSSVDEPIKSFSKSQRWAEPGEPICVVCGRYGEYICDKTDED  130

Query  1920  ICSLECKT-ILLSRIEK-------SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLAS  1765
             +CSLECK   LL   EK       S       P    P T   Y      + S    L  
Sbjct  131   VCSLECKAKHLLQAKEKEEGLNSDSLVKVESKPETLLPVTVYTY-----KEHSFILSLQD  185

Query  1764  DQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALM  1585
             DQ + L+ +L IVV+G+ V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+
Sbjct  186   DQIKNLKLQLGIVVQGEGVTRPIIEFEHCGFPETLNYNLKNSGYEVPTPIQMQMIPVGLL  245

Query  1584  GRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAK  1405
             GR ++ SA+TGSGKT +FL+P++   +       E  + P A+IL PTREL IQIE QAK
Sbjct  246   GRDIVASADTGSGKTAAFLLPVIIKAL-------EETKTPSALILTPTRELAIQIERQAK  298

Query  1404  VLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVI  1228
              L  G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+
Sbjct  299   ELMIGLPNMRTVLLVGGLPLPPQLHRLKQTVKVIIATPGRLLDILKQSSVQLHGIKIVVV  358

Query  1227  DEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNK  1051
             DE D ML+ GF +QV+ I    S   Q ++ SATI   +E++A+ + ++   I++G+ N 
Sbjct  359   DEADTMLKMGFQQQVLDILENTSSDRQTILVSATIPVGIEQLANQLLQNPVRITIGEKNL  418

Query  1050  PNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKA  871
             P   V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+ 
Sbjct  419   PCSNVRQIILWVEEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQC  478

Query  870   VSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQ  691
             +S+H +KS  +R  IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ
Sbjct  479   ISMHSDKSQTERTNILQGLFQEKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQ  538

Query  690   IGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQK  511
             +GRA R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y         H +
Sbjct  539   VGRAGRLGHSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQ  590

Query  510   RRK  502
             +RK
Sbjct  591   KRK  593



>gb|ESA07180.1| hypothetical protein GLOINDRAFT_52624, partial [Rhizophagus irregularis 
DAOM 181602]
Length=529

 Score =   431 bits (1107),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 236/524 (45%), Positives = 331/524 (63%), Gaps = 37/524 (7%)
 Frame = -1

Query  2055  QPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIE  1876
             Q SGS  +  VK+ +++QR A   EP CVICG+YGEYICD+T+ D+CSLECK I + R++
Sbjct  3     QDSGSQEEEPVKEYNYQQRVASSGEPICVICGKYGEYICDQTEHDVCSLECKKIDIGRVK  62

Query  1875  KSRKPTPCPPPVRFPATDDCYYVRDDDKKSES--KCLASDQAELLRRKLNIVVKGDLVSP  1702
             ++        P+      D ++V       ++    LA  Q + +  +  I V+G  +  
Sbjct  63    RTYSKITVQTPI-----SDSFHVNLTGYIPDAIIGSLADIQVQSILTRNRISVQGKNIPR  117

Query  1701  PIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIP  1522
             PI+SF  C +P K+++NL+  GY  PT +QMQAIP AL+GR +L S +TGSGKT SFLIP
Sbjct  118   PILSFTQCKLPTKMMENLQTEGYTQPTSIQMQAIPTALVGRDILASGQTGSGKTASFLIP  177

Query  1521  IVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGM-PFKTALVVGGDAMA  1345
             I+++   L+  C E K  P A+ILAPTRELC QIE  AK L KG+   KTAL+VGG  M 
Sbjct  178   IISHCHSLS-QCYEGKNGPYAIILAPTRELCSQIENLAKSLIKGLLNMKTALLVGGLPMP  236

Query  1344  RQLYRVEHGVSLIVGTPGRLIDLLTK--REIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
              Q++R++ G+ +   TPGRLID+L +  +E+ ++++ MFV+DEVD M + GF  QV +I 
Sbjct  237   NQVHRLKQGIQIAFATPGRLIDILNQHNKELSMNNIHMFVLDEVDMMFKMGFENQVKEII  296

Query  1170  RALSQP------QILMYSATISREVEKMASSMAKHLTVISVG-QLNK------------P  1048
               L  P      Q LM+SATI   +EK+A S+ K    I VG Q  K            P
Sbjct  297   NKLPLPATSLQRQTLMFSATIPENIEKLAKSLLKDYIRIIVGVQQYKNENLDSSLSNFIP  356

Query  1047  NGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAV  868
             N  VKQ  +WVE+K KK++LF +L   ++YKPP+++FV S+LGADLLS AI      ++V
Sbjct  357   NIPVKQTILWVENKSKKKQLFSLLNDPKYYKPPIVIFVESKLGADLLSQAIEKKCNARSV  416

Query  867   SIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQI  688
             SIHG+KS ++R  IL+SFL G+  +IV+TGVL RG++  +V+ VI FDM  S+ EY+HQ+
Sbjct  417   SIHGDKSQEERMMILQSFLNGEYEIIVSTGVLSRGLNFPNVEMVINFDMATSVDEYIHQV  476

Query  687   GRAS-----RMGE--EGTSIVFINEENKKLFPELVEILKSSGAA  577
             GRA+     R  E   G SI FINE++K LF + V +LK+  A 
Sbjct  477   GRAAGNDSLRNSELSSGWSITFINEDHKHLFKKFVSMLKAQPAG  520



>ref|XP_010017051.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Nestor 
notabilis]
 gb|KFQ43178.1| putative ATP-dependent RNA helicase DDX59 [Nestor notabilis]
Length=624

 Score =   434 bits (1116),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 231/514 (45%), Positives = 324/514 (63%), Gaps = 22/514 (4%)
 Frame = -1

Query  2058  NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-ILLSR  1882
             N   GS  +  +K  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   LL  
Sbjct  84    NTDEGSSLEEPIKSFSKSQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQT  143

Query  1881  IEKSRK-------PTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
              EK  K                 P T   Y  +D    S    L  +Q E L+ +L I V
Sbjct  144   QEKENKLKSDQLAKGESQTEAHLPNTP--YSYKD---HSFILGLQDEQIENLKLQLGIAV  198

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGK
Sbjct  199   QGQQVPRPILEFQHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGK  258

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T L+
Sbjct  259   TAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLL  311

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD M + GF +Q
Sbjct  312   VGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMFKMGFQQQ  371

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE 
Sbjct  372   VLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEE  431

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +
Sbjct  432   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTD  491

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I
Sbjct  492   ILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAI  551

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  552   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_005242076.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Falco peregrinus]
Length=624

 Score =   434 bits (1115),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 230/516 (45%), Positives = 329/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             E ++ +  D  SE  +K  S  QR A P EP CV+C RYGEYICD+TD D+CSLECK   
Sbjct  80    EGSRNTDEDCSSEEPIKSFSKSQRWAEPGEPVCVVCCRYGEYICDKTDKDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQTQAKEKNLKSDQFTRAESQAETHLLNTPYFYKD---HSFILGLQDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +IV TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIVATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   ++Q+ +WV
Sbjct  370   QQVLDILEDMSHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNIRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_004562058.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X1 [Maylandia zebra]
 ref|XP_004562059.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X2 [Maylandia zebra]
Length=632

 Score =   434 bits (1115),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 224/513 (44%), Positives = 330/513 (64%), Gaps = 26/513 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL--------------  1888
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L              
Sbjct  88    VKSFKKNQRWPGPGEPVCVMCGRYGEYICDATDNDVCSLECKASHLVQMGMGTGADAFMQ  147

Query  1887  ---SRIEKS-RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVK  1720
                +R E++ +   P   P R   ++  Y  R+D   S    L  +Q + ++++L I  +
Sbjct  148   KDQNRHERTVQSQQPAADPGRVVESEPGYSYREDRFIS---GLTEEQVQRIKQELGIETQ  204

Query  1719  GDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKT  1540
             G  V+ P++ F  C  P  L  NL+ AGY+ PTPVQ+Q +P  L GR ++ SA+TGSGKT
Sbjct  205   GRDVARPVVEFEHCSFPPTLSGNLKKAGYDTPTPVQIQMVPVGLTGRDVIASADTGSGKT  264

Query  1539  GSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVV  1363
              +FL+P+V   ++     +     P+A+IL PTREL IQIE QAK L  G+P  +TAL+V
Sbjct  265   VAFLLPVVVRALE---KSAHSVGSPVALILTPTRELAIQIERQAKELVMGLPNMRTALLV  321

Query  1362  GGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQV  1183
             GG  +  QL+R++  + +++ TPGRLI++L ++E++LD V + V+DEVD ML+ GF +QV
Sbjct  322   GGMPLPPQLHRLKSSIKIVIATPGRLIEILKQKELKLDKVKIVVVDEVDTMLKMGFQQQV  381

Query  1182  MQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESK  1006
             +++   +  + Q L+ SATI    E++A+ + +    I++G+ N+P   V+Q+ +WVE  
Sbjct  382   LEVLEQVPEEHQTLLASATIPTGTEELAARLVRDPVRITIGEKNQPCANVRQILLWVEEP  441

Query  1005  QKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREI  826
              KK+KLF+IL   + Y+PPV+VFV S+LGADLL  A+   TGL AV+IH +KS  +R  I
Sbjct  442   SKKKKLFEILNDGKLYQPPVVVFVESKLGADLLCEAVAKVTGLTAVAIHSDKSQWERNRI  501

Query  825   LRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIV  646
             LR  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I 
Sbjct  502   LRGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAIT  561

Query  645   FINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              +N  NK+LF E+V  +K +G+ +P +L NS +
Sbjct  562   LLNNNNKRLFLEVVSRVKPTGSILPPQLLNSPH  594



>ref|XP_005730370.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X3 [Pundamilia nyererei]
Length=618

 Score =   433 bits (1113),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 223/505 (44%), Positives = 326/505 (65%), Gaps = 26/505 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----------E  1876
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L ++          +
Sbjct  90    VKSFKKNQRWPGPGEPVCVMCGRYGEYICDATDNDVCSLECKASHLVQMGMGTGADAFMQ  149

Query  1875  KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPI  1696
             K +         R   T   Y  R+D   S    L  +Q + ++++L I  +G  V+ P+
Sbjct  150   KDQN--------RHERTVQSYSYREDRFIS---GLTEEQVQRIKQELGIETQGRDVARPV  198

