BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25778_g2_i3 len=3555 path=[1:0-283 285:284-325 327:326-376
378:377-475 477:476-493 495:494-574 576:575-593 595:594-622
624:623-626 628:627-736 738:737-755 757:756-976 978:977-1048
1050:1049-1058 @1060@!:1059-1462 1464:1463-1478 1480:1479-1645
1647:1646-1666 1668:1667-1869 1871:1870-1871 1873:1872-2248
2250:2249-2254 @2256@!:2255-2782 2784:2783-2791 2793:2792-2855
2857:2856-2867 @2869@!:2868-3492 12497:3493-3520 32699:3521-3526
12778:3527-3554]

Length=3555
                                                                      Score     E

ref|XP_009623191.1|  PREDICTED: ER membrane protein complex subun...   1493   0.0      
ref|XP_009785843.1|  PREDICTED: ER membrane protein complex subun...   1484   0.0      
ref|XP_009597396.1|  PREDICTED: ER membrane protein complex subun...   1481   0.0      
ref|XP_009759124.1|  PREDICTED: ER membrane protein complex subun...   1477   0.0      
ref|XP_006366781.1|  PREDICTED: ER membrane protein complex subun...   1466   0.0      
ref|XP_010325953.1|  PREDICTED: ER membrane protein complex subun...   1457   0.0      
ref|XP_007012092.1|  Catalytics isoform 1                              1451   0.0      
ref|XP_002284012.1|  PREDICTED: ER membrane protein complex subun...   1449   0.0      Vitis vinifera
ref|XP_008220058.1|  PREDICTED: ER membrane protein complex subun...   1446   0.0      
ref|XP_007227052.1|  hypothetical protein PRUPE_ppa000842mg            1442   0.0      
ref|XP_011094459.1|  PREDICTED: ER membrane protein complex subun...   1439   0.0      
emb|CDP15321.1|  unnamed protein product                               1438   0.0      
gb|KDP34198.1|  hypothetical protein JCGZ_07769                        1434   0.0      
ref|XP_008378089.1|  PREDICTED: ER membrane protein complex subun...   1424   0.0      
gb|KHG26099.1|  Uncharacterized protein F383_09262                     1422   0.0      
ref|XP_002516556.1|  catalytic, putative                               1421   0.0      Ricinus communis
ref|XP_006450658.1|  hypothetical protein CICLE_v10007348mg            1419   0.0      
ref|XP_010100254.1|  hypothetical protein L484_007251                  1412   0.0      
ref|XP_010254044.1|  PREDICTED: ER membrane protein complex subun...   1409   0.0      
ref|XP_002324236.2|  hypothetical protein POPTR_0018s00550g            1409   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010254043.1|  PREDICTED: ER membrane protein complex subun...   1409   0.0      
ref|XP_009346082.1|  PREDICTED: ER membrane protein complex subun...   1409   0.0      
ref|XP_011026615.1|  PREDICTED: ER membrane protein complex subun...   1402   0.0      
gb|EYU41569.1|  hypothetical protein MIMGU_mgv1a000799mg               1400   0.0      
ref|XP_002308610.1|  hypothetical protein POPTR_0006s25700g            1396   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010049094.1|  PREDICTED: ER membrane protein complex subun...   1395   0.0      
ref|XP_009367894.1|  PREDICTED: ER membrane protein complex subun...   1392   0.0      
ref|XP_008393881.1|  PREDICTED: ER membrane protein complex subun...   1392   0.0      
ref|XP_010049093.1|  PREDICTED: ER membrane protein complex subun...   1390   0.0      
ref|XP_003526482.1|  PREDICTED: ER membrane protein complex subun...   1382   0.0      
gb|KHN18187.1|  Hypothetical protein glysoja_025077                    1380   0.0      
ref|XP_011019630.1|  PREDICTED: ER membrane protein complex subun...   1378   0.0      
ref|XP_003522701.1|  PREDICTED: ER membrane protein complex subun...   1377   0.0      
gb|KHN10213.1|  Hypothetical protein glysoja_017817                    1374   0.0      
gb|KFK25418.1|  hypothetical protein AALP_AA8G112000                   1371   0.0      
gb|KHG18967.1|  Uncharacterized protein F383_07420                     1369   0.0      
ref|XP_006399663.1|  hypothetical protein EUTSA_v10012570mg            1365   0.0      
ref|XP_004501175.1|  PREDICTED: ER membrane protein complex subun...   1359   0.0      
ref|XP_004291191.1|  PREDICTED: ER membrane protein complex subun...   1358   0.0      
gb|KEH36041.1|  ER membrane protein complex subunit-like protein       1355   0.0      
ref|XP_010491889.1|  PREDICTED: ER membrane protein complex subun...   1345   0.0      
ref|XP_009125814.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...   1345   0.0      
ref|XP_010541259.1|  PREDICTED: ER membrane protein complex subun...   1342   0.0      
ref|XP_010925904.1|  PREDICTED: ER membrane protein complex subun...   1341   0.0      
ref|XP_010419729.1|  PREDICTED: ER membrane protein complex subun...   1339   0.0      
emb|CDX69747.1|  BnaA10g20960D                                         1338   0.0      
ref|XP_002873520.1|  hypothetical protein ARALYDRAFT_487993            1332   0.0      
emb|CDX91208.1|  BnaC02g03890D                                         1331   0.0      
gb|KHG08509.1|  Uncharacterized protein F383_13837                     1330   0.0      
ref|NP_196717.3|  PQQ_DH domain-containing protein                     1330   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121935.1|  PREDICTED: ER membrane protein complex subun...   1329   0.0      
ref|XP_010453205.1|  PREDICTED: ER membrane protein complex subun...   1328   0.0      
ref|XP_010668174.1|  PREDICTED: ER membrane protein complex subun...   1327   0.0      
ref|XP_006287000.1|  hypothetical protein CARUB_v10000146mg            1327   0.0      
ref|XP_008802826.1|  PREDICTED: ER membrane protein complex subun...   1326   0.0      
ref|XP_003636448.1|  hypothetical protein MTR_041s0018                 1314   0.0      
ref|XP_009395509.1|  PREDICTED: ER membrane protein complex subun...   1307   0.0      
ref|XP_009396281.1|  PREDICTED: ER membrane protein complex subun...   1305   0.0      
ref|XP_004164260.1|  PREDICTED: ER membrane protein complex subun...   1292   0.0      
ref|XP_008445027.1|  PREDICTED: ER membrane protein complex subun...   1291   0.0      
ref|XP_004150284.1|  PREDICTED: ER membrane protein complex subun...   1288   0.0      
emb|CAB87716.1|  putative protein                                      1287   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382057.1|  hypothetical protein POPTR_0006s25700g            1285   0.0      
ref|XP_006833394.1|  hypothetical protein AMTR_s00109p00121860         1261   0.0      
ref|XP_007012093.1|  Catalytics isoform 2                              1250   0.0      
gb|KDO79764.1|  hypothetical protein CISIN_1g002016mg                  1231   0.0      
ref|XP_007137196.1|  hypothetical protein PHAVU_009G1078000g           1228   0.0      
ref|XP_002439481.1|  hypothetical protein SORBIDRAFT_09g007880         1194   0.0      Sorghum bicolor [broomcorn]
ref|NP_001054975.1|  Os05g0230600                                      1193   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90673.1|  predicted protein                                     1191   0.0      
ref|XP_006654166.1|  PREDICTED: ER membrane protein complex subun...   1187   0.0      
emb|CDX85707.1|  BnaA02g01060D                                         1186   0.0      
ref|XP_004960655.1|  PREDICTED: ER membrane protein complex subun...   1186   0.0      
ref|XP_008648064.1|  PREDICTED: uncharacterized protein LOC100381...   1184   0.0      
gb|EMT32849.1|  hypothetical protein F775_31297                        1181   0.0      
ref|XP_008656322.1|  PREDICTED: ER membrane protein complex subun...   1177   0.0      
gb|EPS59522.1|  hypothetical protein M569_15283                        1175   0.0      
gb|EEC78801.1|  hypothetical protein OsI_19058                         1173   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003568721.1|  PREDICTED: ER membrane protein complex subun...   1169   0.0      
ref|XP_003636402.1|  hypothetical protein MTR_040s0031                 1153   0.0      
gb|KEH36029.1|  ER membrane protein complex subunit-like protein       1149   0.0      
gb|KDO79766.1|  hypothetical protein CISIN_1g002016mg                  1117   0.0      
gb|KDO79765.1|  hypothetical protein CISIN_1g002016mg                  1117   0.0      
gb|EEE62894.1|  hypothetical protein OsJ_17698                         1045   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS55546.1|  hypothetical protein TRIUR3_31633                       995   0.0      
gb|AFW82067.1|  hypothetical protein ZEAMMB73_676127                    993   0.0      
ref|XP_001765108.1|  predicted protein                                  922   0.0      
emb|CDY68532.1|  BnaCnng59410D                                          811   0.0      
ref|XP_002965963.1|  hypothetical protein SELMODRAFT_84520              827   0.0      
ref|XP_002962821.1|  hypothetical protein SELMODRAFT_165412             822   0.0      
emb|CDY67992.1|  BnaCnng57230D                                          541   4e-177   
ref|XP_001638961.1|  predicted protein                                  380   5e-110   Nematostella vectensis
ref|XP_693770.3|  PREDICTED: ER membrane protein complex subunit ...    357   9e-102   Danio rerio [leopard danio]
ref|XP_005162246.1|  PREDICTED: ER membrane protein complex subun...    357   9e-102   
ref|XP_009097868.1|  PREDICTED: ER membrane protein complex subun...    353   2e-100   
ref|XP_008300471.1|  PREDICTED: ER membrane protein complex subun...    350   1e-99    
ref|XP_010738575.1|  PREDICTED: ER membrane protein complex subun...    350   2e-99    
ref|XP_010738577.1|  PREDICTED: ER membrane protein complex subun...    350   3e-99    
ref|XP_007246404.1|  PREDICTED: ER membrane protein complex subun...    348   6e-99    
ref|XP_007246403.1|  PREDICTED: ER membrane protein complex subun...    348   1e-98    
ref|XP_005057879.1|  PREDICTED: ER membrane protein complex subun...    348   2e-98    
ref|XP_007553495.1|  PREDICTED: ER membrane protein complex subun...    345   1e-97    
ref|XP_007553494.1|  PREDICTED: ER membrane protein complex subun...    345   1e-97    
ref|XP_002731135.2|  PREDICTED: ER membrane protein complex subun...    344   2e-97    Saccoglossus kowalevskii
ref|XP_002606692.1|  hypothetical protein BRAFLDRAFT_72541              343   4e-97    Branchiostoma floridae
ref|XP_005528439.1|  PREDICTED: ER membrane protein complex subun...    344   4e-97    
ref|XP_005800159.1|  PREDICTED: ER membrane protein complex subun...    343   5e-97    
ref|XP_010898641.1|  PREDICTED: ER membrane protein complex subun...    343   8e-97    
ref|XP_010898640.1|  PREDICTED: ER membrane protein complex subun...    343   1e-96    
ref|XP_004554132.1|  PREDICTED: ER membrane protein complex subun...    342   2e-96    
ref|XP_004554131.1|  PREDICTED: ER membrane protein complex subun...    342   2e-96    
ref|XP_006785514.1|  PREDICTED: ER membrane protein complex subun...    341   3e-96    
ref|XP_006785513.1|  PREDICTED: ER membrane protein complex subun...    341   3e-96    
ref|XP_007896029.1|  PREDICTED: ER membrane protein complex subun...    340   6e-96    
ref|XP_005941216.1|  PREDICTED: ER membrane protein complex subun...    340   7e-96    
ref|XP_005941217.1|  PREDICTED: ER membrane protein complex subun...    340   7e-96    
ref|XP_003963316.1|  PREDICTED: ER membrane protein complex subun...    339   1e-95    
ref|XP_005733075.1|  PREDICTED: ER membrane protein complex subun...    338   2e-95    
ref|XP_005444047.1|  PREDICTED: ER membrane protein complex subun...    338   2e-95    
ref|XP_005733076.1|  PREDICTED: ER membrane protein complex subun...    338   3e-95    
ref|XP_008411701.1|  PREDICTED: ER membrane protein complex subun...    337   6e-95    
ref|XP_008411702.1|  PREDICTED: ER membrane protein complex subun...    337   8e-95    
ref|XP_005846272.1|  hypothetical protein CHLNCDRAFT_58253              335   2e-94    
gb|KFV66609.1|  ER membrane protein complex subunit 1                   334   9e-94    
ref|XP_008122171.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    334   2e-93    
ref|XP_009897796.1|  PREDICTED: ER membrane protein complex subun...    333   2e-93    
ref|XP_010410820.1|  PREDICTED: ER membrane protein complex subun...    332   3e-93    
ref|XP_005229729.1|  PREDICTED: ER membrane protein complex subun...    332   3e-93    
ref|XP_002943252.2|  PREDICTED: ER membrane protein complex subun...    332   5e-93    
ref|XP_009447861.1|  PREDICTED: ER membrane protein complex subun...    332   6e-93    
ref|XP_008965353.1|  PREDICTED: ER membrane protein complex subun...    332   7e-93    
ref|XP_004850477.1|  PREDICTED: ER membrane protein complex subun...    332   9e-93    
ref|XP_004850476.1|  PREDICTED: ER membrane protein complex subun...    331   1e-92    
gb|KFQ95684.1|  ER membrane protein complex subunit 1                   330   1e-92    
ref|XP_009461713.1|  PREDICTED: ER membrane protein complex subun...    331   1e-92    
ref|XP_006766714.1|  PREDICTED: ER membrane protein complex subun...    331   1e-92    
ref|XP_008965351.1|  PREDICTED: ER membrane protein complex subun...    331   2e-92    
gb|KFO59600.1|  ER membrane protein complex subunit 1                   330   2e-92    
ref|XP_004850475.1|  PREDICTED: ER membrane protein complex subun...    330   2e-92    
ref|XP_009232435.1|  PREDICTED: ER membrane protein complex subun...    330   2e-92    
ref|XP_008965352.1|  PREDICTED: ER membrane protein complex subun...    330   3e-92    
ref|XP_003814479.1|  PREDICTED: ER membrane protein complex subun...    330   3e-92    
ref|XP_004903413.1|  PREDICTED: ER membrane protein complex subun...    330   3e-92    
ref|NP_001258357.1|  ER membrane protein complex subunit 1 isofor...    330   3e-92    
emb|CAH56165.1|  hypothetical protein                                   330   4e-92    Homo sapiens [man]
emb|CAH56140.1|  hypothetical protein                                   330   4e-92    Homo sapiens [man]
ref|XP_008965350.1|  PREDICTED: ER membrane protein complex subun...    330   4e-92    
ref|NP_055862.1|  ER membrane protein complex subunit 1 isoform 1...    330   4e-92    Homo sapiens [man]
ref|XP_004903412.1|  PREDICTED: ER membrane protein complex subun...    330   5e-92    
ref|XP_008965349.1|  PREDICTED: ER membrane protein complex subun...    329   7e-92    
ref|XP_004024832.1|  PREDICTED: ER membrane protein complex subun...    329   7e-92    
ref|XP_008965347.1|  PREDICTED: ER membrane protein complex subun...    329   8e-92    
gb|EHB14730.1|  hypothetical protein GW7_09682                          328   9e-92    
ref|XP_004903411.1|  PREDICTED: ER membrane protein complex subun...    328   9e-92    
dbj|BAF84307.1|  unnamed protein product                                328   1e-91    Homo sapiens [man]
ref|XP_008965348.1|  PREDICTED: ER membrane protein complex subun...    328   1e-91    
ref|XP_005245844.1|  PREDICTED: ER membrane protein complex subun...    328   1e-91    
dbj|BAA07645.2|  KIAA0090                                               328   2e-91    Homo sapiens [man]
ref|NP_001258356.1|  ER membrane protein complex subunit 1 isofor...    328   2e-91    
ref|XP_001162981.2|  PREDICTED: ER membrane protein complex subun...    328   2e-91    Pan troglodytes
ref|XP_009198835.1|  PREDICTED: ER membrane protein complex subun...    327   2e-91    
ref|NP_001168216.1|  hypothetical protein                               303   3e-91    Zea mays [maize]
ref|XP_009447860.1|  PREDICTED: ER membrane protein complex subun...    327   3e-91    
ref|XP_007933833.1|  PREDICTED: ER membrane protein complex subun...    327   3e-91    
ref|XP_007933831.1|  PREDICTED: ER membrane protein complex subun...    327   4e-91    
ref|XP_005317580.1|  PREDICTED: ER membrane protein complex subun...    327   4e-91    
ref|XP_005317578.1|  PREDICTED: ER membrane protein complex subun...    327   4e-91    
ref|XP_009447846.1|  PREDICTED: ER membrane protein complex subun...    327   5e-91    
ref|XP_004425702.1|  PREDICTED: ER membrane protein complex subun...    327   5e-91    
ref|XP_005245845.1|  PREDICTED: ER membrane protein complex subun...    327   6e-91    
ref|XP_009447853.1|  PREDICTED: ER membrane protein complex subun...    326   7e-91    
ref|XP_005317579.1|  PREDICTED: ER membrane protein complex subun...    326   7e-91    
ref|XP_005317577.1|  PREDICTED: ER membrane protein complex subun...    326   9e-91    
ref|XP_005544658.1|  PREDICTED: ER membrane protein complex subun...    325   1e-90    
ref|XP_004678612.1|  PREDICTED: ER membrane protein complex subun...    325   1e-90    
ref|XP_009994097.1|  PREDICTED: ER membrane protein complex subun...    325   1e-90    
ref|NP_001248047.1|  ER membrane protein complex subunit 1 precursor    325   2e-90    
ref|XP_009232431.1|  PREDICTED: ER membrane protein complex subun...    325   2e-90    
ref|XP_010284953.1|  PREDICTED: ER membrane protein complex subun...    324   2e-90    
ref|XP_004377247.1|  PREDICTED: ER membrane protein complex subun...    325   2e-90    
ref|XP_004637725.1|  PREDICTED: ER membrane protein complex subun...    325   3e-90    
ref|XP_005544657.1|  PREDICTED: ER membrane protein complex subun...    324   3e-90    
ref|XP_004637726.1|  PREDICTED: ER membrane protein complex subun...    324   3e-90    
ref|XP_009232432.1|  PREDICTED: ER membrane protein complex subun...    324   3e-90    
ref|XP_004637727.1|  PREDICTED: ER membrane protein complex subun...    324   3e-90    
gb|KFU88223.1|  ER membrane protein complex subunit 1                   323   3e-90    
gb|KFQ67260.1|  ER membrane protein complex subunit 1                   324   3e-90    
ref|XP_005544662.1|  PREDICTED: ER membrane protein complex subun...    324   3e-90    
ref|XP_010612524.1|  PREDICTED: ER membrane protein complex subun...    325   4e-90    
ref|XP_007933832.1|  PREDICTED: ER membrane protein complex subun...    324   4e-90    
gb|KFO19169.1|  Putative protein KIAA0090                               324   4e-90    
ref|XP_006766712.1|  PREDICTED: ER membrane protein complex subun...    323   5e-90    
gb|KFQ14883.1|  ER membrane protein complex subunit 1                   323   5e-90    
ref|XP_009955203.1|  PREDICTED: ER membrane protein complex subun...    323   6e-90    
ref|NP_001126319.1|  ER membrane protein complex subunit 1 precursor    323   6e-90    Pongo abelii [orang utan]
ref|XP_004637724.1|  PREDICTED: ER membrane protein complex subun...    323   6e-90    
ref|XP_005544655.1|  PREDICTED: ER membrane protein complex subun...    323   8e-90    
ref|XP_009232437.1|  PREDICTED: ER membrane protein complex subun...    322   9e-90    
ref|XP_010075621.1|  PREDICTED: ER membrane protein complex subun...    322   9e-90    
ref|XP_010612523.1|  PREDICTED: ER membrane protein complex subun...    323   1e-89    
ref|XP_004457492.1|  PREDICTED: ER membrane protein complex subun...    323   1e-89    
ref|XP_003891273.1|  PREDICTED: ER membrane protein complex subun...    322   1e-89    
ref|XP_004457493.1|  PREDICTED: ER membrane protein complex subun...    322   1e-89    
ref|XP_006145275.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    322   2e-89    
ref|XP_006766713.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_006766711.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_009198830.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_008998778.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_004457491.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_006188333.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_005607459.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_005544661.1|  PREDICTED: ER membrane protein complex subun...    321   2e-89    
ref|XP_004070679.1|  PREDICTED: ER membrane protein complex subun...    321   2e-89    
ref|XP_005409846.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_006866389.1|  PREDICTED: ER membrane protein complex subun...    322   2e-89    
ref|XP_006188332.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_005409845.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_010383862.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_009198814.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_010383860.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_008632544.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    330   3e-89    
ref|XP_001504430.1|  PREDICTED: ER membrane protein complex subun...    321   3e-89    Equus caballus [domestic horse]
ref|XP_005004391.1|  PREDICTED: ER membrane protein complex subun...    321   3e-89    
ref|XP_006094127.1|  PREDICTED: ER membrane protein complex subun...    322   3e-89    
ref|XP_006866388.1|  PREDICTED: ER membrane protein complex subun...    322   4e-89    
ref|XP_008146372.1|  PREDICTED: ER membrane protein complex subun...    321   4e-89    
ref|XP_008264012.1|  PREDICTED: ER membrane protein complex subun...    322   4e-89    
ref|XP_008146375.1|  PREDICTED: ER membrane protein complex subun...    321   4e-89    
ref|XP_006866387.1|  PREDICTED: ER membrane protein complex subun...    321   4e-89    
ref|XP_007067788.1|  PREDICTED: ER membrane protein complex subun...    322   4e-89    
ref|XP_010383861.1|  PREDICTED: ER membrane protein complex subun...    321   4e-89    
ref|XP_003471417.1|  PREDICTED: ER membrane protein complex subun...    321   6e-89    
ref|XP_002716056.2|  PREDICTED: ER membrane protein complex subun...    321   6e-89    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010591363.1|  PREDICTED: ER membrane protein complex subun...    320   6e-89    
ref|XP_003934987.1|  PREDICTED: ER membrane protein complex subun...    320   6e-89    
ref|XP_009198819.1|  PREDICTED: ER membrane protein complex subun...    320   6e-89    
ref|XP_005409844.1|  PREDICTED: ER membrane protein complex subun...    321   6e-89    
ref|XP_003413484.1|  PREDICTED: ER membrane protein complex subun...    320   7e-89    
ref|XP_005607457.1|  PREDICTED: ER membrane protein complex subun...    320   7e-89    
ref|XP_005607455.1|  PREDICTED: ER membrane protein complex subun...    320   8e-89    
ref|XP_004657639.1|  PREDICTED: ER membrane protein complex subun...    320   9e-89    
ref|XP_004657640.1|  PREDICTED: ER membrane protein complex subun...    320   9e-89    
ref|XP_003057541.1|  predicted protein                                  322   9e-89    
ref|XP_005004390.1|  PREDICTED: ER membrane protein complex subun...    320   9e-89    
ref|XP_008264011.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_005607458.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_008071747.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_008540198.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_005883089.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_003471418.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_008264010.1|  PREDICTED: ER membrane protein complex subun...    320   1e-88    
ref|XP_010343818.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_010343817.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_008146374.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_008540196.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_002716055.2|  PREDICTED: ER membrane protein complex subun...    320   2e-88    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008264009.1|  PREDICTED: ER membrane protein complex subun...    320   2e-88    
ref|XP_008587739.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_008587732.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_004657638.1|  PREDICTED: ER membrane protein complex subun...    319   2e-88    
ref|XP_008820049.1|  PREDICTED: ER membrane protein complex subun...    319   3e-88    
ref|XP_006068176.1|  PREDICTED: ER membrane protein complex subun...    319   3e-88    
ref|XP_004592369.1|  PREDICTED: ER membrane protein complex subun...    319   3e-88    
ref|XP_006068174.1|  PREDICTED: ER membrane protein complex subun...    319   3e-88    
ref|XP_008540195.1|  PREDICTED: ER membrane protein complex subun...    318   3e-88    
ref|XP_005607456.1|  PREDICTED: ER membrane protein complex subun...    318   3e-88    
ref|XP_008587725.1|  PREDICTED: ER membrane protein complex subun...    318   3e-88    
ref|XP_002750409.1|  PREDICTED: ER membrane protein complex subun...    318   3e-88    Callithrix jacchus [common marmoset]
ref|XP_004592367.1|  PREDICTED: ER membrane protein complex subun...    318   4e-88    
ref|XP_008998777.1|  PREDICTED: ER membrane protein complex subun...    318   5e-88    
ref|XP_008587717.1|  PREDICTED: ER membrane protein complex subun...    318   5e-88    
ref|XP_009644835.1|  PREDICTED: ER membrane protein complex subun...    318   5e-88    
ref|XP_008540193.1|  PREDICTED: ER membrane protein complex subun...    318   5e-88    
ref|XP_008540197.1|  PREDICTED: ER membrane protein complex subun...    318   6e-88    
ref|XP_006934424.1|  PREDICTED: ER membrane protein complex subun...    318   6e-88    
ref|XP_009323587.1|  PREDICTED: ER membrane protein complex subun...    317   6e-88    
ref|XP_002915693.1|  PREDICTED: uncharacterized protein KIAA0090-...    317   7e-88    
ref|XP_008998779.1|  PREDICTED: ER membrane protein complex subun...    317   8e-88    
ref|XP_006068172.1|  PREDICTED: ER membrane protein complex subun...    318   8e-88    
ref|XP_003989661.1|  PREDICTED: ER membrane protein complex subun...    317   9e-88    
ref|XP_007083894.1|  PREDICTED: ER membrane protein complex subun...    318   1e-87    
ref|XP_006068175.1|  PREDICTED: ER membrane protein complex subun...    317   1e-87    
ref|XP_008998776.1|  PREDICTED: ER membrane protein complex subun...    317   1e-87    
ref|XP_855253.2|  PREDICTED: ER membrane protein complex subunit ...    317   1e-87    
ref|XP_006115158.1|  PREDICTED: ER membrane protein complex subun...    317   1e-87    
ref|XP_008820048.1|  PREDICTED: ER membrane protein complex subun...    317   1e-87    
ref|XP_002408222.1|  conserved hypothetical protein                     315   1e-87    
gb|KFV10186.1|  ER membrane protein complex subunit 1                   316   2e-87    
ref|XP_005617947.1|  PREDICTED: ER membrane protein complex subun...    316   2e-87    
ref|XP_008540194.1|  PREDICTED: ER membrane protein complex subun...    316   2e-87    
ref|XP_006934422.1|  PREDICTED: ER membrane protein complex subun...    316   2e-87    
ref|XP_006934423.1|  PREDICTED: ER membrane protein complex subun...    316   2e-87    
gb|KFP35226.1|  ER membrane protein complex subunit 1                   315   2e-87    
ref|XP_009288024.1|  PREDICTED: ER membrane protein complex subun...    315   2e-87    
ref|XP_009963292.1|  PREDICTED: ER membrane protein complex subun...    315   2e-87    
gb|KFQ73537.1|  ER membrane protein complex subunit 1                   315   2e-87    
ref|XP_004850478.1|  PREDICTED: ER membrane protein complex subun...    315   2e-87    
gb|ELU06819.1|  hypothetical protein CAPTEDRAFT_171523                  316   2e-87    
ref|XP_006068173.1|  PREDICTED: ER membrane protein complex subun...    316   3e-87    
gb|EMC84637.1|  Putative protein KIAA0090 like protein                  315   3e-87    
ref|XP_005617946.1|  PREDICTED: ER membrane protein complex subun...    315   3e-87    
ref|XP_004397122.1|  PREDICTED: ER membrane protein complex subun...    315   4e-87    
ref|XP_010113721.1|  PREDICTED: ER membrane protein complex subun...    315   4e-87    
ref|XP_005617948.1|  PREDICTED: ER membrane protein complex subun...    315   4e-87    
ref|XP_005617944.1|  PREDICTED: ER membrane protein complex subun...    315   4e-87    
ref|XP_003082510.1|  PQQ enzyme repeat-containing protein (ISS)         313   4e-87    
gb|KHG26100.1|  Uncharacterized protein F383_09262                      292   4e-87    
ref|XP_005508039.1|  PREDICTED: ER membrane protein complex subun...    315   4e-87    
gb|ELR45726.1|  Putative protein KIAA0090                               315   5e-87    
ref|XP_004903414.1|  PREDICTED: ER membrane protein complex subun...    314   6e-87    
ref|XP_004592368.1|  PREDICTED: ER membrane protein complex subun...    315   7e-87    
ref|NP_001258358.1|  ER membrane protein complex subunit 1 isofor...    314   8e-87    
ref|XP_005617945.1|  PREDICTED: ER membrane protein complex subun...    314   8e-87    
ref|XP_004024833.1|  PREDICTED: ER membrane protein complex subun...    314   8e-87    
ref|XP_007104658.1|  PREDICTED: ER membrane protein complex subun...    313   2e-86    
emb|CEG00025.1|  ER membrane protein complex subunit 1                  313   2e-86    
ref|XP_004741386.1|  PREDICTED: ER membrane protein complex subun...    313   3e-86    
ref|XP_007104656.1|  PREDICTED: ER membrane protein complex subun...    313   3e-86    
ref|XP_004741384.1|  PREDICTED: ER membrane protein complex subun...    313   3e-86    
ref|XP_004741385.1|  PREDICTED: ER membrane protein complex subun...    312   4e-86    
ref|XP_004741383.1|  PREDICTED: ER membrane protein complex subun...    312   4e-86    
ref|XP_010156840.1|  PREDICTED: ER membrane protein complex subun...    311   5e-86    
ref|XP_007104657.1|  PREDICTED: ER membrane protein complex subun...    312   6e-86    
ref|XP_010956063.1|  PREDICTED: ER membrane protein complex subun...    312   6e-86    
ref|XP_007175095.1|  PREDICTED: ER membrane protein complex subun...    311   7e-86    
ref|XP_007104655.1|  PREDICTED: ER membrane protein complex subun...    311   7e-86    
ref|XP_004741381.1|  PREDICTED: ER membrane protein complex subun...    311   7e-86    
ref|XP_004741382.1|  PREDICTED: ER membrane protein complex subun...    311   8e-86    
dbj|BAC11702.1|  unnamed protein product                                311   9e-86    
ref|XP_004314498.1|  PREDICTED: ER membrane protein complex subun...    311   9e-86    
ref|XP_004425703.1|  PREDICTED: ER membrane protein complex subun...    311   1e-85    
ref|XP_005317581.1|  PREDICTED: ER membrane protein complex subun...    311   1e-85    
ref|XP_007175096.1|  PREDICTED: ER membrane protein complex subun...    311   1e-85    
tpg|DAA32205.1|  TPA: hypothetical protein BOS_2447                     311   1e-85    
ref|XP_005197700.2|  PREDICTED: ER membrane protein complex subun...    311   1e-85    
gb|EMP28302.1|  E3 ubiquitin-protein ligase UBR4                        319   1e-85    
ref|XP_005544660.1|  PREDICTED: ER membrane protein complex subun...    310   2e-85    
ref|XP_010828238.1|  PREDICTED: ER membrane protein complex subun...    310   2e-85    
ref|XP_004272517.1|  PREDICTED: ER membrane protein complex subun...    310   2e-85    
ref|XP_005544659.1|  PREDICTED: ER membrane protein complex subun...    310   2e-85    
ref|XP_010828236.1|  PREDICTED: ER membrane protein complex subun...    310   3e-85    
ref|XP_005197699.2|  PREDICTED: ER membrane protein complex subun...    310   3e-85    
ref|XP_004377248.1|  PREDICTED: ER membrane protein complex subun...    309   3e-85    
ref|XP_008692887.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    309   4e-85    
ref|NP_001034289.1|  ER membrane protein complex subunit 1 isofor...    309   5e-85    
ref|XP_004637728.1|  PREDICTED: ER membrane protein complex subun...    309   5e-85    
gb|EQB78629.1|  hypothetical protein CB1_001086038                      317   5e-85    
gb|AAI29805.1|  C230096C10Rik protein                                   309   6e-85    
dbj|BAC97862.1|  mKIAA0090 protein                                      309   7e-85    
ref|NP_666269.2|  ER membrane protein complex subunit 1 isoform 1...    308   8e-85    
ref|XP_005957134.1|  PREDICTED: ER membrane protein complex subun...    308   1e-84    
ref|XP_005910278.1|  PREDICTED: ER membrane protein complex subun...    307   3e-84    
ref|XP_005607460.1|  PREDICTED: ER membrane protein complex subun...    306   3e-84    
gb|KFP76639.1|  ER membrane protein complex subunit 1                   305   4e-84    
ref|XP_009868812.1|  PREDICTED: ER membrane protein complex subun...    305   4e-84    
ref|XP_005910277.1|  PREDICTED: ER membrane protein complex subun...    306   4e-84    
ref|XP_005910279.1|  PREDICTED: ER membrane protein complex subun...    306   4e-84    
ref|XP_006188334.1|  PREDICTED: ER membrane protein complex subun...    306   5e-84    
ref|XP_004657641.1|  PREDICTED: ER membrane protein complex subun...    305   6e-84    
ref|XP_005409847.1|  PREDICTED: ER membrane protein complex subun...    306   6e-84    
ref|XP_006866390.1|  PREDICTED: ER membrane protein complex subun...    305   8e-84    
ref|XP_009198839.1|  PREDICTED: ER membrane protein complex subun...    305   9e-84    
ref|XP_004457494.1|  PREDICTED: ER membrane protein complex subun...    305   1e-83    
ref|XP_005352999.1|  PREDICTED: ER membrane protein complex subun...    305   1e-83    
ref|XP_005004392.1|  PREDICTED: ER membrane protein complex subun...    305   1e-83    
ref|XP_004603729.1|  PREDICTED: ER membrane protein complex subun...    304   2e-83    
gb|EAW94870.1|  KIAA0090, isoform CRA_a                                 303   3e-83    
ref|XP_003783894.1|  PREDICTED: ER membrane protein complex subun...    303   3e-83    
ref|XP_005081120.1|  PREDICTED: ER membrane protein complex subun...    304   4e-83    
ref|XP_005352998.1|  PREDICTED: ER membrane protein complex subun...    303   4e-83    
gb|KFP34553.1|  ER membrane protein complex subunit 1                   302   4e-83    
ref|XP_006197113.1|  PREDICTED: ER membrane protein complex subun...    303   4e-83    
ref|XP_010207132.1|  PREDICTED: ER membrane protein complex subun...    302   5e-83    
ref|XP_005081119.1|  PREDICTED: ER membrane protein complex subun...    303   6e-83    
ref|XP_003783895.1|  PREDICTED: ER membrane protein complex subun...    302   7e-83    
ref|XP_007459378.1|  PREDICTED: ER membrane protein complex subun...    303   7e-83    
ref|XP_004592370.1|  PREDICTED: ER membrane protein complex subun...    302   8e-83    
ref|XP_007436303.1|  PREDICTED: ER membrane protein complex subun...    301   9e-83    
ref|XP_006068177.1|  PREDICTED: ER membrane protein complex subun...    302   1e-82    
gb|EDL13308.1|  RIKEN cDNA C230096C10, isoform CRA_b                    302   1e-82    
gb|EPQ18170.1|  Putative protein KIAA0090                               301   2e-82    
ref|XP_005833007.1|  hypothetical protein GUITHDRAFT_163084             301   2e-82    
ref|XP_009048195.1|  hypothetical protein LOTGIDRAFT_238345             301   3e-82    
ref|XP_005617949.1|  PREDICTED: ER membrane protein complex subun...    301   3e-82    
gb|EFB18607.1|  hypothetical protein PANDA_003699                       299   7e-82    
ref|XP_005677100.1|  PREDICTED: ER membrane protein complex subun...    299   8e-82    
ref|XP_004397123.1|  PREDICTED: ER membrane protein complex subun...    299   8e-82    
ref|XP_004741387.1|  PREDICTED: ER membrane protein complex subun...    296   6e-81    
ref|XP_001690163.1|  predicted protein                                  283   4e-80    
ref|XP_004272518.1|  PREDICTED: ER membrane protein complex subun...    294   4e-80    
gb|EKC38401.1|  hypothetical protein CGI_10002987                       293   1e-79    
ref|XP_005910280.1|  PREDICTED: ER membrane protein complex subun...    291   7e-79    
gb|EDL13307.1|  RIKEN cDNA C230096C10, isoform CRA_a                    290   8e-79    
ref|XP_002501994.1|  predicted protein                                  276   9e-79    
ref|XP_005353000.1|  PREDICTED: ER membrane protein complex subun...    290   1e-78    
gb|ELK10451.1|  hypothetical protein PAL_GLEAN10012897                  286   1e-77    
ref|XP_009888296.1|  PREDICTED: ER membrane protein complex subun...    283   3e-76    
ref|XP_005428228.1|  PREDICTED: ER membrane protein complex subun...    281   3e-76    
ref|XP_009080247.1|  PREDICTED: ER membrane protein complex subun...    279   2e-75    
gb|KFP87892.1|  ER membrane protein complex subunit 1                   279   2e-75    
gb|KFP22324.1|  ER membrane protein complex subunit 1                   279   3e-75    
gb|KFR16355.1|  ER membrane protein complex subunit 1                   277   1e-74    
ref|XP_008925551.1|  PREDICTED: ER membrane protein complex subun...    277   2e-74    
gb|KFW83772.1|  ER membrane protein complex subunit 1                   277   2e-74    
gb|KFP08449.1|  ER membrane protein complex subunit 1                   277   2e-74    
ref|XP_008501981.1|  PREDICTED: ER membrane protein complex subun...    276   3e-74    
ref|XP_004176591.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    279   4e-74    
ref|XP_009940080.1|  PREDICTED: ER membrane protein complex subun...    276   5e-74    
ref|XP_010161629.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    275   8e-74    
ref|XP_009910967.1|  PREDICTED: ER membrane protein complex subun...    275   8e-74    
gb|KFZ46217.1|  ER membrane protein complex subunit 1                   275   9e-74    
ref|XP_009502747.1|  PREDICTED: ER membrane protein complex subun...    274   1e-73    
ref|XP_010022898.1|  PREDICTED: ER membrane protein complex subun...    274   1e-73    
gb|KFQ45571.1|  ER membrane protein complex subunit 1                   274   1e-73    
gb|KFQ49829.1|  ER membrane protein complex subunit 1                   275   1e-73    
ref|XP_009696349.1|  PREDICTED: ER membrane protein complex subun...    274   1e-73    
ref|XP_010575561.1|  PREDICTED: ER membrane protein complex subun...    275   1e-73    
gb|KFP63976.1|  ER membrane protein complex subunit 1                   274   1e-73    
gb|KFW02828.1|  ER membrane protein complex subunit 1                   274   1e-73    
ref|XP_009816506.1|  PREDICTED: ER membrane protein complex subun...    274   1e-73    
gb|KFV18744.1|  ER membrane protein complex subunit 1                   274   2e-73    
gb|KGL97225.1|  ER membrane protein complex subunit 1                   274   2e-73    
gb|KFV58878.1|  ER membrane protein complex subunit 1                   274   2e-73    
ref|XP_009477318.1|  PREDICTED: ER membrane protein complex subun...    274   2e-73    
ref|XP_009573748.1|  PREDICTED: ER membrane protein complex subun...    274   2e-73    
gb|KFZ50139.1|  ER membrane protein complex subunit 1                   273   3e-73    
gb|KFO11320.1|  ER membrane protein complex subunit 1                   273   3e-73    
ref|XP_006914471.1|  PREDICTED: ER membrane protein complex subun...    273   3e-73    
ref|XP_010301681.1|  PREDICTED: ER membrane protein complex subun...    273   3e-73    
ref|XP_009985687.1|  PREDICTED: ER membrane protein complex subun...    274   4e-73    
ref|XP_005145481.1|  PREDICTED: ER membrane protein complex subun...    273   4e-73    
gb|KFO91023.1|  ER membrane protein complex subunit 1                   273   4e-73    
ref|XP_010136531.1|  PREDICTED: ER membrane protein complex subun...    273   4e-73    
ref|XP_002113501.1|  hypothetical protein TRIADDRAFT_37902              265   5e-73    
gb|KFV85255.1|  ER membrane protein complex subunit 1                   273   5e-73    
ref|XP_008936604.1|  PREDICTED: ER membrane protein complex subun...    272   5e-73    
ref|XP_010188149.1|  PREDICTED: ER membrane protein complex subun...    272   6e-73    
gb|KFQ24918.1|  ER membrane protein complex subunit 1                   272   6e-73    
emb|CAG03213.1|  unnamed protein product                                267   7e-73    
gb|KFO72710.1|  ER membrane protein complex subunit 1                   272   8e-73    
ref|XP_009680909.1|  PREDICTED: ER membrane protein complex subun...    272   9e-73    
ref|XP_005645637.1|  DUF1620-domain-containing protein                  261   1e-72    
ref|NP_001133344.1|  K0090 protein precursor                            271   2e-72    
ref|NP_001012856.1|  ER membrane protein complex subunit 1 precursor    271   2e-72    
ref|XP_005495916.1|  PREDICTED: ER membrane protein complex subun...    272   2e-72    
ref|XP_003212349.2|  PREDICTED: ER membrane protein complex subun...    271   3e-72    
gb|EOB04734.1|  Uncharacterized protein KIAA0090-like protein           269   5e-72    
ref|XP_005015073.1|  PREDICTED: ER membrane protein complex subun...    269   5e-72    
ref|XP_007538555.1|  PREDICTED: ER membrane protein complex subun...    268   1e-71    
gb|KFW11651.1|  ER membrane protein complex subunit 1                   268   1e-71    
ref|XP_006261817.1|  PREDICTED: ER membrane protein complex subun...    268   3e-71    
ref|XP_008165539.1|  PREDICTED: ER membrane protein complex subun...    266   7e-71    
ref|XP_008165538.1|  PREDICTED: ER membrane protein complex subun...    266   8e-71    
ref|XP_008316238.1|  PREDICTED: ER membrane protein complex subun...    266   9e-71    
ref|XP_008316237.1|  PREDICTED: ER membrane protein complex subun...    266   1e-70    
ref|XP_009554537.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    271   1e-70    
ref|NP_001084811.1|  ER membrane protein complex subunit 1 precursor    266   1e-70    
ref|XP_004457495.1|  PREDICTED: ER membrane protein complex subun...    263   3e-70    
ref|XP_005478362.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    262   2e-69    
ref|XP_001420893.1|  predicted protein                                  248   4e-69    
ref|XP_008540199.1|  PREDICTED: ER membrane protein complex subun...    259   8e-69    
ref|XP_001999872.1|  GI22838                                            259   1e-68    
ref|XP_004005222.1|  PREDICTED: ER membrane protein complex subun...    259   1e-68    
gb|ELW68555.1|  hypothetical protein TREES_T100008839                   257   4e-68    
ref|XP_006883655.1|  PREDICTED: ER membrane protein complex subun...    257   7e-68    
ref|XP_006883653.1|  PREDICTED: ER membrane protein complex subun...    257   8e-68    
ref|XP_006883654.1|  PREDICTED: ER membrane protein complex subun...    257   1e-67    
ref|XP_006883652.1|  PREDICTED: ER membrane protein complex subun...    257   1e-67    
gb|ETK92263.1|  hypothetical protein L915_04340                         257   1e-67    
gb|ETM51987.1|  hypothetical protein L914_04285                         256   3e-67    
ref|XP_003764981.1|  PREDICTED: uncharacterized protein KIAA0090 ...    255   3e-67    
ref|XP_001621302.1|  hypothetical protein NEMVEDRAFT_v1g145387          243   4e-67    
ref|XP_008901756.1|  hypothetical protein PPTG_08786                    255   4e-67    
dbj|BAE41992.1|  unnamed protein product                                254   5e-67    
ref|XP_007491343.1|  PREDICTED: ER membrane protein complex subun...    254   7e-67    
ref|XP_007491342.1|  PREDICTED: ER membrane protein complex subun...    254   7e-67    
ref|XP_007491344.1|  PREDICTED: ER membrane protein complex subun...    254   1e-66    
ref|XP_003385319.1|  PREDICTED: uncharacterized protein KIAA0090 ...    253   1e-66    
ref|XP_001366698.2|  PREDICTED: ER membrane protein complex subun...    254   1e-66    
ref|XP_008204908.1|  PREDICTED: ER membrane protein complex subun...    253   1e-66    
ref|NP_001102160.1|  ER membrane protein complex subunit 1 precursor    253   1e-66    
gb|KGL82244.1|  ER membrane protein complex subunit 1                   245   2e-66    
gb|EGW05853.1|  Uncharacterized protein KIAA0090                        251   2e-66    
ref|XP_006980975.1|  PREDICTED: ER membrane protein complex subun...    253   2e-66    
ref|XP_008820050.1|  PREDICTED: ER membrane protein complex subun...    251   3e-66    
ref|XP_006239307.1|  PREDICTED: ER membrane protein complex subun...    252   3e-66    
ref|XP_007514832.1|  predicted protein                                  253   4e-66    
ref|XP_004705451.1|  PREDICTED: ER membrane protein complex subun...    251   6e-66    
ref|XP_006980974.1|  PREDICTED: ER membrane protein complex subun...    251   7e-66    
ref|XP_002170353.2|  PREDICTED: ER membrane protein complex subun...    251   7e-66    
ref|XP_007626002.1|  PREDICTED: ER membrane protein complex subun...    251   9e-66    
ref|XP_007625999.1|  PREDICTED: ER membrane protein complex subun...    250   1e-65    
ref|XP_003511554.2|  PREDICTED: ER membrane protein complex subun...    250   2e-65    
ref|XP_004333139.1|  hypothetical protein ACA1_387250                   250   2e-65    
ref|XP_010220149.1|  PREDICTED: ER membrane protein complex subun...    241   4e-65    
ref|XP_002428345.1|  conserved hypothetical protein                     247   6e-65    
ref|XP_006031555.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    248   1e-64    
gb|ERE85473.1|  E3 ubiquitin-protein ligase                             251   2e-64    
ref|XP_004425704.1|  PREDICTED: ER membrane protein complex subun...    245   3e-64    
ref|XP_002682358.1|  hypothetical protein NAEGRDRAFT_78106              243   2e-63    



>ref|XP_009623191.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=983

 Score =  1493 bits (3864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/983 (76%), Positives = 876/983 (89%), Gaps = 2/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLLL+++FSS+Y   +LYEDQVGLMDWHQ+YIGKVK+AVF TQKAGRKRVVVSTE
Sbjct  1     MAIRAFLLLLILFSSSYYAVALYEDQVGLMDWHQQYIGKVKNAVFQTQKAGRKRVVVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  D ID IDI++GKYVITLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENVIASLDLRHGEIFWRHVLGDNDTIDAIDISMGKYVITLSSGGSILRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL G  PSRS+LL P+NLK D+D++IL+Y +GYLH +SS DG+++WK +L+++G+DIQH
Sbjct  121   SFLRGLKPSRSLLLTPTNLKADKDNVILVYGNGYLHYLSSIDGDILWKMDLSHKGVDIQH  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++HP+G++ +YA+G++  SQF AY INAR  ELLKH SM FPGGFSGDISLV S+K V L
Sbjct  181   LIHPEGSETIYAIGVSDLSQFEAYIINARSDELLKHSSMSFPGGFSGDISLVASDKAVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+GSILVSI F +G I FQQV+IA+LVQ  +G+AVLLPSKL GMVA+ I K + F++VT
Sbjct  241   DSSGSILVSISFIEGEIKFQQVNIANLVQHISGSAVLLPSKLAGMVAVKIGKSLSFIKVT  300

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG+LE VD + +   +S+SL  SEG   FGLI+H   KIHL++K+ NDW S+LL+ES  
Sbjct  301   NEGRLEAVDTIPHVEAVSDSLPFSEGQSGFGLIQHDGTKIHLTLKTGNDWKSHLLKESFK  360

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             ID  +GLVHKVFINNYIRTDR+YGFRALIV+EDHSLLL+QQGEIVW+REDGLASI+DVTT
Sbjct  361   IDQHRGLVHKVFINNYIRTDRTYGFRALIVMEDHSLLLMQQGEIVWNREDGLASIIDVTT  420

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEKDGVSV+KVE +LFEWLKGHLLKLKGTLMLATPDD+A IQ++RL+S+ KSKMTR
Sbjct  421   SELPVEKDGVSVAKVEHSLFEWLKGHLLKLKGTLMLATPDDIAVIQRLRLQSAEKSKMTR  480

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL+A+HTGDGRIVWS L+NA RKS TCENP GLKI+QWQVPHHH
Sbjct  481   DHNGFRKLLIVLTRAGKLFAIHTGDGRIVWSLLLNAFRKSVTCENPRGLKIHQWQVPHHH  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG CGLNSDA  +LSFVD+Y G EL  + P HSI+QVIPLP+TDS EQRL
Sbjct  541   ALDENPSVLVVGTCGLNSDASGILSFVDAYKGVELNYIAPHHSISQVIPLPFTDSIEQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDVGDDYY  1488
             HLLID +G+GHLYP+ PEA+ IF+ ELGNIYWYSV+ N N+LRGH VK+N   ++GDDY 
Sbjct  601   HLLIDAEGYGHLYPKNPEAISIFQEELGNIYWYSVEVNSNVLRGHVVKKNCVPEIGDDYR  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSVVFPS+SE+IIAT+TRKL+EVVHTQAKVT+D+DV YKYISKN+LFVATV PK
Sbjct  661   FESSDLWSVVFPSDSEKIIATSTRKLSEVVHTQAKVTSDQDVSYKYISKNLLFVATVTPK  720

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             + G+IGSVIP++SWL VYL+DT+TGR+LHRM+H GSQGPVHAV SENWVVYHYFNLRAHR
Sbjct  721   STGEIGSVIPEDSWLFVYLVDTITGRVLHRMSHHGSQGPVHAVFSENWVVYHYFNLRAHR  780

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQSRADNKD+LKLVLGKHNLT  +SSY RPEV+ KSQSYFF HSVKT+AVT
Sbjct  781   YEMSVIEIYDQSRADNKDVLKLVLGKHNLTAALSSYSRPEVITKSQSYFFPHSVKTMAVT  840

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             +TAKGITS+QLLIGTIGDQVLALDKR+LDPRRTVNPTQAEKE+GIIPLTD+LPI+PQ+YV
Sbjct  841   ATAKGITSRQLLIGTIGDQVLALDKRYLDPRRTVNPTQAEKEEGIIPLTDTLPIMPQAYV  900

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGLR I+TVPAKLESTTLVFA+GVDLFFT+LAPS+TYDSLT+DFSYALLL+TIV
Sbjct  901   THALKVEGLRNIITVPAKLESTTLVFAHGVDLFFTRLAPSRTYDSLTEDFSYALLLITIV  960

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV+AIF+TWIWSE+KEL+EKWR
Sbjct  961   ALVIAIFVTWIWSERKELEEKWR  983



>ref|XP_009785843.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=981

 Score =  1484 bits (3842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 737/983 (75%), Positives = 865/983 (88%), Gaps = 4/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLL +++F S+ TTF+LYEDQVGLMDWHQ+YIGKVK  VF TQKAGRKRVVVSTE
Sbjct  1     MAIRAFLLFLILFVSS-TTFALYEDQVGLMDWHQQYIGKVKKTVFQTQKAGRKRVVVSTE  59

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+A+LDLRHG+IFWR VLG  DVID IDI LGKYV+TLSSG S LRAWNLPDGQMVWE
Sbjct  60    ENVIAALDLRHGEIFWRQVLGVNDVIDEIDITLGKYVVTLSSGGSILRAWNLPDGQMVWE  119

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL GSSPSRS+LL P+N   D+D+ IL+Y +GYLHAVS  DG+++WKK+LA +G+++ H
Sbjct  120   SFLLGSSPSRSLLLTPANFGADKDNAILVYGNGYLHAVSCIDGDILWKKDLAQKGINVHH  179

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             +VHP+ +  +YA+G+   SQF AY IN   G+LLKH S  FPGGFSGD+SL TS+K VAL
Sbjct  180   LVHPEESGMLYALGVGDRSQFEAYVINVGNGKLLKHSSTEFPGGFSGDLSLSTSDKAVAL  239

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+GSILV+I F  G I FQ+VHI+DL+Q F+G AVLLPSKL GMVA+ IN+ +LF++V 
Sbjct  240   DSSGSILVTISFVGGEIKFQEVHISDLLQGFSGVAVLLPSKLAGMVAVKINRSLLFVKVK  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG LEVVD V +   +S+SLS +EG  AFGLI+   GK+HL+VKS +DW ++ L+ES  
Sbjct  300   DEGTLEVVDTVPHVEAVSDSLSFAEGQTAFGLIQQDGGKVHLTVKSSDDWKTHFLKESVE  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D Q+GLVHKVFINNYIRTDR+YGFRALIV+EDHSLLLLQQG +VW REDGLASI+DVTT
Sbjct  360   VDQQRGLVHKVFINNYIRTDRTYGFRALIVMEDHSLLLLQQGAVVWYREDGLASIIDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEK GVSV+KVE +LFEWLKGHLLKLK TLMLATPDDVA +Q+MRL+S+ KSKMTR
Sbjct  420   SELPVEKAGVSVAKVEHSLFEWLKGHLLKLKATLMLATPDDVAVVQRMRLQSAEKSKMTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL+ALHTGDGRIVWS L+NALRKSETCE+P GLK++ WQVPHHH
Sbjct  480   DHNGFRKLLIVLTRAGKLFALHTGDGRIVWSRLLNALRKSETCESPRGLKLHPWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG CG NSDA  +LSFVD+Y G+EL    PVHSI Q+IPLP+TDSTEQRL
Sbjct  540   ALDENPSVLVVGTCGHNSDASGILSFVDAYRGEELNYFAPVHSITQIIPLPFTDSTEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDYY  1488
             HL+ID +G+GHLYPRT EA+GIF++ELGNIYWYSVD  NN+L+GH VK+N   ++ DDY 
Sbjct  600   HLIIDAEGYGHLYPRTLEAVGIFQKELGNIYWYSVDVNNNLLKGHVVKKNCKPEIADDYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSV+FPS+SE+IIAT+TRKL+EVVHTQAKV  + DV+YKYISKN+LF+ATV PK
Sbjct  660   FESSDLWSVIFPSDSEKIIATSTRKLSEVVHTQAKVVAE-DVLYKYISKNVLFLATVTPK  718

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A GDIGSVIP++SWL VYL+DT+TGR+LHRM+H G QGPVHAV SENWVVYHYFNLRAHR
Sbjct  719   AIGDIGSVIPEDSWLFVYLVDTITGRVLHRMSHHGCQGPVHAVFSENWVVYHYFNLRAHR  778

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSV+EIYDQSRADNKD+LKLVLGKHNL+ PVSSY RPEV+ KSQSYFF H+VKTIAVT
Sbjct  779   YEMSVVEIYDQSRADNKDVLKLVLGKHNLSAPVSSYSRPEVMTKSQSYFFTHTVKTIAVT  838

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NPTQAEKE+GIIPLTDSLPI+PQ+YV
Sbjct  839   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPTQAEKEEGIIPLTDSLPIMPQAYV  898

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGL+ I+T+PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DF+YALLLLTIV
Sbjct  899   THALKVEGLKSIITIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFNYALLLLTIV  958

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV+AIF+TWIWSE+KELQEKWR
Sbjct  959   ALVIAIFVTWIWSERKELQEKWR  981



>ref|XP_009597396.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=982

 Score =  1481 bits (3834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 737/983 (75%), Positives = 863/983 (88%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLL +++  S+YTTF+LYEDQVGLMDWHQ+YIGKVK AVF T KAGRKRVVVSTE
Sbjct  1     MAIRAFLLFLILLVSSYTTFALYEDQVGLMDWHQQYIGKVKKAVFQTHKAGRKRVVVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+A+LDLRHG+IFWR VLG  DVID IDIALGKYV+TLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENVIAALDLRHGEIFWRQVLGVNDVIDEIDIALGKYVVTLSSGGSILRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL GS+PSRS+LL P+N   D+D++IL+Y SGYLHAVSS DG+++WKK+LA +G+D+ H
Sbjct  121   SFLLGSNPSRSLLLTPANFGADKDNVILVYGSGYLHAVSSIDGDILWKKDLAQKGIDVHH  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             +VH + +  +YA+G+   SQF AY IN   GELLKH SM FPGGFSGD+SL TS+K VAL
Sbjct  181   LVHLEESGMLYALGVGDRSQFEAYVINVGNGELLKHSSMEFPGGFSGDLSLSTSDKAVAL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+GSILV+I F  G I FQ+VHI+DL+Q F+G AVLLPSKL GMVA+ IN+ +LF++V 
Sbjct  241   DSSGSILVTISFVGGEIKFQEVHISDLLQGFSGVAVLLPSKLAGMVAVKINRSLLFVKVK  300

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG LEVVD+V +   +S+SLS +EG  AFGLI+   GKI L+VKS +DW ++ L+ES  
Sbjct  301   DEGTLEVVDRVPHVEAVSDSLSFAEGQTAFGLIQQDGGKIRLTVKSSDDWKTHFLKESIE  360

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +GLVHKVFINNYIRTDR+YGFRALIV+EDHSLLLLQQG +VW REDGLASI+DVTT
Sbjct  361   VDQPRGLVHKVFINNYIRTDRTYGFRALIVMEDHSLLLLQQGAVVWYREDGLASIIDVTT  420

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEK GVSV+KVE NLFEWLKGHLLKLK TLMLATPDDVA +Q+MRL+S+ KSKMTR
Sbjct  421   SELPVEKAGVSVAKVEHNLFEWLKGHLLKLKATLMLATPDDVAVVQRMRLQSAEKSKMTR  480

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL+ALHTGDGRIVWS L+NA R S TCE+P GLK++QWQVPHHH
Sbjct  481   DHNGFRKLLIVLTRAGKLFALHTGDGRIVWSRLLNAFRNSGTCESPRGLKLHQWQVPHHH  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG C  NSDA  +LSFVD+Y G+EL  L PVHSI QVIPLP+TDS EQRL
Sbjct  541   ALDENPSVLVVGTCRHNSDASGILSFVDAYRGEELNYLAPVHSITQVIPLPFTDSIEQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDYY  1488
             HL+ID +G+GHLYPRT EA+GIF++ELGNIYWYSV   NN+L+GH VK+N   ++ DDY 
Sbjct  601   HLIIDAEGYGHLYPRTLEAVGIFQKELGNIYWYSVGVNNNLLKGHVVKKNCKPEIADDYC  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSV+FPS+SE++IAT+TRKL+EVVHTQAKV  + DV+YKYISKN+LF+ATV PK
Sbjct  661   FESIDLWSVIFPSDSEKVIATSTRKLSEVVHTQAKVVAE-DVLYKYISKNVLFLATVTPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A GDIGSVIP++SWL VYL+DT+TGR+LHRM+H G QGPVHAV SENWVVYHYFNLRAHR
Sbjct  720   AIGDIGSVIPEDSWLFVYLVDTITGRVLHRMSHHGCQGPVHAVFSENWVVYHYFNLRAHR  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSV+EIYDQSRADNKD+LKLVLGKHNL+ PVSSY RPEV+ KSQSYFF H+VKTIAVT
Sbjct  780   YEMSVVEIYDQSRADNKDVLKLVLGKHNLSAPVSSYSRPEVMTKSQSYFFTHTVKTIAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NPTQAEKE+GIIPLTDSLPI+PQ+YV
Sbjct  840   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPTQAEKEEGIIPLTDSLPIMPQAYV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGL+ I+T+PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DF+YALLLLTIV
Sbjct  900   THALKVEGLKSIITIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFNYALLLLTIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV+AIF+TWIWSE+KELQEKWR
Sbjct  960   ALVIAIFVTWIWSERKELQEKWR  982