Query  1695  MSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIV  1516
             + F  C  P  L  NL+ AGY+ PTPVQMQ +P  L GR ++ SA+TGSGKT +FL+P+V
Sbjct  199   VEFEHCSFPPTLSGNLKKAGYDTPTPVQMQMVPVGLTGRDVIASADTGSGKTVAFLLPVV  258

Query  1515  ANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQ  1339
                ++     +     P+A+IL PTREL IQIE QAK L  G+P  +TAL+VGG  +  Q
Sbjct  259   VRALE---KSAHSVGSPVALILTPTRELAIQIERQAKELVMGLPNMRTALLVGGMPLPPQ  315

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-  1162
             L+R++  + +++ TPGRLI++L ++E++LD V + V+DEVD ML+ GF +QV+++   + 
Sbjct  316   LHRLKSSIKIVIATPGRLIEILKQKELKLDKVKIVVVDEVDTMLKMGFQQQVLEVLEQVP  375

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
              + Q L+ SATI    E++A+ + +    I++G+ N+P   V+Q+ +WVE   KK+KLF+
Sbjct  376   EEHQTLLASATIPTGTEELAARLVRDPVRITIGEKNQPCANVRQILLWVEEPSKKKKLFE  435

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL   + Y+PPV+VFV S+LGADLL  A+   TGL AV+IH +KS  +R  ILR  L GD
Sbjct  436   ILNDGKLYQPPVVVFVESKLGADLLCEAVAKVTGLTAVAIHSDKSQWERNRILRGLLDGD  495

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
               V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I  +N  NK+
Sbjct  496   FEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAITLLNNNNKR  555

Query  621   LFPELVEILKSSGAAIPSELANSKY  547
             LF E+V  +K +G+ +P +L NS +
Sbjct  556   LFLEVVSRVKPTGSILPPQLLNSPH  580



>ref|XP_005304422.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chrysemys 
picta bellii]
 ref|XP_008162519.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chrysemys 
picta bellii]
 ref|XP_008162520.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Chrysemys 
picta bellii]
Length=626

 Score =   433 bits (1113),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 332/530 (63%), Gaps = 31/530 (6%)
 Frame = -1

Query  2058  NQPSGSDSDS--EVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-ILL  1888
             NQ    DS S   +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   LL
Sbjct  85    NQNVDEDSSSVEPIKSFSKSQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLL  144

Query  1887  SRIEK------SRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIV  1726
                EK      S       P    P T   Y      + S    L  DQ + L+ +L IV
Sbjct  145   QAQEKEGLNSDSFVKVESKPETLLPVTLYTY-----KEHSFILSLQDDQIKNLKLQLGIV  199

Query  1725  VKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSG  1546
             V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSG
Sbjct  200   VQGKGVTRPIIEFEHCGFPETLNYNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSG  259

Query  1545  KTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTAL  1369
             KT +FL+P++   +       E  + P A+IL PTREL IQIE QAK L  G+P  +T L
Sbjct  260   KTAAFLLPVIIKAL-------EETKTPSALILTPTRELAIQIERQAKELMIGLPNMRTVL  312

Query  1368  VVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHE  1189
             +VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DE D ML+ GF +
Sbjct  313   LVGGLPLPPQLHRLKQTVKVIIATPGRLLDILKQSSVQLHDIKIVVVDEADTMLKMGFQQ  372

Query  1188  QVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVE  1012
             QV+ I    S   Q ++ SATI   +E++A+ + ++   I++G+ N P   V+Q+ +WVE
Sbjct  373   QVLDILENTSSDRQTILVSATIPVGIEQLANQLLQNPVRITIGEKNLPCSNVRQIILWVE  432

Query  1011  SKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRR  832
                KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+ +S+H +KS  +R 
Sbjct  433   EPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCISMHSDKSQSERT  492

Query  831   EILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTS  652
              IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+
Sbjct  493   NILQGLFQEKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTA  552

Query  651   IVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             I FIN  +KKLF ++V+ +K +G  +P +L NS Y         H ++RK
Sbjct  553   ITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQKRK  594



>gb|KFO93757.1| putative ATP-dependent RNA helicase DDX59 [Buceros rhinoceros 
silvestris]
Length=624

 Score =   432 bits (1112),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 225/512 (44%), Positives = 327/512 (64%), Gaps = 18/512 (4%)
 Frame = -1

Query  2058  NQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI  1879
             N    + S+  +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L +I
Sbjct  84    NSDEETSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQI  143

Query  1878  E------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKG  1717
             +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I V+G
Sbjct  144   QAKEKKLKSDQLTKAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGIAVQG  200

Query  1716  DLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTG  1537
               V  PI+ F  C  P  L  NL+ +GY++PTP+QMQ IP  L+GR ++ SA+TGSGKT 
Sbjct  201   QQVPRPIVEFEHCGFPETLNRNLKNSGYDVPTPIQMQMIPVGLLGRDIVASADTGSGKTA  260

Query  1536  SFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVG  1360
             +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+P  +T L+VG
Sbjct  261   AFLLPVIVKVLT-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLLVG  313

Query  1359  GDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVM  1180
             G  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +QV+
Sbjct  314   GLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQQQVL  373

Query  1179  QIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQ  1003
              I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE   
Sbjct  374   DILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEEPS  433

Query  1002  KKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREIL  823
             KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R +IL
Sbjct  434   KKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVERTDIL  493

Query  822   RSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVF  643
             +  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ ++ R+G  GT+I F
Sbjct  494   QGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNKSGRLGHSGTAITF  553

Query  642   INEENKKLFPELVEILKSSGAAIPSELANSKY  547
             IN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  554   INNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_004943159.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X7 [Gallus gallus]
Length=749

 Score =   437 bits (1123),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 227/514 (44%), Positives = 329/514 (64%), Gaps = 18/514 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLS  1885
             + N    S S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L 
Sbjct  207   KGNTAEDSSSEEPVKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLL  266

Query  1884  RIEKSRKPTPCPPPVRFPATDD------CYYVRDDDKKSESKCLASDQAELLRRKLNIVV  1723
             ++++  +        +  + ++       Y+ +D    S    L  +Q E L+ +L I +
Sbjct  267   QMQEKEEKLKSAHLAKGESQEESHLLNTAYFYKD---HSFILSLQDEQVENLKLQLGIAI  323

Query  1722  KGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGK  1543
             +G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGSGK
Sbjct  324   QGQQVPRPIIEFEHCGFPETLNSNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGSGK  383

Query  1542  TGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALV  1366
             T +FL+P++   +          + P A+ILAPTREL IQIE QAK L  G+P  +T L+
Sbjct  384   TAAFLLPVIMKVLN-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTVLL  436

Query  1365  VGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQ  1186
             VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF +Q
Sbjct  437   VGGLPLPPQLHRLKQSVKVIIATPGRLLEILRQSSVQLHGIKIVVVDEVDTMLKMGFQQQ  496

Query  1185  VMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVES  1009
             V+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WVE 
Sbjct  497   VLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWVEE  556

Query  1008  KQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRRE  829
               KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  S+H EKS  +R  
Sbjct  557   PSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTSMHSEKSQVERTA  616

Query  828   ILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSI  649
             IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  GT+I
Sbjct  617   ILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHSGTAI  676

Query  648   VFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
              FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  677   TFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  710



>ref|XP_001377534.2| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Monodelphis domestica]
 ref|XP_007481098.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Monodelphis domestica]
 ref|XP_007481099.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X3 [Monodelphis domestica]
Length=622

 Score =   432 bits (1110),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 236/545 (43%), Positives = 338/545 (62%), Gaps = 29/545 (5%)
 Frame = -1

Query  2112  SSGSFKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDE  1933
             S G F ++    +  TE         +  VK  +  QR A P EP CV+CGRYGEYICD+
Sbjct  67    SDGHFASV---CLGGTEQCAEDSCVEEEPVKSFAKTQRWAEPGEPVCVVCGRYGEYICDK  123

Query  1932  TDDDICSLECKTILLSRI----EKSRKPTPCPPPVRF--PATDDCYYVRDDDKKSESKCL  1771
             TD D+CSLECK   L ++    EK +  +   P      P  D  Y  ++    S    L
Sbjct  124   TDADVCSLECKAKHLLQVTDNEEKGKLDSLQKPNCELESPLLDAFYTYQE---HSFILNL  180

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               DQ E L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  
Sbjct  181   QDDQIENLKLQLGISVQGQKVPRPIIDFEHCGFPDILNCNLKKSGYEVPTPIQMQMIPIG  240

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQ  1411
             L+GR ++ SA+TGSGKT +FL+P++   +       E+ + P A+ILAPTREL IQIE Q
Sbjct  241   LLGRDIVCSADTGSGKTAAFLLPVIIRAL-------EKNRTPSALILAPTRELAIQIERQ  293

Query  1410  AKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
             AK L  G+P  +T L+VGG  +  QLYR++  V +I+ TPGRL++++ +  +EL  + + 
Sbjct  294   AKELMCGLPNMRTVLLVGGLPLPPQLYRLKQNVKVIIATPGRLLEIMKQSSVELSGIKIV  353

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALS-QPQILMYSATISREVEKMASSMAKHLTVISVGQL  1057
             VIDE D ML+ GF +QV+ I   +    Q L+ SATI   +E++AS +      I++G+ 
Sbjct  354   VIDEADTMLKLGFQQQVLDILENIPPDHQTLLVSATIPASIERLASQLLHDPLRITIGEK  413

Query  1056  NKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGL  877
             N P   V+Q+ +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL
Sbjct  414   NLPCPNVRQIILWVEEPSKKKKLFEILNDEKLFKPPVLVFVDCKLGADLLSDAVHKITGL  473

Query  876   KAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYV  697
             +++S+H +KS  +R  IL+    G+  V+V+TGVLGRG+DL++V  V+ FDMP+S+ EYV
Sbjct  474   RSISMHSDKSQMERTSILQGLFQGEYEVVVSTGVLGRGLDLINVTLVVNFDMPSSMDEYV  533

Query  696   HQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRH  517
             HQ+GRA R+G  GT+I FIN   KKLF ++V+ +K +G+ +P +L NS Y         H
Sbjct  534   HQVGRAGRLGHNGTAITFINNNTKKLFWDIVKRVKPTGSILPPQLLNSPY--------LH  585