>ref|XP_009759124.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=983

 Score =  1477 bits (3825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/983 (76%), Positives = 872/983 (89%), Gaps = 2/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLLL+++FSS+Y   +LYEDQVGLMDWHQ+YIGKVK+AVF TQKAGRKRVVVSTE
Sbjct  1     MAIRAFLLLLILFSSSYYAVALYEDQVGLMDWHQQYIGKVKNAVFQTQKAGRKRVVVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  D ID IDI++GKYVITLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENVIASLDLRHGEIFWRHVLGDNDTIDAIDISMGKYVITLSSGGSILRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL GS PSRS+L  P+NLK D+D++IL+Y +G LH++SS DG+++WKK+L+++ +DIQH
Sbjct  121   SFLRGSKPSRSLLWTPTNLKADKDNVILVYGNGCLHSLSSIDGDILWKKDLSHKSIDIQH  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++HP+G++ +YA+G+   SQF AY IN R GELLKH SM FPGGFSGDISLV S+K V L
Sbjct  181   LIHPEGSETIYAIGVGDLSQFEAYIINVRNGELLKHSSMSFPGGFSGDISLVASDKAVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+GS LVSI F +G I FQQV IA+LVQ  +G+AVLLPSKL GMVA+ I K + F++VT
Sbjct  241   DSSGSSLVSISFTEGEIKFQQVDIANLVQHISGSAVLLPSKLEGMVAVKIGKSLSFIKVT  300

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG+LE VD + +   +S+SL  SEG   FGLI+H    IHL++K+ NDW S+LLEES  
Sbjct  301   NEGRLEAVDTIPHVEAVSDSLPFSEGQSGFGLIQHDGTDIHLTIKTGNDWKSHLLEESFK  360

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +GLVHKVFINNYIRTDR+YGFRALIV+EDHSLLL+QQG IVW+REDGLASI+DVTT
Sbjct  361   VDQHRGLVHKVFINNYIRTDRTYGFRALIVMEDHSLLLMQQGAIVWNREDGLASIIDVTT  420

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEKDGVSV+KVE +LFEWLKGHLLKLKGTLMLATPDD+A IQ++RL+S+ KSKMTR
Sbjct  421   SELPVEKDGVSVAKVEHSLFEWLKGHLLKLKGTLMLATPDDIAVIQRLRLQSAEKSKMTR  480

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL A+HTGDGRIVWS L+NA RKS TCENP GLKI+QWQVPHHH
Sbjct  481   DHNGFRKLLIVLTRAGKLSAIHTGDGRIVWSLLLNAFRKSVTCENPRGLKIHQWQVPHHH  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG CGLNSDA  +LSF+D Y G+EL  L  +HSIAQVIPLP+TDS EQRL
Sbjct  541   ALDENPSVLVVGTCGLNSDASGILSFIDVYKGEELNYLATLHSIAQVIPLPFTDSIEQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDYY  1488
             HLLID +G+GHL+PRTPEA+ IF+ ELGNIYWYSV+  NN+LRGHAVK+N   ++GDDY 
Sbjct  601   HLLIDAEGYGHLFPRTPEAISIFQEELGNIYWYSVEVNNNVLRGHAVKKNCVSEIGDDYC  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSVVFPS+SE+IIAT+TRKLNEVVHTQAKVT+D+DV YKYISKN+LFVATV PK
Sbjct  661   FESSDLWSVVFPSDSERIIATSTRKLNEVVHTQAKVTSDQDVSYKYISKNLLFVATVTPK  720

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             + G+IGSVIP++SWL VYL+DTVTGR+LHRM+H GSQGPVHAV SENWVVYHYFNLRAHR
Sbjct  721   STGEIGSVIPEDSWLFVYLVDTVTGRVLHRMSHHGSQGPVHAVFSENWVVYHYFNLRAHR  780

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQSRADNKD+L LVLGKHNLT  +SSY RPEV+ KSQSYFF+HSVKT+AVT
Sbjct  781   YEMSVIEIYDQSRADNKDVLTLVLGKHNLTAALSSYSRPEVITKSQSYFFSHSVKTMAVT  840

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             +TAKGITS+QLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE+GIIPLTDSLPI+PQ+YV
Sbjct  841   ATAKGITSRQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEEGIIPLTDSLPIMPQAYV  900

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGLR I+TVPAKLESTTLVFA+GVDLFFT+LAPS+TYDSLT+DFSYALLL+TIV
Sbjct  901   THALKVEGLRNIITVPAKLESTTLVFAHGVDLFFTRLAPSRTYDSLTEDFSYALLLITIV  960

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV+AIF+TWIWSE+KEL+EKWR
Sbjct  961   ALVIAIFVTWIWSERKELEEKWR  983



>ref|XP_006366781.1| PREDICTED: ER membrane protein complex subunit 1-like [Solanum 
tuberosum]
Length=982

 Score =  1466 bits (3795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/983 (73%), Positives = 856/983 (87%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLL +++FSS+YT+F+LYEDQVGLMDWHQ+YIGKVK AVF TQKAGRKRVVVSTE
Sbjct  1     MAIRAFLLCIILFSSSYTSFALYEDQVGLMDWHQQYIGKVKKAVFQTQKAGRKRVVVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             EN +A+LDLRHG+IFWR +LG  DVID IDIALGKYV+TLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENAIAALDLRHGEIFWRQILGVNDVIDEIDIALGKYVVTLSSGGSVLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL GS PSRS+LL P+N   D+D++IL Y +G LHAVSS DG+++WKKELA  G+D+QH
Sbjct  121   SFLLGSKPSRSLLLTPTNFGADKDNVILAYGNGCLHAVSSIDGDILWKKELAENGIDVQH  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             +VHP+ +D +YA+G+  +SQF AY +N R GELLKH S  FPGGFSGD+SL TS+K V L
Sbjct  181   LVHPEESDTIYALGIGEASQFEAYVLNVRNGELLKHSSKGFPGGFSGDLSLPTSDKAVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+ + LVS+ F  G I FQ+  I+DL Q ++G AVLLPSKL GMVAI I++ +L +++ 
Sbjct  241   DSSETSLVSVSFVGGEIKFQEFQISDL-QGYSGEAVLLPSKLAGMVAIKIDRSLLLVKLK  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG LEVVD V +   +S+SLS +EG  AFGLI+    KI LSVKS NDW S+ L+ES  
Sbjct  300   DEGTLEVVDTVPHVEAVSDSLSFAEGQTAFGLIQQDGSKIQLSVKSSNDWKSHFLKESIE  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
              D Q+G  HKVFINNY+RTDR+YGFRALIV+EDHSLLLLQQG +VW+RED LASI+DVTT
Sbjct  360   FDQQRGHAHKVFINNYVRTDRTYGFRALIVMEDHSLLLLQQGAVVWNREDALASIIDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPV+KDGVSV+KVE NLFEWLKGHLLKLK TLMLATPDDVAA+Q++RL+SS KSKMTR
Sbjct  420   SELPVQKDGVSVAKVEHNLFEWLKGHLLKLKATLMLATPDDVAAVQRIRLQSSEKSKMTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL+ALHTGDGRIVWS L+NA  KS TCE+P G+K++QWQVPHHH
Sbjct  480   DHNGFRKLLIVLTRAGKLFALHTGDGRIVWSRLLNAFHKSGTCESPRGIKLHQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG CG NSDA  +LSFVD+Y G+EL  L PVHSI QVIPL +TDSTEQRL
Sbjct  540   ALDENPSVLVVGTCGHNSDASGILSFVDAYKGEELNYLVPVHSITQVIPLLFTDSTEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYY  1488
             HL+ID +G+GHLYPRTPEA+ IF++ELG+IYWYSVD  NN+L+GH VK+N  +++ DDY 
Sbjct  600   HLIIDAEGYGHLYPRTPEAVDIFQKELGSIYWYSVDINNNLLKGHVVKKNCKEEIADDYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSV+FPS+SE+IIAT+TRKL+EVVHTQAKV  D+DV+YKYISKN+LF+ATV PK
Sbjct  660   FESSDLWSVIFPSDSEKIIATSTRKLSEVVHTQAKVNADQDVLYKYISKNLLFLATVTPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A GDIGSV P++SWL VYL+DT+TGR+L RM+H G QGPVHAV SENWVVYHYFNLRAHR
Sbjct  720   AMGDIGSVTPEDSWLFVYLVDTITGRVLLRMSHHGCQGPVHAVFSENWVVYHYFNLRAHR  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSV+EIYDQSRADNKD+LKLVLGKHNL+ PVSSY RPE++ KSQSYFF HSVK +AVT
Sbjct  780   YEMSVVEIYDQSRADNKDVLKLVLGKHNLSAPVSSYSRPEIMTKSQSYFFTHSVKAVAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NPTQAEKE+GI+PLTD+LPI+PQ++V
Sbjct  840   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPTQAEKEEGIMPLTDTLPIMPQAFV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGLR I+ +PAKLESTTL+FA+GVDLFFT+LAPSKTYDSLTDDF+YALLLLTIV
Sbjct  900   THALKVEGLRSIIAIPAKLESTTLIFAHGVDLFFTRLAPSKTYDSLTDDFNYALLLLTIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV+++F+TWIWSE+K+LQEKWR
Sbjct  960   ALVISLFVTWIWSERKDLQEKWR  982



>ref|XP_010325953.1| PREDICTED: ER membrane protein complex subunit 1 [Solanum lycopersicum]
Length=982

 Score =  1457 bits (3772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/983 (73%), Positives = 857/983 (87%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLL +++FSS+YT+F+LYEDQVGLMDWHQ+YIGKVK AVF TQKAGRKRVVVSTE
Sbjct  1     MAIRAFLLCIILFSSSYTSFALYEDQVGLMDWHQQYIGKVKKAVFQTQKAGRKRVVVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             EN +A+LDLRHG+IFWR +LG  DVID IDIALGKY++TLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENAIAALDLRHGEIFWRQILGVNDVIDEIDIALGKYLVTLSSGGSVLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL GS PSRS+L  P+N   D+D++IL Y +G LHAVSS DG+++WKKELA   +D+QH
Sbjct  121   SFLLGSKPSRSLLFTPTNFGADKDNVILAYGNGCLHAVSSIDGDILWKKELAENSIDVQH  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             +VHP+ +D +YA+G+  +SQF AY IN R GELLKH S  F GGFSGD+SL TS+KVV L
Sbjct  181   LVHPEESDTIYALGIGEASQFEAYVINVRNGELLKHSSKGFAGGFSGDLSLPTSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+ S LVSI F  G I FQ+  I+DL Q ++G AVLLPSKL GMVAI I++ +LF+++ 
Sbjct  241   DSSKSSLVSISFVGGEIKFQEFQISDL-QGYSGEAVLLPSKLAGMVAIKIDRSLLFVKLK  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG LEVVD V +   +S+SLS +EG  AF LI+    KI L++KS NDW S+ L+ES  
Sbjct  300   DEGTLEVVDTVPHVEAVSDSLSFAEGQTAFALIQQDGAKIQLTIKSSNDWKSHFLKESIE  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
              D Q+GLVHKVFINNY+RTDR+YGFRALIV+EDHSLLLLQQG +VW+RED LASI+DVTT
Sbjct  360   FDQQRGLVHKVFINNYVRTDRTYGFRALIVMEDHSLLLLQQGAVVWNREDALASIIDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPV+KDGVSV+KVE NLFEWLKGHLLKLK TLMLATPDDVAA+Q++RL+S+ KSKMTR
Sbjct  420   SELPVQKDGVSVAKVEHNLFEWLKGHLLKLKATLMLATPDDVAAVQRIRLQSAEKSKMTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GKL+ALHTGDGRIVWS L+NA  KS TCE+P G+K++QWQVPHHH
Sbjct  480   DHNGFRKLLIVLTRAGKLFALHTGDGRIVWSRLLNAFHKSGTCESPRGIKLHQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG CG NSDA  +LSFVD+Y G+EL  L PVHSI Q+IPLP+TDSTEQRL
Sbjct  540   ALDENPSVLVVGTCGHNSDASGILSFVDAYKGEELNYLAPVHSITQIIPLPFTDSTEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYY  1488
             HL+ID++G+GHLYPRTPEA+ IF++ELGNIYWYSVD  NN+L+GH VK+N  +++ DDY 
Sbjct  600   HLIIDSEGYGHLYPRTPEAVDIFQKELGNIYWYSVDINNNLLKGHVVKKNCKEEISDDYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F +  +WSV+ PS+SE+IIAT+TRK +EVVHTQAKV  D++V+YKYISKN+LF+ATV PK
Sbjct  660   FESSDLWSVIIPSDSEKIIATSTRKFSEVVHTQAKVNADQNVLYKYISKNLLFLATVTPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A GDIGSVIPD+SWL VYL+DT+TGR+L RM+H G QGPVHAV SENWVVYHYFNLRAHR
Sbjct  720   AMGDIGSVIPDDSWLFVYLVDTITGRVLLRMSHHGCQGPVHAVFSENWVVYHYFNLRAHR  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSV+EIYDQSRADNKD+LKLVLGKHNL+ PVSSY RPE++ KSQSYFF HSVK +AVT
Sbjct  780   YEMSVVEIYDQSRADNKDVLKLVLGKHNLSAPVSSYSRPEIMTKSQSYFFTHSVKAVAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQVLALDKRFLDPRR++NPTQAEKE+GI+PLTD+LPI+PQ++V
Sbjct  840   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRSLNPTQAEKEEGIMPLTDTLPIMPQAFV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGLR I+ +PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLTDDF+YALLLLTIV
Sbjct  900   THALKVEGLRSIIAIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTDDFNYALLLLTIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV++IF+TWIWSE+K+LQEKWR
Sbjct  960   ALVISIFVTWIWSERKDLQEKWR  982



>ref|XP_007012092.1| Catalytics isoform 1 [Theobroma cacao]
 gb|EOY29711.1| Catalytics isoform 1 [Theobroma cacao]
Length=988

 Score =  1451 bits (3756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 723/964 (75%), Positives = 839/964 (87%), Gaps = 2/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
              SLYEDQVGLMDWHQ++IGKVK AVFHTQK GRKRVVVSTEENV+ASLDLRHG+IFWRHV
Sbjct  25    LSLYEDQVGLMDWHQQFIGKVKQAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHV  84

Query  3224  LGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             L   DVIDGIDIA+GKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LLV +NL
Sbjct  85    LATNDVIDGIDIAIGKYVITLSSGGSILRAWNLPDGQMVWESSLQGPKHSKSLLLVLTNL  144

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             KVD+D++++++++G LHAVSS DGEV+WKK+   E LD+Q ++ P G+D VY VG  +SS
Sbjct  145   KVDKDNVVIVFTNGRLHAVSSIDGEVLWKKDFEAESLDVQQVIQPPGSDLVYVVGFAASS  204

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             QF  Y+INAR GELLKHES  F GGF G++SLV+SE +VALDSTGSIL++I   +G I+F
Sbjct  205   QFEMYQINARNGELLKHESAAFSGGFLGEVSLVSSETLVALDSTGSILLTISSHNGKISF  264

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
             QQ  I++LV D  G AV+ PS +TG+ ++ +N   +F+RV  EGKLEV++K      +S+
Sbjct  265   QQTPISNLVGDSLGPAVITPSSVTGIFSLKVNAITIFIRVIGEGKLEVLEKTNLKTAVSD  324

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +LS+SEG QAF LI+H   +IHL+VK  +DW  NLL+ES  +D Q+GLVHKVFINNYIRT
Sbjct  325   ALSISEGKQAFALIQHAGSEIHLTVKPADDWDGNLLKESIKMDRQRGLVHKVFINNYIRT  384

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRSYGFR LIV+EDHSLLLLQQGEIVWSREDGLASI+DVTTSELPVEKDGVSV+KVE NL
Sbjct  385   DRSYGFRVLIVMEDHSLLLLQQGEIVWSREDGLASIIDVTTSELPVEKDGVSVAKVEHNL  444

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
             FEWLKGH+LKLKGTLMLA+P+D+AAIQ MRLKSS KSKMTRDHNGFRKLLIVL+R+GKL+
Sbjct  445   FEWLKGHMLKLKGTLMLASPEDMAAIQSMRLKSSEKSKMTRDHNGFRKLLIVLTRAGKLF  504

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALHTGDGRIVWS L+ +L K + C++  GL +YQWQVPHHHAMDENPSVLVVG+CG + D
Sbjct  505   ALHTGDGRIVWSHLLQSLHKPQACQHLIGLNLYQWQVPHHHAMDENPSVLVVGRCGPSLD  564

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
             AP VLSFVD+YTGKEL  L   HS+AQVIPLPYTDSTEQRLHLLID D H HLYP+TPEA
Sbjct  565   APGVLSFVDTYTGKELSSLSLAHSVAQVIPLPYTDSTEQRLHLLIDADQHAHLYPKTPEA  624

Query  1607  LGIFKRELGNIYWYSV-DANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +GIF+RE  NIYWYSV D N I++G+A+K     +V D++ F ++ +WSVVFPSESE+II
Sbjct  625   IGIFQREFSNIYWYSVEDDNGIIKGYALKSKCTSEVADEFCFDSRELWSVVFPSESEKII  684

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             AT TRKLNEVVHTQAKV  D+DVMYKY+S+N+LFVAT APKA+G+IGSV P+ESWL+ YL
Sbjct  685   ATVTRKLNEVVHTQAKVIADQDVMYKYLSRNLLFVATAAPKASGEIGSVTPEESWLVAYL  744

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             IDTVTGRILHR+TH GSQGPVHAV SENWVVYHYFNLRAHRYEMSVIEIYDQSRAD+KD+
Sbjct  745   IDTVTGRILHRVTHHGSQGPVHAVFSENWVVYHYFNLRAHRYEMSVIEIYDQSRADDKDV  804

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KLVLGKHNLT P+SSY RPEV+ KSQSYFF HS+K+IAVTSTAKGITSKQLLIGTIGDQ
Sbjct  805   WKLVLGKHNLTSPISSYSRPEVITKSQSYFFTHSLKSIAVTSTAKGITSKQLLIGTIGDQ  864

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             VLALDKRFLDPRR+VNPTQAEKE+GIIPLTDSLPIIPQSYVTHA++ EGL+GIVTVPAKL
Sbjct  865   VLALDKRFLDPRRSVNPTQAEKEEGIIPLTDSLPIIPQSYVTHALRVEGLQGIVTVPAKL  924

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL+TIVALV AIF+TWI SE+KELQ
Sbjct  925   ESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLLITIVALVAAIFVTWILSERKELQ  984

Query  530   EKWR  519
             EKWR
Sbjct  985   EKWR  988



>ref|XP_002284012.1| PREDICTED: ER membrane protein complex subunit 1 [Vitis vinifera]
 emb|CBI20872.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =  1449 bits (3752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 736/986 (75%), Positives = 855/986 (87%), Gaps = 4/986 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLI-FSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             AMA R FLLL+L+  SS   +FSLYEDQVGLMDWHQ+YIGKVKHAVFHTQKAGRKRVVVS
Sbjct  2     AMATRVFLLLLLVLISSPSPSFSLYEDQVGLMDWHQQYIGKVKHAVFHTQKAGRKRVVVS  61

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLR GDIFWRHVLG  D +D IDIALGKYVITLSS GS LRAWNLPDGQMV
Sbjct  62    TEENVIASLDLRRGDIFWRHVLGPNDAVDEIDIALGKYVITLSSEGSILRAWNLPDGQMV  121

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL G  PS+S+L V +NLK+D+D++I ++  G LHAVSS DGEV+WKK+ A+E L++
Sbjct  122   WESFLQGPKPSKSLLSVSANLKIDKDNVIFVFGKGCLHAVSSIDGEVLWKKDFADESLEV  181

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q I+HP G+D +YAVG    SQ  AY+IN R GE+LKH S  FPGGF G++SLV+S+ +V
Sbjct  182   QQIIHPLGSDMIYAVGFVGLSQLDAYQINVRNGEVLKHRSAAFPGGFCGEVSLVSSDTLV  241

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
             ALD+T S L+SI F DG I+ QQ HI++LV D  G AV+LPSKL+GM+ I I+ +++F+R
Sbjct  242   ALDATRSSLISISFLDGEISLQQTHISNLVGDSFGMAVMLPSKLSGMLMIKIDNYMVFVR  301

Query  2570  VTYEGKLEVVDKV-AYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEE  2394
             V  EGKLEV +K+    A +S++L+LSEG QAFGL++HG  KIHL+VK +NDW  +LL+E
Sbjct  302   VADEGKLEVAEKINDAAAAVSDALALSEGQQAFGLVEHGGNKIHLTVKLVNDWNGDLLKE  361

Query  2393  SSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVD  2214
             S  +D Q+G VHK+FIN+YIRTDRS+GFRALIV+EDHSLLLLQQGEIVWSREDGLASI+D
Sbjct  362   SIRMDHQRGCVHKIFINSYIRTDRSHGFRALIVMEDHSLLLLQQGEIVWSREDGLASIID  421

Query  2213  VTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK  2034
             VT SELPVEK+GVSV+KVE NLFEWLKGH+LKLKGTLMLA+P+D+ AIQ MRLKSS KSK
Sbjct  422   VTASELPVEKEGVSVAKVEHNLFEWLKGHMLKLKGTLMLASPEDMIAIQGMRLKSSEKSK  481

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVP  1854
             MTRDHNGFRKLLIVL+R+GKL+ALHTGDGR+VWS L+++L  SE C  P GL +YQWQVP
Sbjct  482   MTRDHNGFRKLLIVLTRAGKLFALHTGDGRVVWSVLLHSLHNSEACAYPTGLNVYQWQVP  541

Query  1853  HHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTE  1674
             HHHAMDENPSVLVVG+CGL SDAP VLSFVD+YTGKEL  L   HSI ++IPL +TDS E
Sbjct  542   HHHAMDENPSVLVVGRCGLGSDAPGVLSFVDTYTGKELDSLFLTHSIERIIPLSFTDSRE  601

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGD  1497
             QRLHL+IDTD H HLYPRTPEA+GIF+ EL NIYWYSV+A N I+RGHA+K N     GD
Sbjct  602   QRLHLIIDTDHHAHLYPRTPEAIGIFQHELPNIYWYSVEAENGIIRGHALKSNCILQEGD  661

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
             +Y F T+ +WS+VFPSESE+I+AT TRKLNEVVHTQAKV TD+DVMYKY+SKN+LFVATV
Sbjct  662   EYCFDTRDLWSIVFPSESEKILATVTRKLNEVVHTQAKVITDQDVMYKYVSKNLLFVATV  721

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             APKA G+IGSV P+ESWL+VYLIDTVTGRI++RMTH G+QGPVHAV SENWVVYHYFNLR
Sbjct  722   APKATGEIGSVTPEESWLVVYLIDTVTGRIIYRMTHHGTQGPVHAVFSENWVVYHYFNLR  781

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             AHRYEMSV+EIYDQSRADNKD+ KLVLGKHNLT PVSSY RPEV+ KSQ YFF HSVK +
Sbjct  782   AHRYEMSVVEIYDQSRADNKDVWKLVLGKHNLTSPVSSYSRPEVITKSQFYFFTHSVKAM  841

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
             AVTSTAKGITSKQLLIGTIGDQVLALDKR+LDPRRT+NP+Q+E+E+GIIPLTDSLPIIPQ
Sbjct  842   AVTSTAKGITSKQLLIGTIGDQVLALDKRYLDPRRTINPSQSEREEGIIPLTDSLPIIPQ  901

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  597
             SYVTH +K EGLRGIVT PAKLESTTLVFAYGVDLFFT++APS+TYD LTDDFSYALLL+
Sbjct  902   SYVTHNLKVEGLRGIVTAPAKLESTTLVFAYGVDLFFTRIAPSRTYDLLTDDFSYALLLI  961

Query  596   tivalvvaifiTWIWSEQKELQEKWR  519
             TIVALV AIF+TWI SE+KELQEKWR
Sbjct  962   TIVALVAAIFVTWILSERKELQEKWR  987



>ref|XP_008220058.1| PREDICTED: ER membrane protein complex subunit 1 [Prunus mume]
Length=988

 Score =  1446 bits (3744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/961 (75%), Positives = 837/961 (87%), Gaps = 2/961 (0%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVGLMDWHQ+YIGKVK AVFHTQK+GR+RVVVSTEENV+ASLDLRHG+IFWRHVLG 
Sbjct  28    YEDQVGLMDWHQQYIGKVKGAVFHTQKSGRRRVVVSTEENVIASLDLRHGEIFWRHVLGS  87

Query  3215  KDVIDGIDIALGKYVITLSSGS-TLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  3039
              D+IDGIDIALGKYVITLSSG   LRAWNLPDGQMVWESFL GS  S+S+L VP+NLKVD
Sbjct  88    NDIIDGIDIALGKYVITLSSGGGILRAWNLPDGQMVWESFLEGSGASKSLLTVPTNLKVD  147

Query  3038  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  2859
             +D+LIL++  G LHA+SS DGEV+WKKE+A E +++Q I+ P GTD +Y +G   SSQF 
Sbjct  148   KDNLILVFGKGSLHAISSIDGEVLWKKEIAPESVEVQQIIQPLGTDIIYVLGFFGSSQFD  207

Query  2858  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQV  2679
             AYKINAR GELLKH S  F GGFSG+  +V+SE +V LDST + LV I F+DG IN+QQ 
Sbjct  208   AYKINARNGELLKHNSATFSGGFSGEALVVSSEILVTLDSTRTKLVIISFQDGEINYQQT  267

Query  2678  HIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS  2499
             HI+D+ +D  G  VLLPSKL G+ ++ I+  V+F+RVT EGKL+V+DK+   A IS+++S
Sbjct  268   HISDIFRDSFGTPVLLPSKLPGVFSVKIDGAVVFIRVTGEGKLQVLDKINNVAAISDAIS  327

Query  2498  LSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRS  2319
             LSEG QAF LI+HG GKIHL+VK  +D   +LL+ES  +D+Q+G VHK+FINNYIRTDRS
Sbjct  328   LSEGQQAFALIQHGDGKIHLTVKPSHDLSGDLLKESIDMDNQRGTVHKIFINNYIRTDRS  387

Query  2318  YGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEW  2139
             +GFRALIV+EDHSLLLLQQG +VWSREDGLASIVDV TSELPVEK+GVSV+KVEQNLFEW
Sbjct  388   HGFRALIVMEDHSLLLLQQGAVVWSREDGLASIVDVVTSELPVEKEGVSVAKVEQNLFEW  447

Query  2138  lkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALH  1959
             LKGH+LKLKGTLMLA+ +DVAAIQ+MRLKS  KSKMTRDHNGFRKLLIVL+R+GKL+ALH
Sbjct  448   LKGHILKLKGTLMLASAEDVAAIQEMRLKSFEKSKMTRDHNGFRKLLIVLTRAGKLFALH  507

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPS  1779
             TG G++VWS L+  LR SETCE P GL IYQWQVPHHHA+DENPSVLVVG+CG NSDAP 
Sbjct  508   TGYGQVVWSLLLPTLRSSETCEYPTGLNIYQWQVPHHHALDENPSVLVVGRCGKNSDAPG  567

Query  1778  VLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGI  1599
             VLS VD+YTGKE+  +  +HSIAQVIPLP+TDSTEQRLHLLID + HGHLYPRT EA+ I
Sbjct  568   VLSIVDAYTGKEINSMAAIHSIAQVIPLPFTDSTEQRLHLLIDVNQHGHLYPRTSEAIDI  627

Query  1598  FKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
             F+REL NIYWYSV+A+N I++GH +K N  ++V D+Y F +K +WS+VFPS+SE+IIAT 
Sbjct  628   FQRELTNIYWYSVEADNGIIKGHVLKSNCIQEVIDNYCFESKDIWSIVFPSDSERIIATV  687

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
             TRKL+EVVHTQAK   D DVM+KYISKN+LFVATVAPK +G IG+  P+ESWL VYLIDT
Sbjct  688   TRKLSEVVHTQAKAIADEDVMFKYISKNLLFVATVAPKGSGPIGTATPEESWLTVYLIDT  747

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             VTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD+ KL
Sbjct  748   VTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDVWKL  807

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
             VLGKHNLT P+SSY RPEV+ KSQSYFF +SVK +AVT TAKGITSKQ+LIGTIGDQVLA
Sbjct  808   VLGKHNLTSPISSYSRPEVVTKSQSYFFTYSVKALAVTLTAKGITSKQVLIGTIGDQVLA  867

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             LDKRFLDPRR+VNPT AEKE+GIIPLTDSLPIIPQSYVTHA+K EGLRGIVTVPAKLEST
Sbjct  868   LDKRFLDPRRSVNPTTAEKEEGIIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAKLEST  927

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKW  522
             TL FAYGVDLFFTQLAPS+TYDSLTDDFSYALLL+TIVAL+ AIF+TWI SE+KEL+EKW
Sbjct  928   TLAFAYGVDLFFTQLAPSRTYDSLTDDFSYALLLITIVALIAAIFVTWILSEKKELREKW  987

Query  521   R  519
             R
Sbjct  988   R  988



>ref|XP_007227052.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
 gb|EMJ28251.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
Length=983

 Score =  1442 bits (3733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/961 (75%), Positives = 834/961 (87%), Gaps = 2/961 (0%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVGLMDWHQ+YIGKVK AVFHTQK+GR+RVVVSTEENV+ASLDLRHG+IFWRHVLG 
Sbjct  23    YEDQVGLMDWHQQYIGKVKGAVFHTQKSGRRRVVVSTEENVIASLDLRHGEIFWRHVLGS  82

Query  3215  KDVIDGIDIALGKYVITLSSGS-TLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  3039
              DVIDGIDIALGKYVITLSSG   LRAWNLPDGQMVWESFL GS  S+S+L VP+NLKVD
Sbjct  83    NDVIDGIDIALGKYVITLSSGGGILRAWNLPDGQMVWESFLEGSGASKSLLTVPTNLKVD  142

Query  3038  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  2859
             +D+LIL++  G LHA+SS DGEV+WKKE+A E +++Q I+ P G+D +Y +G   SSQF 
Sbjct  143   KDNLILVFGKGSLHAISSIDGEVLWKKEIAPESVEVQQIIQPLGSDIIYVLGFFGSSQFD  202

Query  2858  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQV  2679
             AYKINAR GELLKH S  F GGFS +  +V+SE +V LDST S LV I F+DG IN+QQ 
Sbjct  203   AYKINARNGELLKHNSATFSGGFSSEALVVSSEILVTLDSTRSKLVIISFQDGEINYQQT  262

Query  2678  HIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS  2499
             HI+D+  D  G  VLLPSKL GM ++ I+  V+F+RVT EGKLEV+DK+   A IS+++S
Sbjct  263   HISDIFGDSLGTPVLLPSKLPGMFSVKIDGAVVFIRVTGEGKLEVLDKINNVAAISDAIS  322

Query  2498  LSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRS  2319
             LSEG QAF LI+HG GKIHL+VK  +D   +LL+ES  +D+Q+G VHK+FINNYIRTDRS
Sbjct  323   LSEGQQAFALIQHGDGKIHLTVKPSHDLSGDLLKESIDMDNQRGTVHKIFINNYIRTDRS  382

Query  2318  YGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEW  2139
             +GFRALIV+EDHSLLLLQQG IVWSREDGLASIVDV TSELPVEK+GVSV+KVEQNLFEW
Sbjct  383   HGFRALIVMEDHSLLLLQQGAIVWSREDGLASIVDVVTSELPVEKEGVSVAKVEQNLFEW  442

Query  2138  lkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALH  1959
             LKGH+LKLKGTLMLA+ +DVAAIQ+MRLKS  KSKMTRDHNGFRKLLIVL+R+GKL+ALH
Sbjct  443   LKGHILKLKGTLMLASAEDVAAIQEMRLKSFEKSKMTRDHNGFRKLLIVLTRAGKLFALH  502

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPS  1779
             TG G++VWS L+  LR+SETCE P GL IY WQVPHHHA+DENPSVLVVG+CG NSDAP 
Sbjct  503   TGYGQVVWSLLLPTLRRSETCEYPTGLNIYHWQVPHHHALDENPSVLVVGRCGKNSDAPG  562

Query  1778  VLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGI  1599
             VLS VD+YTGKE+  +  +HS+AQVIPLP+TDSTEQRLHLLID + HGHLYPRT EA+ I
Sbjct  563   VLSIVDAYTGKEINSMAAIHSVAQVIPLPFTDSTEQRLHLLIDVNQHGHLYPRTSEAIDI  622

Query  1598  FKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
             F+REL NIYWYSV+A+N I++GH +K N  ++V D+Y F +K +WS+VFPS+SE+IIAT 
Sbjct  623   FQRELTNIYWYSVEADNGIIKGHVLKSNCIQEVIDNYCFESKDIWSIVFPSDSERIIATV  682

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
              RKL+EVVHTQAK   D DVM+KYISKN+LFVATVAPK +G IG+  P+ESWL VYLIDT
Sbjct  683   IRKLSEVVHTQAKAIADEDVMFKYISKNLLFVATVAPKGSGPIGTATPEESWLTVYLIDT  742

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             VTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD+ KL
Sbjct  743   VTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDVWKL  802

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
             VLGKHNLT P+SSY RPEV+ KSQSYFF +SVK +AVT TAKGITSKQ+LIGTIGDQVLA
Sbjct  803   VLGKHNLTSPISSYSRPEVVTKSQSYFFTYSVKALAVTLTAKGITSKQVLIGTIGDQVLA  862

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             LDKRFLDPRR+VNPT AEKE+GIIPLTDSLPIIPQSYVTHA+K EGLRGIVTVPAKLEST
Sbjct  863   LDKRFLDPRRSVNPTTAEKEEGIIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAKLEST  922

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKW  522
             TL FAYGVDLFFTQLAPS+TYDSLTDDFSYALLL+TIVAL+ AIF+TWI SE+KEL+EKW
Sbjct  923   TLAFAYGVDLFFTQLAPSRTYDSLTDDFSYALLLITIVALIAAIFVTWILSEKKELREKW  982

Query  521   R  519
             R
Sbjct  983   R  983



>ref|XP_011094459.1| PREDICTED: ER membrane protein complex subunit 1 [Sesamum indicum]
Length=982

 Score =  1439 bits (3724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/983 (72%), Positives = 847/983 (86%), Gaps = 5/983 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIRAFLLL++ F+S+   +SLYEDQVGLMDWHQ+YIGKVKHAVFHTQKA RKRV+VSTE
Sbjct  3     MAIRAFLLLLMFFASSDPAYSLYEDQVGLMDWHQQYIGKVKHAVFHTQKAARKRVIVSTE  62

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  D ID ID+ALGKYVITLSSG S LRAWNLPDGQMVWE
Sbjct  63    ENVVASLDLRHGEIFWRHVLGPNDAIDQIDVALGKYVITLSSGGSVLRAWNLPDGQMVWE  122

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             S L GS+PS+ +LL+P+NLKVD+D++I +Y +G++HAV+S DGEVIWKKELA+EG+D+Q 
Sbjct  123   STLIGSTPSKPLLLIPTNLKVDKDNMIFVYGNGFIHAVASIDGEVIWKKELASEGIDVQQ  182

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             +++PDG++ +YAVGL   S F  +++N + GELLKH +M+FP GFSGD+S VT +  VAL
Sbjct  183   LIYPDGSEIIYAVGLLGFSGFDVFQLNVKSGELLKHNNMLFPAGFSGDLSFVTDDTAVAL  242

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST  +LV I F+DG I+F Q H++ L++D +GAA ++PSK+ GM  + I+  V+F+ V 
Sbjct  243   DSTRKVLVVICFQDGKISFHQTHVSQLIEDISGAAAIVPSKIPGMFTLKIDASVIFIEVI  302

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              E KL+VV K+ +   +S+SLSL EG +A  LI+HG GKI L+VK  NDW SNL+EE+  
Sbjct  303   NESKLKVVHKIGHENAVSDSLSLPEGQKAVALIQHGDGKILLTVKLGNDWTSNLIEETIQ  362

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D Q+GLVHKVFIN+Y+RTDRS GFR LIV+EDHSLLLLQQGEIVWSREDGLAS++DV  
Sbjct  363   MDHQRGLVHKVFINSYVRTDRSNGFRVLIVMEDHSLLLLQQGEIVWSREDGLASVIDVKA  422

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEKD VSV+KVE +LFEWLKGHLLKLKGTLM+ATPDDV AIQ++RL+SS KSKMTR
Sbjct  423   SELPVEKDSVSVAKVEHSLFEWLKGHLLKLKGTLMIATPDDVVAIQKIRLQSSEKSKMTR  482

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GK++ALHTGDGRIVWS L+N+LRKSE CENP G+ ++QWQ PHHH
Sbjct  483   DHNGFRKLLIVLTRAGKVFALHTGDGRIVWSRLLNSLRKSEACENPRGISLHQWQDPHHH  542

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG+CG NSD+  VLS VD+YTG+E   + P+HSIA +IPL +TDS EQRL
Sbjct  543   ALDENPSVLVVGRCGYNSDSAGVLSIVDTYTGEERSHIGPIHSIAHIIPLHFTDSMEQRL  602

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HLL+D + H HLYPRT EALG       NIYWY+ + +  ILRG+ ++ N   +V DD+ 
Sbjct  603   HLLVDANQHAHLYPRTAEALGXXXX---NIYWYAAETDKGILRGYGLQTNCVLEVADDFC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +WS+VFPSESE+I ATATR LNEVVHTQAKVT D++VMYKYISKN+LF+ATVAPK
Sbjct  660   FDTRDLWSIVFPSESEKIAATATRSLNEVVHTQAKVTADQEVMYKYISKNLLFLATVAPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A G IGSV PDES L+VY+IDTVTGRILHRMTH GSQGP+ AV SENW+VYHYFNLRAHR
Sbjct  720   AVGPIGSVTPDESSLVVYVIDTVTGRILHRMTHHGSQGPIKAVFSENWIVYHYFNLRAHR  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQ+RA+NKD+LKLV G HNLT P+++Y RPEV  KSQSYFFAHSVKT+AVT
Sbjct  780   YEMSVIEIYDQARAENKDVLKLVFGTHNLTSPITAYSRPEVFTKSQSYFFAHSVKTMAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQ+L+GTIGDQVLALDKRFLDPRRTVNPTQAEKE+GIIPLTDSLPIIPQSYV
Sbjct  840   STAKGITSKQVLLGTIGDQVLALDKRFLDPRRTVNPTQAEKEEGIIPLTDSLPIIPQSYV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K EGLRGI T+PAKLESTTLVFAYGVDLFFT+LAPS+TYDSLT+DFSYALLL+TIV
Sbjct  900   THALKVEGLRGIATIPAKLESTTLVFAYGVDLFFTRLAPSRTYDSLTEDFSYALLLITIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             AL+VAIF+TW+WSE+KELQEKWR
Sbjct  960   ALLVAIFVTWVWSEKKELQEKWR  982



>emb|CDP15321.1| unnamed protein product [Coffea canephora]
Length=987

 Score =  1438 bits (3723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/984 (73%), Positives = 853/984 (87%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             A+ IR  LL +   S ++ TFSLY+DQVGLMDWHQ+YIGKVKHAVFHTQKAGRKRVVVST
Sbjct  4     AIRIRVLLLFLFFLSLSHLTFSLYQDQVGLMDWHQQYIGKVKHAVFHTQKAGRKRVVVST  63

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVW  3108
             EENV+ASLDLR G+IFWRHVLG  D ++ +DIALGKYVITLSSG   LRAWNLPDGQM+W
Sbjct  64    EENVIASLDLRRGEIFWRHVLGSNDTVNELDIALGKYVITLSSGGKYLRAWNLPDGQMIW  123

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS+ SRSIL +P+NLKV +D LIL Y SG L+AVSS DGEV+W K+LA+EG+D+Q
Sbjct  124   ESFLPGSTASRSILSIPTNLKVGKDDLILAYGSGSLYAVSSIDGEVLWTKDLASEGIDVQ  183

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++H  G++ +YA+G   SS F  ++INA+ GELLKH+ + F GGF GDIS + S+  VA
Sbjct  184   QLIHRHGSNIIYALGFIGSSHFATFEINAKNGELLKHDKVRFTGGFCGDISFLKSDTAVA  243

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST S LVS+ F+DG I+ +QVHI+DL+ D +G A +LP KL  MVA+ + +F++F+++
Sbjct  244   LDSTRSSLVSVRFRDGEISIEQVHISDLLLDSSGVAAILPYKLIEMVAVKVKEFIIFVKL  303

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EGK  VVD++ + A+IS+SLS+ E  QA  LI+HG  KI L+VK ++DW ++L++E+ 
Sbjct  304   TNEGKFVVVDQIDHTAIISDSLSILEDQQAIALIQHGDNKIQLTVKLVSDWSNHLIKETI  363

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D Q+GL  ++F+NNY+RTDRS GFRALIV+EDHSLLL+QQGEIVWSREDGLASIV+VT
Sbjct  364   YMDCQRGLAQRIFLNNYVRTDRSSGFRALIVMEDHSLLLVQQGEIVWSREDGLASIVEVT  423

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELP+EKD VSV+ VE +L EWLKGH+LKLKGTLMLA PDD+AAIQ++R++SS KSKMT
Sbjct  424   TSELPLEKDSVSVATVEHSLLEWLKGHVLKLKGTLMLANPDDIAAIQKLRVQSSEKSKMT  483

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL+IVL+R+GKL+ALHTGDG+IVWS L+N+LRKS+TCE PN L ++QWQVPHH
Sbjct  484   RDHNGFRKLIIVLTRAGKLFALHTGDGQIVWSVLLNSLRKSQTCEAPNVLTLHQWQVPHH  543

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LV+G+CG N D+P V S VD+YTGKEL  + P HSI Q+IPLP+TDS EQR
Sbjct  544   HALDENPSILVLGRCGPNLDSPGVYSIVDAYTGKELNSVGPFHSIVQIIPLPHTDSREQR  603

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHLLID D H HLYPR+PEAL IF+RE+GNIYWYSV+A+N ILRGHA KEN    + D+Y
Sbjct  604   LHLLIDKDWHAHLYPRSPEALAIFQREVGNIYWYSVEADNGILRGHAAKENCILQLPDEY  663

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +WS+VFPSESE+IIATATRKLNE VHTQAKV  D+DVMYKYISKN+LF+ATVAP
Sbjct  664   CFGTRNLWSIVFPSESERIIATATRKLNEAVHTQAKVVADQDVMYKYISKNLLFIATVAP  723

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             +AAGDIGSV PDESWL+VYL+DT+TGRILHRMTH GSQGPVHAV+SENWVVYHYFNLRAH
Sbjct  724   QAAGDIGSVTPDESWLVVYLVDTITGRILHRMTHYGSQGPVHAVVSENWVVYHYFNLRAH  783

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRADNKD+LKLVLGKHNLT  +S+Y R EV+ K QSYFF+HSVK I+ 
Sbjct  784   RYEMSVIEIYDQSRADNKDVLKLVLGKHNLTSAISAYTRTEVVTKQQSYFFSHSVKAIST  843

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGT+GDQVLALDKRFLDPRRT+NPTQAEKE+GIIPLTDSLPIIPQSY
Sbjct  844   TSTAKGITSKQLLIGTVGDQVLALDKRFLDPRRTLNPTQAEKEEGIIPLTDSLPIIPQSY  903

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTHA+K EGLRGIVTVPAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DFSYALLL+TI
Sbjct  904   VTHALKVEGLRGIVTVPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFSYALLLITI  963

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALVVAIF+TWI SE+KELQEKWR
Sbjct  964   VALVVAIFVTWILSERKELQEKWR  987



>gb|KDP34198.1| hypothetical protein JCGZ_07769 [Jatropha curcas]
Length=985

 Score =  1434 bits (3713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/983 (73%), Positives = 835/983 (85%), Gaps = 2/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             +AIR F++ + + S+  +T SLYEDQVGLMDWHQ+YIGKVK AVFHTQK GRKRVVVSTE
Sbjct  3     VAIRVFIISLFLLSTITSTLSLYEDQVGLMDWHQQYIGKVKDAVFHTQKTGRKRVVVSTE  62

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  DVIDGIDIALGKYVITLSS GS LRAWNLPDGQMVWE
Sbjct  63    ENVIASLDLRHGEIFWRHVLGTDDVIDGIDIALGKYVITLSSEGSILRAWNLPDGQMVWE  122

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL G + S+S+LLVP++LKVD+D++IL++  G LHAVSS  GE++WKK+ + E  ++Q 
Sbjct  123   SFLQGPNHSKSLLLVPASLKVDKDNVILVFGKGCLHAVSSVQGEILWKKDFSVESFEVQQ  182

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+D V+ VG   S+QF  Y++NA+ GELLKHES  F GGFSG++SLV+S+ +V L
Sbjct  183   VIQPLGSDVVHVVGFVGSTQFDVYQLNAKNGELLKHESAAFSGGFSGEVSLVSSDTLVVL  242

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS+ S L+++ F++G INFQ+ +I+DL++D  G   +LPSKLTGM  + IN F +F+RV 
Sbjct  243   DSSRSTLITVNFQNGDINFQKTYISDLIEDPLGTVKILPSKLTGMFTLTINSFTIFIRVI  302

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVDK+ +   +S++LS SEG QAF LI+H    I+L VK  +DW ++LL+E   
Sbjct  303   SEGKLEVVDKINHVTAVSDALSFSEGQQAFALIEHQDNDIYLIVKLGHDWNNDLLKERIK  362

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             ID Q+GLVHKVFINNYIRTDRS+GFRALIV+EDHSLLLLQQGE VWSREDGLASIVDVT 
Sbjct  363   IDHQRGLVHKVFINNYIRTDRSHGFRALIVMEDHSLLLLQQGETVWSREDGLASIVDVTI  422

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEK GVSV+KVEQNLFEWLKGH LKLKGTLMLA+P+DV AIQ MRLKSS KSKMTR
Sbjct  423   SELPVEKKGVSVAKVEQNLFEWLKGHFLKLKGTLMLASPEDVVAIQAMRLKSSEKSKMTR  482

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL++SGK++ALHTGDGRIVWS L+N+LRKSE CENP GL +YQWQVPHHH
Sbjct  483   DHNGFRKLLIVLTKSGKVFALHTGDGRIVWSLLLNSLRKSEACENPTGLNVYQWQVPHHH  542

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMDENPSVLVVG+C  + DA  VLSFVD+YTGKEL      H + QVIPLP+TDSTEQRL
Sbjct  543   AMDENPSVLVVGRCRTSFDALGVLSFVDTYTGKELSSSSLDHPVVQVIPLPFTDSTEQRL  602

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HLLID     HLYP+TPEA GIF+ E  NIYWYSVDA++ I++GHA+K        D+Y 
Sbjct  603   HLLIDAHQQAHLYPKTPEAAGIFQHEFSNIYWYSVDADDGIIKGHALKGKCIDKAADEYC  662

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F  + VWS+VFPSESE+II T TRK +EVVHTQAKV  D++VMYKYIS+N+LFV TVAPK
Sbjct  663   FVARGVWSIVFPSESEKIITTVTRKSSEVVHTQAKVIADQEVMYKYISRNLLFVVTVAPK  722

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             AAG IGS  PDESWL+ YLIDT+TGRILHRMTH GS GPV AV SENWVVYHYFNL+AHR
Sbjct  723   AAGGIGSATPDESWLVAYLIDTITGRILHRMTHHGSHGPVRAVFSENWVVYHYFNLKAHR  782

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQSRADNKD+LKLVLGKHNLT PVSSY RPEV  KSQSY+F HSVK IAVT
Sbjct  783   YEMSVIEIYDQSRADNKDVLKLVLGKHNLTAPVSSYSRPEVTTKSQSYYFTHSVKAIAVT  842

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              TAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NPTQAEKE+GIIPLTDSLPIIPQSYV
Sbjct  843   FTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTINPTQAEKEEGIIPLTDSLPIIPQSYV  902

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA++ EGLRGI++ PAKLESTTLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TIV
Sbjct  903   THALQVEGLRGIISAPAKLESTTLVFVYGVDLFFTRLAPSRTYDSLTEDFSYALLLITIV  962

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             AL+VAIF+TWI SE+KELQ+KWR
Sbjct  963   ALIVAIFVTWILSERKELQDKWR  985



>ref|XP_008378089.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=985

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/984 (73%), Positives = 835/984 (85%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
              MA+R F+LL+L  S+A  + SLYEDQVGLMDWHQ+YIGKVK AVFHT K+GR+RVVVST
Sbjct  2     GMAVRGFVLLLLFLSAANLSLSLYEDQVGLMDWHQQYIGKVKEAVFHTPKSGRRRVVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITL-SSGSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG I WR VLG  D IDGIDIALGKYV+TL S GS LRAWNLPDGQMVW
Sbjct  62    EENVIASLDLRHGGIIWRRVLGSNDAIDGIDIALGKYVVTLXSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+S+L VP++LKVD+ +LIL++  G LHA+SS DGEV+W+K+ A E +++Q
Sbjct  122   ESFLEGSMSSKSLLSVPTSLKVDKGNLILVFGKGSLHAISSIDGEVLWEKDFAAESVEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              I+ P G D  Y +G   SSQF AY+ N R GELLKH S  F GGFSG+  LV+SE +V 
Sbjct  182   QIIQPLGGDVAYVLGFVGSSQFDAYQXNVRNGELLKHSSAPFSGGFSGEALLVSSEILVT  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST S LV + F+DG I +QQ  I+D+  D  G  VLLPSKL G+ ++ +N  V+F+RV
Sbjct  242   LDSTRSKLVIVSFQDGEIXYQQSPISDIFGDSFGTPVLLPSKLPGLFSVKLNGAVIFIRV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EGKLEV+DKV   A IS+++SLS+G QAFGL++HG GKIHL+VK  +D  ++LL+ES 
Sbjct  302   TGEGKLEVLDKVNDVAAISDAISLSDGQQAFGLVQHGDGKIHLTVKPTHDSSTDLLKESI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +DSQ G+VHKVFINNYIRTDRS GFRALIV+ED SLLLLQQG +VW REDGLASI+DV 
Sbjct  362   VVDSQXGVVHKVFINNYIRTDRSNGFRALIVMEDDSLLLLQQGAVVWXREDGLASIIDVV  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVEQNLF+WLKGH+LKLKGTLMLAT  DVAAIQ+MRLKS  KSK+T
Sbjct  422   TSELPVEKVGVSVAKVEQNLFDWLKGHILKLKGTLMLATAADVAAIQEMRLKSFEKSKLT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GKL+ALHTG G++VWS L+  LRKSETCE P GLKIYQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTRAGKLFALHTGXGQVVWSLLLPTLRKSETCEYPTGLKIYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPSVL+VG+CG +S+AP VLS VD+YTGKE+  + P HSI QVIPLP+TDSTEQR
Sbjct  542   HALDENPSVLIVGRCGQSSEAPGVLSIVDAYTGKEINSMAPAHSIVQVIPLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDY  1491
             LHLLID +  GHLYPRT +A+ IF+RE  NIYWYSV A N+I++GHA+K    ++  DDY
Sbjct  602   LHLLIDANQRGHLYPRTSDAIDIFQREFTNIYWYSVXADNDIIKGHALKGTCNQEAVDDY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F +K +WS+VFPS+SE+IIAT TRKL+EVVHTQAKV  D +VMYKYISKN+LFVATVAP
Sbjct  662   CFESKDIWSIVFPSDSEKIIATVTRKLSEVVHTQAKVIADSEVMYKYISKNLLFVATVAP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K +G+IG+  P+ESWL VYLIDTVTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRAH
Sbjct  722   KGSGEIGTATPEESWLTVYLIDTVTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRADNKD+LKLVLGKHNLT P+SSY RPEV+ KSQSY+F +SVK IAV
Sbjct  782   RYEMSVIEIYDQSRADNKDVLKLVLGKHNLTSPISSYSRPEVVTKSQSYYFTYSVKAIAV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T TAKGITSKQLLIGTI DQVLALDKR+LDPRR++NPTQAEKE+GIIPLTD+LPIIPQSY
Sbjct  842   TLTAKGITSKQLLIGTINDQVLALDKRYLDPRRSLNPTQAEKEEGIIPLTDTLPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL+TI
Sbjct  902   VTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  962   VALIAAIFVTWVWSEKKELKEKWR  985



>gb|KHG26099.1| Uncharacterized protein F383_09262 [Gossypium arboreum]
Length=984

 Score =  1422 bits (3681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/964 (74%), Positives = 827/964 (86%), Gaps = 2/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
             FSLYEDQVGLMDWHQ+YIGKVK AVF +Q+AGRKRVVVSTEENV+ASLDLRHG+IFWRH+
Sbjct  21    FSLYEDQVGLMDWHQQYIGKVKQAVFSSQRAGRKRVVVSTEENVIASLDLRHGEIFWRHL  80

Query  3224  LGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             LG  DVIDGIDI LGKYVITLSSG S LR+WNLPDGQMVWES L G   S+S LLVP+NL
Sbjct  81    LGADDVIDGIDIGLGKYVITLSSGGSILRSWNLPDGQMVWESSLQGPKHSKSFLLVPTNL  140

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             K D+D++++++S+G LHA+S  DGEV+WKK+   E  ++Q ++ P G+D ++ VG  + S
Sbjct  141   KFDKDNVLVVFSNGRLHAISCIDGEVLWKKDFEAESFEVQQVILPPGSDLIHVVGFAAFS  200

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             QF  Y+INA+ GELLKHES  F  GF G +SLV++E VVALDSTGSIL++I F+DG I+ 
Sbjct  201   QFEMYQINAKNGELLKHESASFSSGFLGQVSLVSTETVVALDSTGSILLTISFQDGKISS  260

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
             QQ  I++LV+D  G AV++PS ++G+ AI  +   +F+RV  +G LEVV+K  +   +S+
Sbjct  261   QQTPISNLVEDSLGPAVIIPSSVSGIFAIKTDAVTIFIRVIGKGNLEVVEKTTHEIAVSD  320

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +LS+SE  QAF LI+H   +IHL+VK  +DW  NLL+ES  +D Q+GLVHKVFINNYIRT
Sbjct  321   ALSISEDQQAFALIQHASSEIHLTVKLAHDWDGNLLKESVKMDRQRGLVHKVFINNYIRT  380

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRSYGFR LIV+EDHSLLLLQQGEIVWSREDGLASI+DVTTSELPVE+DGVSV+KVE NL
Sbjct  381   DRSYGFRVLIVMEDHSLLLLQQGEIVWSREDGLASIIDVTTSELPVERDGVSVAKVEHNL  440

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
             FEWLKGH+LKLKGTLMLA+P+D+AAIQ MRLKSS KSKMTRDHNGFRKLLIVL+R+GKL+
Sbjct  441   FEWLKGHMLKLKGTLMLASPEDMAAIQSMRLKSSEKSKMTRDHNGFRKLLIVLTRAGKLF  500

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALHTGDGRIVWS+L+ +L KSE C++P GL +YQWQVPHHHAMDENPSVLVV +CG +SD
Sbjct  501   ALHTGDGRIVWSYLLRSLHKSEACQSPIGLNLYQWQVPHHHAMDENPSVLVVSRCGPSSD  560

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
                VLSFVD+YTGKEL  L   H++ QVIPLPYTDSTEQRLHLLID D H HLYP+T  A
Sbjct  561   TSGVLSFVDTYTGKELSSLSLDHAVVQVIPLPYTDSTEQRLHLLIDADKHAHLYPKTSGA  620

Query  1607  LGIFKRELGNIYWYSV-DANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             L IFKRE  NIYWYSV D N I++GHA+K     +V D++ F T+ +WSVVFPSESE+ I
Sbjct  621   LSIFKREFSNIYWYSVEDQNGIIKGHALKCKCTGEVADEFCFDTRDLWSVVFPSESEKTI  680

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             AT TRKLNEVVHTQAKV  D DVMYKYIS+N+LFVATVAPK +G+IGSV P+ESWL+ YL
Sbjct  681   ATVTRKLNEVVHTQAKVVADEDVMYKYISRNLLFVATVAPKGSGEIGSVTPEESWLVAYL  740

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             IDTVTGRILHR+TH GSQGPVHAV SENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD+
Sbjct  741   IDTVTGRILHRVTHHGSQGPVHAVFSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDV  800

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KLVLGKHNLT P+S + RPEV+ KSQSYFF HS+K IAVTSTAKGITSKQLL+GTIGDQ
Sbjct  801   WKLVLGKHNLTSPISLFSRPEVITKSQSYFFTHSLKAIAVTSTAKGITSKQLLLGTIGDQ  860

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             VLALDKRFLDPRRTVNPTQAEKE+GIIPLTDSLPIIPQSYVTHA++ EGLRGI+TVPAKL
Sbjct  861   VLALDKRFLDPRRTVNPTQAEKEEGIIPLTDSLPIIPQSYVTHALRVEGLRGIITVPAKL  920

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL+TIVALV AIF+TW  SE+KELQ
Sbjct  921   ESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLLITIVALVAAIFVTWRLSERKELQ  980

Query  530   EKWR  519
             EKWR
Sbjct  981   EKWR  984



>ref|XP_002516556.1| catalytic, putative [Ricinus communis]
 gb|EEF45897.1| catalytic, putative [Ricinus communis]
Length=983