Query  516   QKRRK  502
              ++RK
Sbjct  586   DQKRK  590



>ref|XP_008925093.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Manacus 
vitellinus]
 gb|KFW83396.1| putative ATP-dependent RNA helicase DDX59 [Manacus vitellinus]
Length=622

 Score =   432 bits (1110),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 234/535 (44%), Positives = 332/535 (62%), Gaps = 32/535 (6%)
 Frame = -1

Query  2070  ATESNQPSGSDSDSE----VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLEC  1903
             AT       +D DS     +K  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLEC
Sbjct  76    ATLGKDSQNTDEDSPLEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDEDVCSLEC  135

Query  1902  KTILLSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRR  1741
             K   L + +       S + T        P     Y+ +D    S    L  +Q E L+ 
Sbjct  136   KAKHLLQTQAKEEQLTSDQLTNSEAEAHLPHAP--YFYKD---HSFILGLRDEQVENLKL  190

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  LMGR ++ SA
Sbjct  191   QLGIAVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLMGRDIVASA  250

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P++   +      S       A+ILAPTREL IQIE QAK L  G+P 
Sbjct  251   DTGSGKTAAFLLPVIMKVLNETETLS-------ALILAPTRELAIQIERQAKELMAGLPN  303

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +T L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+
Sbjct  304   MRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLK  363

Query  1203  RGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV+ I   +SQ  Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+
Sbjct  364   MGFQQQVLDILEDISQDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQI  423

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS
Sbjct  424   ILWVEEPSKKKKLFEILNDEKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKS  483

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+G A R+G
Sbjct  484   QVERTDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGTAGRLG  543

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
               GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y         H +RR+
Sbjct  544   HSGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY--------LHDQRRR  590



>gb|EAW91319.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 59, isoform CRA_b [Homo 
sapiens]
Length=562

 Score =   429 bits (1104),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 229/478 (48%), Positives = 314/478 (66%), Gaps = 15/478 (3%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CV+CGRYGEYICD+TD+D+CSLECK   L ++    EKS
Sbjct  87    SEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +   P        +  +  YV  +     +  L  DQ E L+++L I+V+G  V+ PI+ 
Sbjct  147   KLSNPQKADSEPESPLNASYVYKEHPFILN--LQEDQIENLKQQLGILVQGQEVTRPIID  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C +P  L  NL+ +GYE+PTP+QMQ IP  L+GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIMR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
                   A  E K  P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ------ALFESK-TPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R++  V +I+ TPGRL+D++ +  +EL  V + V+DE D ML+ GF +QV+ I   +   
Sbjct  318   RLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLKMGFQQQVLDILENIPND  377

Query  1152  -QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q ++ SATI   +E++AS +  +   I  G+ N P   V+Q+ +WVE   KK+KLF+IL
Sbjct  378   CQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIILWVEDPAKKKKLFEIL  437

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
               K+ +KPPV+VFV  +LGADLLS A+   TGLK++SIH EKS  +R+ IL+  L GD  
Sbjct  438   NDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKSQIERKNILKGLLEGDYE  497

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
             V+V+TGVLGRG+DL+SV+ V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +KK
Sbjct  498   VVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKK  555



>ref|XP_004562060.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like isoform 
X3 [Maylandia zebra]
Length=616

 Score =   431 bits (1108),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 222/505 (44%), Positives = 326/505 (65%), Gaps = 26/505 (5%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----------E  1876
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L ++          +
Sbjct  88    VKSFKKNQRWPGPGEPVCVMCGRYGEYICDATDNDVCSLECKASHLVQMGMGTGADAFMQ  147

Query  1875  KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPI  1696
             K +         R   T   Y  R+D   S    L  +Q + ++++L I  +G  V+ P+
Sbjct  148   KDQN--------RHERTVQSYSYREDRFIS---GLTEEQVQRIKQELGIETQGRDVARPV  196

Query  1695  MSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIV  1516
             + F  C  P  L  NL+ AGY+ PTPVQ+Q +P  L GR ++ SA+TGSGKT +FL+P+V
Sbjct  197   VEFEHCSFPPTLSGNLKKAGYDTPTPVQIQMVPVGLTGRDVIASADTGSGKTVAFLLPVV  256

Query  1515  ANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQ  1339
                ++     +     P+A+IL PTREL IQIE QAK L  G+P  +TAL+VGG  +  Q
Sbjct  257   VRALE---KSAHSVGSPVALILTPTRELAIQIERQAKELVMGLPNMRTALLVGGMPLPPQ  313

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-  1162
             L+R++  + +++ TPGRLI++L ++E++LD V + V+DEVD ML+ GF +QV+++   + 
Sbjct  314   LHRLKSSIKIVIATPGRLIEILKQKELKLDKVKIVVVDEVDTMLKMGFQQQVLEVLEQVP  373

Query  1161  SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
              + Q L+ SATI    E++A+ + +    I++G+ N+P   V+Q+ +WVE   KK+KLF+
Sbjct  374   EEHQTLLASATIPTGTEELAARLVRDPVRITIGEKNQPCANVRQILLWVEEPSKKKKLFE  433

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL   + Y+PPV+VFV S+LGADLL  A+   TGL AV+IH +KS  +R  ILR  L GD
Sbjct  434   ILNDGKLYQPPVVVFVESKLGADLLCEAVAKVTGLTAVAIHSDKSQWERNRILRGLLDGD  493

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
               V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I  +N  NK+
Sbjct  494   FEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAITLLNNNNKR  553

Query  621   LFPELVEILKSSGAAIPSELANSKY  547
             LF E+V  +K +G+ +P +L NS +
Sbjct  554   LFLEVVSRVKPTGSILPPQLLNSPH  578



>ref|XP_010307694.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Balearica 
regulorum gibbericeps]
Length=624

 Score =   431 bits (1108),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 334/531 (63%), Gaps = 27/531 (5%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ S  DS  E  +K  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNSDEDSSLEEPIKSFSKSQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDC------YYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + ++  K        +     D       Y+ +D    S    L  DQ E L+ +L I
Sbjct  140   LLQSQEKEKKLKSDQLTKEENRADTHLFNTPYFYKD---HSFILGLRDDQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPIGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  V + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGVKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ ++ R+G +GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQLLKSGRVGRDGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  593



>ref|XP_005440161.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Falco cherrug]
Length=624

 Score =   431 bits (1108),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 228/516 (44%), Positives = 328/516 (64%), Gaps = 20/516 (4%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             E ++ +  D  SE  +K  S  QR A P EP CV+C RYGEYICD+TD D+CSLECK   
Sbjct  80    EGSRNTDEDCSSEEPIKSFSKSQRWAEPGEPVCVVCCRYGEYICDKTDKDVCSLECKAKH  139

Query  1890  LSRIE------KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + +      KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQTQAKEKNLKSDQFTRAESQAETHLLNTPYFYKD---HSFILGLQDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIIEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V ++V TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVVVATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQ-PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   ++Q+ +WV
Sbjct  370   QQVLDILEDMSHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNIRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+ RA R+G  GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVNRAGRLGHSGT  549

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y
Sbjct  550   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPY  585



>ref|XP_005997780.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Latimeria 
chalumnae]
Length=629

 Score =   431 bits (1107),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 324/517 (63%), Gaps = 20/517 (4%)
 Frame = -1

Query  2064  ESNQPSG-SDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILL  1888
             E N  +G S  D  VK  S  QR   P EP CV+CGR+GEYICDETD+D+CSLECK   +
Sbjct  86    ECNAEAGDSFEDEPVKSFSKYQRWPGPGEPVCVVCGRFGEYICDETDNDVCSLECKAKHI  145

Query  1887  SRIEKSRKPTP-CP-------PPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLN  1732
              + +     TP CP       P +      D +Y   +D    S  L  +Q   L+++L 
Sbjct  146   LQAKGKLVGTPACPLKTAEQDPLLTETENTDIFYGYKEDHFISS--LTEEQIRNLKQQLG  203

Query  1731  IVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETG  1552
             I V+G     P++ F  C  P  L  NL+ AGYE+PTP+QMQ IP  LMGR +L SA+TG
Sbjct  204   ISVQGTGAIRPVIEFEHCGFPECLHSNLKKAGYEVPTPIQMQMIPVGLMGRDVLASADTG  263

Query  1551  SGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKT  1375
             SGKT +FL+P++   +K        K  P A+IL PTREL IQIE QAK L  G+   +T
Sbjct  264   SGKTAAFLLPVIMRALK-------EKNFPAALILTPTRELAIQIETQAKELMVGLTNMRT  316

Query  1374  ALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGF  1195
             AL+VGG  +  Q++R+   + +++ TPGRL+++L +  +    + + V+DE D ML+ GF
Sbjct  317   ALLVGGMPLPPQIHRLRQNIKVVIATPGRLLEILKQNLLHSQELRVVVVDEADTMLKMGF  376

Query  1194  HEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIW  1018
              +QV++I    ++  Q ++ SATI   +E++A  +      I++G+ N P   V+Q+ +W
Sbjct  377   QQQVLEILEQTTEDCQTILVSATIPAGIEQLAKQLLHEPIRITIGEKNLPCSNVRQIVLW  436

Query  1017  VESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKD  838
             VE   KK+KLF+IL  ++ + PPV+VFV  RLGADLL  A+   TGLK VS H +K  K+
Sbjct  437   VEEPSKKKKLFEILNDRKLFHPPVLVFVDCRLGADLLCDAVQKVTGLKCVSFHSDKQQKE  496

Query  837   RREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEG  658
             R  IL+  L G+  V+V+TGVLGRG+DL++VK V+ FDMP S+ EY+HQIGRA R+G  G
Sbjct  497   RTSILQGLLQGEYEVVVSTGVLGRGLDLVNVKLVVNFDMPPSMDEYIHQIGRAGRLGHRG  556

Query  657   TSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
             T+I FIN  NKKLF ++V+ +K +G+ +P +L NS Y
Sbjct  557   TAITFINNNNKKLFLDVVKRVKPTGSQLPPQLLNSPY  593



>ref|XP_007233278.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Astyanax 
mexicanus]
Length=699

 Score =   433 bits (1113),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 226/509 (44%), Positives = 324/509 (64%), Gaps = 22/509 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-----EKSRKP  1861
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK   L+++     EK    
Sbjct  158   VKSFKKSQRWPEPGEPVCVMCGRYGEYICDSTDNDVCSLECKASHLAKMCKGLGEKVFSK  217

Query  1860  TPCPPPVRFPATDDC---------YYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLV  1708
             T       F  T D          Y+ R+D   +E   L  +Q E ++++L I   G  V
Sbjct  218   TKQEGTGLFSPTTDTEQTGSHELGYFYREDSFIAE---LTEEQVERVKKELAINTNGQQV  274

Query  1707  SPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFL  1528
             S PI+ F  C  P  L  NL+ AGYE PTPVQMQ +P  L GR ++ +A+TGSGKT +FL
Sbjct  275   SRPIIEFEHCHFPEALSTNLKKAGYEAPTPVQMQMLPVGLAGRDVITTADTGSGKTIAFL  334

Query  1527  IPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDA  1351
             +P+V ++++     +++   P ++IL PTREL IQIE QAK L  G+P  +TAL+VGG  
Sbjct  335   LPVVLHSLQTG---ADKSCGPASIILTPTRELAIQIERQAKELIMGLPNMRTALLVGGMP  391

Query  1350  MARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIF  1171
             +  QL+R++  + +++ TPGR+I++L +  + LD V   V+DEVD ML+ GF +QV++I 
Sbjct  392   LPPQLHRLKQHIKIVIATPGRIIEILKQNAVRLDDVKTIVVDEVDTMLKMGFQQQVLEIL  451

Query  1170  RAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQ  994
               +    Q L+ SATI    +++AS + +    IS+GQ N+P   V+Q+ +WVE   KK+
Sbjct  452   EQVPDDHQTLLTSATIPVGTDQLASRLTQDPVRISIGQKNQPCANVRQIVVWVEEPSKKK  511

Query  993   KLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSF  814
             KLF+IL  ++ Y+PPV+VFV  +LGADLL  A+    GL AV+IH +K   +R  IL+  
Sbjct  512   KLFEILNDQKLYQPPVVVFVDCKLGADLLCEAVQKVMGLNAVAIHSDKKQWERNRILKGL  571

Query  813   LVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINE  634
             L G   V+V+TGVLGRG+DL++VK V+ FDMP ++ EYVHQIGRA R+G  GT+I F+N 
Sbjct  572   LEGQFEVVVSTGVLGRGLDLVNVKLVVNFDMPANMDEYVHQIGRAGRLGHRGTAITFMNN  631

Query  633   ENKKLFPELVEILKSSGAAIPSELANSKY  547
              NK+LF ++V  +K +G+ +P +L NS +
Sbjct  632   NNKRLFLDIVNRVKPTGSQLPPQLLNSPH  660



>ref|XP_006278607.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Alligator 
mississippiensis]
Length=627

 Score =   431 bits (1107),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 231/539 (43%), Positives = 336/539 (62%), Gaps = 22/539 (4%)
 Frame = -1

Query  2100  FKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDD  1921
             F   +TS+    ++    GS+ +  +K  S  QR A P EP C++CGRYGEYICD+TD+D
Sbjct  74    FHLADTSLGGDNQNADGDGSNVEEPIKSFSKSQRWAEPGEPICIVCGRYGEYICDKTDED  133

Query  1920  ICSLECKTILLSRIEKS----RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAE  1753
             +CSLECK   L  +++     +      P  +     D  YV  +     S  L  DQ E
Sbjct  134   VCSLECKAKNLLHVKEKEEWLKSDGVMKPESQKETLLDIPYVYKEHPFILS--LQEDQIE  191

Query  1752  LLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSL  1573
              L+ +L I V+G  V  PI+ F     P  L  NL+ +GYE+PTP+QMQ IP  L GR +
Sbjct  192   NLKLQLGIAVQGQGVPRPIIEFEHSGFPEILNYNLKNSGYEVPTPIQMQMIPVGLSGRDI  251

Query  1572  LVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGK  1393
             + SA+TGSGKT +FL+P++   +       E  + P A+IL PTREL IQIE+Q K L  
Sbjct  252   VASADTGSGKTAAFLLPVIIKAL-------EEIKTPSALILTPTRELAIQIEKQTKELMT  304

Query  1392  GMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVD  1216
             G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DE D
Sbjct  305   GLPNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLDILKQSCVQLHDIKIVVVDEAD  364

Query  1215  CMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGA  1039
              ML+ GF +QV+ I    S   Q ++ SATI   +E++A+ + +H   I++G+ N P   
Sbjct  365   TMLKMGFQQQVLDILENTSTDRQTILVSATIPVGIEQLANQLLQHPVRITIGEKNLPCAN  424

Query  1038  VKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIH  859
             V+Q+ +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL+++SIH
Sbjct  425   VRQIILWVEEPSKKKKLFEILNDQKLFKPPVLVFVDCKLGADLLSDAVHKITGLQSISIH  484

Query  858   GEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRA  679
              +KS  +R  IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA
Sbjct  485   SDKSQTERTTILQGLFQAKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRA  544

Query  678   SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  545   GRLGHNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  596



>emb|CAG00632.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=539

 Score =   426 bits (1095),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 225/518 (43%), Positives = 327/518 (63%), Gaps = 33/518 (6%)
 Frame = -1

Query  2004  QREALPDEPKCVICGRYGEYICDETDDDICSLECKT-------------ILLSRIEKSRK  1864
             QR   P EP CV+CGRYGEYICD TD+D+CSLECK              +  S+  K  K
Sbjct  11    QRWPEPGEPVCVMCGRYGEYICDSTDNDVCSLECKASHLFHMGMGTGGDVFNSKDNKDDK  70

Query  1863  PT--PCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
              T  P     +    +  Y  R+D   S    L  +Q + ++++L I  +G  V  P++ 
Sbjct  71    RTQQPAAHSRQLGGGEIEYSYREDQFIS---GLTGEQVQRIKQELGIETQGSDVIRPVIE  127

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ AGYE PTPVQMQ +P  L GR ++ SA+TGSGKT +FL+P+V  
Sbjct  128   FEHCGFPATLSSNLKKAGYEAPTPVQMQMVPVGLTGRDVIASADTGSGKTIAFLLPVVTR  187

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +K           P+A+IL PTREL IQIE QAK +  G+P  +TAL+VGG  +  QL+
Sbjct  188   ALKSTAG-------PVALILTPTRELAIQIERQAKEVVMGLPNMRTALLVGGMPLPPQLH  240

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQ  1156
             R++  + +I+ TPGRL+++L ++ ++LD V + VIDEVD ML+ GF +QV+++   +  +
Sbjct  241   RLKQIIKIIIATPGRLLEILKQKAVQLDKVKVVVIDEVDTMLKMGFQQQVLEVLEQVPEE  300

Query  1155  PQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDIL  976
              Q L+ SATI    E++A+ + +    I +G+ N+P   V+Q+ +WVE   KK+KLFDIL
Sbjct  301   RQTLLVSATIPAGTEELAARLVRDPVRIVIGEKNQPCVNVRQILLWVEEPSKKRKLFDIL  360

Query  975   TSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVP  796
                + Y+PPV+VFV  +LGADLL  A+   T LK V+IH +KS ++R  ILR  L G+  
Sbjct  361   NDSKLYQPPVVVFVDCKLGADLLCEAVAKVTDLKTVAIHSDKSQRERNRILRGLLDGEFE  420

Query  795   VIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLF  616
             V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+GRA R+G  GT+I F+N  NK+LF
Sbjct  421   VVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQVGRAGRLGHRGTAITFLNNNNKRLF  480

Query  615   PELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              E+V  +K +G+ +P +L NS +      +   Q+R+K
Sbjct  481   LEVVNRVKPTGSILPPQLLNSPH------LHEQQRRQK  512



>ref|XP_006025567.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Alligator sinensis]
Length=627

 Score =   427 bits (1099),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 335/539 (62%), Gaps = 22/539 (4%)
 Frame = -1

Query  2100  FKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDD  1921
             F   + S+    ++     S+ +  +K  S  QR A P EP C++CGRYGEYICD+TD+D
Sbjct  74    FHLADASLGGDNQNADGDSSNVEEPIKSFSKFQRWAEPGEPICIVCGRYGEYICDKTDED  133

Query  1920  ICSLECKTILLSRIEKS----RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAE  1753
             +CSLECK   L  +++     +      P  +     D  YV  +     S  L  DQ E
Sbjct  134   VCSLECKAKNLLHVKEKEEWLKSDGVMKPESQKETLLDIPYVYKEHPFILS--LQEDQIE  191

Query  1752  LLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSL  1573
              L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L GR +
Sbjct  192   NLKLQLGIAVQGQGVPRPIIEFEHCGFPEILNYNLKNSGYEVPTPIQMQMIPVGLSGRDI  251

Query  1572  LVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGK  1393
             + SA+TGSGKT +FL+P++   +       E  + P A+IL PTREL +QIE+Q K L  
Sbjct  252   VASADTGSGKTAAFLLPVIIKAL-------EEIKTPSALILTPTRELAVQIEKQTKELMT  304

Query  1392  GMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVD  1216
             G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DE D
Sbjct  305   GLPNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLDILKQSCVQLHDIKIVVVDEAD  364

Query  1215  CMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGA  1039
              ML+ GF +QV+ I    S   Q ++ SATI   +E++A+ + +H   I++G+ N P   
Sbjct  365   TMLKMGFQQQVLDILENTSTDRQTILVSATIPVGIEQLANQLLQHPVRITIGEKNLPCAN  424

Query  1038  VKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIH  859
             V+Q+ +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL+++SIH
Sbjct  425   VRQIILWVEEPSKKKKLFEILNDQKLFKPPVLVFVDCKLGADLLSDAVHKITGLQSISIH  484

Query  858   GEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRA  679
              +KS  +R  IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA
Sbjct  485   SDKSQTERTTILQGLFQAKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRA  544

Query  678   SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  545   GRLGHNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  596



>ref|XP_006025566.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Alligator sinensis]
Length=633

 Score =   428 bits (1100),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 335/539 (62%), Gaps = 22/539 (4%)
 Frame = -1