 Score =  1421 bits (3678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/983 (72%), Positives = 839/983 (85%), Gaps = 2/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FL  +L+ S+A  TFSLYEDQVGLMDWHQRYIGKVK AVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLFSLLLLSTAIPTFSLYEDQVGLMDWHQRYIGKVKDAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHV G  D IDGIDIA+GKYVITLSS G  LRAWNLPDGQMVWE
Sbjct  61    ENVIASLDLRHGEIFWRHVFGTNDAIDGIDIAMGKYVITLSSEGGILRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             SFL G +PS+S+LLVP++ KVD+D+ IL++  G L A+SS  GE+IWKK+ A E  ++Q 
Sbjct  121   SFLQGLNPSKSLLLVPASFKVDKDNTILVFGKGCLSAISSIHGEIIWKKDFAAESFEVQQ  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P  +D +Y VG   SSQF AY+INA+ GELLKHES    GGFSG++SLV++  +V L
Sbjct  181   VIQPPSSDIIYVVGFVGSSQFDAYQINAKNGELLKHESAALSGGFSGEVSLVSTNTLVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DSTGS L ++ F++G I+FQ+ +I+DL+ D  G A+++PSKL G+ A+  + F++F+RVT
Sbjct  241   DSTGSALTAVSFQNGEISFQKTYISDLIADPMGMAMIIPSKLIGVFALKTHSFMIFIRVT  300

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG LEV+DK+ +   +S+SLSL E  QAF +++H    I+L+VK  ++W  +LL+ES  
Sbjct  301   DEGNLEVIDKIKHVTAVSDSLSLLEDWQAFAIVEHRGEDIYLTVKLSHNWNGDLLKESIK  360

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D Q+G+VHKVFINNYIRTDR++GFRALIV+EDHSLLLLQQGEIVWSREDGLASI+DVTT
Sbjct  361   MDHQRGIVHKVFINNYIRTDRTHGFRALIVMEDHSLLLLQQGEIVWSREDGLASIIDVTT  420

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLMLA+P+DV AIQ MRLKSS KSKMTR
Sbjct  421   SELPVEKEGVSVAKVEQNLFEWLKGHILKLKGTLMLASPEDVVAIQAMRLKSSEKSKMTR  480

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLI L++SGK++ALHTGDGR+VWS  +N+LRKS+ CENP G+ +YQWQVPHHH
Sbjct  481   DHNGFRKLLIALTKSGKVFALHTGDGRVVWSVFMNSLRKSDACENPTGVNMYQWQVPHHH  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMDENPSVLVVG+C  +SDA  VLSF+D+YTGKEL      HS+ QVIPL +TDSTEQRL
Sbjct  541   AMDENPSVLVVGRCRPSSDALGVLSFIDTYTGKELSSSSLAHSVVQVIPLTFTDSTEQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HLLID D   HLYP+TPEA+GIF+RE  NI+WYSV+A++ I+RGHA+K N   +V D+Y 
Sbjct  601   HLLIDADQKAHLYPKTPEAVGIFQREFSNIFWYSVEADSGIIRGHALKGNCIGEVADEYC  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F TK +WS++FP ESE+II T TRK NEVVHTQAKV  D+DVMYKYISKN+LFV TV PK
Sbjct  661   FETKRIWSILFPLESEKIITTVTRKANEVVHTQAKVIADQDVMYKYISKNLLFVVTVTPK  720

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A G IG+  P+ESWL+ YLIDTVTGRILHRMTH G+ GPVHAV SENWVVYHYFNLRAHR
Sbjct  721   AIGGIGTATPEESWLVAYLIDTVTGRILHRMTHHGANGPVHAVFSENWVVYHYFNLRAHR  780

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQSRADNKD+ KL+LGKHNLT P+SSY RPEV+ KSQSYFF HSVK IAVT
Sbjct  781   YEMSVIEIYDQSRADNKDVWKLLLGKHNLTSPISSYSRPEVITKSQSYFFTHSVKAIAVT  840

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             ST KGITSKQLL+GTIGDQVLALDKRFLDPRR++NPTQAEKE+GI+PLTDSLPI+PQSYV
Sbjct  841   STTKGITSKQLLLGTIGDQVLALDKRFLDPRRSINPTQAEKEEGILPLTDSLPIMPQSYV  900

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA++ EGLRGI+TVPAKLESTTLVFAYGVDLFFT++APS+TYDSLT+DFSYALLLLTIV
Sbjct  901   THALQVEGLRGIITVPAKLESTTLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLLLTIV  960

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALVVAIF TWI SE+KEL++KWR
Sbjct  961   ALVVAIFATWILSEKKELRDKWR  983



>ref|XP_006450658.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 ref|XP_006476068.1| PREDICTED: ER membrane protein complex subunit 1-like [Citrus 
sinensis]
 gb|ESR63898.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 gb|KDO79763.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=981

 Score =  1419 bits (3672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/985 (72%), Positives = 846/985 (86%), Gaps = 8/985 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRVVVS
Sbjct  1     MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVS  59

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMV
Sbjct  60    TEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMV  119

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+ +LLVP+NLKVD+DSLIL+ S G LHAVSS DGE++W ++ A E +++
Sbjct  120   WESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEV  179

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q ++  D +D +Y VG   SSQF AY+INA  GELL HE+  F GGF GD++LV+S+ +V
Sbjct  180   QQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLV  239

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+T SILV++ FK+  I FQ+ H+++L +D +G   +LPS LTGM  + IN + LF+R
Sbjct  240   TLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIR  299

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             +T E KLEVV KV +  V+S++L  SEG +AF +++HG  K+ ++VK   DW +NL++ES
Sbjct  300   LTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQES  359

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTDRS+GFRALIV+EDHSLLL+QQG+IVW+RED LASI+DV
Sbjct  360   IEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDV  419

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVEK+GVSV+KVE +LFEWLKGH+LKLKGTLMLA+P+DVAAIQ +RLKSS KSKM
Sbjct  420   TTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKM  479

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKLLIVL+++ K++ALH+GDGR+VWS L   L KSE C++P  L +YQWQ PH
Sbjct  480   TRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLL---LHKSEACDSPTELNLYQWQTPH  536

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+CG++S AP++LSFVD+YTGKEL     VHS  QV+PLP+TDSTEQ
Sbjct  537   HHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQ  596

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLL+D D   HLYP+T EA+ IF++E  NIYWYSV+A+N I++GHAVK     +V DD
Sbjct  597   RLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDD  656

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             + F T+ +WS++FP ESE+IIA  +RK NEVVHTQAKVT+++DVMYKYISKN+LFVATVA
Sbjct  657   FCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVA  716

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+G IGS  PDE+WL+VYLIDT+TGRILHRMTH G+QGPVHAVLSENWVVYHYFNLRA
Sbjct  717   PKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRA  776

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEMSV EIYDQSRA+NKD+LKLVLGKHNLT PVSSY RPE+  KSQ+YFF HSVK +A
Sbjct  777   HRYEMSVTEIYDQSRAENKDVLKLVLGKHNLTAPVSSYSRPEITTKSQTYFFTHSVKAVA  836

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRR++NPTQAEKE+GIIPL DSLPIIPQS
Sbjct  837   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRSINPTQAEKEEGIIPLADSLPIIPQS  896

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTH++K EGLRGI+TVPAKLESTTLVFAYGVDLF+T+LAPS+TYDSLT+DFSYALLLLT
Sbjct  897   YVTHSLKVEGLRGILTVPAKLESTTLVFAYGVDLFYTRLAPSRTYDSLTEDFSYALLLLT  956

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVALV AIF+TW+ SE+KEL+EKWR
Sbjct  957   IVALVAAIFVTWVLSEKKELREKWR  981



>ref|XP_010100254.1| hypothetical protein L484_007251 [Morus notabilis]
 gb|EXB82261.1| hypothetical protein L484_007251 [Morus notabilis]
Length=973

 Score =  1412 bits (3654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/987 (72%), Positives = 840/987 (85%), Gaps = 20/987 (2%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVV  3291
             AMA R FLLL ++FS  YT  +FSLYEDQVGLMDWHQ+YIGKVK AVFHTQKAGRKRVVV
Sbjct  2     AMASRVFLLLFIMFS-FYTELSFSLYEDQVGLMDWHQQYIGKVKQAVFHTQKAGRKRVVV  60

Query  3290  STEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQM  3114
             STEENV+ASLDLR G+IFWRHVLG  D +DGIDIALGKY ITLSS GS +RAWNLPDGQM
Sbjct  61    STEENVVASLDLRRGEIFWRHVLGSNDAVDGIDIALGKYAITLSSEGSIIRAWNLPDGQM  120

Query  3113  VWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             VWESFL GS+PS+S+L VP+N+KVDRD+LIL++S G LHA+S  DGEV+WKK+ A E   
Sbjct  121   VWESFLQGSNPSKSLLSVPTNVKVDRDNLILVFSRGSLHAISGVDGEVVWKKDFAAE---  177

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKV  2754
                      +D +YA+G   SSQF AY++NAR GELLK    VFPGGFSG++ LV+ + V
Sbjct  178   ---------SDVIYAIGSVGSSQFDAYELNARNGELLKKHGAVFPGGFSGEMLLVSGDLV  228

Query  2753  VALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFL  2574
             VALD+  S LV+I F+DG I FQQ  ++++V D +G A LLP KL  + A+ IN+FV+ +
Sbjct  229   VALDANKSSLVTINFQDG-IKFQQTDLSNIVGDSSGTAKLLPLKLQEIFAVEINEFVVLI  287

Query  2573  RVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEE  2394
             RVT EGKLE+VDK+   AVIS+ L LSEG  A  L+ HG GKIHL+VK +NDW ++LL+E
Sbjct  288   RVTGEGKLELVDKLNNAAVISDPLLLSEGQHAVALVHHGDGKIHLTVKLVNDWSNDLLKE  347

Query  2393  SSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVD  2214
             S  +D Q+G VH++F+NNYIRTDRS+GFRAL+VLEDHSLLL QQG IVWSRED LASI++
Sbjct  348   SIVLDHQRGFVHRIFMNNYIRTDRSHGFRALVVLEDHSLLLFQQGAIVWSREDSLASIIN  407

Query  2213  VTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK  2034
             V TSELPVEK+GVSV+KVE+NLFEWLKGHLLKLKGTLMLA+PDDVAAIQ MRLKSS KSK
Sbjct  408   VATSELPVEKEGVSVAKVEENLFEWLKGHLLKLKGTLMLASPDDVAAIQGMRLKSSEKSK  467

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVP  1854
             MTRDHNGFRKLLIVL+R+GKL+ALHTGDGR+VWS L+ +LR S  C +P GL IYQWQVP
Sbjct  468   MTRDHNGFRKLLIVLTRAGKLFALHTGDGRVVWSLLLPSLRNS-ACAHPTGLSIYQWQVP  526

Query  1853  HHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTE  1674
             HHHA+DENPSVL+VG+CG +SDAP VLSFVD+YTGKE+  L   HS+ QVIPLP+TDSTE
Sbjct  527   HHHALDENPSVLIVGRCGQSSDAPGVLSFVDTYTGKEIDSLSLAHSVLQVIPLPFTDSTE  586

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGD  1497
             QRLHLLID D H +LYPRTPEA+GIF+RE  NIYWYSVDA++  ++GHA+K N  +++ D
Sbjct  587   QRLHLLIDADQHAYLYPRTPEAIGIFQREFSNIYWYSVDADSGTIKGHALKRNCAQEILD  646

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
             +Y F ++ VWS+VFPS +E+IIA  TRK NEVVHTQAKV  D+DVMYKYISKN+LFVAT+
Sbjct  647   EYCFDSRDVWSIVFPSRTEKIIAAVTRKSNEVVHTQAKVIADQDVMYKYISKNLLFVATI  706

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             APKA+G+IGS  P+ESWL+VYLIDT+TGRIL+RMTH GSQGPVHAV SENWVVYHYFNLR
Sbjct  707   APKASGEIGSATPEESWLVVYLIDTITGRILYRMTHHGSQGPVHAVFSENWVVYHYFNLR  766

Query  1136  AHRYEMSVIEIYDQSR-ADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             AHR+EMSVIEIYDQSR A NKDL KL+LGKHNLT P+SSY R EV+ KSQSY F HSVK 
Sbjct  767   AHRFEMSVIEIYDQSRAAANKDLWKLILGKHNLTSPISSYSRTEVVIKSQSYLFTHSVKA  826

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             I+VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAE+E+GIIPLTD+LPI+P
Sbjct  827   ISVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEREEGIIPLTDALPIVP  886

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  600
             QSYVTH+ + EGLRGIVTVPAKLEST LVFAYGVDLF+T++APS+TYDSLT+DFSYALLL
Sbjct  887   QSYVTHSQRVEGLRGIVTVPAKLESTALVFAYGVDLFYTRIAPSRTYDSLTEDFSYALLL  946

Query  599   ltivalvvaifiTWIWSEQKELQEKWR  519
             +TIV LV AIF TWI SE+K+L++KWR
Sbjct  947   ITIVVLVAAIFATWILSEKKDLRDKWR  973



>ref|XP_010254044.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Nelumbo 
nucifera]
Length=985

 Score =  1409 bits (3648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/984 (73%), Positives = 843/984 (86%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMA+R FLLL L+F  A  + +LYEDQVGLMDWHQ+YIGKVKHAVFHTQ+AGRKRVVVST
Sbjct  2     AMAVRVFLLLTLLFLYANFSSALYEDQVGLMDWHQQYIGKVKHAVFHTQRAGRKRVVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EEN +ASLDLR GDIFWRHVLG  D +DGIDIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENAIASLDLRTGDIFWRHVLGANDAVDGIDIALGKYVITLSSEGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+FL GS+ S S+L + +N K+D+++++L++  G LHAVSS DGE IW+KELA E  +I+
Sbjct  122   ETFLRGSTSSNSLLSILTNFKMDKENMVLVFGGGCLHAVSSIDGETIWRKELATESFEIR  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              I+    +D ++A+G   SS+FV YKI+A+ GELLKH S  FPGGF G++SLV+++ VVA
Sbjct  182   QILQSPESDIIHALGFVGSSKFVTYKIDAKNGELLKHTSTAFPGGFPGELSLVSADTVVA  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+T SILVSI F++G  +F Q  I+DLV D  G A +LP++LTG+ A+ IN F++F+ V
Sbjct  242   LDATRSILVSISFQNGETSFHQTFISDLVADSAGVATILPARLTGIFAMKINSFIVFISV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T E KLEVV K+ Y A +S+ LS SEG +AF L++HG  +I L VK  NDW ++LL+ES 
Sbjct  302   TDEHKLEVVQKITYPAAVSDVLSFSEGQKAFALVQHGGSRIQLVVKLDNDWSTDLLKESI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID +KG V KVFINNYIRTDRS+GFRAL+V+EDHSLLLLQQG+IVWSREDGLASI+D+T
Sbjct  362   EIDPKKGFVEKVFINNYIRTDRSHGFRALVVMEDHSLLLLQQGDIVWSREDGLASIIDMT  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVE NLFEWLKGH LKLKGTLMLA+PDD+ +IQ+MRLKSS K+KMT
Sbjct  422   TSELPVEKKGVSVAKVEHNLFEWLKGHFLKLKGTLMLASPDDITSIQEMRLKSSEKNKMT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+++GKLYALHTGDGR++WS L+++LR+SE CE+P GL IYQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTKAGKLYALHTGDGRVIWSLLLSSLRRSEVCEHPTGLNIYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVGKCGL  DAP V SFVDSYTGKEL  L   HS+AQVI LP+TDSTEQR
Sbjct  542   HAMDENPSVLVVGKCGLGFDAPGVFSFVDSYTGKELDSLSLAHSVAQVITLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDY  1491
             LHLLID   H H+YPR  EA+ I +REL NIYWYSV+   +I+ GHA+K N   DV D+Y
Sbjct  602   LHLLIDASNHAHVYPRNLEAVNILERELPNIYWYSVEYQRDIITGHALKGNCILDVEDEY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +WS+VFPSE+E+IIATATRKLNEVVHTQAKV  D+DVMYKYIS+N+LFVATVAP
Sbjct  662   CFNTRELWSIVFPSEAEKIIATATRKLNEVVHTQAKVIADQDVMYKYISRNLLFVATVAP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KAAG+IGS  P+ESWL+VYLIDT+TGRILHR+TH GSQGPVHAV SENWV+YHYFNLRAH
Sbjct  722   KAAGEIGSATPEESWLVVYLIDTITGRILHRVTHFGSQGPVHAVFSENWVIYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRA NKD+ KLVLGKHNLT  +SSY RPEV+ KSQ+YFF HSVKT+AV
Sbjct  782   RYEMSVIEIYDQSRAGNKDVWKLVLGKHNLTSAISSYSRPEVMVKSQTYFFTHSVKTMAV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TST+KGITSKQLLIGTIGDQVLALDKR+LDPRR+ +PTQ E+E+GIIPLTDSLPIIPQSY
Sbjct  842   TSTSKGITSKQLLIGTIGDQVLALDKRYLDPRRSPDPTQTEREEGIIPLTDSLPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFT++APS+TYDSLT+DFSYALLL+TI
Sbjct  902   VTHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VAL+ AIF+TWI SE KEL+EKWR
Sbjct  962   VALIAAIFVTWILSENKELREKWR  985



>ref|XP_002324236.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
 gb|EEF02801.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
Length=985

 Score =  1409 bits (3647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/984 (70%), Positives = 826/984 (84%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR+ L+ + I S    TFSLYEDQ GLMDWHQ+YIGKVKHAVF TQK GRKRV+VST
Sbjct  2     AMAIRSLLIFLCILSITVPTFSLYEDQAGLMDWHQKYIGKVKHAVFQTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D IDGIDIA+GKY+ITLSS GS LRAWNLPDGQM W
Sbjct  62    EENVIASLDLRHGEIFWRHVLGTNDAIDGIDIAMGKYLITLSSEGSILRAWNLPDGQMWW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL G S S+S L V ++ KVD+D+ IL++  G LHA+SS  GE++WK +   E  ++Q
Sbjct  122   ESFLQGPSDSKSFLFVSTSTKVDKDNTILVFGKGSLHAISSMHGEIVWKVDFPAESFEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++    ++ +Y VG    S F  Y+INA+ GELLKH+S  F GGFSG++SLV+  K+V 
Sbjct  182   EVIQHHDSNTIYVVGFVGFSLFDVYQINAKNGELLKHDSAAFDGGFSGEVSLVSKAKLVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+  S L++I F++G I+FQ+ +++DLV+DF+G AV+LPSKLTG+ A+  N    F+ V
Sbjct  242   LDAARSTLLTISFQNGEISFQKTYVSDLVKDFSGMAVILPSKLTGLFAVKTNTATTFISV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             + EG+LEVVDK+ +  VIS++LS SE  QAF L++HG   IHL+VK  +DW S+LL+E  
Sbjct  302   SSEGQLEVVDKINHATVISDALSFSEDRQAFALVQHGDNDIHLNVKQGHDWNSDLLKERI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ++ Q+G VHKVF+NNY+RTD+S+GFRALIV+EDHSLLLLQQG IVWSREDGLASI+ VT
Sbjct  362   KLNQQRGFVHKVFMNNYVRTDKSHGFRALIVMEDHSLLLLQQGAIVWSREDGLASIIGVT  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVEQNLFEWLKGH+LK+KGTLMLA+ +DVAAIQ MRL+SS KSKMT
Sbjct  422   TSELPVEKKGVSVAKVEQNLFEWLKGHMLKVKGTLMLASAEDVAAIQGMRLRSSEKSKMT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL++SGKL+ALHTGDGRIVWS L+N+LR+SE CENP G+ +YQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTKSGKLFALHTGDGRIVWSVLLNSLRQSEACENPTGINVYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAM+ENPSVLVVG+C  +SDAP + SFVD+YTGKELK     HS+AQVIPLP+TDSTEQR
Sbjct  542   HAMNENPSVLVVGRCKPSSDAPGIFSFVDTYTGKELKSFGLDHSVAQVIPLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHLLIDT G  HLYPR PEA+ IF+ E  NIYWYSV+A+N +++GH +K N   +V ++Y
Sbjct  602   LHLLIDTSGQAHLYPRAPEAVAIFQLEFSNIYWYSVEADNGVIKGHGLKSNCDGEVANNY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ VWS+VFPSESE+II T TR  NE VHTQAKV  D+DVMYKYISKN+LFVATV+P
Sbjct  662   CFGTREVWSIVFPSESEKIITTITRNSNEAVHTQAKVVADQDVMYKYISKNLLFVATVSP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+GDIGS  P+ES L+VY++DTVTGRILHRM H GSQGPVHAV SENW+VYHYFNLRAH
Sbjct  722   KASGDIGSATPEESHLVVYVVDTVTGRILHRMNHHGSQGPVHAVFSENWIVYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEM+VIEIYDQSRADNKD+ KLVLGKHNLT P+SSY RPEV  KSQSY+F HSVK I V
Sbjct  782   RYEMTVIEIYDQSRADNKDVWKLVLGKHNLTSPMSSYSRPEVTTKSQSYYFTHSVKAITV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSK LLIGTIGDQVLA+DKRF DPRR+VNPTQ+EKE+GI+PLTDSLPIIPQSY
Sbjct  842   TSTAKGITSKHLLIGTIGDQVLAMDKRFFDPRRSVNPTQSEKEEGILPLTDSLPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTHA+K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TI
Sbjct  902   VTHALKVEGLRGIVTVPAKLESATLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKWR  519
               L+ AIF+TW+ SE+K+L++KWR
Sbjct  962   FVLIAAIFVTWVLSEKKDLRDKWR  985



>ref|XP_010254043.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Nelumbo 
nucifera]
Length=989

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/983 (73%), Positives = 842/983 (86%), Gaps = 2/983 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMA+R FLLL L+F  A  + +LYEDQVGLMDWHQ+YIGKVKHAVFHTQ+AGRKRVVVST
Sbjct  2     AMAVRVFLLLTLLFLYANFSSALYEDQVGLMDWHQQYIGKVKHAVFHTQRAGRKRVVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EEN +ASLDLR GDIFWRHVLG  D +DGIDIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENAIASLDLRTGDIFWRHVLGANDAVDGIDIALGKYVITLSSEGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+FL GS+ S S+L + +N K+D+++++L++  G LHAVSS DGE IW+KELA E  +I+
Sbjct  122   ETFLRGSTSSNSLLSILTNFKMDKENMVLVFGGGCLHAVSSIDGETIWRKELATESFEIR  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              I+    +D ++A+G   SS+FV YKI+A+ GELLKH S  FPGGF G++SLV+++ VVA
Sbjct  182   QILQSPESDIIHALGFVGSSKFVTYKIDAKNGELLKHTSTAFPGGFPGELSLVSADTVVA  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+T SILVSI F++G  +F Q  I+DLV D  G A +LP++LTG+ A+ IN F++F+ V
Sbjct  242   LDATRSILVSISFQNGETSFHQTFISDLVADSAGVATILPARLTGIFAMKINSFIVFISV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T E KLEVV K+ Y A +S+ LS SEG +AF L++HG  +I L VK  NDW ++LL+ES 
Sbjct  302   TDEHKLEVVQKITYPAAVSDVLSFSEGQKAFALVQHGGSRIQLVVKLDNDWSTDLLKESI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID +KG V KVFINNYIRTDRS+GFRAL+V+EDHSLLLLQQG+IVWSREDGLASI+D+T
Sbjct  362   EIDPKKGFVEKVFINNYIRTDRSHGFRALVVMEDHSLLLLQQGDIVWSREDGLASIIDMT  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVE NLFEWLKGH LKLKGTLMLA+PDD+ +IQ+MRLKSS K+KMT
Sbjct  422   TSELPVEKKGVSVAKVEHNLFEWLKGHFLKLKGTLMLASPDDITSIQEMRLKSSEKNKMT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+++GKLYALHTGDGR++WS L+++LR+SE CE+P GL IYQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTKAGKLYALHTGDGRVIWSLLLSSLRRSEVCEHPTGLNIYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVGKCGL  DAP V SFVDSYTGKEL  L   HS+AQVI LP+TDSTEQR
Sbjct  542   HAMDENPSVLVVGKCGLGFDAPGVFSFVDSYTGKELDSLSLAHSVAQVITLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDY  1491
             LHLLID   H H+YPR  EA+ I +REL NIYWYSV+   +I+ GHA+K N   DV D+Y
Sbjct  602   LHLLIDASNHAHVYPRNLEAVNILERELPNIYWYSVEYQRDIITGHALKGNCILDVEDEY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +WS+VFPSE+E+IIATATRKLNEVVHTQAKV  D+DVMYKYIS+N+LFVATVAP
Sbjct  662   CFNTRELWSIVFPSEAEKIIATATRKLNEVVHTQAKVIADQDVMYKYISRNLLFVATVAP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KAAG+IGS  P+ESWL+VYLIDT+TGRILHR+TH GSQGPVHAV SENWV+YHYFNLRAH
Sbjct  722   KAAGEIGSATPEESWLVVYLIDTITGRILHRVTHFGSQGPVHAVFSENWVIYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRA NKD+ KLVLGKHNLT  +SSY RPEV+ KSQ+YFF HSVKT+AV
Sbjct  782   RYEMSVIEIYDQSRAGNKDVWKLVLGKHNLTSAISSYSRPEVMVKSQTYFFTHSVKTMAV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TST+KGITSKQLLIGTIGDQVLALDKR+LDPRR+ +PTQ E+E+GIIPLTDSLPIIPQSY
Sbjct  842   TSTSKGITSKQLLIGTIGDQVLALDKRYLDPRRSPDPTQTEREEGIIPLTDSLPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFT++APS+TYDSLT+DFSYALLL+TI
Sbjct  902   VTHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKW  522
             VAL+ AIF+TWI SE KEL+EKW
Sbjct  962   VALIAAIFVTWILSENKELREKW  984



>ref|XP_009346082.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=985

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/984 (72%), Positives = 839/984 (85%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
              MA+R F+LL+L  S+A  + SLYEDQVGLMDWHQ+YIGKVK AVFHT K+GR+RVVVST
Sbjct  2     GMAVRGFVLLLLFLSAANLSLSLYEDQVGLMDWHQQYIGKVKEAVFHTPKSGRRRVVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV++SLDLRHG I WR VLG  D IDGIDIALGKYV+TLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVISSLDLRHGGIIWRRVLGSNDAIDGIDIALGKYVVTLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+S+L VP++LKVD+ +LIL++  G LHA+SS DGEV+W+K+ A E +++Q
Sbjct  122   ESFLEGSVSSKSLLSVPTSLKVDKGNLILVFGKGSLHAISSIDGEVLWEKDFAAESVEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              I+ P G+D  Y +G   SSQF AY+IN R GELLKH S  F GGFSG+  LV+SE +V 
Sbjct  182   QIIQPLGSDVAYVLGFVGSSQFDAYQINVRNGELLKHSSAPFSGGFSGEALLVSSEILVT  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST S LV + F+DG IN+QQ  I+D+  D  G  VLLPSKL G+ ++ +N  V+F+RV
Sbjct  242   LDSTRSKLVIVSFQDGEINYQQTPISDIFGDSLGTPVLLPSKLPGLFSVKLNGAVIFIRV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EGKLEV+DKV   A IS+++SLS+G QAFG ++HG GKIHL+VK  +D  ++LL+ES 
Sbjct  302   TGEGKLEVLDKVNDVAAISDAISLSDGQQAFGRVQHGDGKIHLTVKPTHDSSTDLLKESI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D+Q+G+VHKVFINNYIRTDRS GFRALIV+ED SLLLLQQG +VWSREDGLASI+DV 
Sbjct  362   VVDNQRGVVHKVFINNYIRTDRSNGFRALIVMEDDSLLLLQQGAVVWSREDGLASIIDVV  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVEQNLF+WLKGH+LKLKGTLMLA+  DVAAIQ+MRLKS  KSK+T
Sbjct  422   TSELPVEKVGVSVAKVEQNLFDWLKGHVLKLKGTLMLASATDVAAIQEMRLKSFEKSKLT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GKL+ALHTG G++VWS L+  LRKSETCE P GLKIYQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTRAGKLFALHTGYGQVVWSLLLPTLRKSETCEYPTGLKIYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPSVL+VG+CG +S+AP VLS VD+YTGKE+  +  VHSI QVIPLP+TDSTEQR
Sbjct  542   HALDENPSVLIVGRCGQSSEAPGVLSIVDAYTGKEINSMASVHSIVQVIPLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHLLID +  GHLYPRT +A+ IF+RE  N+YWYSV+A+N I++GHA+K N  ++  DDY
Sbjct  602   LHLLIDANQRGHLYPRTSDAIDIFRREFTNMYWYSVEADNGIIKGHALKGNCNQEAVDDY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F +K +W +VFPS+SE+IIAT TRKL+EVVHTQAKV  D +VMYKYISKN+LFVATVAP
Sbjct  662   CFESKDIWLIVFPSDSEKIIATVTRKLSEVVHTQAKVIADSEVMYKYISKNLLFVATVAP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K +G+IG+  P+ESWL VYLIDTVTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRAH
Sbjct  722   KGSGEIGTATPEESWLTVYLIDTVTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R EMSVIEIYDQSRADNKD+LKLVLGKHNLT P+SSY RPEV+ KSQSY+F +SVK I V
Sbjct  782   RNEMSVIEIYDQSRADNKDVLKLVLGKHNLTSPISSYSRPEVVTKSQSYYFTYSVKAIDV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T TAKGITSKQLLIGTI DQVLALDKR+LDPRR++NPTQAEKE+GIIPLTD+LPIIPQSY
Sbjct  842   TLTAKGITSKQLLIGTINDQVLALDKRYLDPRRSLNPTQAEKEEGIIPLTDALPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL+TI
Sbjct  902   VTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  962   VALIAAIFVTWVWSEKKELKEKWR  985



>ref|XP_011026615.1| PREDICTED: ER membrane protein complex subunit 1 [Populus euphratica]
Length=985

 Score =  1402 bits (3630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/984 (70%), Positives = 821/984 (83%), Gaps = 2/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR+ L+ + I S    TFSLYEDQ GLMDWHQ+YIGKVKHAVF TQK GRKRV+VST
Sbjct  2     AMAIRSLLIFLCILSITVPTFSLYEDQAGLMDWHQKYIGKVKHAVFQTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D IDGIDIA+GKY+ITLSS GS LRAWNLPDGQM W
Sbjct  62    EENVIASLDLRHGEIFWRHVLGTNDAIDGIDIAMGKYLITLSSEGSILRAWNLPDGQMWW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL G S S+S L V ++ KVD+D+ IL++  G LHA+SS  GE++WK +   E  ++Q
Sbjct  122   ESFLQGPSNSKSFLFVSTSTKVDKDNTILVFGKGSLHAISSMHGEIVWKVDFPAESFEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++    ++ +Y VG    SQF  Y+INA+ G+LLKH S  F GGFSG++SLV+  K+V 
Sbjct  182   EVIQHHDSNTIYVVGFAGFSQFDVYQINAKNGQLLKHNSAAFDGGFSGEVSLVSKAKLVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+ GS L++I F++G I+FQ+ +++DLV+DF+G AV+LPSKLTG+ A+  N    F+ V
Sbjct  242   LDAAGSTLLTISFQNGEISFQKTYVSDLVKDFSGMAVILPSKLTGLFAVKTNTATTFISV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             + EG+LEVVDK+ +  VIS++LS SE  QAF L++HG   IH +VK  +DW S+LL E  
Sbjct  302   SSEGQLEVVDKINHATVISDALSFSEDRQAFALVQHGDNDIHFNVKQGHDWNSDLLTERI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ++ Q+G VHKVF+NNY+RTD+S+GFRALIV+EDHSLLLLQQG IVWSREDGLASI+ VT
Sbjct  362   KLNQQRGFVHKVFMNNYVRTDKSHGFRALIVMEDHSLLLLQQGAIVWSREDGLASIIGVT  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK GVSV+KVEQNLFEWLKGH+LK+KGTLMLA+ +DVAAIQ MRLKSS KSKM 
Sbjct  422   TSELPVEKKGVSVAKVEQNLFEWLKGHMLKVKGTLMLASAEDVAAIQGMRLKSSEKSKMI  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL++SGKL+ALHTGDGRIVWS L+N+LR+SE CENP G+ +YQWQVPHH
Sbjct  482   RDHNGFRKLLIVLTKSGKLFALHTGDGRIVWSLLLNSLRQSEACENPTGINVYQWQVPHH  541

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAM+ENP+VLVVG+C  +SDAP + SFVD+YTGKELK     HS+AQVIPLP+TDSTEQR
Sbjct  542   HAMNENPAVLVVGRCKPSSDAPGIFSFVDTYTGKELKSFGLDHSVAQVIPLPFTDSTEQR  601

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHLLIDT G  HLYPR PEA  IF+ E  NIYWYSV+A+N +++GH +K +   +V ++Y
Sbjct  602   LHLLIDTSGKAHLYPRAPEAAAIFQLEFSNIYWYSVEADNGVIKGHGLKSSCDGEVANNY  661

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + VWS+VFPSESE+II T TR  NE VHTQAKV  D+DVMYKYISKN+LFVATV+P
Sbjct  662   CFGAREVWSIVFPSESEKIITTITRNSNEAVHTQAKVVADQDVMYKYISKNLLFVATVSP  721

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+GDIGS  P+ES L+VY++DTVTGRILHRM H GSQGPVHAV SENW+VYHYFNLRAH
Sbjct  722   KASGDIGSATPEESHLVVYVVDTVTGRILHRMNHHGSQGPVHAVFSENWIVYHYFNLRAH  781

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEM+VIEIYDQSRADNKD+ KLVLGKHNL  P+SSY RPEV  KSQSY+F HSVK I V
Sbjct  782   RYEMTVIEIYDQSRADNKDVWKLVLGKHNLASPMSSYSRPEVTTKSQSYYFTHSVKAITV  841

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSK LLIGTIGDQVLA+DKRF DPRR+VNPTQ+EKE+GI+PLTDSLPIIPQSY
Sbjct  842   TSTAKGITSKHLLIGTIGDQVLAMDKRFFDPRRSVNPTQSEKEEGILPLTDSLPIIPQSY  901

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTHA+K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TI
Sbjct  902   VTHALKVEGLRGIVTVPAKLESATLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLITI  961

Query  590   valvvaifiTWIWSEQKELQEKWR  519
               LV AIF+TW+ SE+K+L++KWR
Sbjct  962   FVLVAAIFVTWVLSEKKDLRDKWR  985



>gb|EYU41569.1| hypothetical protein MIMGU_mgv1a000799mg [Erythranthe guttata]
Length=983

 Score =  1400 bits (3623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/983 (71%), Positives = 836/983 (85%), Gaps = 2/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             M IR FLLL+L F ++Y TFSL+EDQVGLMDWHQ+YIGKVKHAVFHTQKA RKRV+VSTE
Sbjct  1     MGIRVFLLLLLFFCTSYPTFSLHEDQVGLMDWHQQYIGKVKHAVFHTQKAARKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  DVID IDIALGKYVITLSSG S +RAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGPNDVIDQIDIALGKYVITLSSGGSVVRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             S L GS  SR +LL+P NLKVD+D +I +Y +G+++AV+S DGE IWKKELA+EG+D+Q 
Sbjct  121   STLLGSKSSRPLLLIPKNLKVDKDDVIFVYGNGFIYAVASIDGEFIWKKELASEGIDVQQ  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P+G+D +YAVGL  SS+F  Y+++ + GELLKH SM FP GFSGD+S V+    +A+
Sbjct  181   LILPEGSDTIYAVGLLGSSRFDVYQLDVKSGELLKHNSMFFPAGFSGDLSFVSEGMAMAV  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             D T ++LVS++F+DG I+F + H++ L+  F+G AV LPSK+ G   +     V F++V 
Sbjct  241   DFTETVLVSVLFRDGQISFHKTHVSQLIPGFSGPAVTLPSKIPGTFILKTGSSVHFIKVI  300

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKL VV +V +   +S++LSL E  Q F L++ G GKI L+VK  +DW +NL++++  
Sbjct  301   NEGKLIVVGQVGHTDAVSDALSLPEDQQGFALVQQGDGKIFLTVKLGDDWTTNLIDDTVQ  360

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D Q+GLVHKVF+N Y+RTDRS GFR LIV+EDHSLLLLQQGEIVWSREDGLASI+DV  
Sbjct  361   MDHQRGLVHKVFLNTYVRTDRSNGFRVLIVMEDHSLLLLQQGEIVWSREDGLASIIDVKA  420

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEKDGVSV+KVE NLFEWLKGHLLKLKGTLM+ATPDDV AIQ++RL+SS KSKMTR
Sbjct  421   SELPVEKDGVSVAKVEHNLFEWLKGHLLKLKGTLMIATPDDVVAIQKIRLQSSEKSKMTR  480

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             D NGFRKLLIVL+RSGK++ALHTGDGRIVWS L+ +LRKSETCENP G+ ++QWQ PHHH
Sbjct  481   DRNGFRKLLIVLTRSGKVFALHTGDGRIVWSLLLKSLRKSETCENPRGVSLHQWQDPHHH  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPSVLVVG+CG   D+  V S VD+YTGKE   + P HSIA VIPLP+TDS EQRL
Sbjct  541   ALDENPSVLVVGRCGQGLDSAGVFSIVDTYTGKESYHVGPTHSIAHVIPLPFTDSREQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HLL+D +  GHLYPRT EALGIF+ +LGN+YWYS + +N +LRGH V++N   +V DDY 
Sbjct  601   HLLLDANRQGHLYPRTAEALGIFQHDLGNVYWYSAETDNGVLRGHGVQKNCVLEVADDYC  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +WS+VFPSESE+I ATAT   NEVVHTQAKVT D++VMYKYISKN+LF+ATV+PK
Sbjct  661   FGTRDLWSIVFPSESEKIAATATTSSNEVVHTQAKVTADQEVMYKYISKNLLFLATVSPK  720

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A G IGSV PDES L+VY+IDTVTGRILHRMTH GSQGPV+AV SENW+VYHYFNLRAHR
Sbjct  721   AVGPIGSVTPDESSLVVYVIDTVTGRILHRMTHHGSQGPVNAVFSENWIVYHYFNLRAHR  780

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YEMSVIEIYDQ+RA+NKD+LKLV G HNLT P+++Y RPEV  KSQSYFF HS+KTIAVT
Sbjct  781   YEMSVIEIYDQARAENKDVLKLVFGAHNLTSPITAYSRPEVFTKSQSYFFTHSLKTIAVT  840

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              TAKGITSKQ+L+GTIGDQVLALDKRFLDPRRTVNPTQAEKE+GIIPLTDS+PIIPQSYV
Sbjct  841   LTAKGITSKQILLGTIGDQVLALDKRFLDPRRTVNPTQAEKEEGIIPLTDSIPIIPQSYV  900

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             THA+K E LRGIVTVPAKLESTTLVFAYGVDLFFT+LAPS+TYDSLT+DFSYALLLLTIV
Sbjct  901   THALKVESLRGIVTVPAKLESTTLVFAYGVDLFFTRLAPSRTYDSLTEDFSYALLLLTIV  960

Query  587   alvvaifiTWIWSEQKELQEKWR  519
              L+VAIF+TW+WSE+K+LQ+KWR
Sbjct  961   GLIVAIFVTWVWSEKKDLQDKWR  983



>ref|XP_002308610.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|EEE92133.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=985

 Score =  1396 bits (3613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/985 (71%), Positives = 829/985 (84%), Gaps = 4/985 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR+ L+ + I S    TFSL+EDQVGLMDWHQ+YIGKVKHAVF TQK GRKRV+VST
Sbjct  2     AMAIRSLLIFLFILSLTVPTFSLHEDQVGLMDWHQKYIGKVKHAVFQTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVW  3108
             EEN +ASLDLRHG+IFWRHVLG  D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVW
Sbjct  62    EENAIASLDLRHGEIFWRHVLGANDAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL G   S+S L V ++ KVD+D+ IL++  G LHAVSS  GE++WK +  +E  ++Q
Sbjct  122   ESFLQGPIDSKSFLFVSTSSKVDKDNTILVFGKGSLHAVSSIHGEIVWKIDFPSESFEVQ  181

Query  2927  HIV-HPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
              ++ H DG + +Y VG   SSQF  Y+INA+ GELLKH+S    GGFSG++SLV+  K+V
Sbjct  182   EVIQHHDG-NTIYVVGFVGSSQFDVYQINAKNGELLKHDSAAVDGGFSGEVSLVSRAKLV  240

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+  S L++I F+ G I+FQ+ +I+DLV+DF+G AV+LPSKLTG+ A+  N    F+ 
Sbjct  241   VLDAARSTLLTISFQSGEISFQKTYISDLVEDFSGIAVILPSKLTGLFAVKTNTATAFIS  300

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             V+ EGKLEVVDK+ +  VIS  LS+SE  QAF L++HG   IHL+VK ++DW S+LL+E 
Sbjct  301   VSSEGKLEVVDKIKHATVISNVLSISEDQQAFALVQHGGNDIHLNVKQVHDWNSDLLKER  360

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTD+S+GFRALIV+EDHSLLLLQQGE+VWSREDGLASI+ V
Sbjct  361   IKLDKQRGLVHKVFINNYVRTDKSHGFRALIVMEDHSLLLLQQGEVVWSREDGLASIIGV  420

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVE++GVSV+KVEQNLFEWLKGH+LK+KGTLMLA+ +DVAAIQ MRLKSS KSKM
Sbjct  421   TTSELPVEREGVSVAKVEQNLFEWLKGHMLKVKGTLMLASAEDVAAIQGMRLKSSEKSKM  480

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
              RDHNGFRKLLIVL++S KL+ALHTGDGRIVWS L+N+LR++E CENP G+ +YQWQVPH
Sbjct  481   IRDHNGFRKLLIVLTKSRKLFALHTGDGRIVWSLLLNSLRQTEACENPTGINVYQWQVPH  540

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+C   +DAP + S+VD+YTGKELK     HS+AQVIPLP TDSTEQ
Sbjct  541   HHAMDENPSVLVVGRCRTGTDAPGIFSYVDTYTGKELKSFGLDHSVAQVIPLPLTDSTEQ  600

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             +LHLLID +G  HLYPR PEA  IF+RE  NIYWYSV+A+  +++GH ++ N   +V D+
Sbjct  601   QLHLLIDANGQAHLYPRAPEAAAIFQREFSNIYWYSVEADKGVIKGHGLQSNCDGEVADN  660

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             Y F T+ +WS+VFPSESE+II+T TRK NEVVHTQAKV  D+DVMYKYISK +LFVATV+
Sbjct  661   YSFGTREIWSIVFPSESEKIISTVTRKSNEVVHTQAKVIADQDVMYKYISKKLLFVATVS  720

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+GDIGS  P ES L+VY++DTVTGRILHRMTH GSQGPVHAV SENW+VYHYFNLRA
Sbjct  721   PKASGDIGSATPGESQLVVYVVDTVTGRILHRMTHHGSQGPVHAVFSENWIVYHYFNLRA  780

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEM+VIEIYDQSRADNKD+LKLVLGKHNLT P+SSY RPEV  KSQSY+F HS+K I 
Sbjct  781   HRYEMTVIEIYDQSRADNKDVLKLVLGKHNLTSPISSYSRPEVTTKSQSYYFTHSIKAIT  840

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VTSTAKGITSK LLIGTIGDQVLA+DKRF DPRR+VNPTQ+EKE+GI+PLTDSLPIIPQS
Sbjct  841   VTSTAKGITSKHLLIGTIGDQVLAMDKRFFDPRRSVNPTQSEKEEGILPLTDSLPIIPQS  900

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTH+ K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+T
Sbjct  901   YVTHSHKVEGLRGIVTVPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLIT  960

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVALVVAIF+TW+ SE+K+L +KWR
Sbjct  961   IVALVVAIFVTWVLSEKKDLSDKWR  985



>ref|XP_010049094.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81549.1| hypothetical protein EUGRSUZ_C02905 [Eucalyptus grandis]
Length=984

 Score =  1395 bits (3612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/961 (72%), Positives = 819/961 (85%), Gaps = 3/961 (0%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVGLMDWHQ+YIGKVKHAVFHTQKAGRKRVVVSTE+NV+ASLDLRHGDI+WRHVLG 
Sbjct  25    YEDQVGLMDWHQKYIGKVKHAVFHTQKAGRKRVVVSTEQNVIASLDLRHGDIYWRHVLGA  84

Query  3215  KDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  3039
              D IDGIDIALGKYVITLSSG S LRAWNLPDGQ+VWES L GSSPS+ +L+VP++ +VD
Sbjct  85    DDAIDGIDIALGKYVITLSSGGSILRAWNLPDGQLVWESILKGSSPSKIMLIVPTSFRVD  144

Query  3038  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  2859
             R++LI  ++ G LHAVSS DGE+IW+K+ A + L++Q ++     + V  +G   SSQF 
Sbjct  145   RENLIFAFAGGCLHAVSSIDGEIIWRKDFAAKSLEVQQVIQAPAEETVRVLGYVESSQFH  204

Query  2858  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQV  2679
             AY+IN RKG+ +KH ++ FPGG S D  LV+ + +VALD+T S+L++I+F+DG INF++ 
Sbjct  205   AYEINPRKGDEIKHVNVDFPGGLSADTVLVSDDVLVALDATRSVLLTILFQDGEINFRKT  264

Query  2678  HIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS  2499
              I  LV D  G   +LP KL  M A+  NKF++  +V   G +E+V+K+   A +S+++S
Sbjct  265   QILSLVDDSHGVVEILPCKLADMFALKTNKFLVLAKVMDGGVVELVEKIKEAAALSDAVS  324

Query  2498  LSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRS  2319
             LSE  QA  L +H   K+H+ VK ++DW  +LL+E+  ID+Q+GLVHKVFINNY+RTDRS
Sbjct  325   LSESQQAIALARHENQKLHIIVKPVHDWNIDLLKETIKIDNQRGLVHKVFINNYVRTDRS  384

Query  2318  YGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEW  2139
             YGFRALIV+EDHSLLL+QQGEIVW REDGLAS++DVTTSELPVEKDGVSVSKVEQ+LFEW
Sbjct  385   YGFRALIVMEDHSLLLIQQGEIVWCREDGLASVIDVTTSELPVEKDGVSVSKVEQSLFEW  444

Query  2138  lkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALH  1959
             LKGH+LKLKGTLMLA+P+DVAAIQ MRLKSS KSKMTRDHNGFRKLLIVL+ SGK++ALH
Sbjct  445   LKGHILKLKGTLMLASPEDVAAIQNMRLKSSEKSKMTRDHNGFRKLLIVLTGSGKVFALH  504

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPS  1779
             TGDGRIVWS LV +LRKSE C+ P GL+IY WQVPHHHAMDENPSVLVVG+CG + DAP 
Sbjct  505   TGDGRIVWSLLVQSLRKSEKCDYPTGLRIYPWQVPHHHAMDENPSVLVVGRCGPSDDAPG  564

Query  1778  VLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGI  1599
             +LSF+D+Y G+EL  L P+HSI QVIPLP+TDSTEQRLHLL+D +   HLYPR+P+AL I
Sbjct  565   LLSFIDAYKGEELDSLVPIHSIVQVIPLPFTDSTEQRLHLLVDANQRAHLYPRSPKALTI  624

Query  1598  FKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
             F  E+ NIYWYSV+A+N I+RGH  K +   D  D+Y F  K +WSVV P+ESE+I+A+ 
Sbjct  625   FHSEISNIYWYSVEADNGIIRGHVSKGSCSHD-EDEYCFDPKDLWSVVLPAESEKIVASE  683

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
             T K+NEVVHTQAK   D+DVMYKYISKN+LF+AT APK +G+IGS  P+ESWL+VYLIDT
Sbjct  684   THKINEVVHTQAKAIADQDVMYKYISKNLLFLATTAPKGSGEIGSATPEESWLVVYLIDT  743

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             +TGRILHRMTHQGSQ PVHAV SENWVVYHYFNLRAHRYEMSV+EIYDQSRADNKD+LKL
Sbjct  744   ITGRILHRMTHQGSQAPVHAVFSENWVVYHYFNLRAHRYEMSVVEIYDQSRADNKDVLKL  803

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
             V+GKHNLT PVSSY RPEV AKSQSYFF HSVK I VTSTAKGITSKQLLIGTIGDQVLA
Sbjct  804   VVGKHNLTSPVSSYSRPEVTAKSQSYFFTHSVKAITVTSTAKGITSKQLLIGTIGDQVLA  863

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             LDKR+LDPRRTVNPTQAEKE+G+IPLTDSLPIIPQSYVTHA+K EGLRGIVTVPAKLEST
Sbjct  864   LDKRYLDPRRTVNPTQAEKEEGMIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAKLEST  923

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKW  522
             TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TI AL+VAIF+TWIWSE+K+LQEKW
Sbjct  924   TLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLITIAALIVAIFVTWIWSERKDLQEKW  983

Query  521   R  519
             R
Sbjct  984   R  984



>ref|XP_009367894.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=988

 Score =  1392 bits (3604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/985 (72%), Positives = 838/985 (85%), Gaps = 2/985 (0%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             ++MAIR FLLL+L  S+A+ + SLYEDQVGLMDWHQ+YIGKVK AVFHT K+GR+RVVVS
Sbjct  4     ASMAIRGFLLLLLFLSAAHLSLSLYEDQVGLMDWHQQYIGKVKEAVFHTPKSGRRRVVVS  63

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG I WR VLG  DVI GIDIALGKYVITLSS GS LRAWNLPDGQMV
Sbjct  64    TEENVIASLDLRHGGIIWRRVLGSNDVIGGIDIALGKYVITLSSDGSILRAWNLPDGQMV  123

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+S+L VP++LK+D+++LIL++  G LHA+SS DG+V+W+K+ A E +++
Sbjct  124   WESFLEGSGSSKSLLSVPTSLKIDKENLILVFGKGSLHAISSIDGDVLWEKDFAVESVEV  183

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q IV P G D  Y VG   SS F  Y+IN R GELLKH S  F GGFSG+  LV+ E ++
Sbjct  184   QQIVQPIGGDVAYVVGFVGSSHFDVYQINVRNGELLKHNSAPFSGGFSGEALLVSGEILL  243

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LDST S LV + F+DG IN+QQ  I+D+  D  G  VLLPSKL G  ++ +N  V+F+R
Sbjct  244   TLDSTRSKLVLVSFQDGEINYQQTPISDIFGDSLGTPVLLPSKLPGFFSVKLNGAVIFIR  303

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             VT EGKLEV+DKV   A IS ++S+S+G QAFGL++HG GKIHL+VK  +D  ++LL+ES
Sbjct  304   VTGEGKLEVLDKVNNVAAISGAISISDGQQAFGLVQHGDGKIHLTVKPTHDSSADLLKES  363

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D+Q+G+VHKVF+NNYIRTDRS GFRALIV+ED SLLLLQQG +VWSREDGLASI+DV
Sbjct  364   IDMDNQRGVVHKVFVNNYIRTDRSNGFRALIVMEDDSLLLLQQGAVVWSREDGLASIIDV  423

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
              TSELPVEK GVSV+KVEQNLF+WLKGH+LKLKGTLMLA+  DVAAIQ+MRLKS  KSK+
Sbjct  424   VTSELPVEKVGVSVAKVEQNLFDWLKGHILKLKGTLMLASAADVAAIQEMRLKSFEKSKL  483

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKLLIVL+R+GKL+ALHTG G++VWS L+  LRKSETC+ P GL IYQWQVPH
Sbjct  484   TRDHNGFRKLLIVLTRAGKLFALHTGYGQVVWSLLLPTLRKSETCKYPTGLNIYQWQVPH  543

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVL+VG+CG +S+AP VLS VD+YTGKE+  +  VHSI QVIPLP+TDSTEQ
Sbjct  544   HHAMDENPSVLIVGRCGQSSEAPGVLSIVDAYTGKEINSMAAVHSIVQVIPLPFTDSTEQ  603

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLLID +  GHLYPRT EA+ IF+RE  NIYWYSV+A+N I++GHA+K N  ++V D 
Sbjct  604   RLHLLIDANQRGHLYPRTSEAVDIFQREFTNIYWYSVEADNGIIKGHALKGNCNQEVVDS  663

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             Y F +K +WS+VFPS+SE+IIAT TRKL+EVVHTQAKV  D +VMYKYISKN+LFVATVA
Sbjct  664   YCFESKDIWSIVFPSDSEKIIATVTRKLSEVVHTQAKVIADSEVMYKYISKNLLFVATVA  723

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PK +G+IG+  P+ESWL VYLIDTVTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRA
Sbjct  724   PKGSGEIGTASPEESWLTVYLIDTVTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRA  783

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEMSV+EIYDQSRADNKD+LKLVLGKHNLT P+SSY RPEV+ KSQSY+F +SVK I 
Sbjct  784   HRYEMSVVEIYDQSRADNKDVLKLVLGKHNLTSPISSYSRPEVVTKSQSYYFTYSVKAID  843

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VT TAKGITSKQLLIGTI DQVLALDKRFLDPRR++NPTQ EKE+GIIPLTD+LPIIPQS
Sbjct  844   VTLTAKGITSKQLLIGTINDQVLALDKRFLDPRRSLNPTQEEKEEGIIPLTDALPIIPQS  903

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL+T
Sbjct  904   YVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLLIT  963

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  964   IVALIAAIFVTWVWSEKKELKEKWR  988



>ref|XP_008393881.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=988

 Score =  1392 bits (3604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/985 (73%), Positives = 837/985 (85%), Gaps = 2/985 (0%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             ++MAIR FLLL+L  S+A+ + SLYEDQVGLMDWHQ+YIGKVK AVFHT K+GR+RVVVS
Sbjct  4     ASMAIRGFLLLLLFLSAAHLSLSLYEDQVGLMDWHQQYIGKVKEAVFHTPKSGRRRVVVS  63

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG I WR VLG  DVI GIDIALGKYV+TLSS GS LRAWNLPDGQMV
Sbjct  64    TEENVIASLDLRHGGIIWRRVLGSNDVIGGIDIALGKYVVTLSSDGSILRAWNLPDGQMV  123

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+S+L VP++LK+D+++LIL++  G LHA+SS DGEV+W+K+ A E +++
Sbjct  124   WESFLEGSGSSKSLLSVPTSLKIDKENLILVFGKGSLHAISSIDGEVLWEKDFAVESVEV  183

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q IV P G D  Y +G   SS F AY+IN R GELLKH S  F GGFSG+  LV+SE ++
Sbjct  184   QQIVQPIGGDLAYVLGFVGSSHFDAYQINVRTGELLKHNSAPFSGGFSGEALLVSSEILL  243

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LDSTGS LV + F+DG IN+QQ  I+D+  D  G  VLLPSKL G+ ++ +N  V+F+R
Sbjct  244   TLDSTGSKLVIVSFQDGEINYQQTPISDIFGDSLGTPVLLPSKLPGLFSVKLNGAVIFIR  303

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             VT EGKLEV+DKV   A IS ++S+S+G QAFGL++HG GKIHL+VK   D  ++LL+ES
Sbjct  304   VTGEGKLEVLDKVNNVAAISGAISISDGQQAFGLVQHGDGKIHLTVKPTIDLSADLLKES  363

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +++Q+G+VHKVFINNYIRTDRS GFRALIV+ED SLLLLQQG +VWSREDGLASI+DV
Sbjct  364   IDMNNQRGVVHKVFINNYIRTDRSNGFRALIVMEDDSLLLLQQGAVVWSREDGLASIIDV  423

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
              TSELPVEK GVSV KVEQNLF+WLKGH+LKLKGTLMLA+  DVAAIQ+MRLKS  KSK+
Sbjct  424   VTSELPVEKVGVSVVKVEQNLFDWLKGHILKLKGTLMLASAADVAAIQEMRLKSFEKSKL  483

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             T DHNGFRKLLIVL+R+GKL+ALHTG G++VWS L   LRKSETC+ P GL IYQWQVPH
Sbjct  484   TXDHNGFRKLLIVLTRAGKLFALHTGYGQVVWSLLXPTLRKSETCKYPTGLXIYQWQVPH  543

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVL+VG+CG +S+AP VLS VD+YTGKE+  +  VHSI QVIPLP+TDSTEQ
Sbjct  544   HHAMDENPSVLIVGRCGQSSEAPGVLSIVDAYTGKEINSMAAVHSIVQVIPLPFTDSTEQ  603

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLLID +  GHLYPRT EA+ IF+ E  NIYWYSV+A+N I++GHA+K N  ++  D 
Sbjct  604   RLHLLIDANQRGHLYPRTXEAIDIFQXEFTNIYWYSVEADNGIIKGHALKGNCNQEAVDS  663

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             Y F +K +WS+VFPS+SE+IIAT TRKL+EVVHTQAKV  D +VMYKYISKN+LFVATVA
Sbjct  664   YCFESKDIWSIVFPSDSEKIIATVTRKLSEVVHTQAKVIADSEVMYKYISKNLLFVATVA  723

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PK +G+IG+  P+ESWL VYLIDTVTGRILHRMTH GSQGPVHAV SENWVVYHYFNLRA
Sbjct  724   PKGSGEIGTATPEESWLTVYLIDTVTGRILHRMTHHGSQGPVHAVFSENWVVYHYFNLRA  783

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEMSVIEIYDQSRADNKD+LKLVLGKHNLT P+SSY RPEV+ KSQSY+F +SVK I 
Sbjct  784   HRYEMSVIEIYDQSRADNKDVLKLVLGKHNLTSPISSYSRPEVVTKSQSYYFTYSVKAID  843

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VT TAKGITSKQLLIGTI DQVLALDKRFLDPRR++NPTQAEKE+GIIPLTD+LPIIPQS
Sbjct  844   VTLTAKGITSKQLLIGTINDQVLALDKRFLDPRRSLNPTQAEKEEGIIPLTDALPIIPQS  903

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL+T
Sbjct  904   YVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLLIT  963

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVAL+ AIF+TWIWSE+KEL+EKWR
Sbjct  964   IVALIAAIFVTWIWSEKKELKEKWR  988



>ref|XP_010049093.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Eucalyptus 
grandis]
Length=986

 Score =  1390 bits (3598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/963 (72%), Positives = 819/963 (85%), Gaps = 5/963 (1%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVGLMDWHQ+YIGKVKHAVFHTQKAGRKRVVVSTE+NV+ASLDLRHGDI+WRHVLG 
Sbjct  25    YEDQVGLMDWHQKYIGKVKHAVFHTQKAGRKRVVVSTEQNVIASLDLRHGDIYWRHVLGA  84

Query  3215  KDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  3039
              D IDGIDIALGKYVITLSSG S LRAWNLPDGQ+VWES L GSSPS+ +L+VP++ +VD
Sbjct  85    DDAIDGIDIALGKYVITLSSGGSILRAWNLPDGQLVWESILKGSSPSKIMLIVPTSFRVD  144

Query  3038  RDSLILIYSSGYLHAVSSTDGEVIWKKELANE--GLDIQHIVHPDGTDDVYAVGLTSSSQ  2865
             R++LI  ++ G LHAVSS DGE+IW+K+ A +   L++Q ++     + V  +G   SSQ
Sbjct  145   RENLIFAFAGGCLHAVSSIDGEIIWRKDFAAKRFSLEVQQVIQAPAEETVRVLGYVESSQ  204