Query  2100  FKAMETSIVAATESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDD  1921
             F   + S+    ++     S+ +  +K  S  QR A P EP C++CGRYGEYICD+TD+D
Sbjct  80    FHLADASLGGDNQNADGDSSNVEEPIKSFSKFQRWAEPGEPICIVCGRYGEYICDKTDED  139

Query  1920  ICSLECKTILLSRIEKS----RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAE  1753
             +CSLECK   L  +++     +      P  +     D  YV  +     S  L  DQ E
Sbjct  140   VCSLECKAKNLLHVKEKEEWLKSDGVMKPESQKETLLDIPYVYKEHPFILS--LQEDQIE  197

Query  1752  LLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSL  1573
              L+ +L I V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L GR +
Sbjct  198   NLKLQLGIAVQGQGVPRPIIEFEHCGFPEILNYNLKNSGYEVPTPIQMQMIPVGLSGRDI  257

Query  1572  LVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGK  1393
             + SA+TGSGKT +FL+P++   +       E  + P A+IL PTREL +QIE+Q K L  
Sbjct  258   VASADTGSGKTAAFLLPVIIKAL-------EEIKTPSALILTPTRELAVQIEKQTKELMT  310

Query  1392  GMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVD  1216
             G+P  +T L+VGG  +  QL+R++  V +I+ TPGRL+D+L +  ++L  + + V+DE D
Sbjct  311   GLPNMRTVLLVGGLPLPPQLHRLKQSVKVIIATPGRLLDILKQSCVQLHDIKIVVVDEAD  370

Query  1215  CMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGA  1039
              ML+ GF +QV+ I    S   Q ++ SATI   +E++A+ + +H   I++G+ N P   
Sbjct  371   TMLKMGFQQQVLDILENTSTDRQTILVSATIPVGIEQLANQLLQHPVRITIGEKNLPCAN  430

Query  1038  VKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIH  859
             V+Q+ +WVE   KK+KLF+IL  ++ +KPPV+VFV  +LGADLLS A+   TGL+++SIH
Sbjct  431   VRQIILWVEEPSKKKKLFEILNDQKLFKPPVLVFVDCKLGADLLSDAVHKITGLQSISIH  490

Query  858   GEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRA  679
              +KS  +R  IL+        V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA
Sbjct  491   SDKSQTERTTILQGLFQAKYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRA  550

Query  678   SRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
              R+G  GT+I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  551   GRLGHNGTAITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  602



>ref|NP_001038443.2| probable ATP-dependent RNA helicase DDX59 [Danio rerio]
 gb|AAI34851.1| LOC562123 protein [Danio rerio]
Length=584

 Score =   426 bits (1095),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 222/502 (44%), Positives = 322/502 (64%), Gaps = 20/502 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-----EK--SR  1867
             VK     QR   P EP CV+CGRYGEYICD+TD+DICSLECK   L+ +     +K  + 
Sbjct  61    VKSFKKSQRWPEPGEPVCVMCGRYGEYICDKTDNDICSLECKAAHLAAVCADFGDKLFNN  120

Query  1866  KPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSF  1687
             K TP             Y  ++D   SE   L  +Q E ++ +L IV  G  V  P++ F
Sbjct  121   KNTP-----ESSENTKNYCYKEDTFISE---LTEEQIERVKAELGIVSVGTEVCRPVIEF  172

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
               C  P  L  NL+ AGYE PTPVQMQ +P  L GR ++ +A+TGSGKT +FL+P+V   
Sbjct  173   QHCRFPTVLEKNLKVAGYEAPTPVQMQMVPVGLTGRDVIATADTGSGKTVAFLLPVVMRA  232

Query  1506  VKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYR  1330
             ++   + S     P  +IL PTREL IQIEEQAK L +G+P  +TAL+VGG  +  QL+R
Sbjct  233   LQ---SESASPSCPACLILTPTRELAIQIEEQAKELMRGLPNMRTALLVGGMPLPPQLHR  289

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQ-P  1153
             ++H + +++GTPGRL+++L ++ I+LD V   V+DE D ML+ GF +QV+ I   + +  
Sbjct  290   LKHNIKIVIGTPGRLLEILKQKAIQLDHVRTVVVDEADTMLKMGFQQQVLDILEQVPEDH  349

Query  1152  QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILT  973
             Q L+ SATI    +++A  +      I++GQ N+P   V+Q+ +WVE   KK+KLF+IL 
Sbjct  350   QTLLTSATIPTGTQQLAERLTHDPVTITIGQKNQPCANVRQIVLWVEEPSKKKKLFEILN  409

Query  972   SKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPV  793
              ++ Y+PPV+VFV  +LGADLL  A+     L  V+IH +K   +R +I++  L G   V
Sbjct  410   DEKLYQPPVVVFVDCKLGADLLCEAVQKVMSLNTVAIHSDKMQWERNKIVKGLLEGQFDV  469

Query  792   IVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFP  613
             +++TG+LGRG+DL++VK VI FDMP+++ EYVHQIGRA R+G  GT+I F+N  NK+LF 
Sbjct  470   VISTGILGRGLDLVNVKLVINFDMPSNMDEYVHQIGRAGRLGHRGTAITFMNNNNKRLFL  529

Query  612   ELVEILKSSGAAIPSELANSKY  547
             E+V+ +K +G+ +P ++ NS +
Sbjct  530   EMVKRVKPTGSILPPQILNSPH  551



>ref|XP_004886053.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Heterocephalus 
glaber]
 ref|XP_004862323.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004862324.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Heterocephalus glaber]
 gb|EHB03772.1| Putative ATP-dependent RNA helicase DDX59 [Heterocephalus glaber]
Length=619

 Score =   427 bits (1098),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 245/545 (45%), Positives = 338/545 (62%), Gaps = 30/545 (6%)
 Frame = -1

Query  2109  SGSFKAMETSIVAATESNQPSGSDSDSE-----VKKRSWEQREALPDEPKCVICGRYGEY  1945
             S + +  E  +VA      P  ++ DS      VK  S  QR A P EP CV+C RYGEY
Sbjct  64    SSALQVSEVGLVA------PEWAEKDSPPLEEPVKSFSKTQRWAEPGEPVCVVCARYGEY  117

Query  1944  ICDETDDDICSLECKTILLSRI-EKSRKPT-PCPPPVRFPATDDCYYVRDDDKKSESKCL  1771
             ICD+TD+D+CSLECK   L ++ EK  K     P  VR           D  + +    L
Sbjct  118   ICDQTDEDVCSLECKAKHLLQVKEKEEKLNLSSPQNVRSEPESPLTASYDYREHTFISAL  177

Query  1770  ASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAA  1591
               DQ E L+++L I V+G  V+ PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  
Sbjct  178   QEDQIENLKQQLGISVQGQEVTRPIIDFEHCGFPEALNHNLKKSGYEVPTPIQMQMIPVG  237

Query  1590  LMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQ  1411
             L+GR +L SA+TGSGKT +FL+P++        A SE  + P A+IL PTREL IQIE Q
Sbjct  238   LLGRDILASADTGSGKTAAFLLPVIIR------ALSE-SETPSAVILTPTRELAIQIERQ  290

Query  1410  AKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMF  1234
             AK L  G+P  KT L+VGG  M  QL+R+   V +I+ TPGRL+D++ +  + L  V + 
Sbjct  291   AKELMSGLPRMKTVLLVGGLPMPPQLHRLRQHVKVIIATPGRLLDIIKQNAVTLCGVKIV  350

Query  1233  VIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQL  1057
             V+DE D ML+ GF +QV+ I        Q ++ SATI   +E++AS +  +   I  G+ 
Sbjct  351   VVDEADTMLKMGFQQQVLDILENTPNDCQTILASATIPASIEQLASQLLCNPVRIITGEK  410

Query  1056  NKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGL  877
             N P  +V+Q+ +WVE   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL
Sbjct  411   NLPCSSVRQIILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGL  470

Query  876   KAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYV  697
             K+ SIH EKS  +R+ IL+  L GD  V+V+TGVLGRG+DL+SV  V+ FDMP+S+ EYV
Sbjct  471   KSTSIHSEKSQVERKNILKGLLEGDYEVVVSTGVLGRGLDLVSVLLVVNFDMPSSMDEYV  530

Query  696   HQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRH  517
             HQIGR  R+G+ GT+I FIN  +K+LF ++ + +K +G+ +P +L NS Y         H
Sbjct  531   HQIGRVGRLGQNGTAITFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPY--------LH  582

Query  516   QKRRK  502
              ++RK
Sbjct  583   DQKRK  587



>gb|AAI60762.1| LOC100127243 protein [Xenopus laevis]
Length=638

 Score =   427 bits (1098),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/543 (42%), Positives = 331/543 (61%), Gaps = 53/543 (10%)
 Frame = -1

Query  2052  PSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEK  1873
             P+    +  VK  S  QR   P +P CVICGRYGEYICD+TD D+CSLECK + + +   
Sbjct  70    PTEDAEEEAVKSYSKSQRWPFPGDPLCVICGRYGEYICDQTDHDVCSLECKAMDILQASG  129

Query  1872  SRKPTPCPPPVRFP--ATDD----------------------CYYVRDDDKKSESKC---  1774
             +        P+ FP  AT+                       C  + +D  +  +     
Sbjct  130   AAST-----PLVFPYKATNSSPLLYSTAGPLSNSVVTSEISSCQNIEEDSSQLTTHNHAM  184

Query  1773  ------------LASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYE  1630
                         L+ +Q + LR++L+++V+G+ V  PIM F  C  P  L  N++AAGYE
Sbjct  185   PYTYREHEFISQLSPEQIDHLRQQLSLLVQGNEVCKPIMEFDHCQFPPVLGSNIKAAGYE  244

Query  1629  MPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMIL  1450
             +PTP+QMQ IP  LM R +L SA+TGSGKT +FL+P +       + C E+K  P A+IL
Sbjct  245   VPTPIQMQMIPVGLMERDILASADTGSGKTAAFLLPAI-------IRCLEKKDSPAALIL  297

Query  1449  APTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLL  1273
              PTREL +QIE QAK L +G+P  +TAL+VGG  +  Q++R++  V +I+ TPGRL++++
Sbjct  298   TPTRELAVQIEGQAKELMRGIPHMRTALLVGGMPLPPQIHRLKQAVQIIIATPGRLLEII  357

Query  1272  TKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSATISREVEKMASS  1096
              +  + L  + + ++DE D ML+ GF +QV+ I    S   Q ++ SATI   +E     
Sbjct  358   NQDCVNLGDLKILIVDEADTMLKMGFQQQVLDILEHASHDHQTILVSATIPAGIEAFTKQ  417

Query  1095  MAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGA  916
             + +    I+VG+ N+P   V+Q+ +WVE   KK+KLF+IL   + ++PPV+VFV  RLGA
Sbjct  418   LLQDPVRITVGEKNQPCSNVRQIVLWVEEPSKKKKLFEILNDSKLFQPPVLVFVDCRLGA  477

Query  915   DLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQV  736
             DLLS AI   TGL+ V++H +KS  +R +IL+  L G+  V+V+TGVLGRG+DL++VK V
Sbjct  478   DLLSDAICKITGLECVAMHSDKSQMERMKILQGLLQGEYDVVVSTGVLGRGLDLVNVKLV  537

Query  735   IVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELAN  556
             + FDMP S+ EYVHQIGRA R+G  GT+I  IN  N+ LF +LV+ ++ +G+ +P +L N
Sbjct  538   VNFDMPPSMDEYVHQIGRAGRLGHRGTAITLINRNNRSLFWDLVKRVQPTGSLLPPQLLN  597

Query  555   SKY  547
             S Y
Sbjct  598   SPY  600



>gb|AAI39522.1| LOC562123 protein [Danio rerio]
Length=584

 Score =   425 bits (1093),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 220/502 (44%), Positives = 322/502 (64%), Gaps = 20/502 (4%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-----EK--SR  1867
             VK     QR   P EP CV+CGRYGEYIC++TD+DICSLECK   L+ +     +K  + 
Sbjct  61    VKSFKKSQRWPEPGEPVCVMCGRYGEYICNKTDNDICSLECKAAHLAAVCADFGDKLFNN  120

Query  1866  KPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMSF  1687
             K TP             Y  ++D   SE   L  +Q E ++ +L IV  G  V  P++ F
Sbjct  121   KNTP-----ESSENTKSYCYKEDTFISE---LTEEQIERVKAELGIVSAGAEVCRPVIEF  172

Query  1686  GSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANT  1507
               C  P  L  NL+ AGYE PTPVQMQ +P  L GR ++ +A+TGSGKT +FL+P+V   
Sbjct  173   QHCRFPTVLEKNLKVAGYEAPTPVQMQMVPVGLTGRDVIATADTGSGKTVAFLLPVVMRA  232

Query  1506  VKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYR  1330
             ++   + S     P  +IL PTREL IQIEEQAK L +G+P  +TAL+VGG  +  QL+R
Sbjct  233   LQ---SESASPSCPACLILTPTRELAIQIEEQAKELMRGLPNMRTALLVGGMPLPPQLHR  289

Query  1329  VEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQ-P  1153
             ++H + +++GTPGRL+++L ++ ++LD V   V+DE D ML+ GF +QV+ I   + +  
Sbjct  290   LKHNIKIVIGTPGRLLEILKQKAVQLDHVRTVVVDEADTMLKMGFQQQVLDILEQVPEDH  349

Query  1152  QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILT  973
             Q L+ SATI    +++A  +      I++GQ N+P   V+Q+ +WVE   KK+KLF+IL 
Sbjct  350   QTLLTSATIPTGTQQLAERLTHDPVTITIGQKNQPCANVRQIVLWVEEPSKKKKLFEILN  409

Query  972   SKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPV  793
              ++ Y+PPV+VFV  +LGADLL  A+     L  V+IH +K   +R +I++  L G   V
Sbjct  410   DEKLYQPPVVVFVDCKLGADLLCEAVQKVMSLNTVAIHSDKMQWERNKIVKGLLEGQFDV  469

Query  792   IVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFP  613
             +++TG+LGRG+DL++VK VI FDMP+++ EYVHQIGRA R+G  GT+I F+N  NK+LF 
Sbjct  470   VISTGILGRGLDLVNVKLVINFDMPSNMDEYVHQIGRAGRLGHRGTAITFMNNNNKRLFL  529

Query  612   ELVEILKSSGAAIPSELANSKY  547
             E+V+ +K +G+ +P ++ NS +
Sbjct  530   EMVKRVKPTGSILPPQILNSPH  551



>gb|KFO06166.1| putative ATP-dependent RNA helicase DDX59 [Balearica regulorum 
gibbericeps]
Length=618

 Score =   426 bits (1094),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 331/531 (62%), Gaps = 33/531 (6%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTIL  1891
             + NQ S  DS  E  +K  S  QR   P EP CV+CGRYGEYICD+TD+D+CSLECK   
Sbjct  80    KDNQNSDEDSSLEEPIKSFSKSQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKH  139

Query  1890  LSRIEKSRKPTPCPPPVRFPATDDC------YYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             L + ++  K        +     D       Y+ +D    S    L  DQ E L+ +L I
Sbjct  140   LLQSQEKEKKLKSDQLTKEENRADTHLFNTPYFYKD---HSFILGLRDDQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPIGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMAGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  V + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGVKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHDHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
              +IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GR      +GT
Sbjct  490   TDILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGR------DGT  543

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  544   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  587



>ref|XP_010588497.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 isoform 
X2 [Loxodonta africana]
Length=594

 Score =   424 bits (1090),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 231/517 (45%), Positives = 320/517 (62%), Gaps = 46/517 (9%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI----EKS  1870
             S+  VK  S  QR A P EP CVICGRYGEYICD+TD+D+CSLECK   L ++    EK 
Sbjct  87    SEEPVKSFSKTQRWAEPGEPVCVICGRYGEYICDQTDEDVCSLECKAKHLLQVKEQEEKG  146

Query  1869  RKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPPIMS  1690
             +  +P        +    +YV  +     S  L  DQ E L+++L IVV+G  V+ PI+ 
Sbjct  147   KLSSPQKADSEAESPLSAFYVYKEHPFILS--LEEDQIEHLKQQLGIVVQGQEVTRPIVE  204

Query  1689  FGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVAN  1510
             F  C  P  L  NL+ +GYE+PTP+QMQ IP  L GR +L SA+TGSGKT +FL+P++  
Sbjct  205   FEHCGFPEALSHNLKKSGYEVPTPIQMQMIPVGLQGRDILASADTGSGKTAAFLLPVIIR  264

Query  1509  TVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLY  1333
              +          + P A+IL PTREL IQIE QAK L  G+P  KT L+VGG  +  QLY
Sbjct  265   ALF-------EDRSPSALILTPTRELAIQIERQAKELMSGLPHMKTVLLVGGLPLPPQLY  317

Query  1332  RVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALSQP  1153
             R+   V +I+ TPGRL+D++ +  +EL SV + V+DE                       
Sbjct  318   RLRQRVKVIIATPGRLLDIIKQSAVELCSVKIVVVDET----------------------  355

Query  1152  QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILT  973
               ++ SATI   +E++AS + ++   IS G+ N P   V+Q+ +W+E   KK+KLF+IL 
Sbjct  356   --ILVSATIPTSMEQLASQLLQNPVRISTGEKNLPCSNVRQIILWIEEPSKKKKLFEILN  413

Query  972   SKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPV  793
              K+ +KPPV+VFV  +LGADLLS A+   TGLK +SIH EKS  +R+ IL+  L GD  V
Sbjct  414   DKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKCISIHSEKSQIERKNILKGLLEGDYEV  473

Query  792   IVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFP  613
             +V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF 
Sbjct  474   VVSTGVLGRGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQRGTAITFINNNSKRLFW  533

Query  612   ELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             ++ + +K +G  +P +L NS Y         H ++RK
Sbjct  534   DITKRVKPTGTILPPQLLNSPY--------LHDQKRK  562



>ref|XP_003974349.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like [Takifugu 
rubripes]
Length=628

 Score =   425 bits (1092),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 231/542 (43%), Positives = 337/542 (62%), Gaps = 32/542 (6%)
 Frame = -1

Query  2067  TESNQPSGSDSDSE---VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT  1897
             T S+  + SDS+ E   VK     QR   P EP CV+CGRYGEYICD TD+D+CSLECK 
Sbjct  70    TTSDVQNSSDSEEEEEPVKSFKKLQRWPEPGEPVCVMCGRYGEYICDSTDNDVCSLECKA  129

Query  1896  ILLSRI---------------EKSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASD  1762
               L ++               E  R   P          +  Y  R+D   S    L  +
Sbjct  130   RHLVQMGLGTGGDVFNTKDNNEDKRTQQPAAHSRLRGGGETDYSYREDQFIS---GLTDE  186

Query  1761  QAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMG  1582
             Q + ++++L I  +G  ++ PI+ F  C  P  L  NL+ AGYE PTP+QMQ +P  L G
Sbjct  187   QVQRIKQELGIETQGSHITRPIVEFEHCGFPATLNSNLKKAGYEAPTPIQMQMVPVGLTG  246

Query  1581  RSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKV  1402
             R ++ SA+TGSGKT +FL+P+V   ++   A S +   P+A+IL PTREL IQIE QAK 
Sbjct  247   RDVIASADTGSGKTIAFLMPVVTRALQ-KPALSAKG--PVALILTPTRELAIQIERQAKE  303

Query  1401  LGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVID  1225
             +  G+P  +TAL+VGG  +  QL+R++  + +I+ TPGRL+++L ++ + LD V + VID
Sbjct  304   VVMGLPNMRTALLVGGMPLPPQLHRLKQIIKIIIATPGRLLEILKQKAVRLDKVKVVVID  363

Query  1224  EVDCMLQRGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKP  1048
             EVD ML+ GF +QV+++   +  + Q L+ SATI    E++A+ +      I +G+ N+P
Sbjct  364   EVDTMLKMGFQQQVLEVLEQVPEERQTLLVSATIPAGTEELAARLVHDPVRIVIGEKNQP  423

Query  1047  NGAVKQLAIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAV  868
                V+Q+ +W+E   KK+KLF+IL   + Y+PPV+VFV  +LGADLL  A+   T LK V
Sbjct  424   CANVRQILLWIEEPSKKRKLFEILNDSKLYQPPVVVFVDCKLGADLLCEAVAKVTDLKTV  483