Query  2864  FVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQ  2685
             F AY+IN RKG+ +KH ++ FPGG S D  LV+ + +VALD+T S+L++I+F+DG INF+
Sbjct  205   FHAYEINPRKGDEIKHVNVDFPGGLSADTVLVSDDVLVALDATRSVLLTILFQDGEINFR  264

Query  2684  QVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISES  2505
             +  I  LV D  G   +LP KL  M A+  NKF++  +V   G +E+V+K+   A +S++
Sbjct  265   KTQILSLVDDSHGVVEILPCKLADMFALKTNKFLVLAKVMDGGVVELVEKIKEAAALSDA  324

Query  2504  LSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTD  2325
             +SLSE  QA  L +H   K+H+ VK ++DW  +LL+E+  ID+Q+GLVHKVFINNY+RTD
Sbjct  325   VSLSESQQAIALARHENQKLHIIVKPVHDWNIDLLKETIKIDNQRGLVHKVFINNYVRTD  384

Query  2324  RSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLF  2145
             RSYGFRALIV+EDHSLLL+QQGEIVW REDGLAS++DVTTSELPVEKDGVSVSKVEQ+LF
Sbjct  385   RSYGFRALIVMEDHSLLLIQQGEIVWCREDGLASVIDVTTSELPVEKDGVSVSKVEQSLF  444

Query  2144  EWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYA  1965
             EWLKGH+LKLKGTLMLA+P+DVAAIQ MRLKSS KSKMTRDHNGFRKLLIVL+ SGK++A
Sbjct  445   EWLKGHILKLKGTLMLASPEDVAAIQNMRLKSSEKSKMTRDHNGFRKLLIVLTGSGKVFA  504

Query  1964  LHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDA  1785
             LHTGDGRIVWS LV +LRKSE C+ P GL+IY WQVPHHHAMDENPSVLVVG+CG + DA
Sbjct  505   LHTGDGRIVWSLLVQSLRKSEKCDYPTGLRIYPWQVPHHHAMDENPSVLVVGRCGPSDDA  564

Query  1784  PSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEAL  1605
             P +LSF+D+Y G+EL  L P+HSI QVIPLP+TDSTEQRLHLL+D +   HLYPR+P+AL
Sbjct  565   PGLLSFIDAYKGEELDSLVPIHSIVQVIPLPFTDSTEQRLHLLVDANQRAHLYPRSPKAL  624

Query  1604  GIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
              IF  E+ NIYWYSV+A+N I+RGH  K +   D  D+Y F  K +WSVV P+ESE+I+A
Sbjct  625   TIFHSEISNIYWYSVEADNGIIRGHVSKGSCSHD-EDEYCFDPKDLWSVVLPAESEKIVA  683

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
             + T K+NEVVHTQAK   D+DVMYKYISKN+LF+AT APK +G+IGS  P+ESWL+VYLI
Sbjct  684   SETHKINEVVHTQAKAIADQDVMYKYISKNLLFLATTAPKGSGEIGSATPEESWLVVYLI  743

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             DT+TGRILHRMTHQGSQ PVHAV SENWVVYHYFNLRAHRYEMSV+EIYDQSRADNKD+L
Sbjct  744   DTITGRILHRMTHQGSQAPVHAVFSENWVVYHYFNLRAHRYEMSVVEIYDQSRADNKDVL  803

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
             KLV+GKHNLT PVSSY RPEV AKSQSYFF HSVK I VTSTAKGITSKQLLIGTIGDQV
Sbjct  804   KLVVGKHNLTSPVSSYSRPEVTAKSQSYFFTHSVKAITVTSTAKGITSKQLLIGTIGDQV  863

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             LALDKR+LDPRRTVNPTQAEKE+G+IPLTDSLPIIPQSYVTHA+K EGLRGIVTVPAKLE
Sbjct  864   LALDKRYLDPRRTVNPTQAEKEEGMIPLTDSLPIIPQSYVTHALKVEGLRGIVTVPAKLE  923

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQE  528
             STTLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TI AL+VAIF+TWIWSE+K+LQE
Sbjct  924   STTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLITIAALIVAIFVTWIWSERKDLQE  983

Query  527   KWR  519
             KWR
Sbjct  984   KWR  986



>ref|XP_003526482.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =  1382 bits (3577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/984 (70%), Positives = 833/984 (85%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+FHTQK+GRKRV+VST
Sbjct  2     AMAIRVFLILLLSLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALFHTQKSGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D++DG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDIVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+SIL +P NLK D+D LIL++  G LHAVSS DGEV+WKK+   E +++ 
Sbjct  122   ESFLQGSVASKSILYIPKNLKADKDDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVN  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+    TD++Y  G   SS+F  Y++NA+ GELL ++         G++  V+ +K V 
Sbjct  182   HIIQ--STDEIYVAGFVGSSKFYVYQLNAKNGELLNNDHKTLACDTFGELLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD T S ++++  K+G I+++Q  I+DL++D +G AV+LP +L  + A+ IN  VL ++V
Sbjct  240   LDKTRSKILTLNIKNGGISYKQKPISDLIKDSSGQAVILPLRLPELFALRINSLVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L +VDK+   A +S++LS+SEG  AF  ++H   KIHL VK +NDW  +LL+E  
Sbjct  300   TNEGELVLVDKIDNAAAVSDALSISEGQHAFAFVQHEDSKIHLFVKDVNDWNGDLLKERV  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G + K+FINNY+RTDRSYGFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNIDKIFINNYVRTDRSYGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+P+DV AIQ +RL+SS KSKMT
Sbjct  420   TSELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASPEDVVAIQALRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGR+VWS L++ LRK+E CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRVVWSILLHTLRKTEVCEHPIGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LVVG+CG +  APSVLSF+D+YTGKEL  L   H++AQVIPLPYTDSTEQR
Sbjct  540   HALDENPSILVVGRCGPSLAAPSVLSFIDAYTGKELNSLSLAHTVAQVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+IDT+ H +LYPRTPEA+GI +RE  N+YWYSVDA+N ++RGHA+K N    V D+Y
Sbjct  600   LHLIIDTNQHAYLYPRTPEAIGILQREFSNVYWYSVDADNGVIRGHALKSNCIHKVVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKY+SKN+LFVA  AP
Sbjct  660   CFDFRDLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYVSKNVLFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA G+IG+  P+E+ L++Y+IDTVTGR+LHRM H G QGPVHAV SENWVVYHYFNLRAH
Sbjct  720   KARGEIGTATPEEALLVIYIIDTVTGRVLHRMAHHGCQGPVHAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSV+E+YDQSRADNKD+ K VLGKHNLT P+SSY RPEV+ KSQSYFF HSVK I V
Sbjct  780   RYEMSVVEVYDQSRADNKDVWKFVLGKHNLTSPISSYYRPEVVTKSQSYFFTHSVKAIEV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  840   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AIF+TW+ S++K+LQEKWR
Sbjct  960   VALVAAIFVTWVLSQRKDLQEKWR  983



>gb|KHN18187.1| Hypothetical protein glysoja_025077 [Glycine soja]
Length=983

 Score =  1380 bits (3572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/984 (70%), Positives = 832/984 (85%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+FHTQK+GRKRV+VST
Sbjct  2     AMAIRVFLILLLSLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALFHTQKSGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D++DG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDIVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+SIL +P NLK D+D LIL++  G LHAVSS DGEV+WKK+   E +++ 
Sbjct  122   ESFLQGSVASKSILYIPKNLKADKDDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVN  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+    TD++Y  G   SS+F  Y++NA+ GELL ++         G++  V+ +K V 
Sbjct  182   HIIQ--STDEIYVAGFVGSSKFYVYQLNAKNGELLNNDHKTLACDTFGELLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD T S ++++  K+G I+++Q  I+DL++D +G AV+LP +L  + A+ IN  VL ++V
Sbjct  240   LDKTRSKILTLNIKNGGISYKQKPISDLIKDSSGQAVILPLRLPELFALRINSLVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L +VDK+   A +S++LS+SEG  AF  ++H   KIHL VK +NDW  +LL+E  
Sbjct  300   TNEGELVLVDKIDNAAAVSDALSISEGQHAFAFVQHEDSKIHLFVKDVNDWNGDLLKERV  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G + K+FINNY+RTDRSYGFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNIDKIFINNYVRTDRSYGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+P+DV AIQ +RL+SS KSKMT
Sbjct  420   TSELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASPEDVVAIQALRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGR+VWS L++ LRK+E CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRVVWSILLHTLRKTEVCEHPIGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LVVG+CG +  APSVLSF+D+YTGKEL  L   H++AQVIPLPYTDSTEQR
Sbjct  540   HALDENPSILVVGRCGPSLAAPSVLSFIDAYTGKELNSLSLAHTVAQVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID + H +LYPRTPEA+GI +RE  N+YWYSVDA+N ++RGHA+K N    V D+Y
Sbjct  600   LHLIIDINQHAYLYPRTPEAIGILQREFSNVYWYSVDADNGVIRGHALKSNCIHKVVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKY+SKN+LFVA  AP
Sbjct  660   CFDFRNLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYVSKNVLFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA G+IG+  P+E+ L++Y+IDTVTGR+LHRM H G QGPVHAV SENWVVYHYFNLRAH
Sbjct  720   KARGEIGTATPEEALLVIYIIDTVTGRVLHRMAHHGCQGPVHAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSV+E+YDQSRADNKD+ K VLGKHNLT P+SSY RPEV+ KSQSYFF HSVK I V
Sbjct  780   RYEMSVVEVYDQSRADNKDVWKFVLGKHNLTSPISSYYRPEVVTKSQSYFFTHSVKAIEV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  840   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AIF+TW+ S++K+LQEKWR
Sbjct  960   VALVAAIFVTWVLSQRKDLQEKWR  983



>ref|XP_011019630.1| PREDICTED: ER membrane protein complex subunit 1-like [Populus 
euphratica]
Length=985

 Score =  1378 bits (3566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/985 (70%), Positives = 829/985 (84%), Gaps = 4/985 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR+ L+ + I S    TFSL+EDQVGLMDWHQ+YIGKVKHAVF TQK GRKRV+VST
Sbjct  2     AMAIRSLLIFLFILSLTVPTFSLHEDQVGLMDWHQKYIGKVKHAVFQTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVW  3108
             EEN +ASLDLRHG+IFWRHVLG  D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVW
Sbjct  62    EENAIASLDLRHGEIFWRHVLGANDAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL G   S+S L V ++ KVD+++ IL++  G LHAVSS  GE++WK +  +E  ++Q
Sbjct  122   ESFLQGPIDSKSFLFVSASSKVDKENTILVFGKGSLHAVSSIHGEIVWKIDFPSECFEVQ  181

Query  2927  HIV-HPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
              ++ H DG + +Y VG   SSQF  Y+INA+ GELLKH+S  F GGFSG++SLV+  K+V
Sbjct  182   EVIQHYDG-NTIYVVGFVGSSQFDVYQINAKNGELLKHDSAAFDGGFSGEVSLVSRAKLV  240

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+  S L++I F+ G I+FQ+ +I+DLV+DF+G AV+LPSKLTG+ A+  N    F+ 
Sbjct  241   VLDAARSALLTISFQSGEISFQKTYISDLVEDFSGIAVILPSKLTGLFAVKTNTATAFIS  300

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             V+ EGKLEVVDK+ +  VIS  LS+SE  QAF L++HG   IH +VK ++DW S+LL+E 
Sbjct  301   VSSEGKLEVVDKIKHATVISNVLSISEDQQAFALVRHGSNDIHFNVKQVHDWNSDLLKER  360

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTD+S+GFRALIV+EDHSLLLLQQGE+VWSREDGLASI+ V
Sbjct  361   IKLDQQRGLVHKVFINNYVRTDKSHGFRALIVMEDHSLLLLQQGEVVWSREDGLASIIGV  420

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVE++GVSV+KVEQNLFEWLKGH+LK+KGTLMLA+ +DVAAIQ MRLKSS KSKM
Sbjct  421   TTSELPVEREGVSVAKVEQNLFEWLKGHMLKVKGTLMLASAEDVAAIQGMRLKSSEKSKM  480

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
              RDHNGFRKLLIVL++SGKL+ALHTGDGRIVWS L+N+LR++E CENP G+ +YQWQVPH
Sbjct  481   IRDHNGFRKLLIVLTKSGKLFALHTGDGRIVWSLLLNSLRQTEACENPTGINVYQWQVPH  540

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+C   +DAP + SFVD+YTGKELK     HS+AQVIPLP TD+TEQ
Sbjct  541   HHAMDENPSVLVVGRCRTGTDAPGIFSFVDTYTGKELKSFGLDHSVAQVIPLPLTDATEQ  600

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLLID +G  HLYPR PEA  IF+ E  NIYWYSV+A+  +++GH +K N   +V D+
Sbjct  601   RLHLLIDANGQVHLYPRAPEAAAIFQHEFSNIYWYSVEADKGVIKGHGLKSNCDGEVADN  660

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             Y F T+ +WS+VFPSESE+II+T TRK NEVVHTQAKV  D+DVMYKYISKN+L+VATV+
Sbjct  661   YSFGTREIWSIVFPSESEKIISTVTRKSNEVVHTQAKVIADQDVMYKYISKNLLYVATVS  720

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+GDIGS  P ES L+VY++DTVTGRILHRMTH GSQGPVHAV SENW+VYHYFNLRA
Sbjct  721   PKASGDIGSATPGESQLVVYVVDTVTGRILHRMTHHGSQGPVHAVFSENWIVYHYFNLRA  780

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEM+VIEIYDQSRADNKD+LKLVLGKHNL+ P+SSY R EV  KSQSY+F HS+K I 
Sbjct  781   HRYEMTVIEIYDQSRADNKDVLKLVLGKHNLSSPISSYSRSEVTTKSQSYYFTHSIKAIT  840

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VTSTAKGITSK LLIGTIGDQVLA+DKRF DPRR+VNPTQ+EKE+GI+PLTDSLPIIPQS
Sbjct  841   VTSTAKGITSKHLLIGTIGDQVLAMDKRFFDPRRSVNPTQSEKEEGILPLTDSLPIIPQS  900

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTH+ K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+T
Sbjct  901   YVTHSHKVEGLRGIVTVPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLIT  960

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVALVVAIF+TW+ S++K+L +KWR
Sbjct  961   IVALVVAIFVTWVLSKKKDLSDKWR  985



>ref|XP_003522701.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =  1377 bits (3564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/984 (70%), Positives = 829/984 (84%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AM IR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+FHTQK+GRKRV+VST
Sbjct  2     AMTIRVFLILLLFLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALFHTQKSGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLR G+IFWRHVLG  DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRRGEIFWRHVLGTNDVVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+SIL +P NLK D+D LIL++  G LHAVSS DGEV+WKK+   E +++ 
Sbjct  122   ESFLQGSVASKSILYIPKNLKADKDDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVN  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+    TD++Y  G   SS+F  Y +NA+ GELLK++    P    G++  V+ +K V 
Sbjct  182   HIIQ--STDEIYVAGFVGSSKFYVYGLNAKNGELLKNDHKALPCDTFGELLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD T S +++I  K+G I+++Q  I+DL++D +G AV+LPS+L  + A+ IN  VL ++V
Sbjct  240   LDKTRSKILTINIKNGEISYKQKPISDLIEDSSGQAVILPSRLPELFALRINSHVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L +VDK+   A +S++LS+ EG  AF  ++H   KIHL VK +NDW  +LL+E  
Sbjct  300   TNEGELVLVDKINNAAAVSDALSIPEGQHAFAFVQHEDSKIHLFVKDVNDWNGDLLKERV  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G V K+FINNY+RTDRSYGFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNVDKIFINNYVRTDRSYGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
              SELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+ +DV AIQ +RL+SS KSKMT
Sbjct  420   ASELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASAEDVVAIQALRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGR+VWS L++ LRK+E CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRVVWSILLHTLRKTEVCEHPIGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LVVG+CG +  APSVLSF+D+YTGKEL  L   H++AQVIPLPYTDSTEQR
Sbjct  540   HALDENPSILVVGRCGPSLAAPSVLSFIDAYTGKELNSLSLAHTVAQVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID + + +LYPRT EA+GI +RE  N+YWYSVDA+N ++RGHA+K N    V D+Y
Sbjct  600   LHLIIDINRYAYLYPRTSEAIGILQREFSNVYWYSVDADNGVIRGHALKSNCIHKVVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKY+SKN+LFVA  AP
Sbjct  660   CFDFRNLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYVSKNVLFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+G+IG+  P+E+ L++Y+IDTVTGRILHRMTH G QGPVHAV SENWVVYHYFNLRAH
Sbjct  720   KASGEIGTATPEEASLVIYIIDTVTGRILHRMTHHGCQGPVHAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSV+E+YDQSRADNKD+ K VLGKHNLT P+SSY R EV+ KSQSYFF HSVK I V
Sbjct  780   RYEMSVVEVYDQSRADNKDVWKFVLGKHNLTSPISSYYRAEVVTKSQSYFFTHSVKAIEV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  840   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AIF+TW+ S++K+LQEKWR
Sbjct  960   VALVAAIFVTWVLSQRKDLQEKWR  983



>gb|KHN10213.1| Hypothetical protein glysoja_017817 [Glycine soja]
Length=983

 Score =  1374 bits (3557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/984 (70%), Positives = 829/984 (84%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AM IR FL+L+L  SS + ++SLYEDQVGLMDWHQ+YIGKVKHA+FHTQK+GRKRV+VST
Sbjct  2     AMTIRVFLILLLFLSSTHLSYSLYEDQVGLMDWHQQYIGKVKHALFHTQKSGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLR G+IFWRHVLG  DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRRGEIFWRHVLGTNDVVDGLDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL GS  S+SIL +P NLK D+D LIL++  G LHAVSS DGEV+WKK+   E +++ 
Sbjct  122   ESFLQGSVASKSILYIPKNLKADKDDLILVFGKGCLHAVSSIDGEVLWKKDFVGESIEVN  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+    TD++Y  G   SS+F  Y +NA+ GELLK++    P    G++  V+ +K V 
Sbjct  182   HIIQ--STDEIYVAGFVGSSKFYVYGLNAKNGELLKNDHKALPCDTFGELLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD T S +++I  K+G I+++Q  I+DL++D +G AVLLPS+L  + A+ IN  VL ++V
Sbjct  240   LDKTRSKILTINIKNGEISYKQKPISDLIEDSSGQAVLLPSRLPELFALRINSHVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L +VD++   A +S++LS+ EG  AF  ++H   KIHL VK +NDW  +LL+E  
Sbjct  300   TNEGELVLVDQINNAAAVSDALSIPEGQHAFAFVQHEDSKIHLFVKDVNDWNGDLLKERV  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G V K+FINNY+RTDRSYGFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNVDKIFINNYVRTDRSYGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
              SELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+ +DV AIQ +RL+SS KSKMT
Sbjct  420   ASELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASAEDVVAIQALRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGR+VWS L++ LRK+E CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRVVWSILLHTLRKTEVCEHPIGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LVVG+CG +  APSVLSF+D+YTGKEL  L   H++A+VIPLPYTDSTEQR
Sbjct  540   HALDENPSILVVGRCGPSLAAPSVLSFIDAYTGKELNSLSLAHTVAEVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID + + +LYPRT EA+GI +RE  N+YWYSVDA+N ++RGHA+K N    V D+Y
Sbjct  600   LHLIIDINRYAYLYPRTSEAIGILQREFSNVYWYSVDADNGVIRGHALKSNCIHKVVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKY+SKN+LFVA  AP
Sbjct  660   CFDFRNLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYVSKNVLFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+G+IG+  P+E+ L++Y+IDTVTGRILHRMTH G QGPVHAV SENWVVYHYFNLRAH
Sbjct  720   KASGEIGTATPEEASLVIYIIDTVTGRILHRMTHHGCQGPVHAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSV+E+YDQSRADNKD+ K VLGKHNLT P+S+Y R EV+ KSQSYFF HSVK I V
Sbjct  780   RYEMSVVEVYDQSRADNKDVWKFVLGKHNLTSPISAYYRAEVVTKSQSYFFTHSVKAIEV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  840   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AIF+TW+ S++K+LQEKWR
Sbjct  960   VALVAAIFVTWVLSQRKDLQEKWR  983



>gb|KFK25418.1| hypothetical protein AALP_AA8G112000 [Arabis alpina]
Length=982

 Score =  1371 bits (3548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/983 (70%), Positives = 833/983 (85%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FLLL+L  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLLLLLFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLR G+IFWRHVLG KD IDG+DIALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRLGEIFWRHVLGTKDAIDGVDIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  +  S+S+L VP NLKVD+D  IL++  GYLHAVS+ DGEV+WKK+   EG ++Q 
Sbjct  121   TSLHNAQQSKSLLSVPINLKVDKDYPILVFGGGYLHAVSAVDGEVLWKKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G  +S++ V Y+I+++ GE+   +SM FPGGFSG IS V+++KVV L
Sbjct  181   VLQPPGSSIIYVLGFVNSAEAVVYQIDSKTGEVASQKSMEFPGGFSGGISSVSNDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST SILV+I F DG I+FQ+  I+DLV+D   A +LLP  LT M+A+ +NK  +F+RV 
Sbjct  241   DSTRSILVTISFLDGGISFQKTRISDLVEDSGNAEILLP-LLTNMLAVKVNKRTIFVRVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL +++  +AF  + H   KIHL VK +ND  + LL+ES  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSKIHLMVKLVNDLDTVLLKESIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G V KVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVW RE+GLAS+ DVTT
Sbjct  360   MDQHRGRVSKVFVNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWRREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELPVEKDGVSV++VE  L +WLKGH+LKLKG+L+LA+P+DV AIQ MRLKSSG+SK+TR
Sbjct  420   AELPVEKDGVSVAEVEHTLVDWLKGHVLKLKGSLLLASPEDVVAIQDMRLKSSGRSKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL+I L+R+GKL+ALHTGDGRIVWS L+N+  KSE CE P+G+ +YQWQVPHHH
Sbjct  480   DHNGFRKLIIALTRAGKLFALHTGDGRIVWSVLLNSPSKSEACERPSGISLYQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMDENPSVLVVG+CG++S AP VLSFVD YTGKE+      HS+ QV+PLP+TD+TEQRL
Sbjct  540   AMDENPSVLVVGRCGVDSSAPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPFTDATEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT+GH HLYP+T EAL IF+RE  N+YWY+V+A++ I+RGHA+K +   +  D+Y 
Sbjct  600   HLIADTNGHVHLYPKTSEALSIFQREFENVYWYTVEADDGIIRGHAMKSSCSGETADEYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV +D+D++YKY+SKN+LFVATV+PK
Sbjct  660   FTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNSDQDLLYKYVSKNLLFVATVSPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  720   GAGEIGSVTPEESALVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPEV  KSQSYFFA SVKTIAVT
Sbjct  780   YEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEVFTKSQSYFFAQSVKTIAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSY+
Sbjct  840   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSYI  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ K EGLRGI+T PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  900   THSHKVEGLRGIITAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW+ SE+KEL EKWR
Sbjct  960   ALVAAIYITWVLSEKKELSEKWR  982



>gb|KHG18967.1| Uncharacterized protein F383_07420 [Gossypium arboreum]
Length=982

 Score =  1369 bits (3543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/964 (71%), Positives = 813/964 (84%), Gaps = 3/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
              SLYEDQVGLMDWHQ+YIGKVK AVFHT K GRKRVV STE+N++A+LDLR G+IFWRHV
Sbjct  20    LSLYEDQVGLMDWHQQYIGKVKQAVFHTHKTGRKRVVASTEQNIIATLDLRRGEIFWRHV  79

Query  3224  LGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             LG  DV+DGIDIALGKYVITLSSG S LRAWNLPDGQMVWES L G   S+ +LL   NL
Sbjct  80    LGPNDVVDGIDIALGKYVITLSSGGSILRAWNLPDGQMVWESSLHGPKHSKPLLLT-RNL  138

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
              +++D++++++S+G L+AVS  DGEV+WKK+   E L++Q ++ P G+  +Y +G  +SS
Sbjct  139   IIEKDNVLIVFSNGRLNAVSCIDGEVLWKKDFEEESLEVQQVIQPPGSGFIYVLGFAASS  198

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             QF  YKINA+ GELLKHES  F G F+G++SLV+SE VVALDSTGSIL++I F +G I+ 
Sbjct  199   QFEMYKINAKNGELLKHESTAFSGRFTGEVSLVSSETVVALDSTGSILLTISFHNGKISS  258

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
             QQ  +++L++D  G AV++   +TG+ AI  +   +F+RV  EGKLEVV+K  +  V+S+
Sbjct  259   QQTPVSNLLEDSPGLAVIIHPSVTGIFAIKTDAATIFIRVIGEGKLEVVEKTNHETVVSD  318

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +LS+SEG QAF L++H    IHL+VK  +DW SNLL+ES  +D Q+G VHKVFINNYIRT
Sbjct  319   ALSISEGQQAFALVQHAGSSIHLTVKPAHDWDSNLLKESIKMDQQRGFVHKVFINNYIRT  378

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRS+GFRALIV+EDHSLLLLQQG IVWSREDGLASI+DVTTSELPVEK GVSV+KVE NL
Sbjct  379   DRSHGFRALIVMEDHSLLLLQQGAIVWSREDGLASIIDVTTSELPVEKAGVSVAKVELNL  438

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
             FEWLKGH+LKLKGTLMLATP+D+AAIQ MRLKSS KSKMTRDHNGFRKLLI L+R+GKL+
Sbjct  439   FEWLKGHVLKLKGTLMLATPEDIAAIQHMRLKSSEKSKMTRDHNGFRKLLIALTRAGKLF  498

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
              LHTGDGRIVWS L+ +L KSE+C  P  L +YQWQVPHHHA+DENPSVLVVG+CG +SD
Sbjct  499   GLHTGDGRIVWSHLLQSLHKSESCRQPIVLNLYQWQVPHHHALDENPSVLVVGRCGPSSD  558

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
             A  VLS VDSYTGKE   L  VHS+AQVIPLPYTDSTEQRLHLLID D H HLYP+TPEA
Sbjct  559   ALGVLSLVDSYTGKEFSSLSLVHSVAQVIPLPYTDSTEQRLHLLIDADKHAHLYPKTPEA  618

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +  F+ E  N+YWYSVD +N I++G+A+K     +V D++ F ++ +WS+V PSESE+II
Sbjct  619   IDSFQSEFSNVYWYSVDDDNGIIKGYALKTKCSSNVADEFCFDSRELWSIVLPSESEKII  678

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
              TATRKLNE VHTQAK+  D+DVMYKYIS N+LFVATVAPKA+G+IGSV P+ESWL+VYL
Sbjct  679   TTATRKLNEAVHTQAKLIADQDVMYKYISSNLLFVATVAPKASGEIGSVTPEESWLVVYL  738

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             IDTVTGR+LHRMTH GSQGPV AVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD+
Sbjct  739   IDTVTGRVLHRMTHHGSQGPVQAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDV  798

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KLV+G HNLT PVSSY R EV+ KSQSYFF HS+K IAVT T KGITSKQLLIGTIGDQ
Sbjct  799   WKLVVGNHNLTSPVSSYSRAEVITKSQSYFFTHSLKAIAVTLTVKGITSKQLLIGTIGDQ  858

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             VLALDKRFLDPRR+VNP QAE+E+GIIPLTDSLPIIPQSY+TH+++ EGL+ I+TV AKL
Sbjct  859   VLALDKRFLDPRRSVNPKQAEREEGIIPLTDSLPIIPQSYITHSLRVEGLQSIITVAAKL  918

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTLVFA+G+DLFFT  APS+TYDSLT+DFSYALLL+TIV LV AIF+TWI S++KELQ
Sbjct  919   ESTTLVFAHGLDLFFTHYAPSRTYDSLTEDFSYALLLITIVVLVAAIFVTWILSQRKELQ  978

Query  530   EKWR  519
             ++WR
Sbjct  979   DRWR  982



>ref|XP_006399663.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
 gb|ESQ41116.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
Length=984

 Score =  1365 bits (3533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/984 (70%), Positives = 834/984 (85%), Gaps = 3/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR  LLL+L  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRV+VST
Sbjct  2     AMAIRFTLLLLLFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVIVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D IDG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDAIDGVDIALGKYVITLSSEGSALRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L G+  S+S+L VP+NLKVD+   IL++  GYLHAVS+ DGEV+WKK+   EG ++Q
Sbjct  122   ETSLHGAQHSKSLLSVPTNLKVDKAYPILVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P G+  +Y +G  +SS+ V Y+I+++ GE++  ++M FP GFSG+IS V+S+KVV 
Sbjct  182   RVLQPPGSSIIYVLGFVNSSEAVVYQIDSKSGEVVAQKNMAFPAGFSGEISSVSSDKVVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST SILV+I F DG I+FQ+  I+DLV+D +G A +L   L+ M+A+ +NK  +F+RV
Sbjct  242   LDSTRSILVTIGFLDGDISFQKTSISDLVED-SGKAEILSPLLSNMLAVKVNKRTIFVRV  300

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               EGKLEVVD ++    +S+SL +++   AF  + H   KIHL VK ++D  + LL ES 
Sbjct  301   GGEGKLEVVDSLSDETAMSDSLPVADDQVAFASVHHEGSKIHLMVKLVDDLDTVLLRESI  360

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D  +G VHKVFINNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVT
Sbjct  361   QMDQHRGRVHKVFINNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT  420

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             T+ELPVEKDGVSV+KVE  LF+WLKGH+LKLKGTL+LA+P+DVAAIQ+MR+KSSG++K+T
Sbjct  421   TAELPVEKDGVSVAKVEHTLFDWLKGHMLKLKGTLLLASPEDVAAIQEMRMKSSGRNKLT  480

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL I L+R+GKL+ALHTGDGRIVWS L+N+  KSETCE P+G+ +YQWQVPHH
Sbjct  481   RDHNGFRKLFIALTRAGKLFALHTGDGRIVWSMLLNSPSKSETCERPSGISLYQWQVPHH  540

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVG+CG +S AP VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQR
Sbjct  541   HAMDENPSVLVVGRCGSDSSAPGVLSFVDVYTGKEISSSDMGHSVVQVMPLPFTDSTEQR  600

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ DT+GH HLYP+T EAL IF+ E  N+YWY+V+A+  I+RGHA+K +   +  D+Y
Sbjct  601   LHLIADTNGHVHLYPKTSEALSIFQHEFQNVYWYTVEADEGIIRGHAMKSSCSSETADEY  660

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +W+VVFPSESE++I+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+P
Sbjct  661   CFTTRELWTVVFPSESEKVISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSP  720

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K AG+IGS  P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH
Sbjct  721   KGAGEIGSATPEESTLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAH  780

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             +YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPEV  KSQSYFFA SVKTIAV
Sbjct  781   KYEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEVFTKSQSYFFAQSVKTIAV  840

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSY
Sbjct  841   TSTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSY  900

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TI
Sbjct  901   ITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITI  960

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AI+ITW+ SE+KEL EKWR
Sbjct  961   VALVAAIYITWVLSEKKELSEKWR  984



>ref|XP_004501175.1| PREDICTED: ER membrane protein complex subunit 1-like [Cicer 
arietinum]
Length=981

 Score =  1359 bits (3517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/983 (69%), Positives = 820/983 (83%), Gaps = 4/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FL L+L  S +    S+YEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLTLLLFLSLSNIVSSIYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVLVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG  DV+DG+DIALGKYVITLSSG S LRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTNDVVDGLDIALGKYVITLSSGGSILRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             S L GS  S+SIL VP NLK D+D LIL++  G LHA+S  DGEV+W+K+ A E +++  
Sbjct  121   SSLQGSKESKSILNVPKNLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFAGESIEVTD  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             I+    T+ +Y  G   SS F  Y +NA  GE LK+  +V P   SG++  +  +K V L
Sbjct  181   IIQ--STEVIYVAGFVGSSNFNVYLLNAETGEFLKNNHLVLPFRTSGELLSIPGDKFVVL  238

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS  S +V+I  K+G IN+ Q  I+DL++D +G AV+LPS+L G+ A+ IN +VL ++VT
Sbjct  239   DSARSKIVTINIKNGDINYNQKQISDLIEDSSGQAVILPSRLPGLFALKINSWVLLIKVT  298

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EG+L VV K+   A  S +LS+SE    F  +++   K+HLSVK +NDW S+LL+E+  
Sbjct  299   NEGELVVVHKIDNTAAFSNALSISEDQHVFACVQYEDNKVHLSVKDVNDWNSDLLKENLV  358

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             ID Q+G + K+FINNY+RTDRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVTT
Sbjct  359   IDHQRGNIEKIFINNYVRTDRSHGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVTT  418

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+P+D  AIQ++RL+SS KSKMTR
Sbjct  419   SELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASPEDKVAIQKLRLRSSEKSKMTR  478

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKLLIVL+R+GK++ALHTGDG +VWS + + LRKSE CE+P GL IYQWQVPHHH
Sbjct  479   DHNGFRKLLIVLTRAGKVFALHTGDGHVVWSIMSHTLRKSEECEHPVGLNIYQWQVPHHH  538

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             A+DENPS+LV+G+CG +  AP+VLSF+D+YTGKEL  L   H++A+VIPLPYTDSTEQRL
Sbjct  539   ALDENPSILVIGRCGPSLTAPTVLSFLDAYTGKELNSLSLAHTVARVIPLPYTDSTEQRL  598

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ID + H +LYP+TPEA+ I KRE  NIYWYSV+A+N ++RGHA+K N   +V D+Y 
Sbjct  599   HLIIDINKHAYLYPKTPEAIEILKREFSNIYWYSVEADNGVIRGHALKSNCIHEVVDEYC  658

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F  + +WS+VFPSESE+IIAT +RK NEVVHTQAKV TD DVMYKYISKN+LFVA  APK
Sbjct  659   FVFRDLWSIVFPSESEKIIATVSRKSNEVVHTQAKVMTDHDVMYKYISKNILFVANAAPK  718

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A+G+IG+  P+E+WL++Y+IDTVTGRILHRM H G QGPVHAV SENWVVYHYFNLRAHR
Sbjct  719   ASGEIGTATPEEAWLVIYIIDTVTGRILHRMIHHGCQGPVHAVFSENWVVYHYFNLRAHR  778

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              EMSVIE+YDQSRADNKD+ K VLGKHNLT P+SSY RPEV AKSQSYFF HSVK I VT
Sbjct  779   NEMSVIEVYDQSRADNKDIWKFVLGKHNLTSPISSYYRPEVSAKSQSYFFTHSVKAIEVT  838

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSK LLIGTIGDQVLA+DKRFLDPRRT+NP+QAEKE+GIIPL+DSLPII QSY+
Sbjct  839   STAKGITSKHLLIGTIGDQVLAIDKRFLDPRRTLNPSQAEKEEGIIPLSDSLPIISQSYI  898

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APSKTYDSLT+DFSYALLLLTIV
Sbjct  899   THSLKIEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSKTYDSLTEDFSYALLLLTIV  958

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV A+F+TW+ SE+K+LQEKWR
Sbjct  959   ALVAALFVTWVLSERKDLQEKWR  981



>ref|XP_004291191.1| PREDICTED: ER membrane protein complex subunit 1-like [Fragaria 
vesca subsp. vesca]
Length=985

 Score =  1358 bits (3515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/985 (70%), Positives = 824/985 (84%), Gaps = 4/985 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             +MAIRA LLL+L  S    T SLYEDQVGL+DWHQ+YIGKVK AVFHTQK+GRKRVVVST
Sbjct  2     SMAIRASLLLLLFLSLTTLTVSLYEDQVGLVDWHQQYIGKVKDAVFHTQKSGRKRVVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLR G+IFWRHVLG  DV+DGIDIA+GKYV+TLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVIASLDLRRGEIFWRHVLGSNDVVDGIDIAMGKYVVTLSSEGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESF+ GS  S+S+L VP+NL V+++++IL+Y  G LHAVS  DG  +W K+ A E L++Q
Sbjct  122   ESFIDGSGASKSLLTVPTNLIVNKENVILVYGKGSLHAVSGIDGTPLWTKDFAAESLEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+ P G+D +Y +G   SSQF AY++N   GE+LKH S    GG+SG+  L +S  +V 
Sbjct  182   HIIQPVGSDAIYVLGFVGSSQFDAYQVNPENGEILKHNSAALSGGYSGEAILASSNILVT  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD++ S LV I F+DG +N Q+  I+D++ D +G  VLL SKL GM ++ +N  V  +RV
Sbjct  242   LDASRSKLVVISFQDGELNLQETSISDILGDSSGTPVLLSSKLPGMFSVKVNGGVTLIRV  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T E +LEV+DK+   A IS+++ L+EG QAF L++HG  KIHL+VK  +D   +LL+E+ 
Sbjct  302   TVEARLEVMDKINSVAAISDAIILNEGQQAFALVQHGDSKIHLTVKLSHDLSGDLLKETI  361

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ++ Q+G+VHKVFIN+YIRTDRS GFRALIV+EDHSLLLLQQG IVW+REDGLASIVDV 
Sbjct  362   VMEKQRGMVHKVFINSYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWNREDGLASIVDVL  421

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVE+NLFEWLKGHLLKLKGTLMLA+ DDVAAIQ+ RLKSS KSK+T
Sbjct  422   TSELPVEKEGVSVAKVEENLFEWLKGHLLKLKGTLMLASADDVAAIQERRLKSSEKSKLT  481

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL+IVL+++GKL+ALHTG G++VWS L+  LRKSE CE   GL IYQWQ+PHH
Sbjct  482   RDHNGFRKLIIVLTKAGKLFALHTGYGQVVWSLLLPNLRKSE-CEFATGLNIYQWQLPHH  540

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPS+L+VG+CG  SDAP VLS VD+YTG E+  +   HSI+QVIPLP+TD+TEQR
Sbjct  541   HAMDENPSILIVGRCGQGSDAPGVLSIVDAYTGTEVNSMDLRHSISQVIPLPFTDTTEQR  600

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHLLID + H +LYPRT EA+ IF+RE  NIYWYSV+ NN I++GH +K N  ++V D+Y
Sbjct  601   LHLLIDGNQHAYLYPRTSEAIDIFQREFSNIYWYSVETNNGIIKGHVLKSNCIQEVIDNY  660

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKV-TTDRDVMYKYISKNMLFVATVA  1314
              F ++ +WS++FP++SE+II T TRK NEVVHTQAKV   + D+MYKY+SKN+LFVATVA
Sbjct  661   CFESRDIWSIIFPTDSEKIITTVTRKPNEVVHTQAKVIAAEDDLMYKYVSKNLLFVATVA  720

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PK +G IG+  P+ESWL VYLIDTVTGRILHRMTH G+QGPVHAV SENWVVYHYFNLRA
Sbjct  721   PKGSGAIGTATPEESWLTVYLIDTVTGRILHRMTHHGAQGPVHAVFSENWVVYHYFNLRA  780

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEMSVIEIYDQSRADNKD+ KL+LGKHNLT P+SSY RPEV+ KSQSYFF +SVK I 
Sbjct  781   HRYEMSVIEIYDQSRADNKDVWKLILGKHNLTSPISSYSRPEVVTKSQSYFFTYSVKAID  840

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VT TAKGITSKQLLIGTIGDQVLALDKRFLDPRR++NP+QAEKE+GIIPLTDSLPIIPQS
Sbjct  841   VTLTAKGITSKQLLIGTIGDQVLALDKRFLDPRRSLNPSQAEKEEGIIPLTDSLPIIPQS  900

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTHA++ EGLRGIVT PAKLESTTLVF YGVDLFFTQLAPS+TYDSLTDDFSYALLL+T
Sbjct  901   YVTHALRVEGLRGIVTAPAKLESTTLVFVYGVDLFFTQLAPSRTYDSLTDDFSYALLLIT  960

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IV L+ AIF+TWI SE+KEL+EKWR
Sbjct  961   IVVLIAAIFVTWILSEKKELREKWR  985



>gb|KEH36041.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=983

 Score =  1355 bits (3507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/984 (69%), Positives = 819/984 (83%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR FL  +L  S      SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRV+VST
Sbjct  2     AMAIRVFLSFLLFLSLTNLASSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDVVDGIDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ES L GS  S+SIL +P NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ 
Sbjct  122   ESSLQGSKESKSILNIPKNLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVS  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+     + +Y  G   SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V 
Sbjct  182   HIIQ--SPEVIYVAGFVGSSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD   S +V+I   +G IN+ Q  ++DL++D +G AV+LPSKL G+ A+ IN  VL ++V
Sbjct  240   LDDVRSKIVTIDINNGNINYNQKQVSDLIKDSSGQAVILPSKLPGLFALKINSQVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L  +D++   A  S +LS+SE    F  +++   KI LSVK +NDW   LL+E+ 
Sbjct  300   TNEGELVALDQIDNTAAFSNALSISEDQHVFAFVQYEDNKIQLSVKDVNDWNGALLKENL  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G + K+FINNY+RTDRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNIEKIFINNYVRTDRSHGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+ ++  AIQ++RL+SS KSKMT
Sbjct  420   TSELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASAEEKIAIQKLRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGRIVWS  ++ALRKSE CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRIVWSTTLHALRKSEDCEHPVGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LV+G+CG +  AP+V+SF+D+YTGKEL  L   H++A+VIPLPYTDSTEQR
Sbjct  540   HALDENPSLLVIGRCGPSVTAPTVISFLDAYTGKELNSLSLAHTVARVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID + H +LYPRTPEA+ I KRE  NIYWYSV+ +N ++RGHA+K N   ++ D+Y
Sbjct  600   LHLIIDVNKHAYLYPRTPEAIEILKREFSNIYWYSVETDNGVIRGHALKSNCIHEIVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKYISKN+LFVA  AP
Sbjct  660   CFVFRDLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYISKNILFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+G+IG+  P+E+ L++Y+IDTVTGRILHRMTH G QGPVHAV SENWVVYHYFNLRAH
Sbjct  720   KASGEIGTATPEEATLVIYIIDTVTGRILHRMTHHGCQGPVHAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R+EMSVIE+YDQSRADNKD+ K VLGKHNLT P+SSY RPE+ AKSQSYFF HSVK I V
Sbjct  780   RHEMSVIEVYDQSRADNKDIWKFVLGKHNLTSPISSYYRPEISAKSQSYFFTHSVKAIEV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  840   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV A+F+T++ SE+K+L+EKWR
Sbjct  960   VALVAALFVTYVLSERKDLEEKWR  983



>ref|XP_010491889.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =  1345 bits (3482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/983 (69%), Positives = 826/983 (84%), Gaps = 7/983 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FLLL +  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLLLPVFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  +  S+S+L VP NLKVD+D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q 
Sbjct  121   TALHSAHHSKSLLSVPINLKVDKDYPITVFGGGYLHAVSALDGEVLWEKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G  + S+ V Y+I+++ GE+L  +SM FPGGFSG+IS V+S+KVV L
Sbjct  181   VLQPLGSTVIYVLGFVNLSEAVVYQIDSKSGEVLAQKSMAFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST SILV+I F DG I+FQ+  I+DLV+D +G A +L   L+ M+A+ +NK  +F++V 
Sbjct  241   DSTKSILVTIGFLDGDISFQKTPISDLVED-SGNAEILSPLLSNMLAVKVNKRTVFVKVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL++++  +AF  + H   KIHL VK +N+  + LL E+  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLAVADDQEAFASVHHEGSKIHLMVKLVNELDNVLLRETIE  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G VHKVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVTT
Sbjct  360   MDQHRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELPVEKDGVSV+KVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ++R+KSSGK+K+TR
Sbjct  420   AELPVEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQELRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R GKL+ALHTGDGRIVWS L+    KS+ CE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRGGKLFALHTGDGRIVWSMLL----KSQACERPNGISLYQWQVPHHH  535

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMD+NPSVLVVG+CG +S AP VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQRL
Sbjct  536   AMDKNPSVLVVGRCGSDSSAPGVLSFVDVYTGKEITSSDIGHSVVQVLPLPFTDSTEQRL  595

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  NIYWY+V+A++ I+RGH +K +   +  D+Y 
Sbjct  596   HLIADTVGHVHLYPKTSEALSIFQREFQNIYWYTVEADDGIIRGHVMKSSCSGETADEYC  655

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+SKN+LFVATV+PK
Sbjct  656   FTTRELWTVVFPSESEKIISTLTRKSNEVVHTQAKVNTDQDLLYKYVSKNLLFVATVSPK  715

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  716   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  775

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTIAVT
Sbjct  776   YEVTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVT  835

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSYV
Sbjct  836   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSYV  895

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ + EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  896   THSHRVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  955

Query  587   alvvaifiTWIWSEQKELQEKWR  519
              LV AI+ITW  SE+KEL EKWR
Sbjct  956   VLVAAIYITWALSEKKELSEKWR  978



>ref|XP_009125814.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1-like [Brassica rapa]
Length=984

 Score =  1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/984 (69%), Positives = 824/984 (84%), Gaps = 3/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAI+A LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRV+VST
Sbjct  2     AMAIKASLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVIVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  D IDG++IALGKYVITLSS GSTLRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDAIDGVEIALGKYVITLSSQGSTLRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L  +  S+S+L VP NLKVD+D  IL +  GYLHAVS+ DGEV+ KK+   EG DIQ
Sbjct  122   ETSLHSAQISKSLLSVPINLKVDKDYPILAFGGGYLHAVSAIDGEVLXKKDFTAEGYDIQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P  +  +Y +G   SS+ V Y+I+++ GE++  +SMVFP GFSG +S V+S+K+V 
Sbjct  182   RVLQPPESSIIYVLGFLHSSEAVVYQIDSKTGEVVAEKSMVFPDGFSGAVSSVSSDKIVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST SILV+I F DG I+FQ+  ++DLV+D   A +L P  L+ MVA+ +N+  +F+RV
Sbjct  242   LDSTRSILVTIGFLDGDISFQKTPVSDLVEDSGNAEILSP-LLSNMVAVKVNRRTIFVRV  300

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               EGKLEVVD ++    +S SL +++   AF    H   KI L VK ++D  + LL ES 
Sbjct  301   GGEGKLEVVDSLSDETAMSVSLPVADDQVAFASAHHEGSKIQLMVKLVDDLETVLLRESI  360

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D  +G V KVFINNYI+TD S GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVT
Sbjct  361   EMDQHRGRVDKVFINNYIKTDMSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT  420

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             T+ELPVEKDGVSV+KVE  L +WLKGH+LKLKG+L+LA+P+DVAAIQ+MR+KSSG+SK+T
Sbjct  421   TAELPVEKDGVSVAKVEHTLVDWLKGHMLKLKGSLLLASPEDVAAIQEMRMKSSGRSKLT  480

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL I L+R+GKL+ALHTGDGRIVWS L+N+  KSE CE P+G+ +YQWQVPHH
Sbjct  481   RDHNGFRKLFIALTRAGKLFALHTGDGRIVWSMLLNSPSKSEACERPSGISLYQWQVPHH  540

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVG+CG +S AP VLSFVD YTGKE+      HS+ +V+PLP+TDSTEQR
Sbjct  541   HAMDENPSVLVVGRCGSDSSAPGVLSFVDVYTGKEISSSDIGHSVVRVMPLPFTDSTEQR  600

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ DT+GH HLYP+T EAL IF+RE  N+YWY+V+ ++ I+RGH +K +   +  D+Y
Sbjct  601   LHLIADTEGHVHLYPKTSEALSIFQREFQNVYWYTVEGDDGIIRGHGMKSSCAGETADEY  660

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F TK +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+P
Sbjct  661   CFTTKELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSP  720

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH
Sbjct  721   KGAGEIGSVTPEESALVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAH  780

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             +YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPE+  KSQSYFFA SVKTIAV
Sbjct  781   KYEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEMFTKSQSYFFAQSVKTIAV  840

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSY
Sbjct  841   TSTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSY  900

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSL DDFSYALLL+TI
Sbjct  901   ITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLADDFSYALLLITI  960

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AI+ITW+ SE+KEL EKWR
Sbjct  961   VALVAAIYITWVISEKKELSEKWR  984



>ref|XP_010541259.1| PREDICTED: ER membrane protein complex subunit 1 [Tarenaya hassleriana]
Length=983

 Score =  1342 bits (3473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/983 (70%), Positives = 826/983 (84%), Gaps = 4/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR  L+L+L  SSA  + SLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRVVVSTE
Sbjct  3     MAIRVSLVLLLFLSSAIVSLSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVVVSTE  62

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             EN +ASLDLR G+IFWRHVLG  DVI+GIDIALGKYVITLSS GS LRAWNLPDGQMVWE
Sbjct  63    ENAIASLDLRLGEIFWRHVLGANDVINGIDIALGKYVITLSSEGSILRAWNLPDGQMVWE  122

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L G   S+ +LLVP+NLKV RD  IL++    L AVS  DGE++WKK+   +GL++Q 
Sbjct  123   TALHGVKHSKPLLLVPTNLKVGRDYPILVFGGRSLQAVSGVDGEILWKKDFEPDGLEVQK  182

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G + SSQ   ++I+A+ GE + H+SM+FPGGFSG++S V+S+K+  L
Sbjct  183   VLQPSGSSMLYVLGFSDSSQVDVHQIDAKTGEAVTHKSMMFPGGFSGEVSSVSSDKLAVL  242

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST S LV+I F DG I+FQQ  I+DLV+D +G   +LPS L+ M+A+ +NK  + LRV 
Sbjct  243   DSTRSTLVTISFLDGDISFQQKLISDLVED-SGEVEILPSVLSNMLALKVNKRTILLRVN  301

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGK+E+ D ++    IS SL +++  +AF LI+H   KIH  VK +ND  + LL ES  
Sbjct  302   GEGKMELADTLSDETAISNSLPVADDQEAFALIQHEGNKIHFEVKLVNDRETVLLSESIQ  361

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             ++  +GLVHKVFINNYIRTDR+ GFRALIV+ED SLLLLQQG IVWSREDGLASI+ VTT
Sbjct  362   MEQHRGLVHKVFINNYIRTDRTNGFRALIVMEDQSLLLLQQGAIVWSREDGLASIIGVTT  421

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             SELPVEKDGVSV++VE NLFEWLKGH+LKLKGTLMLA+PDDVAAIQ MRLKSS KSK+TR
Sbjct  422   SELPVEKDGVSVAEVEHNLFEWLKGHVLKLKGTLMLASPDDVAAIQAMRLKSSEKSKLTR  481

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             D NGFRKL+I L+R+GKL+ALHTG+GRIVWS L+N+LRKSETC NP+G+ ++QWQ+PHH 
Sbjct  482   DRNGFRKLIIALTRAGKLFALHTGEGRIVWSVLLNSLRKSETCRNPSGINLFQWQIPHH-  540

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMD+NPSVLVVG+CG  S AP VLSFVD+YTGKE   L   HS+ QVI LP+TDSTEQRL
Sbjct  541   AMDKNPSVLVVGRCGPGSSAPGVLSFVDAYTGKEHSSLGVDHSVVQVISLPFTDSTEQRL  600

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL++DTD   HLYP+T E+L IF++EL N+YWYSV+A+N I+RGHA+K +   +  D Y 
Sbjct  601   HLMVDTDRRVHLYPKTSESLRIFQQELQNVYWYSVEADNGIIRGHAMKSSCSDETADVYC  660

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T T   NEVVHTQAK   D+DVMYKYISKN+LFVATV+PK
Sbjct  661   FTTRELWTVVFPSESEKIISTLTPTPNEVVHTQAKAVADQDVMYKYISKNLLFVATVSPK  720

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
               GDIGSV P+ES L+VYLIDT+TGRILHRM+HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  721   GDGDIGSVTPEESTLVVYLIDTITGRILHRMSHQGCQGPVHAVFSENWVVYHYFNLRAHK  780

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPEV+ KSQSYFFAHSVKT+AVT
Sbjct  781   YEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEVITKSQSYFFAHSVKTMAVT  840

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQVLALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLP+IPQ+YV
Sbjct  841   STAKGITSKQLLIGTIGDQVLALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPVIPQTYV  900

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH++K EGLRGIVT PAKLEST+ VFAYG+D+F+T+LAPS+TYDSLTDDFSYALLL+TIV
Sbjct  901   THSLKVEGLRGIVTEPAKLESTSHVFAYGMDIFYTRLAPSRTYDSLTDDFSYALLLITIV  960

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALVVAI++TW+ SE+KEL++KWR
Sbjct  961   ALVVAIYVTWVLSEKKELRDKWR  983



>ref|XP_010925904.1| PREDICTED: ER membrane protein complex subunit 1 [Elaeis guineensis]
Length=983

 Score =  1341 bits (3470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/984 (68%), Positives = 819/984 (83%), Gaps = 4/984 (0%)
 Frame = -2

Query  3461  MAIRAFL-LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             MA+R  L  L+L+  S ++T +LYEDQVGL DWHQ+YIGKVK AVF TQ+ G+KRVVVST
Sbjct  1     MAVRVCLGFLILLLHSNFST-ALYEDQVGLADWHQKYIGKVKQAVFPTQRTGKKRVVVST  59

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLR GDIFWRHVLG  D +D IDIALGKY ITLSS GS LRAWNLPDGQM+W
Sbjct  60    EENVIASLDLRTGDIFWRHVLGKDDHVDQIDIALGKYFITLSSEGSILRAWNLPDGQMMW  119

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ES L GS+PS+S+L VP+N  + +++ IL++S G+LHAVSS DGE+IWKKE A + L+I+
Sbjct  120   ESALYGSTPSKSLLFVPANTNLGKENRILVFSGGWLHAVSSIDGEIIWKKEFAIDRLEIK  179

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              +  P  +D +YAVG   SSQF  Y+++++ GE+LKH +  FP GF G++SLV+S+ +VA
Sbjct  180   QVFQPLESDIIYAVGFVGSSQFSVYQLSSKSGEVLKHNTASFPSGFCGEVSLVSSDMLVA  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+T S L+SI F+ G+INF Q +I+DL+QDF+G A LLP K TGM A+     +  +RV
Sbjct  240   LDATRSALISISFQSGIINFHQTYISDLLQDFSGMAALLPVKFTGMFAVKTVSGICLVRV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
                 +LEV++K  + A +S+ L++S   QAF +++H   KI   VK   D  +++L+E+ 
Sbjct  300   KGVSELEVIEKFNHPASVSDVLTISGEQQAFAIVQHAETKIDFKVKLDKDLRNDVLKETV  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D Q+G V KVFINNYIRTD+S+GFRALIV+EDHSLLL+QQGEIVWSREDGLASI+D T
Sbjct  360   EMDPQRGHVQKVFINNYIRTDKSHGFRALIVMEDHSLLLVQQGEIVWSREDGLASIIDST  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVE NLFEWLKGH+LKLKGTLMLA+PD++AAIQ MRLKSS ++KMT
Sbjct  420   TSELPVEKEGVSVAKVEHNLFEWLKGHVLKLKGTLMLASPDEIAAIQAMRLKSSERNKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL+IVL+R+GKL ALHTGDGR++WS L+ +L +SE C +P+ L IYQWQVPHH
Sbjct  480   RDHNGFRKLIIVLTRAGKLLALHTGDGRVIWSLLLPSLHRSEACGHPSALNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAM ENPSVLVVG+CG + DA  V S VDSYTGKE   LK  HSI QVIPLP TDSTE+R
Sbjct  540   HAMHENPSVLVVGRCGPSHDALGVFSVVDSYTGKERNSLKLAHSIIQVIPLPLTDSTEKR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDY  1491
             LHL+ID +   HLYPRT +++ IF  E+ NIYW+S++    ++RG++++     DV D+Y
Sbjct  600   LHLIIDANLQAHLYPRTRDSVNIFLHEMSNIYWHSINVGKGVIRGYSLRSGCNLDVVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F TK +W +VFPSESE+I  TATRK+NEVVHTQAKV  D+DVMYKYIS+N+LFVATVAP
Sbjct  660   CFNTKELWRIVFPSESEKIATTATRKMNEVVHTQAKVLADQDVMYKYISRNILFVATVAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KAAG+IGSV P+E+WL+ YLIDTVTGRILHR+THQG+QGP+ AV+SENWVVYHYFNLRAH
Sbjct  720   KAAGEIGSVTPEEAWLVAYLIDTVTGRILHRVTHQGAQGPIRAVVSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRADNKD+ KLVLGKHNLT PVSSY RPEV+ KSQSYFF HSVK +AV
Sbjct  780   RYEMSVIEIYDQSRADNKDVRKLVLGKHNLTSPVSSYSRPEVMVKSQSYFFTHSVKAMAV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T+TAKGITS QLLIGTIGDQVLALDKRFLDPRRT  PTQAEKE+GIIPLTDSLPIIPQ+Y
Sbjct  840   TATAKGITSLQLLIGTIGDQVLALDKRFLDPRRTATPTQAEKEEGIIPLTDSLPIIPQAY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             VTHA++ EGLRGI+T+PAKLESTTLVF+YGVD+FFT++APS+TYDSLT+DFSYALLL+TI
Sbjct  900   VTHALQVEGLRGIITIPAKLESTTLVFSYGVDIFFTRIAPSRTYDSLTEDFSYALLLITI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AIF+TWI SE+KEL+EKWR
Sbjct  960   VALVAAIFVTWILSEKKELREKWR  983



>ref|XP_010419729.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =  1339 bits (3466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/983 (69%), Positives = 827/983 (84%), Gaps = 7/983 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FL+LVL  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLVLVLFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  +  S+S+L VP NLKVD+D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q 
Sbjct  121   TALHSAHHSKSLLSVPINLKVDKDYPITVFGGGYLHAVSALDGEVLWEKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G  + S+ V Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV L
Sbjct  181   VLQPLGSTVIYVLGFVNLSEAVVYQIDSKIGEVVAQKSMVFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS  SILV+I F DG I+FQ+  ++DLV++ +G A +L   L+ M+A+ +NK  +F++V 
Sbjct  241   DSKKSILVTIGFIDGDISFQKTPVSDLVEN-SGNAEILSPLLSNMLAVKVNKRTIFVKVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL +++  +AF  + H   KIHL VK +N+  + LL E+  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSKIHLMVKLVNELDNVLLRETIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G VHKVF+NNY+RTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVTT
Sbjct  360   MDQHRGRVHKVFMNNYVRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELPVEKDGVSV+KVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ++R+KSSGK+K+TR
Sbjct  420   AELPVEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQELRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R+GKL+ALHTGDGRIVWS L+    KS+ CE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRAGKLFALHTGDGRIVWSMLL----KSQACERPNGISLYQWQVPHHH  535

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMD+NPSVLVVG+CG +S AP VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQRL
Sbjct  536   AMDKNPSVLVVGRCGSDSSAPGVLSFVDVYTGKEITSSDIGHSVVQVLPLPFTDSTEQRL  595

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  NIYWY+V A++ I+RGH +K +   +  D+Y 
Sbjct  596   HLIADTVGHVHLYPKTSEALSIFQREFQNIYWYTVGADDGIIRGHVMKSSCSGETADEYC  655

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+PK
Sbjct  656   FTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSPK  715

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  716   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  775

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTIAVT
Sbjct  776   YEVTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVT  835

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSYV
Sbjct  836   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSYV  895

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ + EGL+GIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  896   THSHRVEGLKGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  955

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW  SE+KEL EKWR
Sbjct  956   ALVAAIYITWALSEKKELSEKWR  978



>emb|CDX69747.1| BnaA10g20960D [Brassica napus]
Length=1546

 Score =  1338 bits (3462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/984 (68%), Positives = 824/984 (84%), Gaps = 7/984 (1%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRV+VST
Sbjct  568   AMALRLYLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVIVST  627

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG KD IDG+DIALGKYVITLSS GS +RAWNLPDGQMVW
Sbjct  628   EENVVASLDLRHGEIFWRHVLGTKDAIDGVDIALGKYVITLSSEGSMVRAWNLPDGQMVW  687

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L  +  S+S+L VP NLKVD+D  IL++  GYLHAVS  DGEV+WKK+   EG ++Q
Sbjct  688   ETSLHSAQHSKSLLSVPVNLKVDKDYPILVFGGGYLHAVSPIDGEVLWKKDFTAEGFEVQ  747

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P  +  +Y +G   SS+ + Y+I+++ GE++  +S  FPGGFSG+++ V+++KVV 
Sbjct  748   RVLQPLESSIIYVLGFLHSSEAIVYQIDSKSGEVVAEKSKAFPGGFSGEVASVSNDKVVV  807

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST SILV+I F D  I+FQ+  I+DLV+D +G A +L   L+ M+A+ +NK  +F+RV
Sbjct  808   LDSTRSILVTISFVDEEISFQKTLISDLVED-SGEAEILSPLLSNMLAVKVNKRTIFVRV  866

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               +GKLE+VD ++    +S+SL +++   AF  + H   KIHL+VK ++D  + LL ES 
Sbjct  867   GDQGKLEMVDSLSDETAMSDSLPVADDQVAFASVHHEGSKIHLTVKLVDDLDTVLLRESI  926

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D  +G V KVFINNYI+TDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVT
Sbjct  927   QMDQHRGRVDKVFINNYIKTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT  986

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             T+ELPVEKDGVSV+KVE  L +WLKGH+LKLKG+L+LA+P+DV AIQ+MR+KSSG+SK+T
Sbjct  987   TAELPVEKDGVSVAKVEHTLVDWLKGHILKLKGSLLLASPEDVVAIQEMRMKSSGRSKLT  1046

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL I L+R+GKLYALHTGDGRIVWS L+    KS  C  P+G+ +YQWQVPHH
Sbjct  1047  RDHNGFRKLFIALTRAGKLYALHTGDGRIVWSTLL----KSPACARPSGISLYQWQVPHH  1102

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVG+CG +S +P VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQR
Sbjct  1103  HAMDENPSVLVVGRCGSDSSSPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPFTDSTEQR  1162

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ DTDGH HLYP+T EAL IF+RE  N+YWY+V+ ++ I+RGH +K +   +  D+Y
Sbjct  1163  LHLIADTDGHVHLYPKTSEALSIFQREFQNVYWYNVEGDDGIVRGHGMKSSCSGETADEY  1222

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV+TD+DV+YKY+S+N+LFVATV+P
Sbjct  1223  CFTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVSTDQDVLYKYVSRNLLFVATVSP  1282

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K AG+IGSV P+ES L+VYLIDTVTGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH
Sbjct  1283  KGAGEIGSVTPEESALVVYLIDTVTGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAH  1342

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             +YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPE+  KSQSYFF  SVKTIAV
Sbjct  1343  KYEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEMFTKSQSYFFPQSVKTIAV  1402

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSY
Sbjct  1403  TSTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSY  1462

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TI
Sbjct  1463  ITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITI  1522

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AI+ITW  SE+KEL EKWR
Sbjct  1523  VALVAAIYITWALSEKKELSEKWR  1546



>ref|XP_002873520.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49779.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
Length=982

 Score =  1332 bits (3447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/983 (69%), Positives = 827/983 (84%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FL L+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLTLLLFLSSAIVSFSLYEDQAGLTDWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GS LRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSALRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  +  S+S+L VP NLKVD+D  I+++  GYLHAVS+ DGEV+WKK+   EG ++Q 
Sbjct  121   TSLHTAQHSKSLLSVPINLKVDKDYPIIVFGGGYLHAVSAIDGEVLWKKDFTVEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G  + S+ V Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV L
Sbjct  181   VLQPPGSSIIYVLGFINLSEAVVYQIDSKSGEVVAQKSMVFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST SILV+I F DG ++FQ+  I+DLV+D +G A +L + L+ M+A+ +NK  LF++V 
Sbjct  241   DSTRSILVTIGFIDGGLSFQKTPISDLVED-SGKAEILSALLSNMLAVKVNKRTLFVKVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL +++  +AF  + H   KIHL VK +N+  + LL E+  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSKIHLMVKLVNELDNVLLRETIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G VHKVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVTT
Sbjct  360   MDQHRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELP+ KDGVSVSKVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ++R+KSSGK+K+TR
Sbjct  420   AELPLGKDGVSVSKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQELRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R GKL+ALHTGDGRIVWS L+ +   S+ CE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRPGKLFALHTGDGRIVWSMLLKSPSNSQACERPNGISLYQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMDENPSVLVVGKCG +S AP VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQRL
Sbjct  540   AMDENPSVLVVGKCGSDSSAPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPFTDSTEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  N+YWY+V+A++ I+RGH +K +   +  D+Y 
Sbjct  600   HLIADTVGHVHLYPKTSEALSIFQREFQNVYWYTVEADDGIIRGHVMKGSCSGETADEYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+PK
Sbjct  660   FTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  720   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTI VT
Sbjct  780   YEVTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIEVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTD+LPIIPQ+YV
Sbjct  840   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDTLPIIPQAYV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  900   THSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW+ SE+KEL EKWR
Sbjct  960   ALVAAIYITWVLSEKKELSEKWR  982



>emb|CDX91208.1| BnaC02g03890D [Brassica napus]
Length=997

 Score =  1331 bits (3445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/998 (68%), Positives = 829/998 (83%), Gaps = 18/998 (2%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR  LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRV+VSTE
Sbjct  1     MAIRVSLLLLVFLSSAVVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGK---------------YVITLSS-GS  3150
             ENV+ASLDLRHG+IFWRHVLG  D IDG+DIALGK               YVITLSS GS
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTNDAIDGVDIALGKCRNHLHYMRCSTISGYVITLSSQGS  120

Query  3149  TLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEV  2970
             TLRAWNLPDGQMVWE+ L  +  S+S+L VP NLKVD+D  IL++  GYLHAVS+ DGEV
Sbjct  121   TLRAWNLPDGQMVWETSLHSAQSSKSLLSVPINLKVDKDYPILVFGGGYLHAVSAIDGEV  180

Query  2969  IWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGF  2790
             +WKK+   EG ++Q ++ P  +  +Y +G   SS+ V Y+I+++ GE++  +SMVFPGGF
Sbjct  181   LWKKDFTAEGFEVQRVLQPPESSIIYVLGFLHSSEAVVYQIDSKTGEVVAQKSMVFPGGF  240

Query  2789  SGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGM  2610
             SG IS V+S+KVV LDST SILV+I F DG INFQ+  I+DLV++ +G A +L   L+ M
Sbjct  241   SGAISSVSSDKVVVLDSTRSILVTIGFLDGDINFQKTPISDLVEN-SGNAEILSPLLSNM  299

Query  2609  VAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVK  2430
             +A+ +NK  +F+RV  EGKLEVVD ++    +S+SL +++   AF    H   KI L VK
Sbjct  300   LAVKVNKRTIFVRVGGEGKLEVVDSLSDETAMSDSLPVADDQVAFASAHHEGSKIQLMVK  359

Query  2429  SINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIV  2250
              ++D  + LL ES  +D  +G V KVFINNYI+TDRS GFRALIV+EDHSLLLLQQG IV
Sbjct  360   LVDDLDTVLLRESIEMDQHRGHVDKVFINNYIKTDRSNGFRALIVMEDHSLLLLQQGAIV  419

Query  2249  WSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAI  2070
             WSRE+GLAS+ DVTT+ELPVEKDGVSV+KVE  L +WLKGH+LKLKG+L+LA+P+DVAAI
Sbjct  420   WSREEGLASVTDVTTAELPVEKDGVSVAKVEHTLVDWLKGHMLKLKGSLLLASPEDVAAI  479

Query  2069  QQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             Q+MR+KSSG+SK+TRDHNGFRKL I L+R+GKL+ALHTGDGRIVWS L+N+  KSE CE 
Sbjct  480   QEMRMKSSGRSKLTRDHNGFRKLFIALTRAGKLFALHTGDGRIVWSMLLNSPTKSEACER  539

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIA  1710
             P+G+ +YQWQVPHHHAMDENPSVLVVG+CG +S AP VLSFVD YTGKE+      HS+ 
Sbjct  540   PSGINLYQWQVPHHHAMDENPSVLVVGRCGSDSSAPGVLSFVDVYTGKEISSSDIGHSVV  599

Query  1709  QVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGH  1533
             +V+PLP+TDSTEQRLHL+ DT+GH HLYP+T EAL IF+RE  N+YWY+V+ ++ I+RG 
Sbjct  600   RVMPLPFTDSTEQRLHLIADTEGHIHLYPKTSEALSIFQREFQNVYWYTVEGDDGIIRGQ  659

Query  1532  AVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYK  1353
              +K +   +  D+Y F TK +W+VVFPSESE+II+T TRK NEVVHTQAKV+TD+D++YK
Sbjct  660   GMKSSCAGETADEYCFTTKELWTVVFPSESEKIISTLTRKPNEVVHTQAKVSTDQDLLYK  719

Query  1352  YISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLS  1173
             Y+S+N+LFVATV+PK AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV S
Sbjct  720   YVSRNLLFVATVSPKGAGEIGSVTPEESALVVYLIDTITGRILHRLSHQGCQGPVHAVFS  779

Query  1172  ENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKS  993
             ENWVVYHYFNLRAH++E++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPE+  KS
Sbjct  780   ENWVVYHYFNLRAHKHEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEMFTKS  839

Query  992   QSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGI  813
             QSYFFA SVKTIAVTSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GI
Sbjct  840   QSYFFAQSVKTIAVTSTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGI  899

Query  812   IPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDS  633
             IPLTDSLPIIPQSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDS
Sbjct  900   IPLTDSLPIIPQSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDS  959

Query  632   LTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             LTDDFSYALLL+TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  960   LTDDFSYALLLITIVALVAAIYITWVVSEKKELSEKWR  997



>gb|KHG08509.1| Uncharacterized protein F383_13837 [Gossypium arboreum]
Length=980

 Score =  1330 bits (3443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/966 (70%), Positives = 801/966 (83%), Gaps = 11/966 (1%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
              SLYEDQVGL+DWHQ+Y+GKVK AVFHT K GRKRVVVSTEENV+ASLDLR G+IFWRHV
Sbjct  22    LSLYEDQVGLVDWHQQYLGKVKQAVFHTHKTGRKRVVVSTEENVVASLDLRQGEIFWRHV  81

Query  3224  LGHKDVIDGIDIALGKY---VITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPS  3054
             LG  DVIDGIDIALGK     I      ++ +    DG  +   F SGS      L + +
Sbjct  82    LGSNDVIDGIDIALGKCHYPFIRRKYFESMESSRWADGVGI---FSSGSKA----LKIIT  134

Query  3053  NLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTS  2874
             NLK+++D++++I+S+G L+AVS  DGEV+W+K+   E L +Q ++ P G++ +Y VG  S
Sbjct  135   NLKIEKDNIVIIFSNGRLNAVSCIDGEVLWEKDFEGESLKVQQVIQPPGSNLIYVVGFVS  194

Query  2873  SSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLI  2694
             SS F  Y+INA  GELLKHES  F GGF G++S V SE VVALDSTG IL++I F++G I
Sbjct  195   SSLFEMYQINALNGELLKHESAAFSGGFLGEVSPVFSETVVALDSTGLILLTISFQNGKI  254

Query  2693  NFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVI  2514
             +F Q  I++LV+D  G A ++ S +TG+ AI +N   + +RV  E KLEVV+K  +   I
Sbjct  255   SFHQTPISNLVKDSFGPAKIITSSVTGIFAIKMNAVTIVIRVKDESKLEVVEKTNHETSI  314

Query  2513  SESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYI  2334
             S++LS+SEG QAF L++H   +IHL VK  ++W  NLL+ES  +D  +GLVHKV+INNYI
Sbjct  315   SDALSISEGQQAFALVQHASHEIHLRVKLAHNWDDNLLKESVKMDQHRGLVHKVYINNYI  374

Query  2333  RTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQ  2154
             RTD+SYGFRALIV+EDHSLLLLQQGEIVWSREDGLASI+DVTTSELPVE+DGVSV+KVE 
Sbjct  375   RTDKSYGFRALIVMEDHSLLLLQQGEIVWSREDGLASIIDVTTSELPVERDGVSVAKVEH  434

Query  2153  NLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGK  1974
             NLFEWLKGH+LKLKGTLMLA+P DVAAIQ MRLK+S KSKMTRDHNGFRKLLIVL+R+GK
Sbjct  435   NLFEWLKGHMLKLKGTLMLASPQDVAAIQSMRLKNSEKSKMTRDHNGFRKLLIVLTRAGK  494

Query  1973  LYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLN  1794
             L+ALHTGDG IVWS+L+ +L+KS+ C++P GL +Y+WQVPHHHAMDENPSVLV+GKCG +
Sbjct  495   LFALHTGDGHIVWSYLLQSLQKSKVCQHPIGLNLYKWQVPHHHAMDENPSVLVIGKCGPS  554

Query  1793  SDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTP  1614
             SDAP  LSFVD+YTGKEL  L  VHS+AQVIPLPYTDSTEQ LHLLID D H HLYP+TP
Sbjct  555   SDAPGALSFVDTYTGKELSSLSLVHSVAQVIPLPYTDSTEQCLHLLIDADKHAHLYPKTP  614

Query  1613  EALGIFKRELGNIYWYSV-DANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQ  1437
             EA+  F+RE  NIYWYSV D N I++GHA++     +V D+  F T+ +WS+VFPSESE+
Sbjct  615   EAISTFEREFSNIYWYSVEDDNGIIKGHALRGKCTGEVADEVCFDTRELWSIVFPSESEK  674

Query  1436  IIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIV  1257
             IIA  TRKLNEVVHTQAKV  D++VMYKYIS+N+LFVATVA K + +IGSV P+ESWL+ 
Sbjct  675   IIAIVTRKLNEVVHTQAKVIADQEVMYKYISRNLLFVATVALKGSVEIGSVTPEESWLVA  734

Query  1256  YLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNK  1077
             YLIDTVTGRILHR+TH GSQGPVHAV SENWVVYHYFNL+AHRYEMSVIEIYDQSRADNK
Sbjct  735   YLIDTVTGRILHRVTHHGSQGPVHAVFSENWVVYHYFNLKAHRYEMSVIEIYDQSRADNK  794

Query  1076  DLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIG  897
             D+ KLVLGKHNLT P+S Y RP+V+ KSQSYFF HSVK IAVTST KGITSKQLLIGTIG
Sbjct  795   DVWKLVLGKHNLTSPISLYSRPDVITKSQSYFFTHSVKAIAVTSTTKGITSKQLLIGTIG  854

Query  896   DQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPA  717
             DQVLALDKRFLDPRRTVNPTQAEKE+GIIPLTDSLPIIPQSYVTHA++ EGLRGI+TVPA
Sbjct  855   DQVLALDKRFLDPRRTVNPTQAEKEEGIIPLTDSLPIIPQSYVTHALRVEGLRGIITVPA  914

Query  716   KLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKE  537
             KLESTTLVFA+GVDLFFTQLAPS+TYDSLTDDF+YALLL+TIVAL+ AIF+TW  SE+KE
Sbjct  915   KLESTTLVFAHGVDLFFTQLAPSRTYDSLTDDFNYALLLITIVALLAAIFVTWTLSERKE  974

Query  536   LQEKWR  519
             LQE WR
Sbjct  975   LQENWR  980



>ref|NP_196717.3| PQQ_DH domain-containing protein [Arabidopsis thaliana]
 gb|AED91695.1| PQQ_DH domain-containing protein [Arabidopsis thaliana]
Length=982

 Score =  1330 bits (3441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/983 (69%), Positives = 826/983 (84%), Gaps = 3/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FL L+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLTLLLFLSSAILSFSLYEDQAGLTDWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  +  S+S+L VP NLKVD+D  I ++  GYLHAVS+ DGEV+WKK+   EG ++Q 
Sbjct  121   TSLHTAQHSKSLLSVPINLKVDKDYPITVFGGGYLHAVSAIDGEVLWKKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++   G+  +Y +G   SS+ V Y+I+++ GE++  +S VFPGGFSG+IS V+S+KVV L
Sbjct  181   VLQAPGSSIIYVLGFLHSSEAVVYQIDSKSGEVVAQKSTVFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST SILV+I F DG I+FQ+  I+DLV+D +G A +L   L+ M+A+ +NK  +F+ V 
Sbjct  241   DSTRSILVTIGFIDGDISFQKTPISDLVED-SGTAEILSPLLSNMLAVKVNKRTIFVNVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              +GKLEVVD ++    +S+SL +++  +AF  + H   +IHL VK +ND  + LL E+  
Sbjct  300   DKGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSRIHLMVKLVNDLNNVLLRETIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G VHKVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVTT
Sbjct  360   MDQNRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELP+EKDGVSV+KVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ +R+KSSGK+K+TR
Sbjct  420   AELPLEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQDLRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R+GKL+ALHTGDGRIVWS L+N+  +S++CE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRAGKLFALHTGDGRIVWSMLLNSPSQSQSCERPNGVSLYQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMDENPSVLVVGKCG +S AP VLSFVD YTGKE+      HS+ QV+PLP TDS EQRL
Sbjct  540   AMDENPSVLVVGKCGSDSSAPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPITDSKEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  N+YWY+V+A++ I+RGH +K +   +  D+Y 
Sbjct  600   HLIADTVGHVHLYPKTSEALSIFQREFQNVYWYTVEADDGIIRGHVMKGSCSGETADEYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+PK
Sbjct  660   FTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSPK  719

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  720   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  779

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTIAVT
Sbjct  780   YEVTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVT  839

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTD+LPIIPQ+YV
Sbjct  840   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDTLPIIPQAYV  899

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  900   THSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  959

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW+ SE+KEL EKWR
Sbjct  960   ALVAAIYITWVLSEKKELSEKWR  982



>ref|XP_009121935.1| PREDICTED: ER membrane protein complex subunit 1 [Brassica rapa]
Length=980

 Score =  1329 bits (3439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/984 (68%), Positives = 822/984 (84%), Gaps = 7/984 (1%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRV+VST
Sbjct  2     AMALRLYLLLLVFLSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVIVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG KD IDG+DIALGKYVITLSS GS +RAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTKDAIDGVDIALGKYVITLSSEGSMVRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L  +  S+S+L VP NLKVD+D  IL++  GYLHAVS  DGEV+WKK+   EG ++Q
Sbjct  122   ETSLHSAQHSKSLLSVPVNLKVDKDYPILVFGGGYLHAVSPIDGEVLWKKDFTAEGFEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P  +  +Y +G   SS+ + Y+I+++ GE++  +S  FPGGFSG+++ V+++KVV 
Sbjct  182   RVLQPLESSIIYVLGFLHSSEAIVYQIDSKSGEVVAEKSKAFPGGFSGEVASVSNDKVVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST SILV+I F D  I+FQ+  I+DLV+D +G A +L   L+ M+A+ +NK  +F+RV
Sbjct  242   LDSTRSILVTISFVDEEISFQKTLISDLVED-SGEAEILSPLLSNMLAVKVNKRTIFVRV  300

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               +GKLE+VD ++    +S+SL +++   AF  + H   KIHL+VK ++D  + LL ES 
Sbjct  301   GDQGKLEMVDSLSDETAMSDSLPVADDQVAFASVHHEGSKIHLTVKLVDDLDTVLLRESI  360

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D  +G V KVFINNYI+TDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVT
Sbjct  361   QMDQHRGRVDKVFINNYIKTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT  420

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             T+ELPVEKDGVSV+KVE  L +WLKGH+LKLKG+L+LA+P+DV AIQ+MR+KSSG+SK+T
Sbjct  421   TAELPVEKDGVSVAKVEHTLVDWLKGHILKLKGSLLLASPEDVVAIQEMRMKSSGRSKLT  480

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKL I L+R+GKLYALHTGDGRIVWS L+    KS  C  P+ + +YQWQVPHH
Sbjct  481   RDHNGFRKLFIALTRAGKLYALHTGDGRIVWSTLL----KSPACARPSVISLYQWQVPHH  536

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENPSVLVVG+CG +S +P VLSFVD YTGKE+      HS+ QV+PLP+TDSTEQR
Sbjct  537   HAMDENPSVLVVGRCGSDSSSPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPFTDSTEQR  596

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ DTDGH HLYP+T EAL IF+RE  N+YWY+V+ ++ I+RGH +K +   +  D+Y
Sbjct  597   LHLIADTDGHVHLYPKTSEALSIFQREFQNVYWYNVEGDDGIVRGHGMKSSCSGETADEY  656

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV+TD+DV+YKY+S+N+LFVATV+P
Sbjct  657   CFTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVSTDQDVLYKYVSRNLLFVATVSP  716

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             K AG+IGSV P+ES L+VYLIDTVTGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH
Sbjct  717   KGAGEIGSVTPEESALVVYLIDTVTGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAH  776

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             +YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SSY RPE+  KSQSYFF  SVKTIAV
Sbjct  777   KYEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISSYSRPEMFTKSQSYFFPQSVKTIAV  836

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T TAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSY
Sbjct  837   TLTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSY  896

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TI
Sbjct  897   ITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITI  956

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV AI+ITW  SE+KEL EKWR
Sbjct  957   VALVAAIYITWALSEKKELSEKWR  980



>ref|XP_010453205.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =  1328 bits (3436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/983 (69%), Positives = 828/983 (84%), Gaps = 7/983 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MAIR FLLL+L  SSA  +FSLYEDQ GL DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MAIRVFLLLLLFLSSAIVSFSLYEDQAGLADWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + LS +  S+S+L VP NLKVD+D  I ++  GYLHAVS+ DGEV+W+K+   EG ++Q 
Sbjct  121   TALSSAHHSKSLLSVPINLKVDKDYPITVFGGGYLHAVSAIDGEVLWEKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +Y +G  + S+ V Y+I+++ GE++  +SMVFPGGFSG+IS V+S+KVV L
Sbjct  181   VLQPLGSTVIYVLGFVNLSEAVVYQIDSKIGEVVAQKSMVFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DS  SILV+I F DG I+FQ+  ++DLV++ +G A +L   L+ M+A+ +NK  +F++V 
Sbjct  241   DSKKSILVTIGFIDGDISFQKTPVSDLVEN-SGNAEILSPLLSNMLAVKVNKRTIFVKVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL +++  +AF  + H   KIHL VK +N+  + LL E+  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSKIHLMVKLVNELDNVLLRETIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D  +G VHKVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVTT
Sbjct  360   MDQHRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELPVEKDGVSV+KVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ++R+KSSGK+K+TR
Sbjct  420   AELPVEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQELRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R+GKL+ALHTGDGRIVWS L+    KS+ CE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRAGKLFALHTGDGRIVWSMLL----KSQACERPNGISLYQWQVPHHH  535

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMD+NPSVLVVG+CG +S AP VLSFVD YTGK++      HS+ QV+PLP+TDSTEQRL
Sbjct  536   AMDKNPSVLVVGRCGSDSSAPGVLSFVDVYTGKKITSSDIGHSVVQVLPLPFTDSTEQRL  595

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  NIYWY+V A++ I+RGH +K +   +  D+Y 
Sbjct  596   HLIADTVGHVHLYPKTSEALSIFQREFQNIYWYTVGADDGIIRGHVMKSSCSGETADEYC  655

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV TD+D++YKY+S+N+LFVATV+PK
Sbjct  656   FTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAKVNTDQDLLYKYVSRNLLFVATVSPK  715

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  716   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  775

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE++V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTIAVT
Sbjct  776   YEVTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVT  835

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSYV
Sbjct  836   STAKGITSKQLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSYV  895

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ + EGL+GIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  896   THSHRVEGLKGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  955

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW  SE+KEL EKWR
Sbjct  956   ALVAAIYITWALSEKKELSEKWR  978



>ref|XP_010668174.1| PREDICTED: ER membrane protein complex subunit 1 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score =  1327 bits (3435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/984 (69%), Positives = 816/984 (83%), Gaps = 4/984 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR  LL +L  SS++  FSLYEDQVGLMDWHQ+Y+GKVK A+FHTQKAGRKR+VVST
Sbjct  2     AMAIRVSLLFLLFLSSSFLVFSLYEDQVGLMDWHQQYLGKVKQAIFHTQKAGRKRLVVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EE+++ASLDLR G+IFWRHVLG  D ID IDIALGKYVITLSS GS +RAWNLPDGQMVW
Sbjct  62    EESIIASLDLRRGEIFWRHVLGENDRIDHIDIALGKYVITLSSEGSIVRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ESFL+G  PS S LL   +LKV+RD++IL+YS+G+LHAVSS DG  +W  EL  E +++Q
Sbjct  122   ESFLAGKKPSESSLLTVVDLKVERDNVILVYSNGFLHAVSSVDGASLWDMEL--ESVELQ  179

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P   D +YAVG + SS+  AY IN + GE+LK + + FPGGFSG+ISLV+SE +VA
Sbjct  180   QLIKPVSGDVMYAVGFSGSSKLHAYGINIKTGEVLKQDVVDFPGGFSGEISLVSSETLVA  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD+  ++LV I  KDG +   +VHI DL   F+G A +LP KL GM AI  + + +FLRV
Sbjct  240   LDAQRTLLVIISLKDGKVGIWKVHINDLAPQFSGRAAILPLKLEGMFAIKCSSYTMFLRV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               + ++EVVDK+   A +S+++  +E  +AFG+++ G  K+HL+VK  +D+ ++LL+ES 
Sbjct  300   NDKSEVEVVDKIEDFAAVSDAILFTEEQKAFGIVQQGNTKMHLTVKVGHDYSTDLLKESI  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID  +G V KVFINNY+RTDRSYGFRAL+V+EDHSLLLLQQG  VWSREDGLASIVDVT
Sbjct  360   EIDHNRGQVQKVFINNYLRTDRSYGFRALVVMEDHSLLLLQQGNSVWSREDGLASIVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELP+EK GVSV+KVEQ L EWLKGHLLKLKGTLMLA+P+DVAAIQ +RLKSS KSK+T
Sbjct  420   TSELPLEKKGVSVAKVEQGLLEWLKGHLLKLKGTLMLASPEDVAAIQALRLKSSEKSKLT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVLS++GK+YALHTGDG +VWS  +  LRKSETCENP  L +YQWQVPHH
Sbjct  480   RDHNGFRKLLIVLSKAGKVYALHTGDGHVVWSVFLPNLRKSETCENPVALNLYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HAMDENP+VLVVG+CG   D+P +LS VD+Y GKEL  L   HSI  V+ LP+ DSTE+R
Sbjct  540   HAMDENPAVLVVGRCGNQIDSPGILSIVDTYLGKELNSLGLTHSIVDVMALPFADSTEKR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDY  1491
             LHL++D   + HLYP+TPEA  IF+REL N+YWYSVDA NN+LRGH +K N   ++ D++
Sbjct  600   LHLIVDAVNNVHLYPKTPEAAAIFQRELSNVYWYSVDAENNLLRGHTIKSNCMSELADEF  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F+++ +WS++ PS+SE+IIATA RK +EVVHTQAKV  DR+VMYKYISKN+LFVATVAP
Sbjct  660   CFSSRDLWSIILPSDSEKIIATAARKASEVVHTQAKVMADRNVMYKYISKNLLFVATVAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KAAG+IGSV PDESWL+ YLID VTGRILHR+ H GSQGPV AV SENWVVYHYFNLRA+
Sbjct  720   KAAGEIGSVTPDESWLVCYLIDMVTGRILHRVMHHGSQGPVRAVFSENWVVYHYFNLRAN  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIEIYDQSRADNK++ KL++GKHNLT PVSSY RPE++ KSQ+YFF HSVKTI+V
Sbjct  780   RYEMSVIEIYDQSRADNKNIWKLIIGKHNLTLPVSSYSRPEIMTKSQTYFFTHSVKTISV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T TAKGITSKQLLIGTIGDQVLALDKRFLDPRR+  PT  E EDGIIPLTDSLPI PQSY
Sbjct  840   TLTAKGITSKQLLIGTIGDQVLALDKRFLDPRRSAKPTPTELEDGIIPLTDSLPINPQSY  899

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRG+++VPAKLESTTLVFAYG DLF T+LAPS+TYDSLT+DFSYALLLLTI
Sbjct  900   ITHSLKVEGLRGLLSVPAKLESTTLVFAYGADLFLTRLAPSRTYDSLTEDFSYALLLLTI  959

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             V LV AIF+TWI SE+K+L++KWR
Sbjct  960   VVLVAAIFVTWILSERKDLRDKWR  983



>ref|XP_006287000.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
 gb|EOA19898.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
Length=981

 Score =  1327 bits (3434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/983 (68%), Positives = 825/983 (84%), Gaps = 4/983 (0%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             M IR FL L+L  SSA  +FSLYEDQ G+ DWHQRYIGKVKHAVFHTQK GRKRV+VSTE
Sbjct  1     MGIRVFLPLLLFLSSAIVSFSLYEDQAGITDWHQRYIGKVKHAVFHTQKTGRKRVIVSTE  60

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWE  3105
             ENV+ASLDLRHG+IFWRHVLG KD IDG+ IALGKYVITLSS GSTLRAWNLPDGQMVWE
Sbjct  61    ENVVASLDLRHGEIFWRHVLGTKDAIDGVGIALGKYVITLSSEGSTLRAWNLPDGQMVWE  120

Query  3104  SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQH  2925
             + L  + PS+S+L VP NLKVD+D  I+++  GYLHAVS+ DGEV+W+K+   EG ++Q 
Sbjct  121   TSLHTAKPSKSLLSVPINLKVDKDYPIIVFGGGYLHAVSAIDGEVLWEKDFTAEGFEVQR  180

Query  2924  IVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVAL  2745
             ++ P G+  +  +G  + S+ V Y+I+++ GE++  +S VFPGGFSG+IS V+S+KVV L
Sbjct  181   VLQPPGSSIISVLGFINLSEAVVYQIDSKSGEVVAQKSRVFPGGFSGEISSVSSDKVVVL  240

Query  2744  DSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVT  2565
             DST SILV+I F DG I+FQ+  I+DLV++ +G A +L   L+ M+A+ +NK  +F++V 
Sbjct  241   DSTRSILVTIGFVDGDISFQKTPISDLVEN-SGKAEILSPLLSNMLAVKVNKRTIFVKVG  299

Query  2564  YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
              EGKLEVVD ++    +S+SL +++  +AF  + H   KIHL VK +N+  + LL E+  
Sbjct  300   GEGKLEVVDSLSDETAMSDSLPVADDQEAFASVHHEGSKIHLMVKLVNELDNVLLRETIQ  359

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTT  2205
             +D Q+G VHKVF+NNYIRTDRS GFRALIV+EDHSLLLLQQG IVWSRE+ LAS+ DVTT
Sbjct  360   MDQQRGRVHKVFMNNYIRTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEALASVTDVTT  419

Query  2204  SELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTR  2025
             +ELPVEKDGVSV+KVE  LFEWLKGH+LKLKG+L+LA+P+DV AIQ +R+KSSGK+K+TR
Sbjct  420   AELPVEKDGVSVAKVEHTLFEWLKGHVLKLKGSLLLASPEDVVAIQDLRVKSSGKNKLTR  479

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             DHNGFRKL++ L+R+GKL+ALHTGDGRIVWS L+N+  KS+TCE PNG+ +YQWQVPHHH
Sbjct  480   DHNGFRKLILALTRAGKLFALHTGDGRIVWSMLLNSHSKSQTCERPNGISLYQWQVPHHH  539

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRL  1665
             AMD+NPSVLVVG+C  +S AP VLSFVD YTGKE+      HS+ QV+PLPYTDSTEQRL
Sbjct  540   AMDKNPSVLVVGRCESDSSAPGVLSFVDVYTGKEISSSDIGHSVVQVMPLPYTDSTEQRL  599

Query  1664  HLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYY  1488
             HL+ DT GH HLYP+T EAL IF+RE  N+YWY+V+A+  I+RGH +K +   +  D+Y 
Sbjct  600   HLIADTVGHVHLYPKTSEALSIFQREFQNVYWYTVEADEGIIRGHVMKSSCSGETADEYC  659

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
             F T+ +W+VVFPSESE+II+T TRK NEVVHTQAKV T+ D++YKY+S+N++FVATV+PK
Sbjct  660   FTTRELWTVVFPSESEKIISTLTRKSNEVVHTQAKVNTE-DLLYKYVSRNLMFVATVSPK  718

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              AG+IGSV P+ES L+VYLIDT+TGRILHR++HQG QGPVHAV SENWVVYHYFNLRAH+
Sbjct  719   GAGEIGSVTPEESSLVVYLIDTITGRILHRLSHQGCQGPVHAVFSENWVVYHYFNLRAHK  778

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
             YE +V+EIYDQSRA+NK++ KL+LGKHNLT P++SY RPEV  KSQSYFFA SVKTIAVT
Sbjct  779   YEFTVVEIYDQSRAENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVT  838

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
             STAKGITSK LLIGTIGDQ+LALDKRF+DPRRT+NP+QAEKE+GIIPLTDSLPIIPQSYV
Sbjct  839   STAKGITSKHLLIGTIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDSLPIIPQSYV  898

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltiv  588
             TH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL+TIV
Sbjct  899   THSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLITIV  958

Query  587   alvvaifiTWIWSEQKELQEKWR  519
             ALV AI+ITW+ SE+KEL EKWR
Sbjct  959   ALVAAIYITWVLSEKKELSEKWR  981



>ref|XP_008802826.1| PREDICTED: ER membrane protein complex subunit 1 [Phoenix dactylifera]
Length=985

 Score =  1326 bits (3433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/986 (67%), Positives = 817/986 (83%), Gaps = 6/986 (1%)
 Frame = -2

Query  3464  AMAIRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVV  3291
             AMA+R  L  L+VL++S+  T  +LYEDQVGL DWHQ+YIGKVK AVF TQK+GR+RVVV
Sbjct  2     AMAVRVCLGFLIVLLYSNFST--ALYEDQVGLADWHQKYIGKVKQAVFPTQKSGRRRVVV  59

Query  3290  STEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQM  3114
             STEENV+ASLDLR GDIFWRHVLG  D +D IDIALGKY ITLSS GS LRAWNLPDGQM
Sbjct  60    STEENVIASLDLRRGDIFWRHVLGKDDHVDQIDIALGKYFITLSSEGSILRAWNLPDGQM  119

Query  3113  VWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             +WES    S+PS+S+L VP+N+ + +++ IL++S G+LHAVSS DGE++WKKE A + L+
Sbjct  120   MWESAFYASTPSKSLLYVPANINLGKENRILVFSGGWLHAVSSIDGEIVWKKEFAIDSLE  179

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKV  2754
             I+ +  P  +D +YAVG   SSQF  Y+ +++ GE+LKH +  FPGGF G+ SLV+S+ +
Sbjct  180   IKQVFQPPESDIIYAVGFVGSSQFSVYEFSSKSGEVLKHNTASFPGGFCGEASLVSSDML  239

Query  2753  VALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFL  2574
             VALD+T S L++I F+ G+INF Q +I+DLVQDF+G A LLP K TG+ A+     +  +
Sbjct  240   VALDATRSALIAISFQSGIINFHQTYISDLVQDFSGMAALLPVKFTGIFAMKTVSSIYLV  299

Query  2573  RVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEE  2394
             RV    +LEV++K  + A +S++L+LSE  QAFG+++H   KI   VK   D  + +L+E
Sbjct  300   RVKGVSELEVLEKFNHPASVSDALTLSEEQQAFGIVQHAETKIDFRVKLDKDLRNGVLKE  359

Query  2393  SSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVD  2214
             +  +D Q+G V KVFI+NY+RTD+S+GFRALIV+EDHSL L+QQG +VWSREDGLASI+D
Sbjct  360   TIEMDPQRGHVQKVFISNYVRTDKSHGFRALIVMEDHSLSLVQQGVVVWSREDGLASIID  419

Query  2213  VTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK  2034
              TTSELPVEK+GVSV++VE NLFEWLKGH LKLKGTL+LA+PD++AAIQ MRLK+S ++K
Sbjct  420   STTSELPVEKEGVSVAEVEHNLFEWLKGHALKLKGTLLLASPDEIAAIQAMRLKNSERNK  479

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVP  1854
             MTRDHNGFRKL+IVL+R+GKL ALHTGDGRI+WS    +L +SE CE+P+ L IYQWQVP
Sbjct  480   MTRDHNGFRKLIIVLTRAGKLLALHTGDGRIIWSLFFPSLHRSEACEHPSALNIYQWQVP  539

Query  1853  HHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTE  1674
             HHHAM ENPSVLVVG+CG + DA    S VDSYTGKE   LK  HSI QVIPLP TDSTE
Sbjct  540   HHHAMHENPSVLVVGRCGPSHDALGFFSVVDSYTGKERNSLKLAHSIIQVIPLPLTDSTE  599

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGD  1497
             QRLHL+ID +   HLYPRT +++ IF RE+ NIY +S++   +++RG++++     DV D
Sbjct  600   QRLHLIIDANLQAHLYPRTRDSVNIFLREMSNIYRHSIEVGKDMIRGYSLQSGCNLDVAD  659

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
             +Y F TK +WS+VFPSESE+I  TATRK+NEVVHTQAKV  D+DVMYKY+S+N+LFVATV
Sbjct  660   EYCFNTKELWSIVFPSESEKIATTATRKINEVVHTQAKVIADQDVMYKYVSRNILFVATV  719

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             APKAAG+IGSV P+E+WL+ YLID VTGRILHR+TH G+QGP+HAV+SENWVVYHYFNLR
Sbjct  720   APKAAGEIGSVTPEEAWLVAYLIDAVTGRILHRVTHHGAQGPIHAVVSENWVVYHYFNLR  779

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             AHRYEMSVIEIYD+SRADNKD+ KLVLGKHNLT PVSSY RP+V+ KSQSYFF HSVK +
Sbjct  780   AHRYEMSVIEIYDRSRADNKDVWKLVLGKHNLTSPVSSYSRPDVMVKSQSYFFTHSVKAM  839

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
             AVT+TAKGITSKQLLIGTIGDQVLALDKRFLDPRR V  TQ+EKE+GIIPLTDSLPIIPQ
Sbjct  840   AVTATAKGITSKQLLIGTIGDQVLALDKRFLDPRRNVTLTQSEKEEGIIPLTDSLPIIPQ  899

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  597
             +YVTHA++ EGLRGIVT+PA+LESTTLVF+YGVD+FFT++APS+TYDSLT+DFSYALLL+
Sbjct  900   AYVTHALQVEGLRGIVTIPARLESTTLVFSYGVDIFFTRIAPSRTYDSLTEDFSYALLLI  959

Query  596   tivalvvaifiTWIWSEQKELQEKWR  519
             TIVALV AIF TWI SE+KEL+EKWR
Sbjct  960   TIVALVAAIFATWILSEKKELREKWR  985



>ref|XP_003636448.1| hypothetical protein MTR_041s0018 [Medicago truncatula]
Length=982

 Score =  1314 bits (3401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/984 (67%), Positives = 808/984 (82%), Gaps = 5/984 (1%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR FL  +L  S      SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRV+VST
Sbjct  2     AMAIRVFLSFLLFLSLTNLASSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTNDVVDGIDIALGKYVITLSSDGSILRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             ES L GS  S+SIL +P NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ 
Sbjct  122   ESSLQGSKESKSILNIPKNLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVS  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
             HI+     + +Y  G   SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V 
Sbjct  182   HIIQ--SPEVIYVAGFVGSSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD   S +V+I   +G IN+ Q  ++DL++D +G AV+LPSKL G+ A+ IN  VL ++V
Sbjct  240   LDDVRSKIVTIDINNGNINYNQKQVSDLIKDSSGQAVILPSKLPGLFALKINSQVLLIKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T EG+L  +D++   A  S +LS+SE    F  +++   KI LSVK +NDW   LL+E+ 
Sbjct  300   TNEGELVALDQIDNTAAFSNALSISEDQHVFAFVQYEDNKIQLSVKDVNDWNGALLKENL  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G + K+FINNY+RTDRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   VIDHQRGNIEKIFINNYVRTDRSHGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+ ++  AIQ++RL+SS KSKMT
Sbjct  420   TSELPVEKEGVSVAKVEQNLFEWLKGHVLKLKGTLMIASAEEKIAIQKLRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+GK++ALHTGDGRIVWS  ++ALRKSE CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRAGKVFALHTGDGRIVWSTTLHALRKSEDCEHPVGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LV+G+CG +  AP+V+SF+D+YTGKEL  L   H++A+VIPLPYTDSTEQR
Sbjct  540   HALDENPSLLVIGRCGPSVTAPTVISFLDAYTGKELNSLSLAHTVARVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID + H +LYPRTPEA+ I KRE  NIYWYSV+ +N ++RGHA+K N   ++ D+Y
Sbjct  600   LHLIIDVNKHAYLYPRTPEAIEILKREFSNIYWYSVETDNGVIRGHALKSNCIHEIVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK NEVVHTQAKV TD DVMYKYISKN+LFVA  AP
Sbjct  660   CFVFRDLWSIVFPSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYISKNILFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA+G+IG+  P+E+ L++Y+IDTVTGRIL         G   +  +ENWVVYHYFNLRAH
Sbjct  720   KASGEIGTATPEEATLVIYIIDTVTGRILPSHDPPWLPGSC-SCCNENWVVYHYFNLRAH  778

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R+EMSVIE+YDQSRADNKD+ K VLGKHNLT P+SSY RPE+ AKSQSYFF HSVK I V
Sbjct  779   RHEMSVIEVYDQSRADNKDIWKFVLGKHNLTSPISSYYRPEISAKSQSYFFTHSVKAIEV  838

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY
Sbjct  839   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSY  898

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  591
             +TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTI
Sbjct  899   ITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTI  958

Query  590   valvvaifiTWIWSEQKELQEKWR  519
             VALV A+F+T++ SE+K+L+EKWR
Sbjct  959   VALVAALFVTYVLSERKDLEEKWR  982



>ref|XP_009395509.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=983

 Score =  1307 bits (3383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/985 (66%), Positives = 812/985 (82%), Gaps = 6/985 (1%)
 Frame = -2

Query  3461  MAIRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             MAIRA L  +++L+FSS  +T +L+EDQVGL DWHQ+YIGKVKHA+FHTQK GRKRVVVS
Sbjct  1     MAIRACLGLMILLVFSSTIST-ALFEDQVGLADWHQKYIGKVKHAIFHTQKTGRKRVVVS  59

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMV  3111
             TEENV+ASLDLR GDIFWRHVLG  D ID +DI LGKYV+TLSSG S LRAWNLPDGQM+
Sbjct  60    TEENVVASLDLRTGDIFWRHVLGKIDRIDQVDITLGKYVVTLSSGGSILRAWNLPDGQMI  119

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WES L  S+PS+S+L VP+N+ V +D+LIL++    +HA+SSTDG+++W+KEL+   L+I
Sbjct  120   WESILQVSAPSKSLLHVPANMNVGKDNLILVFGGSSIHALSSTDGQIVWRKELSTNSLEI  179

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q +  P  +D +YA+G   SS+FVAY +N + GE+L+     F  GF G+ SL + + VV
Sbjct  180   QQVFQPHDSDIIYALGFIGSSEFVAYYVNYKTGEVLQQSKASFKSGFCGEASLASDDVVV  239

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
             ALD++ + LVSI F++G+INFQQ++I DL+ +F+G A LLPSK  G++A+ I   ++ LR
Sbjct  240   ALDASRTYLVSISFRNGVINFQQIYIRDLIPEFSGKATLLPSKYNGILAVDIASSIVLLR  299

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             V    +LE+++K+ Y + IS++L LS+  QAF +++H   +IH  VK   D  + +L+E+
Sbjct  300   VKGVNELEIIEKINYPSAISDALPLSKEQQAFAILQHDESRIHFKVKFDTDLTNEVLKET  359

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+G + KVFINNY+RTDR++GFR L+V+EDHSLLL+QQGEIVWSREDGLASIVD 
Sbjct  360   IQMDGQRGNIEKVFINNYMRTDRTHGFRVLVVMEDHSLLLVQQGEIVWSREDGLASIVDS  419

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVEK+GVSV++VE +LFEWLKGH LKLKGTLMLA+PD+VAAIQ +RLKS  K+KM
Sbjct  420   TTSELPVEKEGVSVAEVEHSLFEWLKGHFLKLKGTLMLASPDEVAAIQAIRLKSFEKNKM  479

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKL+IVL+R+GK+ ALHTGDGR+VWS L+  LRKSETC NP  L +YQWQVPH
Sbjct  480   TRDHNGFRKLIIVLTRAGKVLALHTGDGRVVWSVLLPVLRKSETCGNPFALNVYQWQVPH  539

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAM ENPSVLVVG+CG N DAP + S VD+Y GK    L   HS+  ++PLP TDSTEQ
Sbjct  540   HHAMHENPSVLVVGRCGHNFDAPGIFSIVDAYNGKVHNSLVLEHSVRHIMPLPLTDSTEQ  599

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDD  1494
              LH++ID + H HLYP+T +++ IF  E+ NIYWYSV+   NI++G++++     D+ ++
Sbjct  600   NLHIVIDDNLHAHLYPKTSDSVKIFLDEMPNIYWYSVEVGKNIIKGYSLEIKGELDMAEN  659

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
               F  K +WS+VFPSESE I  TATRK+NE+VHTQAK+  D+DVMYKYIS N+LFVATVA
Sbjct  660   -VFQPKELWSIVFPSESETIALTATRKMNEIVHTQAKIVADQDVMYKYISTNILFVATVA  718

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+G+IGS  P+E+WL  YLIDTV+GRILHR++HQG+QGP+HAV+SENWVVYHYFNLRA
Sbjct  719   PKASGEIGSATPEEAWLYAYLIDTVSGRILHRVSHQGAQGPIHAVVSENWVVYHYFNLRA  778

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HR+EMSVIEIYDQSR DNKD+ KLVLGKHNLT P+SSY +PEV  KSQSYFF HSVK++A
Sbjct  779   HRHEMSVIEIYDQSREDNKDVWKLVLGKHNLTAPISSYSKPEVTVKSQSYFFTHSVKSLA  838

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
             VT TAKGITSKQLLIGTIGDQVLALDKRFLDPRR+VNPTQ+EKE+GIIPLTDSLPI+PQS
Sbjct  839   VTVTAKGITSKQLLIGTIGDQVLALDKRFLDPRRSVNPTQSEKEEGIIPLTDSLPIVPQS  898

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  594
             YVTHA++ EGLRGIVT PAKLESTTLVF+YGVDLFFT++APS+TYDSLT+DFSYALLLLT
Sbjct  899   YVTHALQVEGLRGIVTTPAKLESTTLVFSYGVDLFFTRIAPSRTYDSLTEDFSYALLLLT  958

Query  593   ivalvvaifiTWIWSEQKELQEKWR  519
             IVALV A+ +TW  SE+KEL+EKWR
Sbjct  959   IVALVAALLVTWALSEKKELREKWR  983



>ref|XP_009396281.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=997

 Score =  1305 bits (3378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/992 (66%), Positives = 809/992 (82%), Gaps = 5/992 (1%)
 Frame = -2

Query  3479  FKSPSAMAIRA---FLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAG  3309
              +  +AMAIRA   F++L+ +F SA  + +LYEDQVGL DWH +YIGKVKHAVFHTQK G
Sbjct  6     LRPRTAMAIRARLGFVILLSLFFSATLSTALYEDQVGLADWHHKYIGKVKHAVFHTQKTG  65

Query  3308  RKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWN  3132
             RKRVVVSTEENV+ASLDLR G IFWR+VLG  D ID +DIALGKYV+TLSSG S LRAWN
Sbjct  66    RKRVVVSTEENVVASLDLRTGFIFWRNVLGKNDHIDQVDIALGKYVVTLSSGGSILRAWN  125

Query  3131  LPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKEL  2952
             LPDGQM+WES L  S+ S+S L V +N+ V +D+LIL++    +HA+SS DG+++W+KEL
Sbjct  126   LPDGQMIWESTLPVSTLSKSSLYVLANMNVGKDNLILVFGGSSIHALSSMDGQIVWRKEL  185

Query  2951  ANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISL  2772
             + + L+IQ I  P  +D + AVG   SS+FV Y+I+ R GE+++     F  GF G+ SL
Sbjct  186   SIDSLEIQQIFQPHDSDIINAVGFVGSSEFVVYQISYRTGEVMQQSKASFESGFCGEASL  245

Query  2771  VTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHIN  2592
             V    VVALD++ S LVSI FK+ +INF Q++++DLV DF+G   LLP K  GM+AI I 
Sbjct  246   VFDNLVVALDASKSSLVSISFKNEVINFHQINLSDLVPDFSGKVTLLPLKFNGMLAIEIA  305

Query  2591  KFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWG  2412
               +L LRV    +LE V+K+++    S++L LS+  QAF +++H   KIH  VKS ND  
Sbjct  306   SSILLLRVKGANELEFVEKISHPFAFSDALPLSKEQQAFAILQHDESKIHFKVKSDNDLR  365

Query  2411  SNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDG  2232
             + +L+E+  +DSQ+G + KVFINNYIRTDR++GFR L+V+EDHSLLL+QQGEIVWSREDG
Sbjct  366   NEILKETIQMDSQRGNIEKVFINNYIRTDRTHGFRFLVVMEDHSLLLIQQGEIVWSREDG  425

Query  2231  LASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLK  2052
             LASIVD TTSELPVEK+GVSV++VE NLFEWLKGHLLKLKGTLMLA+PD+VAAIQ +RLK
Sbjct  426   LASIVDSTTSELPVEKEGVSVAEVEHNLFEWLKGHLLKLKGTLMLASPDEVAAIQAIRLK  485

Query  2051  SSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKI  1872
             SS K+KMTRDHNGFRKL+IVL+R+GK+ ALHTGDGR+VWS L+ ALR+SETC NP  L++
Sbjct  486   SSEKNKMTRDHNGFRKLIIVLTRAGKVLALHTGDGRVVWSVLLPALRRSETCGNPFALRV  545

Query  1871  YQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLP  1692
             YQWQVPHHHAM ENPSVLVVG+CG   DAP + S VDSYTGK    L   HS++ ++PLP
Sbjct  546   YQWQVPHHHAMHENPSVLVVGRCGHGFDAPGIFSIVDSYTGKVQNSLILEHSVSHIMPLP  605

Query  1691  YTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDA-NNILRGHAVKENY  1515
              TDSTEQRLHL+ID     HLYP+  ++L  F  E+ NIYWYSV+   N ++G++++   
Sbjct  606   LTDSTEQRLHLIIDAKLQAHLYPKNSDSLKHFFNEMPNIYWYSVEVEKNKIKGYSLESKA  665

Query  1514  FKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNM  1335
               D  ++Y F  K +WS++FPSESE+I  TATRK+NE+VHTQAKV  D+DVMYKY+SKN+
Sbjct  666   ELDTAEEYVFQAKELWSIIFPSESEKIAVTATRKMNEIVHTQAKVVADQDVMYKYVSKNI  725

Query  1334  LFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVY  1155
             LFVATVAPKAAG+IGS  P+E+ L  YLIDTV+GRILHR+ HQG+QGPVHAV+SENWVVY
Sbjct  726   LFVATVAPKAAGEIGSATPEEALLYAYLIDTVSGRILHRVCHQGAQGPVHAVVSENWVVY  785

Query  1154  HYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFA  975
             HYFNLRAHRYEMSVIEIYDQSRADNKD+ KLVLGKHNLT PVS Y RP+V+ KSQSYFF 
Sbjct  786   HYFNLRAHRYEMSVIEIYDQSRADNKDVWKLVLGKHNLTAPVSLYSRPDVMVKSQSYFFT  845

Query  974   HSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDS  795
             HSVK++AVT+TAKGITSKQLLIGTIGDQVLALDKRFLDPRR+VNPTQ+EKE+GIIPLTDS
Sbjct  846   HSVKSMAVTATAKGITSKQLLIGTIGDQVLALDKRFLDPRRSVNPTQSEKEEGIIPLTDS  905

Query  794   LPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  615
             LPI+PQSY+TH+++ EGLR +VT+PAKLESTTLVF+YGVDLFFT++APS+TYDSLT+DFS
Sbjct  906   LPIVPQSYITHSLQVEGLRSMVTIPAKLESTTLVFSYGVDLFFTRIAPSRTYDSLTEDFS  965

Query  614   YalllltivalvvaifiTWIWSEQKELQEKWR  519
             YALLL+TIV LV AIF+TW  SE+KEL+EKWR
Sbjct  966   YALLLITIVVLVAAIFVTWALSEKKELKEKWR  997



>ref|XP_004164260.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
Length=985

 Score =  1292 bits (3344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/964 (66%), Positives = 798/964 (83%), Gaps = 4/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
             FSLYEDQVGLMDW Q+Y+GK KHA+FH+ K+GRKRVVVSTEENV+ASLDLRHG+IFWRHV
Sbjct  24    FSLYEDQVGLMDWRQQYLGKAKHALFHSSKSGRKRVVVSTEENVIASLDLRHGEIFWRHV  83

Query  3224  LGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             LG  D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S LLVP +L
Sbjct  84    LGPNDPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSFLLVPKSL  143

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             K +++++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    ++ +YAVG +S +
Sbjct  144   KANQETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLPDSEFIYAVGFSSPT  203

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             Q   +KIN + GELLKH+   F GGFSG++  V+ + +V +D++ S LV I FK+G I  
Sbjct  204   QLDQFKINVKSGELLKHQKATFSGGFSGELVSVSDDVLVTVDTSRSNLVIINFKNGEIGI  263

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
              Q  IA ++ +F+G+  ++PSKL+G++A+ +N  +  +RV  EG+LEVVDK+   A +S+
Sbjct  264   LQSPIAPVIDEFSGSMEIVPSKLSGLLAVKVNSLLTLVRVKGEGELEVVDKIPGQATVSD  323

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +L +SE  QA  L  H    +HL+VK I++W +N ++E+  ID Q+G V KVF+N+YIRT
Sbjct  324   ALLVSENQQAAALAHHEGSHLHLTVKLIDNWSTNFIDENIVIDKQRGSVQKVFLNSYIRT  383

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLASIV+V TSELPVEK GVS++KVE NL
Sbjct  384   DRSHGFRALLVMEDHSLLLVQQGEIVWSREDGLASIVNVVTSELPVEKKGVSITKVENNL  443

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
              EWL+GHLLKLKGTLM+A+P+DV AIQ MRLKSS KSKM+RDHNGFRKLLIVL++SGKL+
Sbjct  444   IEWLQGHLLKLKGTLMIASPEDVVAIQNMRLKSSDKSKMSRDHNGFRKLLIVLTKSGKLF  503

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALH+GDGR+VWS L+    KS+ C  P  L IYQWQ PHH AMDENPSVL+VG+C  + D
Sbjct  504   ALHSGDGRVVWSRLLQPFHKSKDCA-PRWLNIYQWQDPHHRAMDENPSVLIVGRCEQSMD  562

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
              P +LSFVD+YTGKE+      HSI +VIPLP+TDSTEQRLH+LID +   HLYP+T EA
Sbjct  563   GPGLLSFVDTYTGKEISSSSQTHSIVKVIPLPFTDSTEQRLHILIDAESRAHLYPQTSEA  622

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +GI + E  NIYWYSV+ ++ I++GHA+      DV DDY F +K VW ++ PSESE+II
Sbjct  623   IGILQSEFSNIYWYSVEVDSGIIKGHALMRKCV-DVVDDYCFESKDVWLIMLPSESEKII  681

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             A+A+RKLNEVVHTQAKV  D+DVMYKYISKN+LF+ATVAPK++G+IG+  P++SWL+VYL
Sbjct  682   ASASRKLNEVVHTQAKVVADQDVMYKYISKNLLFLATVAPKSSGEIGTTTPEDSWLVVYL  741

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID V GRILHRMTH GS GPVHAV SENWVVYHYFNL+AHRYEMSV+EIYDQSRADN D+
Sbjct  742   IDIVNGRILHRMTHHGSTGPVHAVFSENWVVYHYFNLKAHRYEMSVVEIYDQSRADNIDV  801

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KL++GKHNLT P+SSY RPE+LAKSQSYFF HSVK I+VTST+KGITSKQLLIGTI DQ
Sbjct  802   WKLIIGKHNLTTPISSYSRPEILAKSQSYFFTHSVKEISVTSTSKGITSKQLLIGTINDQ  861

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +LALDKR+LDPRR++NP+QAE+E+G+IPLTDSLPIIPQ+YVTH+++ EGLRGIVT+PAKL
Sbjct  862   ILALDKRYLDPRRSINPSQAEREEGVIPLTDSLPIIPQTYVTHSLQVEGLRGIVTIPAKL  921

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL+TIVALV+AIF TW+ SE+KELQ
Sbjct  922   ESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLLITIVALVIAIFATWVLSERKELQ  981

Query  530   EKWR  519
             +KW+
Sbjct  982   DKWK  985



>ref|XP_008445027.1| PREDICTED: ER membrane protein complex subunit 1 [Cucumis melo]
Length=985

 Score =  1291 bits (3341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/964 (66%), Positives = 799/964 (83%), Gaps = 4/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
             FSLYEDQVGLMDW Q+Y+GK KHA+FH+ K+GRKRVVVSTEENV+ASLDLRHG+IFWRHV
Sbjct  24    FSLYEDQVGLMDWRQQYLGKAKHALFHSSKSGRKRVVVSTEENVIASLDLRHGEIFWRHV  83

Query  3224  LGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             LG  D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S+LLVP +L
Sbjct  84    LGPNDPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSLLLVPKSL  143