Query  867   SIHGEKSMKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQI  688
             +IH +KS  +R  ILR  L GD  V+++TGVLGRG+DL++V+ V+ FDMPN++ EYVHQ+
Sbjct  484   AIHSDKSQWERNRILRGLLDGDFEVVISTGVLGRGLDLVNVRLVVNFDMPNTMDEYVHQV  543

Query  687   GRASRMGEEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKR  508
             GRA R+G  GT+I F+N  NK+LF E+V  +K +G+ +P +L NS +      +   Q+R
Sbjct  544   GRAGRLGHRGTAITFLNNNNKRLFLEVVNRVKPTGSILPPQLLNSPH------LHEQQRR  597

Query  507   RK  502
             +K
Sbjct  598   QK  599



>emb|CDQ85337.1| unnamed protein product [Oncorhynchus mykiss]
Length=609

 Score =   424 bits (1090),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/498 (44%), Positives = 322/498 (65%), Gaps = 9/498 (2%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK     QR   P EP CV+C R+GEYICD TD+D+CSLECK   L+++E+  K + C  
Sbjct  76    VKSFRKSQRWPEPGEPVCVMCARFGEYICDSTDNDVCSLECKASHLAKMEE--KTSQCGQ  133

Query  1845  PVRFPATDDCYYVRDDDKKSES---KCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCD  1675
             P    A +    V  D    E      L  +Q + ++++L IV +G  V  PI+ F  C+
Sbjct  134   PAVDRAGNTVEDVYKDYSYKEDAFISGLTEEQVQRVKQELGIVTEGREVGRPIIEFEQCN  193

Query  1674  VPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLN  1495
             +P  L  NL+ AGYE PTPVQMQ +P  L GR ++ SA+TGSGKT +FL+P+V   +K  
Sbjct  194   LPSTLSANLKKAGYEAPTPVQMQMVPVGLAGRDVIASADTGSGKTVAFLLPVVVCALKRL  253

Query  1494  LACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHG  1318
             +        P A+IL PTREL IQIE Q K L  G+P  +T L+VGG  +  QL+R++  
Sbjct  254   VEGG--LGGPAALILTPTRELAIQIERQTKELVVGLPNMRTGLLVGGMPLPPQLHRLKST  311

Query  1317  VSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRAL-SQPQILM  1141
             + +I+ TPGRL+++L ++ ++LD V + V+DE D ML+ GF +Q++++   +  + Q L+
Sbjct  312   IKIIIATPGRLLEILKQKAVQLDGVRVVVVDEADTMLKMGFQQQILKVLENIPEEHQTLL  371

Query  1140  YSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQH  961
              SATI +  E++A+ + +    I++G  N+P   ++Q+ +WVE   KK+KLF+IL   + 
Sbjct  372   TSATIPKGTEQLAARLTQDPVRIAIGDRNQPCADIRQIVLWVEEPSKKKKLFEILNDGKL  431

Query  960   YKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVAT  781
             Y+PPV+VFV  +LGADLL  A+    GL  V+IH +K+  +R  IL+  L GD  V+V+T
Sbjct  432   YQPPVVVFVDCKLGADLLCEAVKKIMGLNTVAIHSDKTQWERNRILKGLLEGDFEVVVST  491

Query  780   GVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVE  601
             GVLGRG+DL++VK V+ FDMP ++ EYVHQ+GRA R+G  GT+I F+N +NK+LF E+V 
Sbjct  492   GVLGRGLDLVNVKLVVNFDMPPNMDEYVHQVGRAGRLGHRGTAITFVNNDNKRLFLEVVN  551

Query  600   ILKSSGAAIPSELANSKY  547
              +K +G+ +P +L NS +
Sbjct  552   RVKPTGSQLPPQLLNSPH  569



>gb|KFQ83848.1| putative ATP-dependent RNA helicase DDX59 [Phoenicopterus ruber 
ruber]
Length=617

 Score =   422 bits (1084),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 331/531 (62%), Gaps = 34/531 (6%)
 Frame = -1

Query  2064  ESNQPSGSDSDSE--VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT--  1897
             + NQ +  DS SE  +K  S  QR A P EP CV+CGRYGEYICD+TD D+CSLECK   
Sbjct  80    KDNQNTDEDSSSEEPIKSFSKSQRWAEPGEPVCVVCGRYGEYICDKTDKDVCSLECKAKH  139

Query  1896  ILLSRIE----KSRKPTPCPPPVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNI  1729
             +L S+ E    KS + T           +  Y+ +D    S    L  +Q E L+ +L I
Sbjct  140   LLQSQEEEKKLKSDQLTTAESQAETHLLNTPYFYKD---HSFILGLRDEQIENLKLQLGI  196

Query  1728  VVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGS  1549
              V+G  V  PI+ F  C  P  L  NL+ +GYE+PTP+QMQ IP  L+GR ++ SA+TGS
Sbjct  197   AVQGQQVPRPIVEFEHCGFPETLNHNLKNSGYEVPTPIQMQMIPVGLLGRDIVASADTGS  256

Query  1548  GKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FKTA  1372
             GKT +FL+P++   +K         + P A+ILAPTREL IQIE QAK L  G+P  +T 
Sbjct  257   GKTAAFLLPVIMKVLK-------ETETPSALILAPTRELAIQIERQAKELMVGLPNMRTV  309

Query  1371  LVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFH  1192
             L+VGG  +  QL+R++  V +I+ TPGRL+++L +  ++L  + + V+DEVD ML+ GF 
Sbjct  310   LLVGGLPLPPQLHRLKQSVKVIIATPGRLLEILKQSSVQLHGIKIVVVDEVDTMLKMGFQ  369

Query  1191  EQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWV  1015
             +QV+ I   +S   Q ++ SATI   +E +A+ +  +   I++G+ N P   V+Q+ +WV
Sbjct  370   QQVLDILEDISHSHQTILVSATIPVGIEHLANQLLHNFVRITIGEKNLPCSNVRQIILWV  429

Query  1014  ESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDR  835
             E   KK+KLF+IL  K+ +KPPV+VFV  +LGADLLS A+   TGL+  ++H EKS  +R
Sbjct  430   EEPSKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSDAVHKITGLQCTAMHSEKSQVER  489

Query  834   REILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGT  655
               IL+  L     VIV+TGVLGRG+DL++VK V+ FDMP+S+ EYVH       +G  GT
Sbjct  490   TGILQGLLQEKYEVIVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVH-------LGHSGT  542

Query  654   SIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +I FIN  +KKLF ++V+ +K +G  +P +L NS Y          QKRR+
Sbjct  543   AITFINNNSKKLFWDVVKRVKPTGTILPPQLLNSPYL-------HDQKRRE  586



>ref|XP_006635016.1| PREDICTED: probable ATP-dependent RNA helicase DDX59-like [Lepisosteus 
oculatus]
Length=634

 Score =   421 bits (1082),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 223/533 (42%), Positives = 326/533 (61%), Gaps = 47/533 (9%)
 Frame = -1

Query  2025  VKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRIEKSRKPTPCPP  1846
             VK     QR   P EP CV+CGRYGEYICD TD+D+CSL+CK   L ++           
Sbjct  92    VKSFRHSQRWPEPGEPVCVVCGRYGEYICDTTDNDVCSLQCKAEHLDQMGVE--------  143

Query  1845  PVRFPATD-DCYYVRDDDKKSESKC----------------------LASDQAELLRRKL  1735
                 P TD  C    +++K   S C                      L  +Q   L+++L
Sbjct  144   ----PGTDVGCDNKPEEEKALFSTCVDDGDDGEGEICSYKEDAFISSLTEEQVMRLKQEL  199

Query  1734  NIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAET  1555
              IVV+G  V  P++ F  C  P  L  NL+ AGYE+PTPVQMQ +P  L GR  + +A+T
Sbjct  200   GIVVQGQGVCRPVIEFEQCSFPPVLSSNLKKAGYEVPTPVQMQMVPVGLAGRDAIATADT  259

Query  1554  GSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-FK  1378
             GSGKT +FL+P++   +    A SE    P A+IL PTREL IQIE QAK L  G+P  +
Sbjct  260   GSGKTAAFLLPVLVRALGERQASSEYG--PKALILTPTRELAIQIENQAKELVMGLPNMR  317

Query  1377  TALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRG  1198
             TAL+VGG  +  QL+R++  + +I+ TPGRL++++ ++ ++L  + + V+DE D ML+ G
Sbjct  318   TALLVGGMPLPSQLHRLKQNIKIIIATPGRLLEIMKQKAVQLSGIKIVVVDEADTMLKMG  377

Query  1197  FHEQVMQIFRALSQP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAI  1021
             F +QV+ +   + +  Q L+ SATI   +E++A+ + ++   I++G  N+P   V+Q+ +
Sbjct  378   FQQQVLDVLEQVPEDHQTLLVSATIPAGIEQLANQLTQNPVRITIGDKNQPCSNVRQIVL  437

Query  1020  WVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMK  841
             WVE   KK+KLF+IL  ++ Y PPV+VFV  +LGADLL  A+     L  VSIH +K   
Sbjct  438   WVEEPSKKKKLFEILNDRKLYLPPVLVFVDCKLGADLLCEAVHKVLALNTVSIHSDKPQC  497

Query  840   DRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEE  661
             +R  IL+  L GD  V+V+TGVLGRG+DL++VK V+ FDMP+S+ EYVHQ+GRA R+G  
Sbjct  498   ERNSILQGLLQGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRAGRLGHR  557

Query  660   GTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             GT+I F+N  NK+LF +LV  +K +G+ +P++L NS +         H++R+K
Sbjct  558   GTAITFVNNNNKRLFLDLVNRVKPTGSLLPAQLLNSPH--------LHEQRKK  602



>ref|XP_005330435.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX59 [Ictidomys tridecemlineatus]
Length=627

 Score =   420 bits (1079),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 247/569 (43%), Positives = 339/569 (60%), Gaps = 64/569 (11%)
 Frame = -1

Query  2109  SGSFKAMETSIVAA--TESNQPSGSDSDSEVKKRSWEQREALPDEPKCVICGRYGEYICD  1936
             SGSF +    +  A   E  Q    D++  VK  S  QR A P EP CV+CGRYGEYICD
Sbjct  58    SGSFPSPAGQLAEAGLVEPEQ----DAEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICD  113