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             K +++++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    +D +YAVG +S +
Sbjct  144   KANQETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLHDSDIIYAVGFSSPT  203

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             Q   ++IN + GELLKH++  F GGFSG++  V+ + +V +D+  S LV I FK+G I  
Sbjct  204   QLDQFQINVKSGELLKHQTATFSGGFSGELVSVSDDVLVTVDTARSNLVIINFKNGEIGI  263

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
              Q  IA ++ +F+G   ++PSKL+G++A+ +N  +  +RV  EG+LEVVDK+   A +S+
Sbjct  264   LQSPIAPVIDEFSGLMEIVPSKLSGLLAVKVNSLLTLVRVKGEGELEVVDKIPGQATVSD  323

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +L +SE   A  L  H    +HL+VK I++W ++ ++E+  ID Q+G V KVF+N+YIRT
Sbjct  324   ALLVSENQHAAALAHHEGSHMHLTVKLIDNWSTSFIDENIVIDKQRGSVQKVFLNSYIRT  383

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLASIV+V TSELPVEK GVS++KVE NL
Sbjct  384   DRSHGFRALLVMEDHSLLLVQQGEIVWSREDGLASIVNVVTSELPVEKKGVSIAKVENNL  443

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
              EWL+GHLLKLKGTLM+A+P+DV AIQ MRLKSS KSKM+RDHNGFRKLLIVL++SGKL+
Sbjct  444   IEWLQGHLLKLKGTLMIASPEDVVAIQNMRLKSSDKSKMSRDHNGFRKLLIVLTKSGKLF  503

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALH+GDGR+VWS L+    KS+ C  P  L IYQWQ PHH AMDENPSVLVVG+CG + D
Sbjct  504   ALHSGDGRVVWSRLLQPFHKSKDCA-PRWLNIYQWQDPHHRAMDENPSVLVVGRCGQSMD  562

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
              P +LSFVD+YTGKE+      HSI +VIPLP+TDSTE+RLH+LID +G  HLYP+T EA
Sbjct  563   GPGLLSFVDTYTGKEISSSSQTHSIVKVIPLPFTDSTERRLHILIDAEGRAHLYPQTSEA  622

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +GI + E  NIYWYSV+A++ I++GHA+      DV DDY F +K VW ++ PS+SE+II
Sbjct  623   IGILQSEFSNIYWYSVEADSGIIKGHALMRKCV-DVVDDYCFESKDVWLIMLPSDSEKII  681

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             A+ATRKLNEVVHTQAKV  D+DVMYKYISKN+LF+ATVAPK++G+IG+  P++SWL+VYL
Sbjct  682   ASATRKLNEVVHTQAKVVADQDVMYKYISKNLLFLATVAPKSSGEIGTTTPEDSWLVVYL  741

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID V GRILHRM H GS GPVHAV SENWVVYHYFNL+AHRYEMSV+EIYDQSRADN D+
Sbjct  742   IDIVNGRILHRMIHHGSTGPVHAVFSENWVVYHYFNLKAHRYEMSVVEIYDQSRADNIDV  801

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KL++GKHNLT P+SSY RPE+LAKSQSYFF HSVK I+VTST+KGITSKQLLIGTI DQ
Sbjct  802   WKLIIGKHNLTTPISSYSRPEILAKSQSYFFTHSVKAISVTSTSKGITSKQLLIGTINDQ  861

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +LALDKR+LDPRR++NP+QAE+E+G+IPLTDSLPIIPQ+YVTHA++ EGLRGI+T+PAKL
Sbjct  862   ILALDKRYLDPRRSINPSQAEREEGVIPLTDSLPIIPQTYVTHALQVEGLRGIMTIPAKL  921

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL+TIVALV+AIF TW+ SE+KELQ
Sbjct  922   ESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLLITIVALVIAIFATWVLSERKELQ  981

Query  530   EKWR  519
             +KW+
Sbjct  982   DKWK  985



>ref|XP_004150284.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
 gb|KGN62826.1| Catalytic [Cucumis sativus]
Length=985

 Score =  1288 bits (3332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/964 (66%), Positives = 798/964 (83%), Gaps = 4/964 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
             FSLYEDQVGLMDW Q+Y+GK KHA+FH+ K+GRKRVVVSTEENV+ASLDLRHG+IFWRHV
Sbjct  24    FSLYEDQVGLMDWRQQYLGKAKHALFHSSKSGRKRVVVSTEENVIASLDLRHGEIFWRHV  83

Query  3224  LGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             LG  D IDGI+  LGKYV++LSS G+ LRAWNLPDGQM WESFL G+SPS+S LLVP +L
Sbjct  84    LGPNDPIDGIEFVLGKYVVSLSSEGNFLRAWNLPDGQMAWESFLQGTSPSKSFLLVPKSL  143

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             K +++++IL++S   LHAVSS DGEVIWK +L    ++IQ I+    ++ +YAVG +S +
Sbjct  144   KANQETVILVFSRSCLHAVSSLDGEVIWKIDLTENSVEIQKIIQLPDSEFIYAVGFSSPT  203

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             Q   +KIN + GELLKH++  F GGFSG++  V+ + +V +D++ S LV I FK+G I  
Sbjct  204   QLDQFKINVKSGELLKHQTATFSGGFSGELVSVSDDVLVTVDTSRSNLVIINFKNGEIGI  263

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
                 IA ++ +F+G+  ++PSKL+G++A+ +N  +  +RV  EG+LEVVDK+   A +S+
Sbjct  264   LLSPIAPVIDEFSGSMEIVPSKLSGLLAVKVNSLLTLVRVKGEGELEVVDKIPGQATVSD  323

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +L +SE  QA  L  H    +HL+VK I++W +N ++E+  ID Q+G V KVF+N+YIRT
Sbjct  324   ALLVSEHQQAAALAHHEGSHLHLTVKLIDNWSTNFIDENIVIDKQRGSVQKVFLNSYIRT  383

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLASIV+V TSELPVEK GVS++KVE NL
Sbjct  384   DRSHGFRALLVMEDHSLLLVQQGEIVWSREDGLASIVNVVTSELPVEKKGVSITKVENNL  443

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
              EWL+GHLLKLKGTLM+A+P+DV AIQ MRLKSS KSKM+RDHNGFRKLLIVL++SGKL+
Sbjct  444   IEWLQGHLLKLKGTLMIASPEDVVAIQNMRLKSSDKSKMSRDHNGFRKLLIVLTKSGKLF  503

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALH+GDGR+VWS L+    KS+ C  P  L IYQWQ PHH AMDENPSVL+VG+C  + D
Sbjct  504   ALHSGDGRVVWSRLLQPFHKSKDCA-PRWLNIYQWQDPHHRAMDENPSVLIVGRCEQSMD  562

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
              P +LSFVD+YTGKE+      HSI +VIPLP+TDSTEQRLH+LID +   HLYP+T EA
Sbjct  563   GPGLLSFVDTYTGKEISSSSQTHSIVKVIPLPFTDSTEQRLHILIDAESRAHLYPQTSEA  622

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +GI + E  NIYWYSV+ ++ I++GHA+      DV DDY F +K VW ++ PSESE+II
Sbjct  623   IGILQSEFSNIYWYSVEVDSGIIKGHALMRKCV-DVVDDYCFESKDVWLIMLPSESEKII  681

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             A+A+RKLNEVVHTQAKV  D+DVMYKYISKN+LF+ATVAPK++G+IG+  P++SWL+VYL
Sbjct  682   ASASRKLNEVVHTQAKVVADQDVMYKYISKNLLFLATVAPKSSGEIGTTTPEDSWLVVYL  741

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID V GRILHRMTH GS GPVHAV SENWVVYHYFNL+AHRYEMSV+EIYDQSRADN D+
Sbjct  742   IDIVNGRILHRMTHHGSTGPVHAVFSENWVVYHYFNLKAHRYEMSVVEIYDQSRADNIDV  801

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
              KL++GKHNLT P+SSY RPE+LAKSQSYFF HSVK I+VTST+KGITSKQLLIGTI DQ
Sbjct  802   WKLIIGKHNLTTPISSYSRPEILAKSQSYFFTHSVKEISVTSTSKGITSKQLLIGTINDQ  861

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +LALDKR+LDPRR++NP+QAE+E+G+IPLTDSLPIIPQ+YVTH+++ EGLRGIVT+PAKL
Sbjct  862   ILALDKRYLDPRRSINPSQAEREEGVIPLTDSLPIIPQTYVTHSLQVEGLRGIVTIPAKL  921

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL+TIVALV+AIF TW+ SE+KELQ
Sbjct  922   ESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLLITIVALVIAIFATWVLSERKELQ  981

Query  530   EKWR  519
             +KW+
Sbjct  982   DKWK  985



>emb|CAB87716.1| putative protein [Arabidopsis thaliana]
Length=955

 Score =  1287 bits (3331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/951 (68%), Positives = 799/951 (84%), Gaps = 7/951 (1%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIA  3186
             HQRYIGKVKHAVFHTQK GRKRV+VSTEENV+ASLDLRHG+IFWRHVLG KD IDG+ IA
Sbjct  10    HQRYIGKVKHAVFHTQKTGRKRVIVSTEENVVASLDLRHGEIFWRHVLGTKDAIDGVGIA  69

Query  3185  LGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSS  3009
             LGKYVITLSS GSTLRAWNLPDGQMVWE+ L  +  S+S+L VP    VD+D  I ++  
Sbjct  70    LGKYVITLSSEGSTLRAWNLPDGQMVWETSLHTAQHSKSLLSVP----VDKDYPITVFGG  125

Query  3008  GYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGE  2829
             GYLHAVS+ DGEV+WKK+   EG ++Q ++   G+  +Y +G   SS+ V Y+I+++ GE
Sbjct  126   GYLHAVSAIDGEVLWKKDFTAEGFEVQRVLQAPGSSIIYVLGFLHSSEAVVYQIDSKSGE  185

Query  2828  LLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFT  2649
             ++  +S VFPGGFSG+IS V+S+KVV LDST SILV+I F DG I+FQ+  I+DLV+D +
Sbjct  186   VVAQKSTVFPGGFSGEISSVSSDKVVVLDSTRSILVTIGFIDGDISFQKTPISDLVED-S  244

Query  2648  GAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGL  2469
             G A +L   L+ M+A+ +NK  +F+ V  +GKLEVVD ++    +S+SL +++  +AF  
Sbjct  245   GTAEILSPLLSNMLAVKVNKRTIFVNVGDKGKLEVVDSLSDETAMSDSLPVADDQEAFAS  304

Query  2468  IKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLE  2289
             + H   +IHL VK +ND  + LL E+  +D  +G VHKVF+NNYIRTDRS GFRALIV+E
Sbjct  305   VHHEGSRIHLMVKLVNDLNNVLLRETIQMDQNRGRVHKVFMNNYIRTDRSNGFRALIVME  364

Query  2288  DHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkg  2109
             DHSLLLLQQG IVWSRE+GLAS+ DVTT+ELP+EKDGVSV+KVE  LFEWLKGH+LKLKG
Sbjct  365   DHSLLLLQQGAIVWSREEGLASVTDVTTAELPLEKDGVSVAKVEHTLFEWLKGHVLKLKG  424

Query  2108  tlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSF  1929
             +L+LA+P+DV AIQ +R+KSSGK+K+TRDHNGFRKL++ L+R+GKL+ALHTGDGRIVWS 
Sbjct  425   SLLLASPEDVVAIQDLRVKSSGKNKLTRDHNGFRKLILALTRAGKLFALHTGDGRIVWSM  484

Query  1928  LVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTG  1749
             L+N+  +S++CE PNG+ +YQWQVPHHHAMDENPSVLVVGKCG +S AP VLSFVD YTG
Sbjct  485   LLNSPSQSQSCERPNGVSLYQWQVPHHHAMDENPSVLVVGKCGSDSSAPGVLSFVDVYTG  544

Query  1748  KELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYW  1569
             KE+      HS+ QV+PLP TDS EQRLHL+ DT GH HLYP+T EAL IF+RE  N+YW
Sbjct  545   KEISSSDIGHSVVQVMPLPITDSKEQRLHLIADTVGHVHLYPKTSEALSIFQREFQNVYW  604

Query  1568  YSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHT  1392
             Y+V+A++ I+RGH +K +   +  D+Y F T+ +W+VVFPSESE+II+T TRK NEVVHT
Sbjct  605   YTVEADDGIIRGHVMKGSCSGETADEYCFTTRELWTVVFPSESEKIISTLTRKPNEVVHT  664

Query  1391  QAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMT  1212
             QAKV TD+D++YKY+S+N+LFVATV+PK AG+IGSV P+ES L+VYLIDT+TGRILHR++
Sbjct  665   QAKVNTDQDLLYKYVSRNLLFVATVSPKGAGEIGSVTPEESSLVVYLIDTITGRILHRLS  724

Query  1211  HQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKP  1032
             HQG QGPVHAV SENWVVYHYFNLRAH+YE++V+EIYDQSRA+NK++ KL+LGKHNLT P
Sbjct  725   HQGCQGPVHAVFSENWVVYHYFNLRAHKYEVTVVEIYDQSRAENKNVWKLILGKHNLTAP  784

Query  1031  VSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRR  852
             ++SY RPEV  KSQSYFFA SVKTIAVTSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRR
Sbjct  785   ITSYSRPEVFTKSQSYFFAQSVKTIAVTSTAKGITSKQLLIGTIGDQILALDKRFVDPRR  844

Query  851   TVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDL  672
             T+NP+QAEKE+GIIPLTD+LPIIPQ+YVTH+ K EGLRGIVT P+KLESTT VFAYGVDL
Sbjct  845   TLNPSQAEKEEGIIPLTDTLPIIPQAYVTHSHKVEGLRGIVTAPSKLESTTHVFAYGVDL  904

Query  671   FFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             F+T+LAPSKTYDSLTDDFSYALLL+TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  905   FYTRLAPSKTYDSLTDDFSYALLLITIVALVAAIYITWVLSEKKELSEKWR  955



>ref|XP_006382057.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|ERP59854.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=918

 Score =  1285 bits (3324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/909 (70%), Positives = 764/909 (84%), Gaps = 4/909 (0%)
 Frame = -2

Query  3236  WRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             WRHVLG  D IDGIDIA+ KY ITLSSG S LRAWNLPDGQMVWESFL G   S+S L V
Sbjct  11    WRHVLGANDAIDGIDIAMTKYAITLSSGGSILRAWNLPDGQMVWESFLQGPIDSKSFLFV  70

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIV-HPDGTDDVYAVG  2883
              ++ KVD+D+ IL++  G LHAVSS  GE++WK +  +E  ++Q ++ H DG + +Y VG
Sbjct  71    STSSKVDKDNTILVFGKGSLHAVSSIHGEIVWKIDFPSESFEVQEVIQHHDG-NTIYVVG  129

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
                SSQF  Y+INA+ GELLKH+S    GGFSG++SLV+  K+V LD+  S L++I F+ 
Sbjct  130   FVGSSQFDVYQINAKNGELLKHDSAAVDGGFSGEVSLVSRAKLVVLDAARSTLLTISFQS  189

Query  2702  GLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYG  2523
             G I+FQ+ +I+DLV+DF+G AV+LPSKLTG+ A+  N    F+ V+ EGKLEVVDK+ + 
Sbjct  190   GEISFQKTYISDLVEDFSGIAVILPSKLTGLFAVKTNTATAFISVSSEGKLEVVDKIKHA  249

Query  2522  AVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFIN  2343
              VIS  LS+SE  QAF L++HG   IHL+VK ++DW S+LL+E   +D Q+GLVHKVFIN
Sbjct  250   TVISNVLSISEDQQAFALVQHGGNDIHLNVKQVHDWNSDLLKERIKLDKQRGLVHKVFIN  309

Query  2342  NYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSK  2163
             NY+RTD+S+GFRALIV+EDHSLLLLQQGE+VWSREDGLASI+ VTTSELPVE++GVSV+K
Sbjct  310   NYVRTDKSHGFRALIVMEDHSLLLLQQGEVVWSREDGLASIIGVTTSELPVEREGVSVAK  369

Query  2162  VEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSR  1983
             VEQNLFEWLKGH+LK+KGTLMLA+ +DVAAIQ MRLKSS KSKM RDHNGFRKLLIVL++
Sbjct  370   VEQNLFEWLKGHMLKVKGTLMLASAEDVAAIQGMRLKSSEKSKMIRDHNGFRKLLIVLTK  429

Query  1982  SGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKC  1803
             S KL+ALHTGDGRIVWS L+N+LR++E CENP G+ +YQWQVPHHHAMDENPSVLVVG+C
Sbjct  430   SRKLFALHTGDGRIVWSLLLNSLRQTEACENPTGINVYQWQVPHHHAMDENPSVLVVGRC  489

Query  1802  GLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYP  1623
                +DAP + S+VD+YTGKELK     HS+AQVIPLP TDSTEQ+LHLLID +G  HLYP
Sbjct  490   RTGTDAPGIFSYVDTYTGKELKSFGLDHSVAQVIPLPLTDSTEQQLHLLIDANGQAHLYP  549

Query  1622  RTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSE  1446
             R PEA  IF+RE  NIYWYSV+A+  +++GH ++ N   +V D+Y F T+ +WS+VFPSE
Sbjct  550   RAPEAAAIFQREFSNIYWYSVEADKGVIKGHGLQSNCDGEVADNYSFGTREIWSIVFPSE  609

Query  1445  SEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESW  1266
             SE+II+T TRK NEVVHTQAKV  D+DVMYKYISK +LFVATV+PKA+GDIGS  P ES 
Sbjct  610   SEKIISTVTRKSNEVVHTQAKVIADQDVMYKYISKKLLFVATVSPKASGDIGSATPGESQ  669

Query  1265  LIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRA  1086
             L+VY++DTVTGRILHRMTH GSQGPVHAV SENW+VYHYFNLRAHRYEM+VIEIYDQSRA
Sbjct  670   LVVYVVDTVTGRILHRMTHHGSQGPVHAVFSENWIVYHYFNLRAHRYEMTVIEIYDQSRA  729

Query  1085  DNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIG  906
             DNKD+LKLVLGKHNLT P+SSY RPEV  KSQSY+F HS+K I VTSTAKGITSK LLIG
Sbjct  730   DNKDVLKLVLGKHNLTSPISSYSRPEVTTKSQSYYFTHSIKAITVTSTAKGITSKHLLIG  789

Query  905   TIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVT  726
             TIGDQVLA+DKRF DPRR+VNPTQ+EKE+GI+PLTDSLPIIPQSYVTH+ K EGLRGIVT
Sbjct  790   TIGDQVLAMDKRFFDPRRSVNPTQSEKEEGILPLTDSLPIIPQSYVTHSHKVEGLRGIVT  849

Query  725   VPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSE  546
             VPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL+TIVALVVAIF+TW+ SE
Sbjct  850   VPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLLITIVALVVAIFVTWVLSE  909

Query  545   QKELQEKWR  519
             +K+L +KWR
Sbjct  910   KKDLSDKWR  918



>ref|XP_006833394.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
 gb|ERM98672.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
Length=976

 Score =  1261 bits (3262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/968 (65%), Positives = 782/968 (81%), Gaps = 13/968 (1%)
 Frame = -2

Query  3413  YTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFW  3234
             Y + +LYEDQVG+MDWHQ+YIGKV HAVFHTQK GRKRVVV+T+EN++ASLDLR GDIFW
Sbjct  19    YPSCALYEDQVGIMDWHQQYIGKVNHAVFHTQKQGRKRVVVATDENIIASLDLRRGDIFW  78

Query  3233  RHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVWESFLSGSSPSRSILLVP  3057
             RHVLG  D ++ IDIALGKYVITLSS GS LRAWNLPDGQM+WESFL GS PS+S+L V 
Sbjct  79    RHVLGDSDAVNDIDIALGKYVITLSSSGSILRAWNLPDGQMMWESFLQGSGPSKSLLSVS  138

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
             ++        IL++S G LHA+S  DG+V+W++EL+ E L++  I      + +YA GL 
Sbjct  139   AS--------ILVFSGGCLHAISGIDGDVLWRRELSGESLEMHKIRQSPNGETIYAAGLV  190

Query  2876  SSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
              SSQ   Y++N + G+++ H+  +F GGFSG++  ++   +VALD+T S +V+  F +G 
Sbjct  191   GSSQLALYELNPKNGDIVNHKMALFSGGFSGEMLFLSDGTLVALDATRSTIVTASFNNGN  250

Query  2696  INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGK-LEVVDKVAYGA  2520
             + F Q  I ++V +F+G+A LLPS+  G VAI  +  VL + V   GK +E +DK+   +
Sbjct  251   LVFHQRPIIEIVPEFSGSASLLPSRFKGSVAIKTDSHVLLILVRENGKKMETLDKIEGPS  310

Query  2519  VISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINN  2340
              IS++L  SE  QAFG+++H    + LS+K      + L+ ++  +D Q+G    VFINN
Sbjct  311   AISDALLFSEDQQAFGVVRHEQDVLSLSIKLDGGGNNELITDNIKVDGQRGRAEMVFINN  370

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKV  2160
             YIRTDRS GFRAL+V+ED+SL+LLQQG IVW REDGLASIVD T SELP+EK+GVSV+ V
Sbjct  371   YIRTDRSQGFRALVVMEDYSLMLLQQGNIVWCREDGLASIVDTTISELPLEKEGVSVANV  430

Query  2159  EQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRS  1980
             E +LF+WLKGH LKLK TLMLA+ +D+A IQ+MRLK+S K+KMTRDHNGFRKLLIVL+R+
Sbjct  431   EHSLFQWLKGHFLKLKETLMLASAEDIAVIQEMRLKNSEKTKMTRDHNGFRKLLIVLTRA  490

Query  1979  GKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCG  1800
             GK+ ALHTGDGR+VWS L  + RKSE C+NP G+KIYQWQVPHHHA+DENPSVLVVG+CG
Sbjct  491   GKILALHTGDGRVVWSLLSPSFRKSEKCQNPTGVKIYQWQVPHHHALDENPSVLVVGRCG  550

Query  1799  LNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPR  1620
             L S  P+ LSFVDSYTGKEL+ L+  H + Q++PLP+TDS EQRLHL +D +   HL+PR
Sbjct  551   LGS--PNFLSFVDSYTGKELESLRLTHPVTQIVPLPFTDSLEQRLHLFVDGEKRAHLHPR  608

Query  1619  TPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSES  1443
             + E+LG+F REL NIY YS+D+   I+RG+ +K    ++ GDDY F T+ +W VVFP ES
Sbjct  609   SSESLGVFLRELPNIYLYSIDSERGIIRGYGLKGKCIREEGDDYCFETRELWKVVFPLES  668

Query  1442  EQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWL  1263
             E+I A ATRK NEVVHTQAKV TD+DV++KYIS+N+LFVAT+APKA   IGS+ PDE+WL
Sbjct  669   EKISAVATRKSNEVVHTQAKVLTDQDVIFKYISRNVLFVATIAPKATDGIGSITPDEAWL  728

Query  1262  IVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRAD  1083
             + YLIDTVTGRILHR+TH G+ GP+ AV SENWVVYHYFNLRAH+YEMSVIEIYDQSRAD
Sbjct  729   VAYLIDTVTGRILHRVTHLGAHGPIQAVFSENWVVYHYFNLRAHKYEMSVIEIYDQSRAD  788

Query  1082  NKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGT  903
             NKD+LKLVLGKHNLT PVSSY RPEV+ KSQSYFF HSVK++AVTSTAKGITSKQLLIGT
Sbjct  789   NKDVLKLVLGKHNLTTPVSSYSRPEVMVKSQSYFFTHSVKSMAVTSTAKGITSKQLLIGT  848

Query  902   IGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTV  723
             IGDQVLALDKR++DPRRT+NPTQAEKE+GIIPLTDSLPIIPQSYVTH+V+ EGLRGI T 
Sbjct  849   IGDQVLALDKRYVDPRRTINPTQAEKEEGIIPLTDSLPIIPQSYVTHSVRVEGLRGIETF  908

Query  722   PAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQ  543
             PAKLEST+LVF YGVDLF+T++APS+TYDSLT++FSY+LLL+TIVALV AIFITW  SE+
Sbjct  909   PAKLESTSLVFIYGVDLFYTRIAPSRTYDSLTEEFSYSLLLITIVALVAAIFITWRLSEK  968

Query  542   KELQEKWR  519
             KEL++KWR
Sbjct  969   KELRDKWR  976



>ref|XP_007012093.1| Catalytics isoform 2 [Theobroma cacao]
 gb|EOY29712.1| Catalytics isoform 2 [Theobroma cacao]
Length=870

 Score =  1250 bits (3235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/838 (73%), Positives = 716/838 (85%), Gaps = 2/838 (0%)
 Frame = -2

Query  3404  FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV  3225
              SLYEDQVGLMDWHQ++IGKVK AVFHTQK GRKRVVVSTEENV+ASLDLRHG+IFWRHV
Sbjct  25    LSLYEDQVGLMDWHQQFIGKVKQAVFHTQKTGRKRVVVSTEENVIASLDLRHGEIFWRHV  84

Query  3224  LGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
             L   DVIDGIDIA+GKYVITLSSG S LRAWNLPDGQMVWES L G   S+S+LLV +NL
Sbjct  85    LATNDVIDGIDIAIGKYVITLSSGGSILRAWNLPDGQMVWESSLQGPKHSKSLLLVLTNL  144

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSS  2868
             KVD+D++++++++G LHAVSS DGEV+WKK+   E LD+Q ++ P G+D VY VG  +SS
Sbjct  145   KVDKDNVVIVFTNGRLHAVSSIDGEVLWKKDFEAESLDVQQVIQPPGSDLVYVVGFAASS  204

Query  2867  QFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINF  2688
             QF  Y+INAR GELLKHES  F GGF G++SLV+SE +VALDSTGSIL++I   +G I+F
Sbjct  205   QFEMYQINARNGELLKHESAAFSGGFLGEVSLVSSETLVALDSTGSILLTISSHNGKISF  264

Query  2687  QQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISE  2508
             QQ  I++LV D  G AV+ PS +TG+ ++ +N   +F+RV  EGKLEV++K      +S+
Sbjct  265   QQTPISNLVGDSLGPAVITPSSVTGIFSLKVNAITIFIRVIGEGKLEVLEKTNLKTAVSD  324

Query  2507  SLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRT  2328
             +LS+SEG QAF LI+H   +IHL+VK  +DW  NLL+ES  +D Q+GLVHKVFINNYIRT
Sbjct  325   ALSISEGKQAFALIQHAGSEIHLTVKPADDWDGNLLKESIKMDRQRGLVHKVFINNYIRT  384

Query  2327  DRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNL  2148
             DRSYGFR LIV+EDHSLLLLQQGEIVWSREDGLASI+DVTTSELPVEKDGVSV+KVE NL
Sbjct  385   DRSYGFRVLIVMEDHSLLLLQQGEIVWSREDGLASIIDVTTSELPVEKDGVSVAKVEHNL  444

Query  2147  FEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLY  1968
             FEWLKGH+LKLKGTLMLA+P+D+AAIQ MRLKSS KSKMTRDHNGFRKLLIVL+R+GKL+
Sbjct  445   FEWLKGHMLKLKGTLMLASPEDMAAIQSMRLKSSEKSKMTRDHNGFRKLLIVLTRAGKLF  504

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSD  1788
             ALHTGDGRIVWS L+ +L K + C++  GL +YQWQVPHHHAMDENPSVLVVG+CG + D
Sbjct  505   ALHTGDGRIVWSHLLQSLHKPQACQHLIGLNLYQWQVPHHHAMDENPSVLVVGRCGPSLD  564

Query  1787  APSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
             AP VLSFVD+YTGKEL  L   HS+AQVIPLPYTDSTEQRLHLLID D H HLYP+TPEA
Sbjct  565   APGVLSFVDTYTGKELSSLSLAHSVAQVIPLPYTDSTEQRLHLLIDADQHAHLYPKTPEA  624

Query  1607  LGIFKRELGNIYWYSV-DANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +GIF+RE  NIYWYSV D N I++G+A+K     +V D++ F ++ +WSVVFPSESE+II
Sbjct  625   IGIFQREFSNIYWYSVEDDNGIIKGYALKSKCTSEVADEFCFDSRELWSVVFPSESEKII  684

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             AT TRKLNEVVHTQAKV  D+DVMYKY+S+N+LFVAT APKA+G+IGSV P+ESWL+ YL
Sbjct  685   ATVTRKLNEVVHTQAKVIADQDVMYKYLSRNLLFVATAAPKASGEIGSVTPEESWLVAYL  744

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             IDTVTGRILHR+TH GSQGPVHAV SENWVVYHYFNLRAHRYEMSVIEIYDQSRAD+KD+
Sbjct  745   IDTVTGRILHRVTHHGSQGPVHAVFSENWVVYHYFNLRAHRYEMSVIEIYDQSRADDKDV  804

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIG  897
              KLVLGKHNLT P+SSY RPEV+ KSQSYFF HS+K+IAVTSTAKGITSKQLLIGTIG
Sbjct  805   WKLVLGKHNLTSPISSYSRPEVITKSQSYFFTHSLKSIAVTSTAKGITSKQLLIGTIG  862



>gb|KDO79764.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=859

 Score =  1231 bits (3185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/862 (70%), Positives = 727/862 (84%), Gaps = 8/862 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRVVVS
Sbjct  1     MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVS  59

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMV
Sbjct  60    TEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMV  119

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+ +LLVP+NLKVD+DSLIL+ S G LHAVSS DGE++W ++ A E +++
Sbjct  120   WESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEV  179

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q ++  D +D +Y VG   SSQF AY+INA  GELL HE+  F GGF GD++LV+S+ +V
Sbjct  180   QQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLV  239

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+T SILV++ FK+  I FQ+ H+++L +D +G   +LPS LTGM  + IN + LF+R
Sbjct  240   TLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIR  299

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             +T E KLEVV KV +  V+S++L  SEG +AF +++HG  K+ ++VK   DW +NL++ES
Sbjct  300   LTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQES  359

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTDRS+GFRALIV+EDHSLLL+QQG+IVW+RED LASI+DV
Sbjct  360   IEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDV  419

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVEK+GVSV+KVE +LFEWLKGH+LKLKGTLMLA+P+DVAAIQ +RLKSS KSKM
Sbjct  420   TTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKM  479

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKLLIVL+++ K++ALH+GDGR+VWS L   L KSE C++P  L +YQWQ PH
Sbjct  480   TRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLL---LHKSEACDSPTELNLYQWQTPH  536

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+CG++S AP++LSFVD+YTGKEL     VHS  QV+PLP+TDSTEQ
Sbjct  537   HHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQ  596

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLL+D D   HLYP+T EA+ IF++E  NIYWYSV+A+N I++GHAVK     +V DD
Sbjct  597   RLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDD  656

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             + F T+ +WS++FP ESE+IIA  +RK NEVVHTQAKVT+++DVMYKYISKN+LFVATVA
Sbjct  657   FCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVA  716

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+G IGS  PDE+WL+VYLIDT+TGRILHRMTH G+QGPVHAVLSENWVVYHYFNLRA
Sbjct  717   PKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRA  776

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
             HRYEMSV EIYDQSRA+NKD+LKLVLGKHNLT PVSSY RPE+  KSQ+YFF HSVK +A
Sbjct  777   HRYEMSVTEIYDQSRAENKDVLKLVLGKHNLTAPVSSYSRPEITTKSQTYFFTHSVKAVA  836

Query  953   VTSTAKGITSKQLLIGTIGDQV  888
             VTSTAKGITSKQLLIGTIGDQV
Sbjct  837   VTSTAKGITSKQLLIGTIGDQV  858



>ref|XP_007137196.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
 gb|ESW09190.1| hypothetical protein PHAVU_009G1078000g, partial [Phaseolus vulgaris]
Length=897

 Score =  1228 bits (3178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/898 (68%), Positives = 732/898 (82%), Gaps = 4/898 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMAIR FLLL L  SS    +SL+EDQVGLMDWHQ+YIGKVKHA+FHTQK GRKRV+VST
Sbjct  2     AMAIRVFLLLFLFLSSTNIGYSLFEDQVGLMDWHQQYIGKVKHALFHTQKTGRKRVLVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG  DV+DG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTDDVVDGLDIALGKYVITLSSDGSLLRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L GS  S+SIL +P NLK D+D LIL++  G L+AVS  DGEV+W+K+ A E +++ 
Sbjct  122   ETPLQGSKQSKSILYIPKNLKADKDDLILVFGKGCLYAVSGIDGEVLWRKDFAGESIEVS  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              I+    TD +Y  G   SS+F  Y +NA  GELLK++  + P    G++  V+ +K V 
Sbjct  182   RIIQ--STDKIYVAGFVGSSKFYVYGLNADTGELLKNDHTILPCDTFGELLSVSGDKFVV  239

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LD   S +++I  K+G I+++Q  I+DL++D +G AV+LPS+L  + A+ I+  +L ++V
Sbjct  240   LDKMRSKILTINIKNGEISYKQKPISDLIKDSSGQAVILPSRLPELFALRIDSHLLTVKV  299

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
             T E  L +VDK+   A +S++LS+SEG  AF  I+H    I L VK IND    LL+ES 
Sbjct  300   TNEDDLVLVDKINNAAAVSDALSISEGQHAFAFIQHEGSNIRLFVKDINDRNGELLKESI  359

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              ID Q+G + K+FINNY+RTDRSYGFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVT
Sbjct  360   IIDHQRGNIEKIFINNYVRTDRSYGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVT  419

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT  2028
             TSELPVEK+GVSV+KVEQNLFEWLKGH+LKLKGTLM+A+P+DV AIQ +RL+SS KSKMT
Sbjct  420   TSELPVEKEGVSVTKVEQNLFEWLKGHVLKLKGTLMIASPEDVVAIQALRLRSSEKSKMT  479

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RDHNGFRKLLIVL+R+ K++ALHTGDGRIVWS L++ LRK+E CE+P GL IYQWQVPHH
Sbjct  480   RDHNGFRKLLIVLTRARKVFALHTGDGRIVWSILLHTLRKTEVCEHPVGLNIYQWQVPHH  539

Query  1847  HAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQR  1668
             HA+DENPS+LVVG+CG    AP+VLSF+D+YTGKEL  L+  H+IAQVIPLPYTDSTEQR
Sbjct  540   HALDENPSILVVGRCGPGLAAPAVLSFIDAYTGKELNSLRLAHTIAQVIPLPYTDSTEQR  599

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             LHL+ID D H +LYPRTPEA+ I + E  N+YWYSV+A+N ++RGHA+K N    + D+Y
Sbjct  600   LHLIIDIDQHAYLYPRTPEAIDILQHEFSNVYWYSVEADNGVVRGHALKSNCIHKIVDEY  659

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
              F  + +WS+VFPSESE+IIAT TRK  EVVHTQAKV TD DVMYKY+S N+LFVA  AP
Sbjct  660   CFDFRDLWSIVFPSESEKIIATVTRKSKEVVHTQAKVMTDYDVMYKYVSNNILFVANAAP  719

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
             KA G+IG+  P+E+WL++Y+IDTVTGRILHRMTH G QGPV AV SENWVVYHYFNLRAH
Sbjct  720   KAMGEIGTATPEEAWLVIYIIDTVTGRILHRMTHHGCQGPVRAVFSENWVVYHYFNLRAH  779

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             RYEMSVIE+YDQSRADNKD+ K VLGKHNLT P+SSY RPEV  KSQSYFF HSVK I V
Sbjct  780   RYEMSVIEVYDQSRADNKDIWKFVLGKHNLTSPMSSYYRPEVTTKSQSYFFTHSVKAIDV  839

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
             T T+KGITSKQLLIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPI+ Q
Sbjct  840   TLTSKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIVSQ  897



>ref|XP_002439481.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
 gb|EES17911.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
Length=989

 Score =  1194 bits (3090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/970 (62%), Positives = 771/970 (79%), Gaps = 3/970 (0%)
 Frame = -2

Query  3422  SSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGD  3243
             S A    ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV++SLDLR GD
Sbjct  21    SLATLATAIYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVISSLDLRSGD  80

Query  3242  IFWRHVLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSIL  3066
             IFWRHV+   D +D + ++ GKYV+TLSSG T LRAWNLPDGQM+WE+ L  S+ S   L
Sbjct  81    IFWRHVIDKNDPLDQLSLSHGKYVLTLSSGGTILRAWNLPDGQMIWETNLRTSAASNPQL  140

Query  3065  LVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAV  2886
              V SN KV +D+L+L+ +  +++AVSS DG + W+KE + +GL+I+ I+     D VYA+
Sbjct  141   HVMSNNKVAKDNLVLVSAGRWIYAVSSIDGAISWEKEFSIDGLEIKGILQSPENDVVYAL  200

Query  2885  GLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFK  2706
             GL  SS+   Y ++A+ GE+LK      PGG  G+  L +   +VALD   S L+ I FK
Sbjct  201   GLAGSSKLALYHLSAKTGEILKDIQESLPGGLCGETVLGSDNVLVALDKARSSLLLIEFK  260

Query  2705  DGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAY  2526
                I++ +VH++DLVQD +G+   L S   G++++  +  +  L++     LEV+ K   
Sbjct  261   AERISYNKVHVSDLVQDLSGS-FKLQSLSNGIISLQTSSSISLLKLKGTVGLEVIQKFDQ  319

Query  2525  GAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFI  2346
              A +S+SLS++E  +AF +++H   +I   VK  +D  S  + E   ID  +G V KVF+
Sbjct  320   PAAVSDSLSITEKDEAFAVVQHLGSEIEFIVKFTSDLSSENIREKVNIDQNRGNVEKVFL  379

Query  2345  NNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVS  2166
             N+YIRTD+S+GFRAL+V+EDHSLLL+QQGE+VWSREDGLASIVDVTTSELPVEKDGVSV+
Sbjct  380   NSYIRTDKSHGFRALVVMEDHSLLLIQQGEVVWSREDGLASIVDVTTSELPVEKDGVSVA  439

Query  2165  KVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLS  1986
              VE NLFEWLKGH+LKLKGTLMLA  D+VAAIQ +RLKSS K+KMTRDHNGFRKLL+VL+
Sbjct  440   DVEHNLFEWLKGHMLKLKGTLMLANADEVAAIQALRLKSSEKNKMTRDHNGFRKLLVVLT  499

Query  1985  RSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK  1806
             ++GK+ ALHTGDGR++WS L+++LR S     P+ L+IYQWQVPHH  M ENPSVLVVGK
Sbjct  500   KAGKVMALHTGDGRVIWSNLLSSLRASRFGGMPSALRIYQWQVPHHSVMRENPSVLVVGK  559

Query  1805  CGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLY  1626
              G  S  P V S +DSY+G+EL  +K  HS+ Q+IPL   DS+EQRLHL++D++ + HLY
Sbjct  560   SGAESSTPGVFSILDSYSGEELNSMKLDHSVVQIIPLTLKDSSEQRLHLIVDSNSNAHLY  619

Query  1625  PRTPEALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDVGDDYYFATKYVWSVVFPS  1449
             P++P+AL +F  E+ N+Y+YSVD   N+++G++++++   ++GD+Y F+TK +WS++FPS
Sbjct  620   PKSPDALNVFLHEMSNLYFYSVDIQANVIKGYSLQKSCGLNLGDEYCFSTKELWSIIFPS  679

Query  1448  ESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDES  1269
             +SE+I  + TRK+NEVVHTQAK+  D DVMYKY+SKN++FVAT++PKAAGDIGS +P+E+
Sbjct  680   DSERIAISETRKMNEVVHTQAKIIGDHDVMYKYLSKNLVFVATLSPKAAGDIGSALPEEA  739

Query  1268  WLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSR  1089
              ++ YLID VTGRILHR+TH G+QGPVHAVLSENWVVYHYFNLRAHR+EM+VIEIYDQSR
Sbjct  740   SVVAYLIDAVTGRILHRVTHHGAQGPVHAVLSENWVVYHYFNLRAHRFEMAVIEIYDQSR  799

Query  1088  ADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLI  909
             ADNKD++KL+LGKHNL+ P++SY RPEV  KSQS+FF HSVK +AVT TAKGITSKQLLI
Sbjct  800   ADNKDVMKLILGKHNLSAPITSYARPEVAVKSQSFFFTHSVKAMAVTQTAKGITSKQLLI  859

Query  908   GTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIV  729
             GTIGDQVLALDKR+LDPRR+VNPTQ EKE+GIIPLTDSLPIIPQS+VTH+ + E LRGIV
Sbjct  860   GTIGDQVLALDKRYLDPRRSVNPTQQEKEEGIIPLTDSLPIIPQSFVTHSHQVEALRGIV  919

Query  728   TVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWS  549
             ++PAKLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI  LV AI  TWIWS
Sbjct  920   SIPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAVLVGAIIATWIWS  979

Query  548   EQKELQEKWR  519
             E+KEL++KWR
Sbjct  980   EKKELRDKWR  989



>ref|NP_001054975.1| Os05g0230600 [Oryza sativa Japonica Group]
 gb|AAS98480.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT93850.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16889.1| Os05g0230600 [Oryza sativa Japonica Group]
 dbj|BAG91928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =  1193 bits (3087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/965 (62%), Positives = 764/965 (79%), Gaps = 3/965 (0%)
 Frame = -2

Query  3407  TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRH  3228
             T ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV+ASLDLR GDIFWRH
Sbjct  26    TAAVYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRH  85

Query  3227  VLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSN  3051
             V+   D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN
Sbjct  86    VIEKNDPVDELSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSN  145

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
              KV +D+L+ + +  +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  S
Sbjct  146   NKVAKDNLVFVLAGRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGS  205

Query  2870  SQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLIN  2691
             S+   Y++NA+ GE +KH    FP    G+  L +   +VALD T S L  I  K   I+
Sbjct  206   SKLNLYQLNAKTGETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESIS  265

Query  2690  FQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVIS  2511
             + +VHI+DLVQD +G   LLP    G++A+  +  V  L++     LEV+      A +S
Sbjct  266   YNKVHISDLVQDLSGTVKLLPLMSNGVIALQASSTVSLLKLKGIDGLEVIQSFEQPAAVS  325

Query  2510  ESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIR  2331
             ++L+++E  +AF +++H   +I   VK  +D    ++ E   ID  +G + KVF+NNYIR
Sbjct  326   DALTITEKDEAFAVVQHTGSEIEFVVKFTSDVTGEVIREKINIDQHRGNIQKVFLNNYIR  385

Query  2330  TDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQN  2151
             TD+S+GFRAL+V+EDHSLLL+QQGE+VWSREDGLASIVDVTTSELP+EKDGVSV+ VE N
Sbjct  386   TDKSHGFRALVVMEDHSLLLVQQGEVVWSREDGLASIVDVTTSELPIEKDGVSVANVEHN  445

Query  2150  LFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKL  1971
             LFEWLKGH+LKLKGTLMLA  D++AAIQ MRLKSS K+KMTRDHNGFRKLLIVL+++GK+
Sbjct  446   LFEWLKGHMLKLKGTLMLANADELAAIQAMRLKSSEKNKMTRDHNGFRKLLIVLTKAGKV  505

Query  1970  YALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNS  1791
              ALHTGDGRI+WS L+ +LR S++ E P+ L+I QWQVPHH  M ENPS+L++G+ G +S
Sbjct  506   IALHTGDGRIIWSNLLQSLRSSKSGEMPSALRICQWQVPHHRVMHENPSILIIGRSGADS  565

Query  1790  DAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
              AP VLS +DSY+G+EL  LK  HS+ Q+IPL   DS+E RL L++D+    HLYPR+P+
Sbjct  566   AAPGVLSVLDSYSGEELNSLKLDHSVVQIIPLTVKDSSEHRLQLIVDSHSRAHLYPRSPD  625

Query  1610  ALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
             A+ +F  E+ N Y Y+VD   N++RGH+++++   +  D+Y F+TK +WS+VFPS++E+I
Sbjct  626   AMNVFLHEMPNTYLYTVDIETNVIRGHSLQKS-CDNSADEYCFSTKELWSIVFPSDTERI  684

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
               + TRK+NEVVH QAK+  D+DVMYKY+SKN++FVATV+PKA+G+IGS  P+E+WL+ Y
Sbjct  685   AISETRKMNEVVHAQAKIIADQDVMYKYLSKNLVFVATVSPKASGEIGSAAPEEAWLVAY  744

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             LID VTGRILHR+TH G+QGPVHAV+SENWVVYHYFNLRAHR+EM+VIEIYDQSRADNKD
Sbjct  745   LIDAVTGRILHRVTHHGAQGPVHAVVSENWVVYHYFNLRAHRFEMAVIEIYDQSRADNKD  804

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
             ++KL+LGKHNL+ P +SY RPEV+ KSQSYFF  SVK IA T TAKGITSKQLLIGTIGD
Sbjct  805   VMKLILGKHNLSAPTTSYTRPEVMVKSQSYFFTFSVKAIAATQTAKGITSKQLLIGTIGD  864

Query  893   QVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAK  714
             QVLALDKRF+DPRR+VNPTQ EKE+GIIPLTD+LPIIP SY+TH+++ E LRGIV++P+K
Sbjct  865   QVLALDKRFVDPRRSVNPTQQEKEEGIIPLTDALPIIPTSYLTHSLQVEALRGIVSIPSK  924

Query  713   LESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKEL  534
             LESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI ALV AI +TWIWSE+KEL
Sbjct  925   LESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAALVAAIVVTWIWSEKKEL  984

Query  533   QEKWR  519
             ++KWR
Sbjct  985   RDKWR  989



>dbj|BAJ90673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=989

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/970 (61%), Positives = 773/970 (80%), Gaps = 2/970 (0%)
 Frame = -2

Query  3422  SSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGD  3243
             S A    ++Y DQVGL DWHQ+YIGKVK AV+HTQK+GR+RVVV TEENV+ASLDLR GD
Sbjct  20    SLATLAAAVYADQVGLADWHQKYIGKVKQAVYHTQKSGRRRVVVLTEENVIASLDLRSGD  79

Query  3242  IFWRHVLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSIL  3066
             IFWRHV+   + ID + ++ GKYV+TLSSG S LRAWNLPDGQMVWE+ +  SS S+S+L
Sbjct  80    IFWRHVIEKNNPIDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMVWETNIQTSSASKSLL  139

Query  3065  LVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAV  2886
              V SN KV +D+L+L+ +  +++A+SS DG + W KE   +GL+I+ +V     D VY V
Sbjct  140   HVLSNSKVVQDNLVLVLAGQWIYAISSIDGLISWGKEFTLDGLEIKQVVQSPENDIVYVV  199

Query  2885  GLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFK  2706
             G+  SS+   Y++NA+ GE++K      P G  G++ L +S  +VALD T S L  + FK
Sbjct  200   GIAGSSKLAVYQLNAKTGEIVKDAQESLPDGLCGEMLLGSSNVLVALDETRSALFIVEFK  259

Query  2705  DGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAY  2526
                I++ +V I++ VQDF+G   LLP    G++A+  +  V  L++     LEV+     
Sbjct  260   GESISYNKVQISEFVQDFSGMVKLLPLMSNGIIALQSSSTVSLLKLKGMNGLEVIHSFDR  319

Query  2525  GAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFI  2346
              A +S++L+++E  +AF +++H   +I   VK  +D  + ++ E   ID  +G V KVF+
Sbjct  320   PASVSDALTITEKDEAFAIVQHVGSQIEFIVKVTSDLTNEIIREKVDIDQHRGSVEKVFL  379

Query  2345  NNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVS  2166
             NNY+RTD+S+GFRAL+V+EDHSLLL+QQG +VWSREDGLASIVDV  SELPVEKDGVSV+
Sbjct  380   NNYVRTDKSHGFRALVVMEDHSLLLIQQGAVVWSREDGLASIVDVMASELPVEKDGVSVA  439

Query  2165  KVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLS  1986
              VE NLFEWLKGH+LKLKGTLMLA+ D++AAIQ +R++SS K+KMTRDHNGFRKLLIVL+
Sbjct  440   DVEHNLFEWLKGHVLKLKGTLMLASVDELAAIQALRVRSSEKNKMTRDHNGFRKLLIVLT  499

Query  1985  RSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK  1806
             ++GK+ ALHTGDGRI+WS L+ +LR S++ E P+ L+IYQWQVPHH  M ENPS+LVVG+
Sbjct  500   KAGKVIALHTGDGRIIWSNLLPSLRASKSGEMPSALRIYQWQVPHHRVMRENPSILVVGR  559

Query  1805  CGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLY  1626
              G +S AP VL  +DSY+G+EL   +  HS+AQ+IPL   DS+EQRLHL++D++ + HLY
Sbjct  560   SGASSVAPGVLCILDSYSGEELNSQRFDHSVAQIIPLILKDSSEQRLHLIVDSNSNAHLY  619

Query  1625  PRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPS  1449
             PR+P+AL  F  E+ N Y+YSVD   N +RG++++++   D GD Y F+T+ +WS++FPS
Sbjct  620   PRSPDALNSFMTEMSNQYFYSVDIQKNAIRGYSLQKSCDFDSGDTYCFSTRLLWSIIFPS  679

Query  1448  ESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDES  1269
             ++E+I  + TRK+NEVVHTQAK+  D+DVMYKY+SK+++FVATV+PKAAG+IGS  P+E+
Sbjct  680   DAERISVSETRKMNEVVHTQAKIIADQDVMYKYLSKSLIFVATVSPKAAGEIGSAAPEEA  739

Query  1268  WLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSR  1089
              L+ YLID V+GRILHRMTH G+QGPVH+V+SENWVVYHYFNLRAHR+E++VIEIYDQSR
Sbjct  740   SLMAYLIDAVSGRILHRMTHHGAQGPVHSVVSENWVVYHYFNLRAHRFEIAVIEIYDQSR  799

Query  1088  ADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLI  909
             ADNKD+LKL+LGKHNL+ P++SY RPEV+ KSQSYFF HSVK +AVT TAKGITSKQLLI
Sbjct  800   ADNKDVLKLILGKHNLSAPMTSYSRPEVMVKSQSYFFTHSVKAMAVTQTAKGITSKQLLI  859

Query  908   GTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIV  729
             GTIGDQVLALDKRFLDPRR+VNPTQ EKE+GIIPLTD LPIIPQSYVTH+++ E LRGIV
Sbjct  860   GTIGDQVLALDKRFLDPRRSVNPTQQEKEEGIIPLTDYLPIIPQSYVTHSLQVEALRGIV  919

Query  728   TVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWS  549
             ++PAKLESTTLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL+TIVALV A+F+TWIWS
Sbjct  920   SIPAKLESTTLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLLITIVALVAALFVTWIWS  979

Query  548   EQKELQEKWR  519
             E+KEL++KWR
Sbjct  980   EKKELRDKWR  989



>ref|XP_006654166.1| PREDICTED: ER membrane protein complex subunit 1-like [Oryza 
brachyantha]
Length=985

 Score =  1187 bits (3071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/963 (61%), Positives = 770/963 (80%), Gaps = 4/963 (0%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVGL DWHQRYIGKVK AV+H+QK+GR+RVVV TEENV+ASLDLR GDIFWRHV+
Sbjct  25    AVYEDQVGLADWHQRYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVI  84

Query  3221  GHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLK  3045
                D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  +  S+S+L V SN K
Sbjct  85    EKNDPVDQLSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVAKSSKSLLHVLSNNK  144

Query  3044  VDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQ  2865
             V +D+L+ + +  +++AVSS DG + W KE + +GL+I+ +V     D +YAVGL+ SS+
Sbjct  145   VAKDNLVFVSAGQWIYAVSSIDGVISWGKEFSLDGLEIKQVVQSPENDIIYAVGLSGSSK  204

Query  2864  FVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQ  2685
                Y++NA+ GE++KH    FP    G+  L +   +VALD T S L  I F    I+++
Sbjct  205   LNLYQLNAKTGEIVKHIQESFPSAICGETILGSHNMLVALDETRSGLFLIEFNGERISYK  264

Query  2684  QVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISES  2505
             +VHI+DLVQD +G   LL     G++A+ ++  V  L++     LE++      A +S++
Sbjct  265   KVHISDLVQDLSGTVKLLQLMPNGVIALQVSSTVFVLKLKGIDGLELIQSFEQPAAVSDA  324

Query  2504  LSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTD  2325
             L+++E  +AF +++H   +I   VK  +D  + ++ E   ID  +G + KVF+NNYIRTD
Sbjct  325   LAITEKDEAFAIVQHVGSEIEFVVKLTSDVTNEVIREKINIDQHRGNIQKVFLNNYIRTD  384

Query  2324  RSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLF  2145
             +S+GFRAL+V+EDHSLLL+QQG +VW+REDGLASIVDVTTSELPVEKDGVSV+ VE NLF
Sbjct  385   KSHGFRALLVMEDHSLLLVQQGAVVWNREDGLASIVDVTTSELPVEKDGVSVANVEHNLF  444

Query  2144  EWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYA  1965
             EWLKGH+LKLKGTLMLA+ D++AAIQ MRLKSS K+KMTRDHNGFRKLLIVL+++GK+ A
Sbjct  445   EWLKGHMLKLKGTLMLASADELAAIQAMRLKSSEKNKMTRDHNGFRKLLIVLTKAGKVIA  504

Query  1964  LHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDA  1785
             LHTGDGRI+WS L+ +LR S++ E P+ L +YQWQVPHH  M ENPS+L+VG+ G +S A
Sbjct  505   LHTGDGRIIWSNLLQSLRASKSGEMPSALSLYQWQVPHHRVMHENPSILIVGRSGADSAA  564

Query  1784  PSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEAL  1605
             P +LS +DSY+G EL  L+  HS+ Q+IPL   DS+E RL L+ D+  + +LYPR+P+A+
Sbjct  565   PGLLSVLDSYSGDELTSLRLDHSVVQIIPLTLKDSSEHRLQLIFDSHSNAYLYPRSPDAM  624

Query  1604  GIFKRELGNIYWYSVDA-NNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
              +F  E+ N Y Y+VD   N++RG++++++   D  D+Y F+TK +WS+VFPS++E+I  
Sbjct  625   NVFLPEMSNTYLYTVDTEKNVIRGYSLQKSC--DNSDEYCFSTKELWSIVFPSDTERIAI  682

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
             + TRK+NEVVH QAK+  D+DVMYKY+SKN++FVAT++PKAAG+IGS  P+E+WL+ YLI
Sbjct  683   SETRKMNEVVHAQAKIIADQDVMYKYLSKNLIFVATLSPKAAGEIGSAAPEEAWLVAYLI  742

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             D VTGRILHR+TH G+QGPVHAV+SENWVVYHYFNLRAHR+EM+VIEIYDQSRADNKD++
Sbjct  743   DAVTGRILHRVTHHGAQGPVHAVVSENWVVYHYFNLRAHRFEMAVIEIYDQSRADNKDVM  802

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
             KL+LGKHNL+ P++SY RPEV+ KSQSYFF  SVKTIAVT TAKGIT+KQLLIGTIGDQV
Sbjct  803   KLILGKHNLSAPITSYTRPEVMVKSQSYFFTFSVKTIAVTQTAKGITNKQLLIGTIGDQV  862

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             LALDKRF+DPRR+VNPTQ EKE+GIIPLTD+L IIP SYVTH+++ E LRGIV++P+KLE
Sbjct  863   LALDKRFVDPRRSVNPTQQEKEEGIIPLTDALSIIPTSYVTHSLQVEALRGIVSIPSKLE  922

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQE  528
             STTL+F YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TIVAL+ AI +TWIWSE+KEL++
Sbjct  923   STTLIFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIVALIAAIVVTWIWSEKKELRD  982

Query  527   KWR  519
             KWR
Sbjct  983   KWR  985



>emb|CDX85707.1| BnaA02g01060D [Brassica napus]
Length=942

 Score =  1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/999 (62%), Positives = 764/999 (76%), Gaps = 75/999 (8%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AM I+A LLL++  S A  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRV+VST
Sbjct  2     AMEIKASLLLLIFLSYAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVIVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGK---------------YVITLSS-G  3153
             EENV+AS DLRHG+IFWR+VLG KD IDG+DIALGK               YVITLSS G
Sbjct  62    EENVVASPDLRHGEIFWRYVLGTKDAIDGVDIALGKCRNHLHYMWCSSISGYVITLSSQG  121

Query  3152  STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGE  2973
             S LRAWNLPDGQMVW++ L  +  S+S+L VP NLKVD+D  IL +  GYLHAVS+ DGE
Sbjct  122   SMLRAWNLPDGQMVWKTSLHSAQSSKSLLSVPINLKVDKDYPILAFGGGYLHAVSAIDGE  181

Query  2972  VIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGG  2793
             V+WKK+   EG ++Q I+ P  +  +Y +G   SS+ V Y+I+ R G+++  +SMV PGG
Sbjct  182   VLWKKDFTAEGFEVQRILQPHESSIIYVLGFLHSSKAVVYQIDPRTGKVVAQKSMVVPGG  241

Query  2792  FSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTG  2613
             FSG I  V+S+KVV LDST SILV+I F DG I+F +  ++DLV+D +G A +L  +L+ 
Sbjct  242   FSGVILSVSSDKVVVLDSTRSILVTINFLDGDISFHKTPVSDLVED-SGNAEILSPRLSN  300

Query  2612  MVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSV  2433
             M+A+ +NK  +F+RV  EGKLEVVD ++    +S+SL +++   AF  + H   KIHL V
Sbjct  301   MLAVKVNKRTIFVRVGGEGKLEVVDSLSDETAMSDSLPVTDDQVAFASVHHEGSKIHLMV  360

Query  2432  KSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEI  2253
             K ++D  + LL ES  +D  +G V KVFINNYI+TDRS GFRALIV+EDHSLLLLQQG I
Sbjct  361   KLVDDLDTVLLRESIEMDQHRGRVDKVFINNYIKTDRSNGFRALIVMEDHSLLLLQQGAI  420

Query  2252  VWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAA  2073
             VWSRE+GLAS+ DVTT+ELPVEKDGVSV+KVE  L +WLKGH+LKLKG+L+LA+P+DVAA
Sbjct  421   VWSREEGLASVTDVTTAELPVEKDGVSVAKVEHTLVDWLKGHMLKLKGSLLLASPEDVAA  480

Query  2072  IQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCE  1893
             IQ+MR+KSSG+SK+TRDHNGFRKL I L+R+GKL+AL+TGDGRIVWS L+N+  KSE CE
Sbjct  481   IQEMRMKSSGRSKLTRDHNGFRKLFIALTRAGKLFALYTGDGRIVWSMLLNSPSKSEACE  540