Query  1935  ETDDDICSLECKTILLSRI-EKSRK----------PTPCPPPVRFPATDDCYYVRDDDKK  1789
             +TD+D+CSLECK   L ++ EK  K            P PPP+     DD Y  ++    
Sbjct  114   KTDEDVCSLECKAKHLLQVKEKDEKLKLSSPQKAGSEPEPPPL-----DDVYVYKEHPFI  168

Query  1788  SESKCLASDQAELLRRKLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQM  1609
                  L  DQ E L+++L I+V+G  V+ PI+ F  C  P  L +NL+ +GYE+PTP+QM
Sbjct  169   LN---LQEDQIENLKQQLGILVQGQEVTRPIIDFEHCGFPEALNNNLKKSGYEVPTPIQM  225

Query  1608  QAIPAALMGRSLLVSAETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELC  1429
             Q IP  L+GR +L SA+TGSGKT +FL+P++        A  ERK  P A++L PTREL 
Sbjct  226   QMIPVGLLGRDILASADTGSGKTAAFLLPVIIR------ALFERK-TPSALVLTPTRELA  278

Query  1428  IQIEEQAKVLGKGMP-FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTK---RE  1261
             IQIE QAK L  G+P  KT L+VGG  +  QLYR+   V + +     LI    K   R+
Sbjct  279   IQIERQAKELMSGLPRMKTVLLVGGLPLPPQLYRLRQHVKVSI----HLIXCPXKSFIRD  334

Query  1260  IELDSVSMF---------------VIDEVDCMLQRGFHEQVMQIFRALSQP-QILMYSAT  1129
             I  +S   F               V +E D ML+ GF +QV+ I   +    Q ++ SAT
Sbjct  335   IGANSWGFFPPXGVSVVLCSFKIIVAEEADTMLKMGFQQQVLDILENIPNDCQTILVSAT  394

Query  1128  ISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFDILTSKQHYKPP  949
             I   +E++AS +  +   +  G+ N P   V+Q+ +WVE   KK+KLF+IL  K+ +KPP
Sbjct  395   IPASIEQLASQLLHNPVRVIAGEKNLPCANVRQIILWVEDPAKKKKLFEILNDKKLFKPP  454

Query  948   VIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGDVPVIVATGVLG  769
             V+VFV  RLGADLLS A+   TGLK+ SIH EKS  +R+ IL+  L GD  V+V+TGVLG
Sbjct  455   VLVFVDCRLGADLLSEAVQKVTGLKSTSIHSEKSQMERKNILKGLLEGDYEVVVSTGVLG  514

Query  768   RGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKKLFPELVEILKS  589
             RG+DL+SVK V+ FDMP+S+ EYVHQ+GR  R+G+ GT+I FIN  +K+LF ++ + +K 
Sbjct  515   RGLDLISVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLFWDIAKRVKP  574

Query  588   SGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             +G+ +P +L NS Y         H ++RK
Sbjct  575   TGSILPPQLLNSPY--------LHDQKRK  595



>ref|XP_008530673.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Equus przewalskii]
Length=606

 Score =   418 bits (1075),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 232/520 (45%), Positives = 321/520 (62%), Gaps = 37/520 (7%)
 Frame = -1

Query  2037  SDSEVKKRSWEQREALPDEPKCVICGRYGEYICDETDDDICSLECKT-ILLSRIEKSRKP  1861
             S+  VK  S  QR A P EP CV+CGRYGEYICD TD+D+CSLECK   LL+  E+  K 
Sbjct  84    SEEPVKSFSKTQRWAEPGEPVCVVCGRYGEYICDRTDEDVCSLECKARHLLTVQEEEEKL  143

Query  1860  TPCPP------PVRFPATDDCYYVRDDDKKSESKCLASDQAELLRRKLNIVVKGDLVSPP  1699
                 P      P   P     Y  ++    S    L  DQ E L+R+L IVV+G  V  P
Sbjct  144   KLGGPQGADSEPASLPQAG--YVYKEHPFISN---LQGDQIENLKRQLGIVVQGRDVPRP  198

Query  1698  IMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSAETGSGKTGSFLIPI  1519
             I+ F  C  P  L  NL+ AGYE+PTP+QMQ +P  L+GR +L SA+TGSGKT +FL+P+
Sbjct  199   IIDFEHCGFPEALNHNLKEAGYEVPTPIQMQMVPVGLLGRDILASADTGSGKTAAFLLPV  258

Query  1518  VANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMPFKTALVVGGDAMARQ  1339
             +       L      + P A+IL PTREL IQIE Q        P  T   +  +  A+ 
Sbjct  259   I-------LRALLESKTPAALILTPTRELAIQIERQ-------RPCLTYSSLNSEFSAQC  304

Query  1338  LYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQRGFHEQVMQIFRALS  1159
             L  V H  S+I+ TPGRL+D++ +  ++L  + + V+DE D ML+ GF +QV+ +   + 
Sbjct  305   LAHVSH--SVIIATPGRLLDIIKQNAVDLCGIKIVVVDEADTMLKMGFQQQVLDVLENVP  362

Query  1158  QP-QILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQLAIWVESKQKKQKLFD  982
             Q  Q ++ SATI   +E++A  +  +   I  G+ N P  +V+Q+ +W+E   KK+KLF+
Sbjct  363   QDCQTILVSATIPTSIEQLAGQLLHNPVRIVTGEKNLPCSSVRQIILWIEEPAKKKKLFE  422

Query  981   ILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKSMKDRREILRSFLVGD  802
             IL  K+ +KPPV+VFV  +LGADLLS A+   TGLK+VSIH EKS  +RR IL+  L GD
Sbjct  423   ILNDKKLFKPPVLVFVDCKLGADLLSEAVQKVTGLKSVSIHSEKSQTERRNILKGLLEGD  482

Query  801   VPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMGEEGTSIVFINEENKK  622
               V+V+TGVLGRG+DL+SVK V+ FDMP+S+ EYVHQIGR  R+G+ GT+I FIN  +K+
Sbjct  483   YEVVVSTGVLGRGLDLVSVKLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKR  542

Query  621   LFPELVEILKSSGAAIPSELANSKYSVGSFSVGRHQKRRK  502
             LF ++ + +K +G+ +P +L NS Y         H ++RK
Sbjct  543   LFWDIAKRVKPTGSILPPQLLNSPY--------LHDQKRK  574



>ref|XP_010894289.1| PREDICTED: probable ATP-dependent RNA helicase DDX59 [Esox lucius]
Length=653

 Score =   417 bits (1073),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 219/520 (42%), Positives = 326/520 (63%), Gaps = 20/520 (4%)
 Frame = -1

Query  2052  PSGSDSDSEVKKRSWE-QREALPDEPKCVICGRYGEYICDETDDDICSLECKTILLSRI-  1879
             P  SD D E  K S + QR   P EP CV+CGR+GEYICD TD+D+CSLECK   L+++ 
Sbjct  96    PEDSDKDDEPVKSSKKCQRWPEPGEPICVMCGRFGEYICDSTDNDVCSLECKASHLAKMG  155

Query  1878  -------------EKSRKPTPCPPPVRFP-ATDDCYYVRDDDKKSESKCLASDQAELLRR  1741
                          ++   P+     VR   + +D  Y  ++D       L  +Q   +++
Sbjct  156   MSTGGSAFNRNPGDERNSPSGQHAAVRGDRSAEDLDYSYEEDAFISG--LTEEQVRRVKQ  213

Query  1740  KLNIVVKGDLVSPPIMSFGSCDVPRKLLDNLEAAGYEMPTPVQMQAIPAALMGRSLLVSA  1561
             +L I  +G  V  PI+ F  C++P  +  NL+ AGYE PTPVQMQ +P  L GR ++ SA
Sbjct  214   ELGIATEGREVGRPIVEFEHCNLPPTIGANLKKAGYEAPTPVQMQMVPVGLSGRDVIASA  273

Query  1560  ETGSGKTGSFLIPIVANTVKLNLACSERKQKPLAMILAPTRELCIQIEEQAKVLGKGMP-  1384
             +TGSGKT +FL+P+V   +K           P A++L PTREL IQIE Q K L  G+  
Sbjct  274   DTGSGKTVAFLLPVVVQALKHQRRVEGCPGGPTALVLTPTRELAIQIERQVKELVVGVAN  333

Query  1383  FKTALVVGGDAMARQLYRVEHGVSLIVGTPGRLIDLLTKREIELDSVSMFVIDEVDCMLQ  1204
              +TAL+VGG  + +QL+R++    +I+ TPGRL+++L ++ ++LD V + V+DE D ML+
Sbjct  334   MRTALLVGGMPLPQQLHRLKRTNKIIIATPGRLLEILKQKAVQLDGVRVVVVDEADTMLK  393

Query  1203  RGFHEQVMQIFRAL-SQPQILMYSATISREVEKMASSMAKHLTVISVGQLNKPNGAVKQL  1027
              GF +QV+++   +  + Q L+ SATI +  E++A+ + +    I++G  N+P   ++Q+
Sbjct  394   MGFQQQVLEVLEHVPDEHQTLLTSATIPKSTEQLAARLTQDPVRITIGDKNQPCANIRQI  453

Query  1026  AIWVESKQKKQKLFDILTSKQHYKPPVIVFVGSRLGADLLSGAITISTGLKAVSIHGEKS  847
              +WVE   KK+KLF+IL   + Y+PPV+VFV  + GADLL  A+     LKAV+IH +K+
Sbjct  454   VLWVEEPSKKKKLFEILNDGKLYQPPVVVFVDCKPGADLLCEAVLKVMDLKAVAIHSDKT  513

Query  846   MKDRREILRSFLVGDVPVIVATGVLGRGVDLLSVKQVIVFDMPNSIKEYVHQIGRASRMG  667
               +R  IL+  L GD  V+V+TGVLGRG+DL++VK V+ FDMP ++ EYVHQ+GRA R+G
Sbjct  514   QLERNRILKGLLEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPRNMDEYVHQVGRAGRLG  573

Query  666   EEGTSIVFINEENKKLFPELVEILKSSGAAIPSELANSKY  547
               GT+I F+N  NK LF E+V  +K +G+ +P +L NS +
Sbjct  574   HRGTAITFVNNNNKHLFLEVVNRVKPTGSQLPPQLLNSPH  613



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8305271774144