Query  1892  NPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSI  1713
              P+G+ +YQWQVPHHHAMDENP VLVVG+CG +S AP VLSFVD YTGKE+      HS+
Sbjct  541   RPSGISLYQWQVPHHHAMDENPYVLVVGRCGSDSSAPGVLSFVDFYTGKEISSSDIGHSV  600

Query  1712  AQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRG  1536
              +V+PLP+TDSTEQRLHL+ DT+GH HLYP+T EAL IF+R+  N+YWY+V+ ++ I+RG
Sbjct  601   VRVMPLPFTDSTEQRLHLIADTEGHVHLYPKTSEALRIFQRDFQNVYWYTVEGDDGIIRG  660

Query  1535  HAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMY  1356
             H +K +   +  D+Y F TK +W+VVFPSESE+II+T  RK NEVVHTQAKV TD+D++Y
Sbjct  661   HGMKSSCAGETADEYCFTTKELWTVVFPSESEKIISTLIRKPNEVVHTQAKVNTDQDLLY  720

Query  1355  KYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVL  1176
             KY+S+N+LFVATV+PK AG+IGSV P+ES L++Y                          
Sbjct  721   KYVSRNLLFVATVSPKGAGEIGSVTPEESALVIY--------------------------  754

Query  1175  SENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAK  996
                                      DQSRA+NK++ KLVLGKHNLT P+SSY RPE+  K
Sbjct  755   -------------------------DQSRAENKNVWKLVLGKHNLTAPISSYSRPEMFTK  789

Query  995   SQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDG  816
             SQSYFFA  VKTIAVTSTAKGITSKQLLIGTIGDQ+LALDKRF      VN +QAEKE+G
Sbjct  790   SQSYFFAQLVKTIAVTSTAKGITSKQLLIGTIGDQILALDKRF------VNLSQAEKEEG  843

Query  815   IIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYD  636
             IIPLTDSLPIIPQSY+TH++K EGLR IVT PAKLESTT VFAYGVDLF+ +LAPSKTYD
Sbjct  844   IIPLTDSLPIIPQSYITHSLKVEGLRCIVTAPAKLESTTYVFAYGVDLFYKRLAPSKTYD  903

Query  635   SLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             SLTDDFSYALLL+TIVALV AI+ITW+  E+KEL EKWR
Sbjct  904   SLTDDFSYALLLITIVALVAAIYITWVVLEKKELSEKWR  942



>ref|XP_004960655.1| PREDICTED: ER membrane protein complex subunit 1-like [Setaria 
italica]
Length=988

 Score =  1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/964 (62%), Positives = 767/964 (80%), Gaps = 6/964 (1%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV++SLDLR GDIFWRHV+
Sbjct  28    AIYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVISSLDLRSGDIFWRHVI  87

Query  3221  GHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLK  3045
                D +D + ++LGKYV+TLSSG T LRAWNLPDGQM+WE+ L  S+ S   L V SN K
Sbjct  88    DKNDPLDQLSLSLGKYVLTLSSGGTILRAWNLPDGQMIWETNLKTSTASNPQLHVMSNNK  147

Query  3044  VDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQ  2865
             V +D+L+L+ +  +++AVSS DG + W+KE + +GL+I+ ++     D VYA G+  SS+
Sbjct  148   VAKDNLVLVSAGRWIYAVSSIDGAISWEKEFSLDGLEIKQVLQSPENDIVYAFGIAGSSK  207

Query  2864  FVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQ  2685
                Y+++A+ GE+LK      PG  SG+I L +   +VAL+   S L  I FK   I+++
Sbjct  208   LALYQLSAKTGEILKDVQESLPGELSGEIVLGSDNVLVALNKARSSLFLIEFKSERISYK  267

Query  2684  QVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISES  2505
             +VH++DLVQD +G    L S   G++ +  +  V  L++     LEVV +    A +S++
Sbjct  268   KVHVSDLVQDLSGT-FKLQSLSNGVITLQTSSTVFLLKLKDTNGLEVVQRFDQPAAVSDA  326

Query  2504  LSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTD  2325
             L+++E  +AF +++H   +I   VK  +D  +  + E   ID  +G V KVF+N+YIRTD
Sbjct  327   LTIAEKDEAFAVVQHVGSQIEFIVKFRSDVSNENIREKVNIDHHRGNVEKVFLNSYIRTD  386

Query  2324  RSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLF  2145
             +S+GFRAL+V+EDHSLLL+QQGE+VWSREDGLASIVDVTTSELPVEKDGVSV+ VE NLF
Sbjct  387   KSHGFRALVVMEDHSLLLIQQGEVVWSREDGLASIVDVTTSELPVEKDGVSVADVEHNLF  446

Query  2144  EWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYA  1965
             EWLKGH+LKLKGTLMLA  D+VAAIQ +RLKSS K+KMTRDHNGFRKLLIVL+++GK+ A
Sbjct  447   EWLKGHMLKLKGTLMLANADEVAAIQALRLKSSEKNKMTRDHNGFRKLLIVLTKAGKVIA  506

Query  1964  LHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDA  1785
             LHTGDGRI+WS L+ +LR S     P+ L+IYQWQVPHH  M ENPSVLVVGK G  S A
Sbjct  507   LHTGDGRIIWSNLMPSLRASRFGGMPSALRIYQWQVPHHSIMRENPSVLVVGKSGAESSA  566

Query  1784  PSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEAL  1605
             P V S +DSY+G+EL  ++  HS+ Q+IPL   D +EQRLHL++D++ + HLYP++P+AL
Sbjct  567   PGVFSILDSYSGEELNSMRLDHSVVQIIPLTLKDLSEQRLHLIVDSNSNAHLYPKSPDAL  626

Query  1604  GIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDV-GDDYYFATKYVWSVVFPSESEQII  1431
              +F  E  N+Y+YSVD   N++RG++++++   D+ GD+Y F+TK +WS++FPS+SE+I 
Sbjct  627   NVFLHETPNLYFYSVDIQANVIRGYSLQKSC--DIKGDEYCFSTKEIWSIIFPSDSERIA  684

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
              + TRK+NEVVHTQAK+  D DVMYKY+SKN++FVATV+PKAAGDIGS +P+E+ L+ YL
Sbjct  685   ISETRKMNEVVHTQAKIIGDHDVMYKYLSKNLVFVATVSPKAAGDIGSALPEEASLVAYL  744

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID VTGRILHR+TH G+QGPVHAVLSENWVVYHYFNLRAHR+EM VIEIYDQSRADNKD+
Sbjct  745   IDAVTGRILHRVTHHGAQGPVHAVLSENWVVYHYFNLRAHRFEMEVIEIYDQSRADNKDV  804

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
             +KL+LGKHNL+ P++SY RPEV+ KSQSYFF HSVK +AVT TAKGITSKQLLIGTIGDQ
Sbjct  805   MKLILGKHNLSAPITSYARPEVVVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTIGDQ  864

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             VLALDKR+LDPRR+ NPTQ EKE+GIIPLTDSLPIIPQS+VTH+ + E LRGIV++PAKL
Sbjct  865   VLALDKRYLDPRRSANPTQQEKEEGIIPLTDSLPIIPQSFVTHSHQVEALRGIVSIPAKL  924

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             ESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI  LV AI +TWIWSE+KEL+
Sbjct  925   ESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAVLVAAIIVTWIWSEKKELR  984

Query  530   EKWR  519
             +KWR
Sbjct  985   DKWR  988



>ref|XP_008648064.1| PREDICTED: uncharacterized protein LOC100381974 isoform X1 [Zea 
mays]
 gb|AFW77478.1| hypothetical protein ZEAMMB73_969683 [Zea mays]
Length=988

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/988 (61%), Positives = 774/988 (78%), Gaps = 5/988 (1%)
 Frame = -2

Query  3473  SPSAMAIRAFLLLVLIFSSAYT-TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRV  3297
             +P   ++   L  +L+F S  T   ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RV
Sbjct  3     APPRRSLLVLLAGILVFGSLTTLATAIYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRV  62

Query  3296  VVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDG  3120
             VV TEENV++SLDLR GDIFWRHV+   D +D + ++LGKYV+TLS G T LRAWNLPDG
Sbjct  63    VVLTEENVISSLDLRSGDIFWRHVIDKNDPLDQLSLSLGKYVLTLSLGGTILRAWNLPDG  122

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              M+WE+ L  S+ S   L V SN KV  D+L+L+ +  +++AVSSTDG ++W+KE + +G
Sbjct  123   HMIWETNLRISTASNPQLHVMSNNKVANDNLVLVSAGRWIYAVSSTDGAILWEKEFSLDG  182

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
             L+I+ I+       VYA+GL  SS+   Y ++A+ GE+LK      PGG  G+  LV+  
Sbjct  183   LEIKRILQSPENGIVYALGLAGSSKLALYHLSAKTGEILKDIQESLPGGLLGETVLVSDN  242

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVL  2580
              +VALD   S L+ I FK   I++ +VH++DLVQD +G+ + L S   G++++  +  + 
Sbjct  243   VLVALDKARSSLLVIEFKGERISYNKVHVSDLVQDLSGS-LELQSLSNGVISLQTSSSIS  301

Query  2579  FLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLL  2400
              L++     LEV+ +    A +S+SL+++E   AF +++H   +I   VKS +D  S ++
Sbjct  302   LLKLKGTDGLEVLQRFDQPAAVSDSLTITEKEAAFAVVQHLGSEIEFIVKSTSDLSSEII  361

Query  2399  EESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASI  2220
             +E   ID  +G V KVF+N+YIRTDRS+GFRAL+V+EDHSLLL+QQGE+VWSREDGLASI
Sbjct  362   KEKLVIDQNRGNVEKVFLNSYIRTDRSHGFRALVVMEDHSLLLIQQGEVVWSREDGLASI  421

Query  2219  VDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGK  2040
             VDVTTSELPVEKDGVSV+ VE NLFEWLKGH+LKLKG+LMLA  D+VAAIQ MRLKSS K
Sbjct  422   VDVTTSELPVEKDGVSVADVEHNLFEWLKGHMLKLKGSLMLANADEVAAIQAMRLKSSEK  481

Query  2039  SKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQ  1860
             +KMTRDHNGFRKLL+VL+++GK+ ALHTGDGR++WS LV +LR S     P+ L+IYQWQ
Sbjct  482   NKMTRDHNGFRKLLVVLTKAGKVMALHTGDGRVIWSKLVPSLRASRCGGVPSALRIYQWQ  541

Query  1859  VPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDS  1680
             VPHH  M ENPSVLVVGK G     P V S +DSY+G+EL  +K  HS+ Q+IPL   DS
Sbjct  542   VPHHSVMRENPSVLVVGKFGAEPSIPGVFSILDSYSGEELNSMKLDHSVVQIIPLTLKDS  601

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDV  1503
             +EQ+LHL +D+D + HLYP++P+AL +F  E+ N+Y+YSVD   N+++G++++++   +V
Sbjct  602   SEQQLHLFVDSDSNAHLYPKSPDALNVFLHEMSNLYFYSVDIQANVIKGYSLQKSCNLNV  661

Query  1502  GDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVA  1323
             GD+Y F+TK +W ++FPS+SE+I  + TRK+NEVVHTQAK++ D DVMYKY+SKN++FVA
Sbjct  662   GDEYCFSTKELWFIIFPSDSERITISETRKMNEVVHTQAKISGDHDVMYKYLSKNLVFVA  721

Query  1322  TVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFN  1143
             T++PKAA DIGS +P+E+ L+ YLID VTGRILHR+TH G+QGPVHAVLSENWVVYHYFN
Sbjct  722   TLSPKAAVDIGSALPEEASLVAYLIDAVTGRILHRVTHHGAQGPVHAVLSENWVVYHYFN  781

Query  1142  LRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVK  963
             LRAHR+EM+VIEIYDQSRA NKD+ KL+LGKHNL  P++SY RPEV  KSQSYFF HSVK
Sbjct  782   LRAHRFEMAVIEIYDQSRAGNKDVTKLILGKHNLLAPITSYARPEVAVKSQSYFFTHSVK  841

Query  962   TIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPII  783
              +AVT TAKGITSKQLL+GTIGDQVLALDKR+LDPRR+VNPTQ EKE+GIIPLTDSLPII
Sbjct  842   AMAVTQTAKGITSKQLLLGTIGDQVLALDKRYLDPRRSVNPTQQEKEEGIIPLTDSLPII  901

Query  782   PQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYall  603
             PQS+VTH+ + E LR IV++PAKLES T+VF YGVDLF+TQLAPS+TYDSLTD+FSYALL
Sbjct  902   PQSFVTHSHQVEALRAIVSIPAKLES-TIVFTYGVDLFYTQLAPSRTYDSLTDEFSYALL  960

Query  602   lltivalvvaifiTWIWSEQKELQEKWR  519
             L+TI  LV AI  TWIWSE+KEL++KWR
Sbjct  961   LITIAVLVAAIIGTWIWSEKKELRDKWR  988



>gb|EMT32849.1| hypothetical protein F775_31297 [Aegilops tauschii]
Length=1139

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/962 (61%), Positives = 768/962 (80%), Gaps = 2/962 (0%)
 Frame = -2

Query  3398  LYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLG  3219
             +YEDQVGL DWHQ+YIGKVK AV+HTQK+GR+RVVV TEENV+ASLDLR GDIFWRHV+ 
Sbjct  28    VYEDQVGLADWHQKYIGKVKQAVYHTQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVIE  87

Query  3218  HKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKV  3042
               + ID + ++ GKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V SN KV
Sbjct  88    KNNPIDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMIWETNIQTSTSSKSLLHVLSNSKV  147

Query  3041  DRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQF  2862
              +D+L+L+ +  +++AVSS DG + W KE   +GL+I+ +V     D VY VG+  SS+ 
Sbjct  148   VKDNLVLVLAGQWIYAVSSIDGVISWGKEFTLDGLEIKQVVQSPENDIVYVVGIAGSSKL  207

Query  2861  VAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  2682
               Y++NA+ GE++K      P G  G+I L +S  +VALD T S L  + FK   I++ +
Sbjct  208   AVYQLNAKTGEIVKDAQESLPDGLCGEILLGSSNVLVALDETRSALFIVEFKGESISYNK  267

Query  2681  VHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESL  2502
             V I++ VQDF+G   LLP    G++A+  +  V  L++     LEV+      A +S++L
Sbjct  268   VQISEFVQDFSGTVKLLPLMSNGIIALQSSSTVSLLKLKGMDGLEVIHSFDQPASVSDAL  327

Query  2501  SLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDR  2322
             +++E ++AF +++H   +I   VK  +D  + ++ E   ID  +G VHKVF+NNY+RTD+
Sbjct  328   TITEKYEAFAVVQHVGSQIEFIVKVTSDLTNEIIREKVDIDQHRGSVHKVFLNNYVRTDK  387

Query  2321  SYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFE  2142
             S+GFRAL+V+EDHS+LL+QQG +VWSREDGLASIVDV  SELPVEKDGVSV+ VE NLFE
Sbjct  388   SHGFRALVVMEDHSILLIQQGAVVWSREDGLASIVDVMASELPVEKDGVSVADVEHNLFE  447

Query  2141  WlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYAL  1962
             WLKGH+LKLKGTLMLA+ D++AAIQ +R++SS K+KMTRDHNGFRKLLIVL+++GK+ AL
Sbjct  448   WLKGHVLKLKGTLMLASVDELAAIQALRVRSSEKNKMTRDHNGFRKLLIVLTKAGKVVAL  507

Query  1961  HTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAP  1782
             HTGDGRI+WS L+ +LR S++ E P+ L+IYQWQVPHH  M ENPS+LVVG+ G +S AP
Sbjct  508   HTGDGRIIWSNLLPSLRASKSGEMPSALRIYQWQVPHHRVMRENPSILVVGRSGASSVAP  567

Query  1781  SVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
              VL  +DSY+G+EL      HS+AQ+IPL   DS+EQRLHL++D++ + HLYPR+ +AL 
Sbjct  568   GVLCVLDSYSGEELNSRSFDHSVAQIIPLTLKDSSEQRLHLIVDSNSNAHLYPRSLDALN  627

Query  1601  IFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
              F  E+ N Y+YSVD   N +RG++++++   +  D Y F+TK +WS++FPS++E+I  +
Sbjct  628   SFISEMSNQYFYSVDIQKNAIRGYSLQKSCDFNSDDTYCFSTKLLWSIIFPSDAERISVS  687

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
               RK+NEVVHTQAK+  D+DVMYKY+SKN++FVATV+P AAG+IGS  P+E+ L+ YLID
Sbjct  688   EARKMNEVVHTQAKIIADQDVMYKYLSKNLIFVATVSPNAAGEIGSAAPEEASLVAYLID  747

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
              V+GRILHR+TH G+QGPVHAV+SENWVVYHYFNLRAHR+E++VIEIYDQSRADNKD+LK
Sbjct  748   AVSGRILHRVTHHGAQGPVHAVVSENWVVYHYFNLRAHRFEIAVIEIYDQSRADNKDVLK  807

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVL  885
             L+LGKHNL+ P++SY RPEV+ KSQSYFF HSVK +AVT TAKGITSKQLLIGTIGDQVL
Sbjct  808   LILGKHNLSAPMTSYSRPEVMVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTIGDQVL  867

Query  884   ALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLES  705
             ALDKRFLDPRR++NPTQ EKE+GIIPLTDSLPIIPQSYVTH ++ E LRGIV++PAKLES
Sbjct  868   ALDKRFLDPRRSLNPTQQEKEEGIIPLTDSLPIIPQSYVTHTLQVEALRGIVSIPAKLES  927

Query  704   TTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEK  525
             TTLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL+TIVALV A+F+TWIWSE+KEL++K
Sbjct  928   TTLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLLITIVALVAALFVTWIWSEKKELRDK  987

Query  524   WR  519
             WR
Sbjct  988   WR  989



>ref|XP_008656322.1| PREDICTED: ER membrane protein complex subunit 1-like [Zea mays]
Length=989

 Score =  1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/965 (61%), Positives = 763/965 (79%), Gaps = 3/965 (0%)
 Frame = -2

Query  3407  TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRH  3228
             T ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV++SLDLR GDIFWRH
Sbjct  26    TTAIYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVISSLDLRSGDIFWRH  85

Query  3227  VLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSN  3051
             V+   D +D + ++LGKYV+TLSSG T LRAWNLPDG M+WE+ L  S+ S S L V SN
Sbjct  86    VIDKNDPLDQLGLSLGKYVLTLSSGGTILRAWNLPDGLMIWETNLRTSTASNSQLHVMSN  145

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
              K  RD+L+L+ +  +++AVSS DG + W+KE + + L+I+ I+     D VYA+GL  S
Sbjct  146   NKAARDNLVLVSAGRWIYAVSSIDGAISWEKEFSLDDLEIKRILQSPENDVVYALGLAGS  205

Query  2870  SQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLIN  2691
             S+   Y ++A+ GE+LK     FPGG  G   L +    VALD   S L+ I FK   I+
Sbjct  206   SKLALYHLSAKTGEILKDIQESFPGGLCGKTVLGSDNVFVALDKARSSLLLIEFKGERIS  265

Query  2690  FQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVIS  2511
             + +V ++DLVQD +G+   L S  + ++++  +  +  L++     LEV+ +    A +S
Sbjct  266   YNKVLVSDLVQDLSGS-FELQSLSSDIISLQTSSSISLLKLKGTDGLEVLQRFDQPAAVS  324

Query  2510  ESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIR  2331
             +SL ++E  +AF +++H   +I   VK  +D  S ++ E   ID  KG V +VF+N+YIR
Sbjct  325   DSLPITEKEKAFAVVQHLGSEIEFIVKFTSDLSSEIIREKVNIDQNKGNVERVFLNSYIR  384

Query  2330  TDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQN  2151
             TD+S+GFRAL+V+EDHSLLL+QQGE+VWSR+DGLASIVDVTTSELPVEKDGVSV+ VE N
Sbjct  385   TDKSHGFRALVVMEDHSLLLIQQGEVVWSRDDGLASIVDVTTSELPVEKDGVSVAGVEHN  444

Query  2150  LFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKL  1971
             LFEWLKGH+LKLKGTLMLA  D+VAAIQ +RLKSS K+KMTRDHNGFRKLL+VL+++GK+
Sbjct  445   LFEWLKGHMLKLKGTLMLANADEVAAIQALRLKSSEKNKMTRDHNGFRKLLVVLTKAGKV  504

Query  1970  YALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNS  1791
               LHTGDGR++WS L+ +LR S     P+ L+IYQWQVPHH  M ENPSVLVVG+ G  S
Sbjct  505   MTLHTGDGRVIWSKLLPSLRASRFGGVPSALRIYQWQVPHHSVMRENPSVLVVGRTGAES  564

Query  1790  DAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
              AP V S +DSY+G+EL  +K  HS+ Q+IPL   DS+EQRL+L++D++ + HLYP++ +
Sbjct  565   SAPGVFSILDSYSGEELNSMKLDHSVFQIIPLTLKDSSEQRLYLILDSNSNAHLYPKSAD  624

Query  1610  ALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
              L IF  E+ N+Y+YSVD   N+++G++++++   + GDDY F+TK +WS++FPS+SE+I
Sbjct  625   TLNIFLHEMSNLYFYSVDIQANVIKGYSLQKSCDLNFGDDYCFSTKELWSIIFPSDSERI  684

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
             + + TR +NEVVHTQAK   D DVMYKY+SKN++FVAT++PKAAGDIGSV+P+E+ L+ Y
Sbjct  685   VISETRNMNEVVHTQAKTIGDHDVMYKYLSKNLVFVATLSPKAAGDIGSVLPEEASLVAY  744

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             LID VTGRILHR+TH G+QGPVHAVLSENWVVYHYFNLRAHR+EM+VIEIYDQSRADNKD
Sbjct  745   LIDAVTGRILHRVTHHGAQGPVHAVLSENWVVYHYFNLRAHRFEMAVIEIYDQSRADNKD  804

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
             ++KL+LGKHNL+ P++SY RPEV  KSQSYFF HSVK +AVT TAKGITSKQLLIGTIGD
Sbjct  805   VMKLILGKHNLSAPITSYARPEVAVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTIGD  864

Query  893   QVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAK  714
             QVLALDKR+LDPRR+VNPTQ EKE+GIIPLTDSLPIIPQS+VTH+ + E LRGIV++PAK
Sbjct  865   QVLALDKRYLDPRRSVNPTQQEKEEGIIPLTDSLPIIPQSFVTHSHQVEALRGIVSIPAK  924

Query  713   LESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKEL  534
             LESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI  LV AI +TWIWSE+KEL
Sbjct  925   LESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAVLVAAIIVTWIWSEKKEL  984

Query  533   QEKWR  519
              +KWR
Sbjct  985   GDKWR  989



>gb|EPS59522.1| hypothetical protein M569_15283, partial [Genlisea aurea]
Length=908

 Score =  1175 bits (3040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/909 (64%), Positives = 743/909 (82%), Gaps = 4/909 (0%)
 Frame = -2

Query  3236  WRHVLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             WRHVLG KD+ID IDIALGKYVITLS G T LRAW+LPDGQMVWES L GS PS+ ++L+
Sbjct  1     WRHVLGPKDIIDQIDIALGKYVITLSRGGTVLRAWSLPDGQMVWESTLLGSRPSKPLVLI  60

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGL  2880
             P NL +D+D++I ++ +G++HAVSS DGEVIWKKELA++G +   +VHP G D +YA GL
Sbjct  61    PKNLNIDKDNIIFVFGNGHIHAVSSIDGEVIWKKELASDGFEAHELVHPVGGDSIYAFGL  120

Query  2879  TSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDG  2700
               SS+ V Y++N + GELL + S++FPGGFSGD+S V+ +  V +D++G+ LV +  K+G
Sbjct  121   IGSSEVVFYRLNIKSGELLDNGSILFPGGFSGDLSFVSDDTAVVMDASGTNLVVVHLKNG  180

Query  2699  LINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGA  2520
              ++F Q H++DL+QD +  AV+LPSK+ G+  +  +   +F +V  EG+L V++K+ +  
Sbjct  181   QLSFHQRHVSDLIQDSSRTAVILPSKVPGLFILKSDASNIFFKVGNEGELNVLEKLDHAN  240

Query  2519  VISESLSLSEGHQAFGLIKH-GVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFIN  2343
              +S+SL LSEG QAF L++  G  +I L+VKS +DW +NL+ E   +  Q+G + KVFIN
Sbjct  241   AVSDSLPLSEGRQAFALVQQAGDSEILLTVKSSDDWTANLVTEKIQMGPQRGHIQKVFIN  300

Query  2342  NYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSK  2163
             NY+RTDRS GFR LIV+ED+SL+LLQQGEIVWSREDGLASI+DV  SELP EKDGVSV+ 
Sbjct  301   NYVRTDRSNGFRVLIVMEDYSLVLLQQGEIVWSREDGLASIIDVKASELPFEKDGVSVAN  360

Query  2162  VEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSR  1983
             VE  LFEWL+GHLLK+KG+LMLA+PD++A IQ+MRL SS K+KMTRD NGFRKLL+VL+R
Sbjct  361   VEHGLFEWLQGHLLKIKGSLMLASPDELAVIQKMRLGSSEKTKMTRDRNGFRKLLVVLTR  420

Query  1982  SGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKC  1803
             +GK+ ALHTGDGRIVWS ++N+L KS  C+ P  + ++QWQ PHHHA+DENPSVLV G C
Sbjct  421   AGKILALHTGDGRIVWSLMLNSLWKS-PCKTPRWISLHQWQDPHHHALDENPSVLVAGMC  479

Query  1802  GLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYP  1623
               +SD+  ++S VD YTG E+  + P+HSIAQ+I L +TDS EQRLHLL+D+DG  HLYP
Sbjct  480   DGSSDSAGLISVVDVYTGNEITHVGPIHSIAQIITLQFTDSLEQRLHLLLDSDGRAHLYP  539

Query  1622  RTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSE  1446
             RT +ALGIF++ELGNIYWYSVD +  ILRGH +++    DV D++ +  K++WS+V P E
Sbjct  540   RTADALGIFRKELGNIYWYSVDTDEGILRGHGLQKTCILDVADEFCYEAKHLWSIVLPPE  599

Query  1445  SEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESW  1266
             +E+II+TA+R  NEVVHTQ KVT D+DV YKY+SKN+LF+ATV+PK  G IGSV PDES 
Sbjct  600   TERIISTASRNPNEVVHTQTKVTADQDVWYKYVSKNLLFLATVSPKGVGPIGSVTPDESS  659

Query  1265  LIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRA  1086
             L +Y+I+TV+GRILHR+ H G+QGPV+AV SENWVVYH FNLRAHRYEM+V+EIYD++RA
Sbjct  660   LFIYVINTVSGRILHRIAHHGAQGPVNAVFSENWVVYHCFNLRAHRYEMNVVEIYDEARA  719

Query  1085  DNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIG  906
             +NKD+ KLV G HNLT PV++Y R E   KSQSYFF HSVK++ VTST+KGITSKQ+L+G
Sbjct  720   ENKDIAKLVFGAHNLTSPVTAYSRLEASVKSQSYFFTHSVKSMVVTSTSKGITSKQVLVG  779

Query  905   TIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVT  726
             TIGDQ+LALDKRFLDPRRTVNP+QAEKE+GIIPLTDSLPIIPQSYVTH VK EGLR +VT
Sbjct  780   TIGDQILALDKRFLDPRRTVNPSQAEKEEGIIPLTDSLPIIPQSYVTHGVKVEGLRNVVT  839

Query  725   VPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSE  546
              PA+LEST LVFA+GVDLFF +LAPSKT+DSLT++FSYALLLLTI AL+VAIF+TWIWSE
Sbjct  840   FPARLESTALVFAHGVDLFFARLAPSKTFDSLTEEFSYALLLLTIAALLVAIFVTWIWSE  899

Query  545   QKELQEKWR  519
             +KELQ+KWR
Sbjct  900   KKELQDKWR  908



>gb|EEC78801.1| hypothetical protein OsI_19058 [Oryza sativa Indica Group]
Length=1036

 Score =  1173 bits (3035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/952 (61%), Positives = 753/952 (79%), Gaps = 3/952 (0%)
 Frame = -2

Query  3368  WHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDI  3189
             WHQ+YIGKVK AV+H+QK+GR+RVVV TEENV+ASLDLR GDIFWRHV+   D +D + +
Sbjct  86    WHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVIEKNDPVDELSL  145

Query  3188  ALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYS  3012
             +LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN KV +D+L+ + +
Sbjct  146   SLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSNNKVAKDNLVFVLA  205

Query  3011  SGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKG  2832
               +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  S +   Y++NA+ G
Sbjct  206   GRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGSLKLNLYQLNAKTG  265

Query  2831  ELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF  2652
             E +KH    FP    G+  L +   +VALD T S L  I  K   I++ +VHI+DLVQD 
Sbjct  266   ETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESISYNKVHISDLVQDL  325

Query  2651  TGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFG  2472
             +G   LLP    G++A+  +  V  L++     LEV+      A +S++L+++E  +AF 
Sbjct  326   SGTVKLLPLMSNGVIALQASSTVSLLKLKGIDGLEVIQSFEQPAAVSDALTITEKDEAFA  385

Query  2471  LIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVL  2292
             +++H   +I   VK  +D    ++ E   ID  +G + KVF+NNYIRTD+S+GFRAL+V+
Sbjct  386   VVQHTGSEIEFVVKFTSDVTGEVIREKINIDQHRGNIQKVFLNNYIRTDKSHGFRALVVM  445

Query  2291  EDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklk  2112
             EDHSLLL+QQGE+VWSREDGLASIVDVTTSELP+EKDGVSV+ VE NLFEWLKGH+LKLK
Sbjct  446   EDHSLLLVQQGEVVWSREDGLASIVDVTTSELPIEKDGVSVANVEHNLFEWLKGHMLKLK  505

Query  2111  gtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWS  1932
             GTLMLA  D++AAIQ MRLKSS K+KMTRDHNGFRKLLIVL+++GK+ ALHTGDGRI+WS
Sbjct  506   GTLMLANADELAAIQAMRLKSSEKNKMTRDHNGFRKLLIVLTKAGKVIALHTGDGRIIWS  565

Query  1931  FLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT  1752
              L+ +LR S++ E P+ L+I QWQVPHH  M ENPS+L++G+ G +S AP VLS +DSY+
Sbjct  566   NLLQSLRSSKSGEMPSALRICQWQVPHHRVMHENPSILIIGRSGADSAAPGVLSILDSYS  625

Query  1751  GKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIY  1572
             G+EL  LK  HS+ Q+IPL   DS+E RL L++D+    HLYPR+P+A+ +F  E+ N Y
Sbjct  626   GEELNSLKLDHSVVQIIPLTVKDSSEHRLQLIVDSHSRAHLYPRSPDAMNVFLHEMPNTY  685

Query  1571  WYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVH  1395
              Y+VD   N++RGH+++++   +  D+Y F+TK +WS+VFPS++E+I  + TRK+NEVVH
Sbjct  686   LYTVDIETNVIRGHSLQKS-CDNSADEYCFSTKELWSIVFPSDTERIAISETRKMNEVVH  744

Query  1394  TQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRM  1215
              QAK+  D+DVMYKY+SKN++FVATV+PKA+G+IGS  P+E+WL+ YLID VTGRILHR+
Sbjct  745   AQAKIIADQDVMYKYLSKNLVFVATVSPKASGEIGSAAPEEAWLVAYLIDAVTGRILHRV  804

Query  1214  THQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTK  1035
             TH G+QGPVHAV+SENWVVYHYFNLRAHR+EM+VIEIYDQSRADNKD++KL+LGKHNL+ 
Sbjct  805   THHGAQGPVHAVVSENWVVYHYFNLRAHRFEMAVIEIYDQSRADNKDVMKLILGKHNLSA  864

Query  1034  PVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPR  855
             P++SY RPEV+ KSQSYFF  SVK IA T TAKGITSKQLLIGTIGDQVLALDKRF+DPR
Sbjct  865   PITSYTRPEVMVKSQSYFFTFSVKAIAATQTAKGITSKQLLIGTIGDQVLALDKRFVDPR  924

Query  854   RTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVD  675
             R+VNPTQ EKE+GIIPLTD+LPIIP SY+TH+++ E LRGIV++P+KLESTTLVF YGVD
Sbjct  925   RSVNPTQQEKEEGIIPLTDALPIIPTSYLTHSLQVEALRGIVSIPSKLESTTLVFTYGVD  984

Query  674   LFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             LF+TQLAPS+TYDSLTD+FSYALLL+TI ALV AI +TWIWSE+KEL++KWR
Sbjct  985   LFYTQLAPSRTYDSLTDEFSYALLLITIAALVAAIVVTWIWSEKKELRDKWR  1036



>ref|XP_003568721.1| PREDICTED: ER membrane protein complex subunit 1 [Brachypodium 
distachyon]
Length=989

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/961 (60%), Positives = 764/961 (80%), Gaps = 2/961 (0%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV+ASLDLR GDIFWRHV+  
Sbjct  29    YEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVIEK  88

Query  3215  KDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVD  3039
              D ID + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V S+ KV 
Sbjct  89    NDPIDQLSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNIQTSTASKSLLHVLSSNKVA  148

Query  3038  RDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFV  2859
             +D+L+L+ +   ++AVSS DG + W+K+   + L+I+ ++     D V  VG+  SS+  
Sbjct  149   KDNLVLVSTGRSIYAVSSIDGVISWRKDFTLDDLEIKQVIQSPENDIVSVVGVAGSSKLA  208

Query  2858  AYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQV  2679
              Y++NA+ GE++K      PGG  G+  L + + ++ALD T S +  I FK   +++ +V
Sbjct  209   LYQLNAKSGEIVKDAQESLPGGLCGETVLGSHDVLIALDQTRSAIFVIEFKGLSLSYNKV  268

Query  2678  HIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS  2499
              +++ VQD +G   LLP    G++A+  +  V  L++     LEV+      A +S++L+
Sbjct  269   RVSNFVQDLSGTVKLLPLMSNGIIALQSSCTVYLLKLKGMDGLEVIHSFDRPAAVSDALA  328

Query  2498  LSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRS  2319
             ++E  +AF +++H   +I   VK  +D  + ++ E   ID  +G V KVF+NNY+RTD+S
Sbjct  329   ITEKDEAFAVVQHVGSQIEFIVKVTSDLSNEVIREKVDIDQHRGSVQKVFLNNYVRTDKS  388

Query  2318  YGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEW  2139
             +GFRALIV+EDHS+LL+QQG +VWSREDGLASIVDV  SELPVEK+GVSV+ VE NLFEW
Sbjct  389   HGFRALIVMEDHSILLVQQGAVVWSREDGLASIVDVMASELPVEKEGVSVANVEHNLFEW  448

Query  2138  lkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALH  1959
             LKGH+LKLKGTLMLA+ D++AAIQ +RL+SS K+KMTRDHNGFRKLLI+L+++GK+ ALH
Sbjct  449   LKGHMLKLKGTLMLASADELAAIQSLRLRSSEKNKMTRDHNGFRKLLIILTKAGKVMALH  508

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPS  1779
             TGDGRI+WS  +  LR S++ E  + L+IYQWQVPHH  M ENPS+LVVG+ G +S +P 
Sbjct  509   TGDGRIIWSNFLPFLRASKSGEISSALRIYQWQVPHHRVMRENPSILVVGRSGGDSVSPG  568

Query  1778  VLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGI  1599
             VLS +DSY+G+EL   +  HS+AQ+IPL   DS+EQRLHL++D++   HLYPR+P+AL  
Sbjct  569   VLSILDSYSGEELNSQRFDHSVAQIIPLILKDSSEQRLHLIVDSNSLAHLYPRSPDALKS  628

Query  1598  FKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
             F  E  N+Y+YSVD   N +RG++++++   ++ D+Y F+TK +WS+VFPS++E+I  + 
Sbjct  629   FIHERSNLYFYSVDIQENAIRGYSLQKSCDLNLEDEYCFSTKELWSIVFPSDAERIAISE  688

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
             TRKLNEVVHTQAK++ D+DVMYKY+SKN++FVATV+PKAAG+IGS  P+E+ L+ YLID 
Sbjct  689   TRKLNEVVHTQAKISADQDVMYKYVSKNLVFVATVSPKAAGEIGSAAPEEASLVAYLIDA  748

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             VTGRILHR+TH G+QGPVHAV+SENWVVYHYFNLRAHR+E++VIEIYDQSRADNKD++KL
Sbjct  749   VTGRILHRVTHHGAQGPVHAVVSENWVVYHYFNLRAHRFEIAVIEIYDQSRADNKDVMKL  808

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
             +LGKHNL+ P++SY RP+V  KSQSYFF HSVK +AVT TAKGITSKQLLIGTIGDQVLA
Sbjct  809   ILGKHNLSAPITSYSRPDVTVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTIGDQVLA  868

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             LDKRFLDPRR++NPTQ EKE+GIIPLTDSLPIIPQSYVTH+++ E LRGIV +PAKLEST
Sbjct  869   LDKRFLDPRRSLNPTQQEKEEGIIPLTDSLPIIPQSYVTHSLQVEALRGIVAIPAKLEST  928

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKW  522
             TLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL+TI ALV A+ +TW+WSE+KEL++KW
Sbjct  929   TLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLLITIAALVAALVVTWVWSEKKELRDKW  988

Query  521   R  519
             R
Sbjct  989   R  989



>ref|XP_003636402.1| hypothetical protein MTR_040s0031 [Medicago truncatula]
Length=871

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/852 (67%), Positives = 707/852 (83%), Gaps = 3/852 (0%)
 Frame = -2

Query  3071  ILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVY  2892
             IL++  NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y
Sbjct  22    ILIIQKNLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIY  79

Query  2891  AVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSII  2712
               G   SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I 
Sbjct  80    VAGFVGSSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTID  139

Query  2711  FKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKV  2532
               +G IN+ Q  ++DL++D +G AV+LPSKL G+ A+ IN  VL ++VT EG+L  +D++
Sbjct  140   INNGNINYNQKQVSDLIKDSSGQAVILPSKLPGLFALKINSQVLLIKVTNEGELVALDQI  199

Query  2531  AYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKV  2352
                A  S +LS+SE    F  +++   KI LSVK +NDW   LL+E+  ID Q+G + K+
Sbjct  200   DNTAAFSNALSISEDQHVFAFVQYEDNKIQLSVKDVNDWNGALLKENLVIDHQRGNIEKI  259

Query  2351  FINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVS  2172
             FINNY+RTDRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVTTSELPVEK+GVS
Sbjct  260   FINNYVRTDRSHGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVTTSELPVEKEGVS  319

Query  2171  VSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIV  1992
             V+KVEQNLFEWLKGH+LKLKGTLM+A+ ++  AIQ++RL+SS KSKMTRDHNGFRKLLIV
Sbjct  320   VAKVEQNLFEWLKGHVLKLKGTLMIASAEEKIAIQKLRLRSSEKSKMTRDHNGFRKLLIV  379

Query  1991  LSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVV  1812
             L+R+GK++ALHTGDGRIVWS  ++ALRKSE CE+P GL IYQWQVPHHHA+DENPS+LV+
Sbjct  380   LTRAGKVFALHTGDGRIVWSTTLHALRKSEDCEHPVGLNIYQWQVPHHHALDENPSLLVI  439

Query  1811  GKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGH  1632
             G+CG +  AP+V+SF+D+YTGKEL  L   H++A+VIPLPYTDSTEQRLHL+ID + H +
Sbjct  440   GRCGPSVTAPTVISFLDAYTGKELNSLSLAHTVARVIPLPYTDSTEQRLHLIIDVNKHAY  499

Query  1631  LYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVF  1455
             LYPRTPEA+ I KRE  NIYWYSV+ +N ++RGHA+K N   ++ D+Y F  + +WS+VF
Sbjct  500   LYPRTPEAIEILKREFSNIYWYSVETDNGVIRGHALKSNCIHEIVDEYCFVFRDLWSIVF  559

Query  1454  PSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPD  1275
             PSESE+IIAT TRK NEVVHTQAKV TD DVMYKYISKN+LFVA  APKA+G+IG+  P+
Sbjct  560   PSESEKIIATVTRKSNEVVHTQAKVMTDHDVMYKYISKNILFVANAAPKASGEIGTATPE  619

Query  1274  ESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQ  1095
             E+ L++Y+IDTVTGRILHRMTH G QGPVHAV SENWVVYHYFNLRAHR+EMSVIE+YDQ
Sbjct  620   EATLVIYIIDTVTGRILHRMTHHGCQGPVHAVFSENWVVYHYFNLRAHRHEMSVIEVYDQ  679

Query  1094  SRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQL  915
             SRADNKD+ K VLGKHNLT P+SSY RPE+ AKSQSYFF HSVK I VTSTAKGITSKQL
Sbjct  680   SRADNKDIWKFVLGKHNLTSPISSYYRPEISAKSQSYFFTHSVKAIEVTSTAKGITSKQL  739

Query  914   LIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRG  735
             LIGTIGDQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY+TH++K EGLRG
Sbjct  740   LIGTIGDQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSYITHSLKVEGLRG  799

Query  734   IVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWI  555
             IVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTIVALV A+F+T++
Sbjct  800   IVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTIVALVAALFVTYV  859

Query  554   WSEQKELQEKWR  519
              SE+K+L+EKWR
Sbjct  860   LSERKDLEEKWR  871



>gb|KEH36029.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=849

 Score =  1149 bits (2973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/846 (67%), Positives = 703/846 (83%), Gaps = 3/846 (0%)
 Frame = -2

Query  3053  NLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTS  2874
             NLK D+D LIL++  G LHA+S  DGEV+W+K+ A+E +++ HI+     + +Y  G   
Sbjct  6     NLKADKDDLILVFGKGCLHAISGIDGEVLWRKDFASESIEVSHIIQ--SPEVIYVAGFVG  63

Query  2873  SSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLI  2694
             SS+F  Y++NA+ GELLK+  +  P   SG+   V+ +K V LD   S +V+I   +G I
Sbjct  64    SSKFYVYEVNAKSGELLKNNHVALPFATSGESLSVSGDKFVVLDDVRSKIVTIDINNGNI  123

Query  2693  NFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVI  2514
             N+ Q  ++DL++D +G AV+LPSKL G+ A+ IN  VL ++VT EG+L  +D++   A  
Sbjct  124   NYNQKQVSDLIKDSSGQAVILPSKLPGLFALKINSQVLLIKVTNEGELVALDQIDNTAAF  183

Query  2513  SESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYI  2334
             S +LS+SE    F  +++   KI LSVK +NDW   LL+E+  ID Q+G + K+FINNY+
Sbjct  184   SNALSISEDQHVFAFVQYEDNKIQLSVKDVNDWNGALLKENLVIDHQRGNIEKIFINNYV  243

Query  2333  RTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQ  2154
             RTDRS+GFRAL+V+EDHSLLL+QQGEIVWSREDGLAS+VDVTTSELPVEK+GVSV+KVEQ
Sbjct  244   RTDRSHGFRALMVMEDHSLLLVQQGEIVWSREDGLASVVDVTTSELPVEKEGVSVAKVEQ  303

Query  2153  NLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGK  1974
             NLFEWLKGH+LKLKGTLM+A+ ++  AIQ++RL+SS KSKMTRDHNGFRKLLIVL+R+GK
Sbjct  304   NLFEWLKGHVLKLKGTLMIASAEEKIAIQKLRLRSSEKSKMTRDHNGFRKLLIVLTRAGK  363

Query  1973  LYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLN  1794
             ++ALHTGDGRIVWS  ++ALRKSE CE+P GL IYQWQVPHHHA+DENPS+LV+G+CG +
Sbjct  364   VFALHTGDGRIVWSTTLHALRKSEDCEHPVGLNIYQWQVPHHHALDENPSLLVIGRCGPS  423

Query  1793  SDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTP  1614
               AP+V+SF+D+YTGKEL  L   H++A+VIPLPYTDSTEQRLHL+ID + H +LYPRTP
Sbjct  424   VTAPTVISFLDAYTGKELNSLSLAHTVARVIPLPYTDSTEQRLHLIIDVNKHAYLYPRTP  483

Query  1613  EALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQ  1437
             EA+ I KRE  NIYWYSV+ +N ++RGHA+K N   ++ D+Y F  + +WS+VFPSESE+
Sbjct  484   EAIEILKREFSNIYWYSVETDNGVIRGHALKSNCIHEIVDEYCFVFRDLWSIVFPSESEK  543

Query  1436  IIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIV  1257
             IIAT TRK NEVVHTQAKV TD DVMYKYISKN+LFVA  APKA+G+IG+  P+E+ L++
Sbjct  544   IIATVTRKSNEVVHTQAKVMTDHDVMYKYISKNILFVANAAPKASGEIGTATPEEATLVI  603

Query  1256  YLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNK  1077
             Y+IDTVTGRILHRMTH G QGPVHAV SENWVVYHYFNLRAHR+EMSVIE+YDQSRADNK
Sbjct  604   YIIDTVTGRILHRMTHHGCQGPVHAVFSENWVVYHYFNLRAHRHEMSVIEVYDQSRADNK  663

Query  1076  DLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIG  897
             D+ K VLGKHNLT P+SSY RPE+ AKSQSYFF HSVK I VTSTAKGITSKQLLIGTIG
Sbjct  664   DIWKFVLGKHNLTSPISSYYRPEISAKSQSYFFTHSVKAIEVTSTAKGITSKQLLIGTIG  723

Query  896   DQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPA  717
             DQVLALDKRFLDPRRT+NP+QAEKE+GIIPLTDSLPII QSY+TH++K EGLRGIVTVPA
Sbjct  724   DQVLALDKRFLDPRRTLNPSQAEKEEGIIPLTDSLPIISQSYITHSLKVEGLRGIVTVPA  783

Query  716   KLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKE  537
             KLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLLTIVALV A+F+T++ SE+K+
Sbjct  784   KLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLLTIVALVAALFVTYVLSERKD  843

Query  536   LQEKWR  519
             L+EKWR
Sbjct  844   LEEKWR  849



>gb|KDO79766.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
 gb|KDO79767.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=795

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/796 (69%), Positives = 667/796 (84%), Gaps = 8/796 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRVVVS
Sbjct  1     MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVS  59

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMV
Sbjct  60    TEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMV  119

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+ +LLVP+NLKVD+DSLIL+ S G LHAVSS DGE++W ++ A E +++
Sbjct  120   WESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEV  179

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q ++  D +D +Y VG   SSQF AY+INA  GELL HE+  F GGF GD++LV+S+ +V
Sbjct  180   QQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLV  239

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+T SILV++ FK+  I FQ+ H+++L +D +G   +LPS LTGM  + IN + LF+R
Sbjct  240   TLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIR  299

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             +T E KLEVV KV +  V+S++L  SEG +AF +++HG  K+ ++VK   DW +NL++ES
Sbjct  300   LTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQES  359

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTDRS+GFRALIV+EDHSLLL+QQG+IVW+RED LASI+DV
Sbjct  360   IEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDV  419

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVEK+GVSV+KVE +LFEWLKGH+LKLKGTLMLA+P+DVAAIQ +RLKSS KSKM
Sbjct  420   TTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKM  479

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKLLIVL+++ K++ALH+GDGR+VWS L   L KSE C++P  L +YQWQ PH
Sbjct  480   TRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLL---LHKSEACDSPTELNLYQWQTPH  536

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+CG++S AP++LSFVD+YTGKEL     VHS  QV+PLP+TDSTEQ
Sbjct  537   HHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQ  596

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLL+D D   HLYP+T EA+ IF++E  NIYWYSV+A+N I++GHAVK     +V DD
Sbjct  597   RLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDD  656

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             + F T+ +WS++FP ESE+IIA  +RK NEVVHTQAKVT+++DVMYKYISKN+LFVATVA
Sbjct  657   FCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVA  716

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+G IGS  PDE+WL+VYLIDT+TGRILHRMTH G+QGPVHAVLSENWVVYHYFNLRA
Sbjct  717   PKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRA  776

Query  1133  HRYEMSVIEIYDQSRA  1086
             HRYEMSV EIYDQSRA
Sbjct  777   HRYEMSVTEIYDQSRA  792



>gb|KDO79765.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=794

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/796 (69%), Positives = 667/796 (84%), Gaps = 8/796 (1%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYT--TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             MAIR F++L L+F S+ T  + SLYEDQVGLMDWHQ+YIGKVKHAVFHTQK GRKRVVVS
Sbjct  1     MAIR-FIILTLLFLSSCTIPSLSLYEDQVGLMDWHQQYIGKVKHAVFHTQKTGRKRVVVS  59

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMV  3111
             TEENV+ASLDLRHG+IFWRHVLG  DV+DGIDIALGKYVITLSS GSTLRAWNLPDGQMV
Sbjct  60    TEENVIASLDLRHGEIFWRHVLGINDVVDGIDIALGKYVITLSSDGSTLRAWNLPDGQMV  119

Query  3110  WESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             WESFL GS  S+ +LLVP+NLKVD+DSLIL+ S G LHAVSS DGE++W ++ A E +++
Sbjct  120   WESFLRGSKHSKPLLLVPTNLKVDKDSLILVSSKGCLHAVSSIDGEILWTRDFAAESVEV  179

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVV  2751
             Q ++  D +D +Y VG   SSQF AY+INA  GELL HE+  F GGF GD++LV+S+ +V
Sbjct  180   QQVIQLDESDQIYVVGYAGSSQFHAYQINAMNGELLNHETAAFSGGFVGDVALVSSDTLV  239

Query  2750  ALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
              LD+T SILV++ FK+  I FQ+ H+++L +D +G   +LPS LTGM  + IN + LF+R
Sbjct  240   TLDTTRSILVTVSFKNRKIAFQETHLSNLGEDSSGMVEILPSSLTGMFTVKINNYKLFIR  299

Query  2570  VTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
             +T E KLEVV KV +  V+S++L  SEG +AF +++HG  K+ ++VK   DW +NL++ES
Sbjct  300   LTSEDKLEVVHKVDHETVVSDALVFSEGKEAFAVVEHGGSKVDITVKPGQDWNNNLVQES  359

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDV  2211
               +D Q+GLVHKVFINNY+RTDRS+GFRALIV+EDHSLLL+QQG+IVW+RED LASI+DV
Sbjct  360   IEMDHQRGLVHKVFINNYLRTDRSHGFRALIVMEDHSLLLVQQGKIVWNREDALASIIDV  419

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKM  2031
             TTSELPVEK+GVSV+KVE +LFEWLKGH+LKLKGTLMLA+P+DVAAIQ +RLKSS KSKM
Sbjct  420   TTSELPVEKEGVSVAKVEHSLFEWLKGHMLKLKGTLMLASPEDVAAIQAIRLKSSEKSKM  479

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
             TRDHNGFRKLLIVL+++ K++ALH+GDGR+VWS L   L KSE C++P  L +YQWQ PH
Sbjct  480   TRDHNGFRKLLIVLTKARKIFALHSGDGRVVWSLL---LHKSEACDSPTELNLYQWQTPH  536

Query  1850  HHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQ  1671
             HHAMDENPSVLVVG+CG++S AP++LSFVD+YTGKEL     VHS  QV+PLP+TDSTEQ
Sbjct  537   HHAMDENPSVLVVGRCGVSSKAPAILSFVDTYTGKELNSFDLVHSAVQVMPLPFTDSTEQ  596

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             RLHLL+D D   HLYP+T EA+ IF++E  NIYWYSV+A+N I++GHAVK     +V DD
Sbjct  597   RLHLLVDDDRRIHLYPKTSEAISIFQQEFSNIYWYSVEADNGIIKGHAVKSKCAGEVLDD  656

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
             + F T+ +WS++FP ESE+IIA  +RK NEVVHTQAKVT+++DVMYKYISKN+LFVATVA
Sbjct  657   FCFETRVLWSIIFPMESEKIIAAVSRKQNEVVHTQAKVTSEQDVMYKYISKNLLFVATVA  716

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
             PKA+G IGS  PDE+WL+VYLIDT+TGRILHRMTH G+QGPVHAVLSENWVVYHYFNLRA
Sbjct  717   PKASGHIGSADPDEAWLVVYLIDTITGRILHRMTHHGAQGPVHAVLSENWVVYHYFNLRA  776

Query  1133  HRYEMSVIEIYDQSRA  1086
             HRYEMSV EIYDQSRA
Sbjct  777   HRYEMSVTEIYDQSRA  792



>gb|EEE62894.1| hypothetical protein OsJ_17698 [Oryza sativa Japonica Group]
Length=950

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/966 (57%), Positives = 711/966 (74%), Gaps = 44/966 (5%)
 Frame = -2

Query  3407  TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRH  3228
             T ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV+ASLDLR GDIFWRH
Sbjct  26    TAAVYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRH  85

Query  3227  VLGHKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSN  3051
             V+   D +D + ++LGKYV+TLSSG S LRAWNLPDGQM+WE+ L  S  S+ +L V SN
Sbjct  86    VIEKNDPVDELSLSLGKYVVTLSSGGSILRAWNLPDGQMIWETNLQVSKSSKPLLHVLSN  145

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
              KV +D+L+ + +  +++AVSS DG + W KE + +GLD++ I+     D VYAVGL  S
Sbjct  146   NKVAKDNLVFVLAGRWIYAVSSIDGVISWGKEFSLDGLDLKQIIQSPENDIVYAVGLAGS  205

Query  2870  SQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLIN  2691
             S+   Y++NA+ GE +KH    FP    G+  L +   +VALD T S L  I  K   I+
Sbjct  206   SKLNLYQLNAKTGETVKHIQESFPIALCGETILGSHNVLVALDETRSDLFLIELKGESIS  265

Query  2690  FQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVIS  2511
             + +VHI+DLVQD +G   LLP    G++A+  +  V  L++     LEV+      A +S
Sbjct  266   YNKVHISDLVQDLSGTVKLLPLMSNGVIALQASSTVSLLKLKGIDGLEVIQSFEQPAAVS  325

Query  2510  ESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIR  2331
             ++L+++E  +AF +++H   +I   VK  +D    ++ E   ID  +G + KVF+NNYIR
Sbjct  326   DALTITEKDEAFAVVQHTGSEIEFVVKFTSDVTGEVIREKINIDQHRGNIQKVFLNNYIR  385

Query  2330  TDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQN  2151
             TD+S+GFRAL+V+EDHSLLL+QQGE+VWSREDGLASIVDVTTSELP+EKDGVSV+ VE N
Sbjct  386   TDKSHGFRALVVMEDHSLLLVQQGEVVWSREDGLASIVDVTTSELPIEKDGVSVANVEHN  445

Query  2150  LFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKL  1971
             LFEWLKGH+LKLKGTLMLA  D++AAIQ MRLKSS K+KMTRDHNGFRKLLIVL+++GK+
Sbjct  446   LFEWLKGHMLKLKGTLMLANADELAAIQAMRLKSSEKNKMTRDHNGFRKLLIVLTKAGKV  505

Query  1970  YALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNS  1791
              ALHTGDGRI+WS L+ +LR S++ E P+ L+I QWQVPHH  M ENPS+L++G+ G +S
Sbjct  506   IALHTGDGRIIWSNLLQSLRSSKSGEMPSALRICQWQVPHHRVMHENPSILIIGRSGADS  565

Query  1790  DAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
              AP VLS +DSY+G+EL  LK  HS+ Q+IPL   DS+E RL L++D+    HLYPR+P+
Sbjct  566   AAPGVLSVLDSYSGEELNSLKLDHSVVQIIPLTVKDSSEHRLQLIVDSHSRAHLYPRSPD  625

Query  1610  ALGIFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
             A+ +F  E+ N Y Y+VD   N++RGH+++++   +  D+Y F+TK +WS+VFPS++E+I
Sbjct  626   AMNVFLHEMPNTYLYTVDIETNVIRGHSLQKS-CDNSADEYCFSTKELWSIVFPSDTERI  684

Query  1433  IATATRKLNEVVHTQ-AKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIV  1257
               + TRK+NEV H   AK+T  R  M   I + + F+  +          ++  E+W   
Sbjct  685   AISETRKMNEVCHAPGAKITAARYDMQVPI-QGIWFLLLLCLLKL-----LVVSENW---  735

Query  1256  YLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNK  1077
                                            VVYHYFNLRAHR+EM+VIEIYDQSRADNK
Sbjct  736   -------------------------------VVYHYFNLRAHRFEMAVIEIYDQSRADNK  764

Query  1076  DLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIG  897
             D++KL+LGKHNL+ P +SY RPEV+ KSQSYFF  SVK IA T TAKGITSKQLLIGTIG
Sbjct  765   DVMKLILGKHNLSAPTTSYTRPEVMVKSQSYFFTFSVKAIAATQTAKGITSKQLLIGTIG  824

Query  896   DQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPA  717
             DQVLALDKRF+DPRR+VNPTQ EKE+GIIPLTD+LPIIP SY+TH+++ E LRGIV++P+
Sbjct  825   DQVLALDKRFVDPRRSVNPTQQEKEEGIIPLTDALPIIPTSYLTHSLQVEALRGIVSIPS  884

Query  716   KLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKE  537
             KLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI ALV AI +TWIWSE+KE
Sbjct  885   KLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAALVAAIVVTWIWSEKKE  944

Query  536   LQEKWR  519
             L++KWR
Sbjct  945   LRDKWR  950



>gb|EMS55546.1| hypothetical protein TRIUR3_31633 [Triticum urartu]
Length=885

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/852 (58%), Positives = 657/852 (77%), Gaps = 5/852 (1%)
 Frame = -2

Query  3398  LYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLG  3219
             +YEDQVGL DWHQ+YIGKVK AV+HTQK+GR+RVVV TEENV+ASLDLR GDIFWRHV+ 
Sbjct  28    VYEDQVGLADWHQKYIGKVKQAVYHTQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVIE  87

Query  3218  HKDVIDGIDIALGKYVITLSSG-STLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKV  3042
               + ID + ++ GKYV+TLSSG S LRAWNLPDGQM+WE+ +  S+ S+S+L V SN KV
Sbjct  88    KNNPIDQLSLSAGKYVVTLSSGGSILRAWNLPDGQMIWETNIHTSTSSKSLLHVLSNSKV  147

Query  3041  DRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQF  2862
              +D+L+L+ +  +++AVSS DG + W KE   +GL+I+ +V     D VY VG+  SS+ 
Sbjct  148   VKDNLVLVLAGQWIYAVSSIDGVISWGKEFTLDGLEIKQVVQSPDNDIVYVVGIAGSSKL  207

Query  2861  VAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQ  2682
               Y++NA+ GE++K      P G  G+I L +S  +VALD T S L  + FK   I++ +
Sbjct  208   AVYQLNAKTGEIVKDAQESLPDGLCGEILLGSSNVLVALDETRSALFIVDFKGESISYNK  267

Query  2681  VHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESL  2502
             V I++ VQDF+G   LLP    G++A+  +  V  L++     LEV+      A +S++L
Sbjct  268   VQISEFVQDFSGTVKLLPLMSNGIIALQSSSTVSLLKLKGMDGLEVIHSFDQPASVSDAL  327

Query  2501  SLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDR  2322
             +++E  +AF +++H   +I   VK  +D  + ++ E   ID  +G V KVF+NNY+RTD+
Sbjct  328   TITEKDEAFAVVQHVGSQIEFIVKVTSDLTNEIIREKVDIDQHRGSVQKVFLNNYVRTDK  387

Query  2321  SYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFE  2142
             S+GFRAL+V+EDHS+LL+QQG +VWSREDGLASIVDV TSELPVEKDGVSV+ VE NLFE
Sbjct  388   SHGFRALVVMEDHSILLIQQGAVVWSREDGLASIVDVMTSELPVEKDGVSVADVEHNLFE  447

Query  2141  WlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYAL  1962
             WLKGH+LKLKGTLMLA+ D++AAIQ +R++SS K+KMTRDHNGFRKLLIVL+++GK+ AL
Sbjct  448   WLKGHVLKLKGTLMLASVDELAAIQALRVRSSEKNKMTRDHNGFRKLLIVLTKAGKVIAL  507

Query  1961  HTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAP  1782
             HTGDGRI+WS L+ +LR S++ E P+ L+IYQWQVPHH  + ENP++LVVG+ G +S AP
Sbjct  508   HTGDGRIIWSNLLPSLRASKSGEMPSALRIYQWQVPHHRVIRENPTILVVGRSGASSVAP  567

Query  1781  SVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
              VL  +DSY+G+EL      HS+AQ+IPL   DS+EQRLHL++D++ + HLYPR+P+AL 
Sbjct  568   GVLCILDSYSGEELNSQSFDHSVAQIIPLTLKDSSEQRLHLIVDSNSNAHLYPRSPDALN  627

Query  1601  IFKRELGNIYWYSVD-ANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
              F  E+ N Y+YSVD   N +RG++++++   +  D Y F+TK +WS++FPS++E+I  +
Sbjct  628   SFINEMSNQYFYSVDIQKNAIRGYSLQKSCDFNSDDTYCFSTKLLWSIIFPSDAERISVS  687

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
               RK+NEVVHTQAK+  D+DVMYKY+SKN++FVATV+PKAAG+IGS  P+E+ L+ YLID
Sbjct  688   EARKMNEVVHTQAKIIADQDVMYKYLSKNLIFVATVSPKAAGEIGSAAPEEASLMAYLID  747

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
              V+GRILHR+TH G+QGPVHAV+SENWVVYHYFNLRAHR+E++VIEIYDQSRADNKD+LK
Sbjct  748   AVSGRILHRVTHHGAQGPVHAVVSENWVVYHYFNLRAHRFEIAVIEIYDQSRADNKDVLK  807

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV-  888
             L+LGKHNL+ P++SY RPEV+ KSQSYFF HSVK +AVT TAKGITSKQLLIGT GDQ+ 
Sbjct  808   LILGKHNLSAPMTSYSRPEVMVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTTGDQIR  867

Query  887   --LALDKRFLDP  858
               L L + ++ P
Sbjct  868   MSLTLKRVWIHP  879



>gb|AFW82067.1| hypothetical protein ZEAMMB73_676127 [Zea mays]
Length=881

 Score =   993 bits (2566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/842 (59%), Positives = 650/842 (77%), Gaps = 3/842 (0%)
 Frame = -2

Query  3407  TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRH  3228
             T ++YEDQVGL DWHQ+YIGKVK AV+H+QK+GR+RVVV TEENV++SLDLR GDIFWRH
Sbjct  26    TTAIYEDQVGLADWHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVISSLDLRSGDIFWRH  85

Query  3227  VLGHKDVIDGIDIALGKYVITLSSGST-LRAWNLPDGQMVWESFLSGSSPSRSILLVPSN  3051
             V+   D +D + ++LGKYV+TLSSG T LRAWNLPDG M+WE+ L  S+ S S L V SN
Sbjct  86    VIDKNDPLDQLGLSLGKYVLTLSSGGTILRAWNLPDGLMIWETNLRTSTASNSQLHVMSN  145

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
              K  RD+L+L+ +  +++AVSS DG + W+KE + + L+I+ I+     D VYA+GL  S
Sbjct  146   NKAARDNLVLVSAGRWIYAVSSIDGAISWEKEFSLDDLEIKRILQSPENDVVYALGLAGS  205

Query  2870  SQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLIN  2691
             S+   Y ++A+ GE+LK     FPGG  G   L +    VALD   S L+ I FK   I+
Sbjct  206   SKLALYHLSAKTGEILKDIQESFPGGLCGKTVLGSDNVFVALDKARSSLLLIEFKGERIS  265

Query  2690  FQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVIS  2511
             + +V ++DLVQD +G+   L S  + ++++  +  +  L++     LEV+ +    A +S
Sbjct  266   YNKVLVSDLVQDLSGS-FELQSLSSDIISLQTSSSISLLKLKGTDGLEVLQRFDQPAAVS  324

Query  2510  ESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIR  2331
             +SL ++E  +AF +++H   +I   VK  +D  S ++ E   ID  KG V +VF+N+YIR
Sbjct  325   DSLPITEKEKAFAVVQHLGSEIEFIVKFTSDLSSEIIREKVNIDQNKGNVERVFLNSYIR  384

Query  2330  TDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQN  2151
             TD+S+GFRAL+V+EDHSLLL+QQGE+VWSR+DGLASIVDVTTSELPVEKDGVSV+ VE N
Sbjct  385   TDKSHGFRALVVMEDHSLLLIQQGEVVWSRDDGLASIVDVTTSELPVEKDGVSVAGVEHN  444

Query  2150  LFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKL  1971
             LFEWLKGH+LKLKGTLMLA  D+VAAIQ +RLKSS K+KMTRDHNGFRKLL+VL+++GK+
Sbjct  445   LFEWLKGHMLKLKGTLMLANADEVAAIQALRLKSSEKNKMTRDHNGFRKLLVVLTKAGKV  504

Query  1970  YALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNS  1791
               LHTGDGR++WS L+ +LR S     P+ L+IYQWQVPHH  M ENPSVLVVG+ G  S
Sbjct  505   MTLHTGDGRVIWSKLLPSLRASRFGGVPSALRIYQWQVPHHSVMRENPSVLVVGRTGAES  564

Query  1790  DAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
              AP V S +DSY+G+EL  +K  HS+ Q+IPL   DS+EQRL+L++D++ + HLYP++ +
Sbjct  565   SAPGVFSILDSYSGEELNSMKLDHSVFQIIPLTLKDSSEQRLYLILDSNSNAHLYPKSAD  624

Query  1610  ALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
              L IF  E+ N+Y+YSVD   N+++G++++++   + GDDY F+TK +WS++FPS+SE+I
Sbjct  625   TLNIFLHEMSNLYFYSVDIQANVIKGYSLQKSCDLNFGDDYCFSTKELWSIIFPSDSERI  684

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
             + + TR +NEVVHTQAK   D DVMYKY+SKN++FVAT++PKAAGDIGSV+P+E+ L+ Y
Sbjct  685   VISETRNMNEVVHTQAKTIGDHDVMYKYLSKNLVFVATLSPKAAGDIGSVLPEEASLVAY  744

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             LID VTGRILHR+TH G+QGPVHAVLSENWVVYHYFNLRAHR+EM+VIEIYDQSRADNKD
Sbjct  745   LIDAVTGRILHRVTHHGAQGPVHAVLSENWVVYHYFNLRAHRFEMAVIEIYDQSRADNKD  804

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
             ++KL+LGKHNL+ P++SY RPEV  KSQSYFF HSVK +AVT TAKGITSKQLLIGTIGD
Sbjct  805   VMKLILGKHNLSAPITSYARPEVAVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIGTIGD  864

Query  893   QV  888
             Q+
Sbjct  865   QI  866



>ref|XP_001765108.1| predicted protein [Physcomitrella patens]
 gb|EDQ70103.1| predicted protein [Physcomitrella patens]
Length=998

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/994 (50%), Positives = 703/994 (71%), Gaps = 16/994 (2%)
 Frame = -2

Query  3455  IRAFL--LLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             +RA L  L V++   + T  +LYEDQVG+ DWHQ+YIG+VKHAVF TQ  GRKRVVV+TE
Sbjct  6     LRASLCQLFVVVACLSSTCLALYEDQVGVRDWHQQYIGRVKHAVFQTQGTGRKRVVVATE  65

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWES  3102
             +N +ASL+LR GDI+WRHVLG  D ID ++I++GKYV+TLS G+T+RAW+LPDG ++WE+
Sbjct  66    QNAIASLNLRTGDIYWRHVLGETDNIDALEISMGKYVLTLSKGNTVRAWHLPDGALIWET  125

Query  3101  FLSG-SSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQ  2928
              +      +  ++ +P ++  D+ + + +YS   L A+S  DG  +W+ + A ++ + I+
Sbjct  126   RIQAFQGFNLGLIKLPVDIDGDKVNDLFVYSGSILTAISGADGATLWRVDAAGSKNIFIE  185

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              +V        Y +G          +I+ + G+L   +S       S +   VTS+  VA
Sbjct  186   KVVLAPEEGKAYGLGFFGIMGVALVEIDLKTGDLSDLKSAELSSMLSTEHLHVTSDYAVA  245

Query  2747  LDSTG-SILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLR  2571
             L S   S++V++I     +   +  ++ ++ +   +  LL + L G++++  +   + L+
Sbjct  246   LQSDAESLVVALINSHKELIVVETPVSSILTNPGTSLKLLSTNLEGVISLSSDDQTVILK  305

Query  2570  V-TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIK---HGVGK--IHLSVKSINDWGS  2409
             V    GKL +V+++     +S+SLS+ +   A  +++    G  +   +L VK  ND+  
Sbjct  306   VDPTTGKLSLVERLTGAVAVSDSLSVLDDKYATAIVEFSEEGSAQNVFNLRVKG-NDFSD  364

Query  2408  NLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGL  2229
              + +E+  + S +G + K F+N Y+RTDRS+GFRAL+V ED SL LLQQGE+VW+REDGL
Sbjct  365   EVQKETVKLPSHRGFIQKAFLNAYVRTDRSHGFRALVVGEDDSLSLLQQGEVVWTREDGL  424

Query  2228  ASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKS  2049
             ASIVD + +ELP+EKDGVSV++VE +L EWLKGH++K+K TL LATPD++AA+Q+ RL  
Sbjct  425   ASIVDASPAELPLEKDGVSVAEVEHDLAEWLKGHIMKMKATLFLATPDELAAVQRARLNQ  484

Query  2048  SGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIY  1869
             + K+K TRDHNGFRKLL+VL+++GK+ ALHTGDG +VWS LV +LR S      + LKI+
Sbjct  485   ADKTKHTRDHNGFRKLLVVLTKAGKISALHTGDGHVVWSLLVPSLRASYGNPRFSPLKIF  544

Query  1868  QWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQVIPLPY  1689
             QWQVPH HA+DENP VL++ +     D    LS++D + G EL+ +K  +S+ QV+  P 
Sbjct  545   QWQVPHQHALDENPVVLILAQADPGYDVKGALSWIDVHKGTELQSVKLSYSVTQVVTTPV  604

Query  1688  TDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKENYF  1512
             TDS+EQRLHLLID     HL+P T E+L +F +   N Y+Y VD A+  + G+ + +   
Sbjct  605   TDSSEQRLHLLIDNRKRAHLFPATEESLALFLKYKENAYFYEVDKADQKMHGYGLLDLVD  664

Query  1511  KDVG---DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISK  1341
                G   + Y F ++ +WS+VFP+E+E I    TRK +EV HTQ KV ++RD+++KY++K
Sbjct  665   PSTGNIKEGYVFESRKLWSIVFPAETESITTVVTRKSDEVTHTQTKVLSNRDILFKYLNK  724

Query  1340  NMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWV  1161
             N++FVATVAPK    +G+V P+E  L+VYL+DTVTGRILHR++H   QGPVHAVLSENWV
Sbjct  725   NLVFVATVAPKDKSQVGAVSPEEKTLVVYLVDTVTGRILHRVSHPNMQGPVHAVLSENWV  784

Query  1160  VYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYF  981
             VYHYFNLR HRYEMSV+EIYDQSR  +K +++L+LG+HN + P+SSY    +  K QSYF
Sbjct  785   VYHYFNLRQHRYEMSVLEIYDQSRLPDKGVIQLMLGQHNSSVPISSYSPVNLEVKQQSYF  844

Query  980   FAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLT  801
             F  +VKT+ VTSTAKGIT+KQLL+GT+ DQVLALDKR  DPRRT+ PT AE+E+GI+PLT
Sbjct  845   FTFTVKTMTVTSTAKGITAKQLLLGTVNDQVLALDKRLFDPRRTLTPTPAEQEEGILPLT  904

Query  800   DSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDD  621
             DS+PI PQSY+TH+ + EGLRG++T+PA+LEST+LVFAYG+DLF+T  APSK YDSLT+D
Sbjct  905   DSIPISPQSYLTHSYQVEGLRGLLTIPARLESTSLVFAYGLDLFYTHTAPSKIYDSLTED  964

Query  620   FSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             FSYALLL+TIV L ++I +T++ SE++EL EKW+
Sbjct  965   FSYALLLVTIVVLFLSIIVTYVLSERRELAEKWK  998



>emb|CDY68532.1| BnaCnng59410D, partial [Brassica napus]
Length=536

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 466/528 (88%), Gaps = 6/528 (1%)
 Frame = -2

Query  2096  ATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNA  1917
             A+P+DV AIQ+MR+KSSG+SK+TRDHNGFRKL I L+R+GKL+ALHTGDGRIVWS L+N 
Sbjct  13    ASPEDVVAIQEMRMKSSGRSKLTRDHNGFRKLFIALTRAGKLFALHTGDGRIVWSTLLN-  71

Query  1916  LRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELK  1737
                S  C  P+G+ +YQWQVPHHHAMDENPSVLVVG+CG +S +P VLSFVD YTGKE+ 
Sbjct  72    ---SPACARPSGISLYQWQVPHHHAMDENPSVLVVGRCGSDSSSPGVLSFVDVYTGKEIS  128

Query  1736  ILKPVHSIAQVIPLP-YTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSV  1560
                  HS+ QV+PLP +TDSTEQRLHL+ DTDGH HLYP+TPEALGIF+RE  N+YWY+V
Sbjct  129   SSDIGHSVVQVMPLPLFTDSTEQRLHLIADTDGHVHLYPKTPEALGIFQREFQNVYWYNV  188

Query  1559  DANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAK  1383
             + ++ I+RGH +K +   +  D+Y F T+ +W+VVFPSESE+II+T TRK NEVVHTQAK
Sbjct  189   EGDDGIIRGHGMKSSCAGETADEYCFTTRELWTVVFPSESEKIISTLTRKPNEVVHTQAK  248

Query  1382  VTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQG  1203
             V+TD+DV+YKY+S+N+LFVATV+PK AG+IGSV P+ES L+VYLIDTVTGRILHR++HQG
Sbjct  249   VSTDQDVLYKYVSRNLLFVATVSPKGAGEIGSVTPEESALVVYLIDTVTGRILHRLSHQG  308

Query  1202  SQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSS  1023
              QGPVHAV SENWVVYHYFNLRAH+YE++V+EIYDQSRA+NK++ KLVLGKHNLT P+SS
Sbjct  309   CQGPVHAVFSENWVVYHYFNLRAHKYEVTVVEIYDQSRAENKNVWKLVLGKHNLTAPISS  368

Query  1022  YLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVN  843
             Y RPE+  KSQSYFF  SVKTIAVTSTAKGITSKQLLIGTIGDQ+LALDKRF+DPRRT+N
Sbjct  369   YSRPEMFTKSQSYFFPQSVKTIAVTSTAKGITSKQLLIGTIGDQILALDKRFVDPRRTLN  428

Query  842   PTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFT  663
             P+QAEKE+GIIPLTDSLPIIPQSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T
Sbjct  429   PSQAEKEEGIIPLTDSLPIIPQSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYT  488

Query  662   QLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +LAPSKTYDSLTDDFSYALLL+TIVALV AI+ITW  SE+KEL EKWR
Sbjct  489   RLAPSKTYDSLTDDFSYALLLITIVALVAAIYITWALSEKKELSEKWR  536



>ref|XP_002965963.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
 gb|EFJ33383.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
Length=942

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/954 (48%), Positives = 656/954 (69%), Gaps = 36/954 (4%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIA  3186
             HQ YIGKV HAVF T  +G+KRV+V+TE++V+ASL+LR G+IFWR VL   + IDG+ +A
Sbjct  20    HQEYIGKVTHAVFQT-ASGKKRVIVATEKSVVASLNLRSGEIFWRQVLEESEPIDGLQVA  78

Query  3185  LGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSG  3006
             LGKY ++LS G +LR+++LPDG ++WE+ L  S     + L+PS+        +L+   G
Sbjct  79    LGKYAVSLSRGGSLRSFHLPDGSLIWETSLYTSPSPAQLFLLPSDD-------LLVLKQG  131

Query  3005  YLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGEL  2826
              ++ VSS DG ++W  +L +E    Q  +  +G  ++Y  G + SS    ++I+A  G  
Sbjct  132   IVYVVSSADGRLLWTADLLDESRLAQTSLSFEG-KNIYVAGFSGSS-IALFRIDASTGAF  189

Query  2825  --LKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF  2652
               LK    + P  F     +++S    ALD+ G I V+ + +  ++  Q+  +A L+   
Sbjct  190   TTLKTTEPLNPSSF-----VLSSGVFAALDTQGDI-VTGLMEGEVVELQKTSLATLLDSP  243

Query  2651  TGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFG  2472
               +A LLP K+ G   +  +   +F+    +  +EV+ ++   AV+S S+ L        
Sbjct  244   VSSAQLLPDKIPGGCVLSTDGGSIFVLGLDKKGVEVLQQIQGPAVVSNSIVLDGTFAQSF  303

Query  2471  LIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIVL  2292
             L +    +I + V S  +W     EE+  +D  KG V KVF+N YI+TDRS GFR LIV 
Sbjct  304   LQRVNSKEIRVRVLSGKEW-IETAEETVEVDPNKGGVQKVFMNAYIKTDRSRGFRVLIVG  362

Query  2291  EDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklk  2112
             +DHSL LLQQG++VWSRE+ LAS+VD  T+ELP+EK GVSV++VE +L+EWLKGH+L+LK
Sbjct  363   QDHSLALLQQGKVVWSREEALASVVDTLTAELPLEKAGVSVAEVEHDLYEWLKGHVLRLK  422

Query  2111  gtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWS  1932
              TLMLAT ++  A+Q +RL ++ K+KMTRDHNGFRKL++VL+ SGKL+ALHTG+G IVWS
Sbjct  423   STLMLATAEEQTALQALRLNNADKTKMTRDHNGFRKLIVVLTSSGKLFALHTGNGGIVWS  482

Query  1931  FLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT  1752
               +  L           LK+Y W++PH H +DENP  LV+G    + D     ++VD  T
Sbjct  483   RFIPEL------STKGSLKLYPWRIPHKH-VDENPVALVLGS---SHDGTGFAAWVDMLT  532

Query  1751  GKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIY  1572
             G   + L   +S+   + LP  DS+E+RLHLLID     HLYP + E+L +F++ + N+Y
Sbjct  533   GSVQETLALPYSVKLALALPLVDSSERRLHLLIDDQNKAHLYPTSDESLSLFEKYMQNVY  592

Query  1571  WYSVDAN-NILRGHAVKENYFKDVGDD--YYFATKYVWSVVFPSESEQIIATATRKLNEV  1401
             +Y  D     + G+ +K     D G++    F ++ +WSV+FP +SE I A  TR+ +E+
Sbjct  593   FYIADKGAGQIEGYNIKSQI--DSGEEGGLVFLSQKIWSVLFPKDSETIAAITTRRADEM  650

Query  1400  VHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILH  1221
             VHTQAKV  +RDV YKY++KNM+FVATV P+ +  +G+  P+E+WL+ YLID+VTG+ILH
Sbjct  651   VHTQAKVLGNRDVWYKYLNKNMVFVATVTPQDS-RVGAANPEETWLVAYLIDSVTGQILH  709

Query  1220  RMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNL  1041
             R++H  +QGPVHAV SENWVVY YFN+R HR+EMSV+E+YD+S AD KD+L+L+LG++N 
Sbjct  710   RVSHAHAQGPVHAVFSENWVVYCYFNVRNHRHEMSVLEVYDKS-ADGKDVLQLMLGRYNA  768

Query  1040  TKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLD  861
             + P SS+    +  K QSYFF  +V+T++VT TA+GIT KQ+L+GTIG+QV+ALDKRFLD
Sbjct  769   SVPFSSFSPRNLEVKGQSYFFPSTVRTMSVTFTARGITGKQILVGTIGNQVIALDKRFLD  828

Query  860   PRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYG  681
             PRR+ +PT  E+E+G+IPL++ LP+ PQSY+THA + E LRGI++VPA+LEST LVFAYG
Sbjct  829   PRRSADPTPMEREEGVIPLSEGLPVFPQSYLTHAARVEELRGIISVPARLESTCLVFAYG  888

Query  680   VDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +DLFFT+ APS+TYDSLT+DFSYALLL+TIV LVVAI ++ + S++KEL+EKW+
Sbjct  889   IDLFFTRTAPSRTYDSLTEDFSYALLLITIVVLVVAIAVSMVLSQRKELREKWK  942



>ref|XP_002962821.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
 gb|EFJ36284.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
Length=942

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/955 (48%), Positives = 658/955 (69%), Gaps = 38/955 (4%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDGIDIA  3186
             HQ YIGKV HAVF T  +G+KRV+V+TE++V+ASL+LR G+IFWR VL   + IDG+ +A
Sbjct  20    HQEYIGKVTHAVFQT-ASGKKRVIVATEKSVVASLNLRSGEIFWRQVLEESEPIDGLQVA  78

Query  3185  LGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSG  3006
             LGKY ++LS G +LR+++LPDG ++WE+ L  S     + L+PS+        +L+   G
Sbjct  79    LGKYAVSLSRGGSLRSFHLPDGSLIWETSLYTSPSPAQLFLLPSDD-------LLVLKQG  131

Query  3005  YLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGEL  2826
              ++ VSS DG ++W  +L +E    Q  +  +G  ++Y  G + SS    ++I+A  G  
Sbjct  132   IVYVVSSADGRLLWTSDLLDESRLAQTSLSFEG-KNIYVAGFSGSS-LALFRIDASTGAF  189

Query  2825  --LKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF  2652
               LK    + P  F     +++S    ALD+ G+I+  ++  + ++  Q+  +A L+   
Sbjct  190   TTLKTTEPLNPSSF-----VLSSGVFAALDTQGNIVTGLMEAE-VVELQKTSLATLLDSP  243

Query  2651  TGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFG  2472
               +A LLP K+ G   +  +   +F+    +  +EV+ ++    V+S S+ L +G  A  
Sbjct  244   VSSAQLLPDKIPGGCVLSTDGGSIFVLGLDKKGVEVLQQIQGPPVVSNSIVL-DGTFAQS  302

Query  2471  LIKHGVGK-IHLSVKSINDWGSNLLEESSAIDSQKGLVHKVFINNYIRTDRSYGFRALIV  2295
              ++H   K I + V S  +W     EE+  +D  KG V KVF+N YI+TDRS GFR LIV
Sbjct  303   FLQHINSKEIRVRVLSGKEWIETA-EETVEVDPNKGGVQKVFMNAYIKTDRSRGFRVLIV  361

Query  2294  LEDHSLLLLQQGEIVWSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllkl  2115
              +DHSL LLQQG++VWSRE+ LAS+VD  T+ELP+EK GVSV++VE +L+EWLKGH+L+L
Sbjct  362   GQDHSLALLQQGKVVWSREEALASVVDTLTAELPLEKAGVSVAEVEHDLYEWLKGHVLRL  421

Query  2114  kgtlmLATPDDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW  1935
             K TLMLAT ++  A+Q +RL ++ K+KMTRDHNGFRKL++VL+ SGKL+ALHTG+G IVW
Sbjct  422   KSTLMLATAEEQTALQALRLNNADKTKMTRDHNGFRKLIVVLTSSGKLFALHTGNGGIVW  481

Query  1934  SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSY  1755
             S  +  L           LK+Y W++PH H +DEN   LV+G    + D     ++VD  
Sbjct  482   SRFIPEL------STKGSLKLYPWRIPHKH-VDENAVALVLGS---SHDGTGFAAWVDML  531

Query  1754  TGKELKILKPVHSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNI  1575
             TG   + L   +S+   + LP  DS+E+RLHLLID     HLYP + E+L +F++ + N+
Sbjct  532   TGSVQETLALPYSVKVALALPVVDSSERRLHLLIDDQNKAHLYPTSDESLSLFEKYMQNV  591

Query  1574  YWYSVDAN-NILRGHAVKENYFKDVGDD--YYFATKYVWSVVFPSESEQIIATATRKLNE  1404
             Y+Y  D     + G+ +K     D G++    F ++ +WSV+FP +SE I A  TR+ +E
Sbjct  592   YFYIADKEAGQIEGYNIKSQV--DAGEEGGLVFQSQKIWSVLFPKDSETIAAITTRRADE  649

Query  1403  VVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRIL  1224
             +VHTQAKV  +RDV YKY++KNM+FVATV P+ +  +G+  P+E+WL+ YLID+VTG+IL
Sbjct  650   MVHTQAKVLGNRDVWYKYLNKNMVFVATVTPQDS-RVGAANPEETWLVAYLIDSVTGQIL  708

Query  1223  HRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHN  1044
             HR++H  +QGPVH V SENWVVY YFN+R HR+EMSV+E+YD+S AD KD+L+L+LG++N
Sbjct  709   HRVSHAHAQGPVHVVFSENWVVYCYFNVRNHRHEMSVLEVYDKS-ADGKDVLQLMLGRYN  767

Query  1043  LTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFL  864
              + P SS+    +  K QSYFF  +V+T++VT TA+GIT KQ+L+GTIG+QV+ALDKRFL
Sbjct  768   ASVPFSSFSPRNLEVKGQSYFFPSTVRTMSVTFTARGITGKQILVGTIGNQVIALDKRFL  827

Query  863   DPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAY  684
             DPRR+ +PT  E+E+G+IPL++ LP+ PQSY+THA + E LRGI++VPA+LEST LVFAY
Sbjct  828   DPRRSADPTPMEREEGVIPLSEGLPLFPQSYLTHAARVEELRGIISVPARLESTCLVFAY  887

Query  683   GVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             G+DLFFT+ APS+TYDSLT+DFSYALLL+TIV LVVAI ++ + S++KEL+EKW+
Sbjct  888   GIDLFFTRTAPSRTYDSLTEDFSYALLLITIVVLVVAIAVSMVLSQRKELREKWK  942



>emb|CDY67992.1| BnaCnng57230D [Brassica napus]
Length=446

 Score =   541 bits (1393),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 269/443 (61%), Positives = 344/443 (78%), Gaps = 2/443 (0%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             AMA+R +LLL++  SSA  +FSLYEDQVGLMDWHQRYIGKVKHAVFHTQK GRKRV+VST
Sbjct  2     AMALRLYLLLIVFVSSAIVSFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKTGRKRVIVST  61

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSS-GSTLRAWNLPDGQMVW  3108
             EENV+ASLDLRHG+IFWRHVLG KD IDG+DIALGKYVITLSS GS LRAWNLPDGQMVW
Sbjct  62    EENVVASLDLRHGEIFWRHVLGTKDAIDGVDIALGKYVITLSSEGSMLRAWNLPDGQMVW  121

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             E+ L  +  S+S+L VP NLK D+D  IL++  GYLHAVS  DGE++WKK+   EG ++Q
Sbjct  122   ETSLHSAQHSKSLLSVPVNLKFDKDYSILVFGGGYLHAVSPIDGELLWKKDFTAEGFEVQ  181

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSEKVVA  2748
              ++ P  +  VY +G   SS+ + Y+I+++ GE++  +S  FPG FSG+IS V+++KVV 
Sbjct  182   RVLQPLESSIVYVLGFLHSSEAIVYQIDSKSGEVVAEKSKAFPGRFSGEISAVSNDKVVV  241

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRV  2568
             LDST SILV+I F DG I+FQ+  I+ LV+D +G A +L   L+ M+A+ +NK  +F+RV
Sbjct  242   LDSTRSILVTISFVDGEISFQKTLISSLVED-SGEAEILSPLLSNMLAVKVNKRTIFVRV  300

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
               +GKLE+VD ++    +S+SL +++   AF  + H   KIHL+VK ++D  + LL ES 
Sbjct  301   GDQGKLEMVDSLSDETAMSDSLPVADDQVAFASVHHEGSKIHLTVKLVDDLDTVLLRESI  360

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVDVT  2208
              +D  +G V +VFINNYI+TDRS GFRALIV+EDHSLLLLQQG IVWSRE+GLAS+ DVT
Sbjct  361   QMDQHRGRVDRVFINNYIKTDRSNGFRALIVMEDHSLLLLQQGAIVWSREEGLASVTDVT  420

Query  2207  TSELPVEKDGVSVSKVEQNLFEW  2139
             T+ELPVEKDGVSV+KVE  L +W
Sbjct  421   TAELPVEKDGVSVAKVEHTLVDW  443



>ref|XP_001638961.1| predicted protein [Nematostella vectensis]
 gb|EDO46898.1| predicted protein [Nematostella vectensis]
Length=994

 Score =   380 bits (976),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 281/1029 (27%), Positives = 499/1029 (48%), Gaps = 147/1029 (14%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             +++I A ++  LIF    ++ +L+EDQVGL+DW + +IGK K   F       KR+ V+T
Sbjct  4     SLSILAIVVFSLIFQPKSSS-ALFEDQVGLLDWRKTFIGKTKFVHFDVSSHTSKRLYVAT  62

Query  3284  EENVLASLDLRHGDIFWRHVLGHKD-VIDGIDIALGKYVITLSSGSTL-RAWNLPDGQMV  3111
             E NVLASL+ R G + WR V+   +  ID + +  G +++++S G    R+W+   G ++
Sbjct  63    ESNVLASLNSRTGQVMWRIVMEENEGQIDAL-LHKGSFLVSVSGGGKFVRSWDTSSGSLL  121

Query  3110  WESFL-----SGSSPSRSIL--------LVPSNLKVDRDSLILIYSSGYLHAVSSTDGEV  2970
             WE+ +        +P R+ +        ++  +  + +   I++ S   + A S  DG  
Sbjct  122   WENMMYKGAPDPDAPKRNFVYNWNGIDAVITEHKGIKQ---IVVVSGNLVKAFSLQDGSE  178

Query  2969  IWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGF  2790
              W    +N+ + +  + H      V+ +G+    + +   ++A KG+L K +S+  P   
Sbjct  179   YWSYHRSNDTIKLYAMSH--SGSKVHVIGVQDEGRIIVQSLSAGKGQLDKTKSLAAPWVS  236

Query  2789  SGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGM  2610
             SG  S + S+             ++I  D L +   +HI  L  +    A ++ S LTG 
Sbjct  237   SGTASCIISQGK-----------ALICADSLTH--SLHIGSLENNSQEMAEVILSTLTGA  283

Query  2609  VAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIH--LS  2436
                     +  L+ T +         A+G+  +  +S SE         H + K++  LS
Sbjct  284   D-------ITSLKPTLQ---------AFGSYTNSWMSQSEFVLHLSPENHLLLKLNPDLS  327

Query  2435  VKSINDWGSNLLEESSAIDSQKGLVHKVFINN----------------------------  2340
             ++ + ++  N L   S ++  K +V  + IN                             
Sbjct  328   IQIMREYTDNCLLFGSVLND-KAIVVSMMINGDSLDLQSLDLESGKEISEMAQKVKFLEH  386

Query  2339  -----------YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVTTSEL  2196
                        + + ++S G+R  ++  DH++ L+QQ G I+WSRE+ LA +  V   EL
Sbjct  387   HGQPELATVYLFAKKEQSIGYRVFLLTSDHTMSLIQQTGRIMWSREEALAEVTAVDVVEL  446

Query  2195  PVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAA-IQQMR-------------  2058
             P      + + +++         +L +    + A      A ++Q +             
Sbjct  447   PFSPAQANFNTLQEEFGAHPNDDVLSMFIRRIRAQAKQFQALVKQFQTFVNAQQGHAPAP  506

Query  2057  -LKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNG  1881
              + ++   ++TRD    RKL+++ + SGK++ L + DG ++W   +  L K  +  N   
Sbjct  507   DVTTAEDEQLTRDQFNLRKLILIATASGKMFGLDSSDGSVLWETFLPGL-KPFSHNNKEF  565

Query  1880  LKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSI----  1713
               +Y  +   H  +      +++GK G  ++  SVL   +  +GK L    P  +I    
Sbjct  566   HLLYTQRTVAHFPLPAQ--CVIIGKSGSTNN--SVLHVFNPISGKPLDEDNPQGNILPFK  621

Query  1712  -AQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILR  1539
               Q + +P+ D+   ++ LL+D++ + H++P T +A     +E  +I++Y VD     + 
Sbjct  622   VMQTMLMPHLDNKHAKILLLLDSEKNVHVFPDTKDARSTITKEENSIFFYLVDRETGSVT  681

Query  1538  GHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVM  1359
             GH +++     +G      T+ +W V  P+  ++I   A++   E VH+Q KV  DR V+
Sbjct  682   GHMLRKAESGKLG------TQEMWRVQIPTSQQKITVVASKNPLEHVHSQGKVLGDRRVL  735

Query  1358  YKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAV  1179
             YKY++ N++ +AT A      +    P  S   VYLID VTG I++   H+ ++GPVH V
Sbjct  736   YKYLNPNLIAIATEA------VTDGKPSTS---VYLIDAVTGMIIYTNRHKNAKGPVHLV  786

Query  1178  LSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLA  999
              SENW VY  +N ++ RYE+ V+E+Y+     N           ++  P      P  + 
Sbjct  787   HSENWAVYSMYNTKSRRYELVVLELYEGYEERNSTAFS------SMDPP------PHPMI  834

Query  998   KSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKED  819
               QSY F  +++T+ V+ T +GIT+K LL+G     +L++ K FLDPRRT NPTQ ++E+
Sbjct  835   LHQSYVFPTTIRTMTVSITERGITNKHLLLGLQTGYILSIPKNFLDPRRTFNPTQEDREE  894

Query  818   GIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTY  639
             G+ P    + I+PQ+Y+ +      ++GI T P+ LEST LVF YG+DL++ Q+ PS+ +
Sbjct  895   GLYPYIPEMTIMPQAYINYNQTIMYIKGIHTAPSGLESTCLVFGYGLDLYWAQITPSRMF  954

Query  638   DSLTDDFSY  612
             D L +DF Y
Sbjct  955   DVLKEDFDY  963



>ref|XP_693770.3| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Danio 
rerio]
Length=964

 Score =   357 bits (915),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 288/1008 (29%), Positives = 490/1008 (49%), Gaps = 86/1008 (9%)
 Frame = -2

Query  3437  LVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLD  3258
             L +  S  YT  +++EDQVG  DW Q+YIGKV+ A+F T     K+++V+T++NV ASL+
Sbjct  8     LAISVSLLYTASAVFEDQVGKFDWRQQYIGKVRFALFDTHSQASKKLLVATDKNVFASLN  67

Query  3257  LRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFL-SGS  3087
              R GD+FWRHV   G +  ID + +     V+ + +G  LR+W    G + WE+ L SGS
Sbjct  68    SRTGDLFWRHVDKTGPEGHIDALLMHGQDAVVVVGNGRLLRSWETTVGGLKWETVLDSGS  127

Query  3086  SPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDG  2907
               + +++ V   +K      +L  S+  LH +SS  G   W + L +        ++  G
Sbjct  128   FQAAALVGVQDYVKY---VAVLKKSTIALHDLSS--GSQTWVENLPDSDTVQYQTIYSGG  182

Query  2906  TDDVYAVGLTSSSQFVAYKINARKGELLKHESM--VFPGGFSGDISLVTSEKVVALDS-T  2736
                V+ +G+  +S  V  +     GE++  +S+   +         +V+S  ++ +D  T
Sbjct  183   NGLVFVLGVLPNSHIVIVEYKIEDGEIMNKKSVEAAWMSSLESSCVVVSSGILMCVDQIT  242

Query  2735  GSILVSIIFKDGLINFQQVHIADL-VQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYE  2559
              S+    +        +Q+H+  L ++  +G   +L S         + +F+L L   + 
Sbjct  243   QSLYTQPLHSAEQTEMRQIHLQTLDLEVASGFQPVLTSTQPSPAHPPLAEFILQLSPEHH  302

Query  2558  GKLEVVDKVAYGAVISESLSLSEGH-QAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA-  2385
               L++ D      +I+     S  +  AF           +S K+      NL    +  
Sbjct  303   ILLQLKD-----GLIAPLRDFSPSYLAAFATSGEKTVVAVMSPKNDTACSINLFSADTGR  357

Query  2384  ----------IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSRE  2238
                        D   G  +K++++ +++ D S G+R ++  ED +L  LQQ G +VW RE
Sbjct  358   RHLDTTIIYHTDPYGGKPNKLYVHAFLKKDDSVGYRVMVQTEDLTLTFLQQPGRVVWMRE  417

Query  2237  DGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAA  2073
             + LA +V++   +LP+     E +G    K +  L   LK    +               
Sbjct  418   EALADVVNMEMVDLPLTGTQAELEGEFGKKADGLLPMVLKRLSSQFILLQAWMAHLWKLF  477

Query  2072  IQQMRLKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRK  1908
                 + +SS K+++T     RD    +K++++++ SGKL+ + +  G ++W   +  ++ 
Sbjct  478   YDARKPRSSVKNEITIDTLSRDEFNLQKMMVMVTASGKLFGIDSRSGTVLWKQYLENIK-  536

Query  1907  SETCENPNGL-KIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKI  1734
                   PN   K+   +   H       ++L+  +  GL S     L   +   GK+ +I
Sbjct  537   ------PNSFFKLIVQRTTAHFPHPPQCTLLIKDQDTGLGS-----LYVFNPIFGKKSQI  585

Query  1733  LKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSV  1560
               P     I Q + LP  D    ++ LLID       +P T   L   +    +I++Y V
Sbjct  586   SVPALPRPILQSLLLPVIDQDYSKVLLLIDDQNKVTAFPSTKNILQQLQETASSIFFYLV  645

Query  1559  DANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAK  1383
             D+N   L G  ++ +           +T+ +W VV P+E ++I+A   ++ NE VH+Q +
Sbjct  646   DSNQGKLSGFRLRTD----------LSTELIWEVVIPTEVQKIVAVKGKRANEHVHSQGR  695

Query  1382  VTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQG  1203
             V  DR V+YKY++ N+L V T +     +        S++ ++LID VTGRI+H    + 
Sbjct  696   VMGDRSVLYKYLNPNLLAVITESTDTHQE-------RSFVGIFLIDGVTGRIVHEAVQRK  748

Query  1202  SQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSS  1023
             ++GPVH V SENWV+Y Y+N +  R E SV+E+++ +   N  +        +L +P   
Sbjct  749   ARGPVHCVHSENWVIYVYWNSKFRRNEFSVLELFEGAELYNSTVFS------SLDRPHP-  801

Query  1022  YLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVN  843
                P+VL   QSY F   + T+  T T KGITS+ LL+G     +L+L K FLDPRR   
Sbjct  802   ---PQVL--QQSYIFPAPISTLEATLTEKGITSRHLLVGLPSGNILSLPKMFLDPRRPEV  856

Query  842   PTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFT  663
              ++  +E+ +IP    +PI  + ++ +      +RGI T P+ LEST LV AYG+D++ T
Sbjct  857   VSEQSREENLIPYAPEMPIRTEWFINYNQTVSRVRGIYTAPSGLESTCLVVAYGLDIYQT  916

Query  662   QLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             ++ PSK +D L DD+ Y L+   ++ L  A  I+   +E K L   WR
Sbjct  917   RVFPSKQFDVLKDDYDYVLISSVLLGLFFATMISKRLAEVKLLNRAWR  964



>ref|XP_005162246.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Danio 
rerio]
Length=967

 Score =   357 bits (915),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 287/1011 (28%), Positives = 490/1011 (48%), Gaps = 89/1011 (9%)
 Frame = -2

Query  3437  LVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLD  3258
             L +  S  YT  +++EDQVG  DW Q+YIGKV+ A+F T     K+++V+T++NV ASL+
Sbjct  8     LAISVSLLYTASAVFEDQVGKFDWRQQYIGKVRFALFDTHSQASKKLLVATDKNVFASLN  67

Query  3257  LRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFL-SGS  3087
              R GD+FWRHV   G +  ID + +     V+ + +G  LR+W    G + WE+ L SGS
Sbjct  68    SRTGDLFWRHVDKTGPEGHIDALLMHGQDAVVVVGNGRLLRSWETTVGGLKWETVLDSGS  127

Query  3086  SPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDG  2907
               + +++ V   +K      +L  S+  LH +SS  G   W + L +        ++  G
Sbjct  128   FQAAALVGVQDYVKY---VAVLKKSTIALHDLSS--GSQTWVENLPDSDTVQYQTIYSGG  182

Query  2906  TDDVYAVGLTSSSQFVAYKINARKGELLKHESM--VFPGGFSGDISLVTSEKVVALDS-T  2736
                V+ +G+  +S  V  +     GE++  +S+   +         +V+S  ++ +D  T
Sbjct  183   NGLVFVLGVLPNSHIVIVEYKIEDGEIMNKKSVEAAWMSSLESSCVVVSSGILMCVDQIT  242

Query  2735  GSILVSIIFKDGLINFQQVHIADL-VQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYE  2559
              S+    +        +Q+H+  L ++  +G   +L S         + +F+L L   + 
Sbjct  243   QSLYTQPLHSAEQTEMRQIHLQTLDLEVASGFQPVLTSTQPSPAHPPLAEFILQLSPEHH  302

Query  2558  GKLEVVDKVAYGAVISESLSLSEGH-QAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA-  2385
               L++ D      +I+     S  +  AF           +S K+      NL    +  
Sbjct  303   ILLQLKD-----GLIAPLRDFSPSYLAAFATSGEKTVVAVMSPKNDTACSINLFSADTGR  357

Query  2384  ----------IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSRE  2238
                        D   G  +K++++ +++ D S G+R ++  ED +L  LQQ G +VW RE
Sbjct  358   RHLDTTIIYHTDPYGGKPNKLYVHAFLKKDDSVGYRVMVQTEDLTLTFLQQPGRVVWMRE  417

Query  2237  DGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDV  2079
             + LA +V++   +LP+       E +    + ++  L   +   L      L        
Sbjct  418   EALADVVNMEMVDLPLTGTQAELEGEFGKKAAIQDGLLPMVLKRLSSQFILLQAWMAHLW  477

Query  2078  AAIQQMR-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNA  1917
                   R  +SS K+++T     RD    +K++++++ SGKL+ + +  G ++W   +  
Sbjct  478   KLFYDARKPRSSVKNEITIDTLSRDEFNLQKMMVMVTASGKLFGIDSRSGTVLWKQYLEN  537

Query  1916  LRKSETCENPNGL-KIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKE  1743
             ++       PN   K+   +   H       ++L+  +  GL S     L   +   GK+
Sbjct  538   IK-------PNSFFKLIVQRTTAHFPHPPQCTLLIKDQDTGLGS-----LYVFNPIFGKK  585

Query  1742  LKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYW  1569
              +I  P     I Q + LP  D    ++ LLID       +P T   L   +    +I++
Sbjct  586   SQISVPALPRPILQSLLLPVIDQDYSKVLLLIDDQNKVTAFPSTKNILQQLQETASSIFF  645

Query  1568  YSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHT  1392
             Y VD+N   L G  ++ +           +T+ +W VV P+E ++I+A   ++ NE VH+
Sbjct  646   YLVDSNQGKLSGFRLRTD----------LSTELIWEVVIPTEVQKIVAVKGKRANEHVHS  695

Query  1391  QAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMT  1212
             Q +V  DR V+YKY++ N+L V T +     +        S++ ++LID VTGRI+H   
Sbjct  696   QGRVMGDRSVLYKYLNPNLLAVITESTDTHQE-------RSFVGIFLIDGVTGRIVHEAV  748

Query  1211  HQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKP  1032
              + ++GPVH V SENWV+Y Y+N +  R E SV+E+++ +   N  +        +L +P
Sbjct  749   QRKARGPVHCVHSENWVIYVYWNSKFRRNEFSVLELFEGAELYNSTVFS------SLDRP  802

Query  1031  VSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRR  852
                   P+VL   QSY F   + T+  T T KGITS+ LL+G     +L+L K FLDPRR
Sbjct  803   HP----PQVL--QQSYIFPAPISTLEATLTEKGITSRHLLVGLPSGNILSLPKMFLDPRR  856

Query  851   TVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDL  672
                 ++  +E+ +IP    +PI  + ++ +      +RGI T P+ LEST LV AYG+D+
Sbjct  857   PEVVSEQSREENLIPYAPEMPIRTEWFINYNQTVSRVRGIYTAPSGLESTCLVVAYGLDI  916

Query  671   FFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             + T++ PSK +D L DD+ Y L+   ++ L  A  I+   +E K L   WR
Sbjct  917   YQTRVFPSKQFDVLKDDYDYVLISSVLLGLFFATMISKRLAEVKLLNRAWR  967



>ref|XP_009097868.1| PREDICTED: ER membrane protein complex subunit 1 [Serinus canaria]
Length=995

 Score =   353 bits (906),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 283/993 (28%), Positives = 478/993 (48%), Gaps = 114/993 (11%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A     + G K++VV+TEENV+A+L+ R G+I WRHV 
Sbjct  23    AVYEDQVGKFDWRQQYVGKLKFASLEASQ-GSKKLVVATEENVVAALNSRSGEILWRHV-  80

Query  3221  GHKDVIDG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    +++ +P
Sbjct  81    -DKGTPEGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQGAALVGLP  139

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
               +K      +L  ++  LH +S  +G   W + L         +++  GT  ++ VG+ 
Sbjct  140   EAVKY---VAVLKKAALSLHYLS--NGHQKWVEHLPESESTQYELLYSRGTGVIHVVGIV  194

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S       +   GE+ +   +  P  G   G  ++V    +V +D+   +L  +   D
Sbjct  195   PQSHLNVLTFSVEDGEITRQVRVAAPWLGALQGPCAVVGEAMLVCVDAAARLL-HVCALD  253

Query  2702  GLINFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF--------  2577
                + + + +  L  +F          T  +V   S+    + +  + F L         
Sbjct  254   TEQDMRNIPLQSLELEFADDFQARILATQPSVTSASRTQFFLQLSPSHFSLLQYKQGLLS  313

Query  2576  -LRVTYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS--  2427
              LR   +  L       +    AV++    L    S+G QA   ++  + +  L+  +  
Sbjct  314   HLRDFQQAALVSFATTGEKTVAAVLTCRSELKPGSSDGLQAGSTLEDALRQDSLTCSNQT  373

Query  2426  --IN----DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLLL  2271
               IN    + G  LL+ +   + ++G     +++I  +++ D S G+RAL+  EDH L+ 
Sbjct  374   YNINLYLVETGQRLLDTTITFNLEQGGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMF  433

Query  2270  LQQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllkl  2115
             LQQ G++VWSRE+ LA +V +   +LP+       E +    + ++  L       L   
Sbjct  434   LQQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSSQ  493

Query  2114  kgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHTG  1953
                L   T          R   S          + RD    +K++++++ SGKL+ + + 
Sbjct  494   LILLQAWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESS  553

Query  1952  DGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVL  1773
              G I+W   +  +R   +       K+   +   H       ++LV        D  + +
Sbjct  554   SGTILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETNM  600

Query  1772  SFVDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
             SF+  +    GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   
Sbjct  601   SFLYVFNPIFGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKNV  660

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             L   +    +IY+Y VDA    L G  +K++           +T+  W V  P+E ++I+
Sbjct  661   LRQLEEIAHSIYFYLVDAEQGKLSGFRLKKD----------LSTEESWEVAIPTEVQRIV  710

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
                 ++ NE VH+Q +V  DR V+YK ++ N+L V T     + D+     + +++ +YL
Sbjct  711   TVKGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVT----ESTDMHH---ERAFIGIYL  763

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             +D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N   
Sbjct  764   MDGVTGRIIHSSVQKKARGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATA  823

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LL+G     
Sbjct  824   FS------SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGA  871

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ L
Sbjct  872   ILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGL  931

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             EST LV AYG+D+F T++ PSK +D L DD+ Y
Sbjct  932   ESTCLVVAYGLDIFQTRVYPSKQFDVLKDDYDY  964



>ref|XP_008300471.1| PREDICTED: ER membrane protein complex subunit 1 [Stegastes partitus]
Length=962

 Score =   350 bits (899),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 292/1011 (29%), Positives = 496/1011 (49%), Gaps = 79/1011 (8%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             MA    L L  I   A T  +++EDQVG  DW Q+Y+GKV+ + F T     K+VVV+TE
Sbjct  1     MAKLILLWLKCILLCA-TVEAVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVVVATE  59

Query  3281  ENVLASLDLRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVW  3108
              NV A+L+ R G++FWRHV   G +  ID +       V+ + +G  LR+W++  G + W
Sbjct  60    RNVFAALNTRTGELFWRHVDKAGSEGTIDALLQHGQDAVLVVGNGRVLRSWDVNVGGLNW  119

Query  3107  ESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDI  2931
             E  L   S   + L+   ++   +   +L  ++  LH +S  +G   W + L + E +D 
Sbjct  120   EIVLDSGSFQSACLVGQQDMV--KHVAVLKKTAISLHYLS--NGHQKWIENLPDIETVDY  175

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEK  2757
             Q  V+ DG  +VY +G+   S       +   GE++K  S+  P          +V    
Sbjct  176   Q-AVYSDGNGEVYVLGVVPHSHIAIVVYSIEDGEIIKQISVEAPWLSNIQASCVVVGQGM  234

Query  2756  VVALDSTGSILVSIIFKDGLINFQ--QVHIADLVQDF-TGAAVLLPSKLTGMVAIHINKF  2586
             +  +DS     +S    D  +  Q  Q+ +  L  +   G   +L S         +++F
Sbjct  235   LTCVDSAA---MSFYMLDVHLQLQMTQIPLQSLALEVDPGFNPVLLSHQPNPARQPLSEF  291

Query  2585  VLFLRVTYEGKLEVVD-KVAYGAVISESLSLS---EGHQAFGLIKHGVGKIHLSVKSIN-  2421
              L L   +   L++ D ++        +L +S    G +    +     K   SV   + 
Sbjct  292   FLQLGPDHYQLLQLNDGQIVTMRDFKPALLVSFATTGEKTVAAVMSPKNKTACSVNLFSA  351

Query  2420  DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV  2250
             D G  LL+ +    +D   G   K+F+  +++ D S G+RA++  EDH+L  +QQ G ++
Sbjct  352   DTGRRLLDTTLIFNMDPNGGKPEKLFVQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVM  411

Query  2249  WSREDGLASIVDVTTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAI  2070
             W+RE+ L+ +V +   +LP+      +        + L   +LK   + ++     +A +
Sbjct  412   WTREEALSDVVTMEMVDLPLTGTQAELEGEFGKKADGLMSMVLKRLSSQLILLQAWIAHL  471

Query  2069  QQM-----RLKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVN  1920
              ++     + +S  K+ +T     RD    +K++++++ SGKL+ + +  G I+W   ++
Sbjct  472   WKLFYDARKPRSQVKNDITIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLD  531

Query  1919  ALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKE  1743
              +  +         K+   +   H       ++L+  K  GL     + L   +   GK+
Sbjct  532   NVPSNA------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGKK  580

Query  1742  LKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYW  1569
               +  P     I Q + LP  D    ++ LL+D       +P T   L   +    +I++
Sbjct  581   SHVTPPALPQPILQSLMLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFF  640

Query  1568  YSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHT  1392
             Y VD++   L G+ ++ +           +T+ +W VV P+E ++I++   ++ NE VH+
Sbjct  641   YLVDSSQGRLSGYRLRTD----------LSTEQIWEVVIPAEIQKIVSVKGKRPNEHVHS  690

Query  1391  QAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMT  1212
             Q +V  DR V+YKY++ N+L V T     + D+     + S++ + LID VTGRI+H   
Sbjct  691   QGRVMGDRSVLYKYLNPNLLAVVT----ESTDLHQ---ERSFIGILLIDGVTGRIIHEAV  743

Query  1211  HQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKP  1032
              + ++GPVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P
Sbjct  744   QRKARGPVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRP  797

Query  1031  VSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRR  852
              +    P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR
Sbjct  798   HA----PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRR  851

Query  851   TVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDL  672
                 ++  +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D+
Sbjct  852   PEIVSEQSREENLIPYAPELLIRTEWFINYNQTVSRVRGIYTAPSGLESTCLVVAYGLDI  911

Query  671   FFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             + T++ PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  912   YQTRVYPSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  962



>ref|XP_010738575.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Larimichthys 
crocea]
Length=962

 Score =   350 bits (898),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 288/998 (29%), Positives = 493/998 (49%), Gaps = 86/998 (9%)
 Frame = -2

Query  3410  TTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWR  3231
             T  +++EDQVG  DW Q+Y+GKV+ + F T     K+V+++TE NV A+L+ R GD+FWR
Sbjct  17    TVEAVFEDQVGKFDWRQQYVGKVRFSSFDTHAQSSKKVLLATESNVFAALNTRTGDLFWR  76

Query  3230  HV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLV  3060
             HV   G +  ID +       V+ + +G  LR+W +  G + WE  L SGS  S  ++  
Sbjct  77    HVDKTGPEGNIDALLQHGQDAVLVVGNGRLLRSWEINVGGLNWEILLDSGSFQSACLVGQ  136

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYAVG  2883
               N+K      +L  +   LH +S  +G   W + L  +E +D Q  V+ DG  +VYA+G
Sbjct  137   QDNVK---HVAVLKKTVVSLHYLS--NGHQKWIENLPESETVDYQ-AVYSDGNGEVYAMG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S       +   GE++K  S+  P         +++    +  +D      VS+  
Sbjct  191   VVPHSHITIVVYSVEDGEIIKQVSVEAPWLSNIQTSCAVIGPGMLTCMDPAT---VSLYM  247

Query  2708  KDGLIN--FQQVHIADLVQDFT-GAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL----  2550
              D  +     Q+ +  L  + T G   +L S         +++F  FL++  E  L    
Sbjct  248   LDLHLESEMTQIPLQALGLEVTPGFHPVLVSTQPNPARQPLSEF--FLQLGPEQYLLLQL  305

Query  2549  ---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--S  2388
                ++V    +   +  S + + G +    +     K   S+   N + G  LL+ +   
Sbjct  306   NNGQIVTLRDFKPAMLASFA-TAGEKTVAAVMSPKNKTACSINLFNAETGRRLLDTTLIY  364

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDV  2211
              +D   G   K+++  +++ D S G+R ++  EDH+L  LQQ G ++W+RE+ L+ +V +
Sbjct  365   NLDPNGGKPEKLYVQAFLKKDDSVGYRVMVQTEDHALAFLQQPGRVMWTREEALSDVVTM  424

Query  2210  TTSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM-----RLKSS  2046
                +LP+      +        + L   ++K   + ++     +A + ++     + +S 
Sbjct  425   EMVDLPLTGTQAELEGEFGKKADGLMSMVMKRLSSQLILLQAWIAHLWKLFYDARKPRSQ  484

Query  2045  GKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNG  1881
              K+++T     RD    +K++++++ SGKL+ + +  G I+W   ++ +  +        
Sbjct  485   VKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWKHYLDNVPSNA------A  538

Query  1880  LKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIA  1710
              K+   +   H       ++L+  K  GL     + L   +   GK+  I  P     I 
Sbjct  539   FKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGKKSHITPPALPQPIL  593

Query  1709  QVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGH  1533
             Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L G+
Sbjct  594   QSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRLSGY  653

Query  1532  AVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYK  1353
              ++ +           +T+ +W VV P+E ++I++   ++ NE VH+Q +V  DR V+YK
Sbjct  654   RLRTD----------LSTELIWEVVIPTEVQKIVSIKGKRPNEHVHSQGRVMGDRSVLYK  703

Query  1352  YISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLS  1173
             Y++ N+L V T     + D+     + S++ + LID VTGRI+H    + ++GPVH V S
Sbjct  704   YLNPNLLAVVT----ESTDLHQ---ERSFVGILLIDGVTGRIIHEAVQRKARGPVHVVHS  756

Query  1172  ENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKS  993
             ENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL   
Sbjct  757   ENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL--Q  804

Query  992   QSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGI  813
             QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    T+  +E+ +
Sbjct  805   QSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVTEQSREENL  864

Query  812   IPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDS  633
             IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D 
Sbjct  865   IPYAPELIIRTEWFINYNQTVSRVRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDV  924

Query  632   LTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  925   LKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  962



>ref|XP_010738577.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Larimichthys 
crocea]
Length=965

 Score =   350 bits (897),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 290/1005 (29%), Positives = 493/1005 (49%), Gaps = 97/1005 (10%)
 Frame = -2

Query  3410  TTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWR  3231
             T  +++EDQVG  DW Q+Y+GKV+ + F T     K+V+++TE NV A+L+ R GD+FWR
Sbjct  17    TVEAVFEDQVGKFDWRQQYVGKVRFSSFDTHAQSSKKVLLATESNVFAALNTRTGDLFWR  76

Query  3230  HV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLV  3060
             HV   G +  ID +       V+ + +G  LR+W +  G + WE  L SGS  S  ++  
Sbjct  77    HVDKTGPEGNIDALLQHGQDAVLVVGNGRLLRSWEINVGGLNWEILLDSGSFQSACLVGQ  136

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYAVG  2883
               N+K      +L  +   LH +S  +G   W + L  +E +D Q  V+ DG  +VYA+G
Sbjct  137   QDNVK---HVAVLKKTVVSLHYLS--NGHQKWIENLPESETVDYQ-AVYSDGNGEVYAMG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S       +   GE++K  S+  P         +++    +  +D      VS+  
Sbjct  191   VVPHSHITIVVYSVEDGEIIKQVSVEAPWLSNIQTSCAVIGPGMLTCMDPAT---VSLYM  247

Query  2708  KDGLIN--FQQVHIADLVQDFT-GAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL----  2550
              D  +     Q+ +  L  + T G   +L S         +++F  FL++  E  L    
Sbjct  248   LDLHLESEMTQIPLQALGLEVTPGFHPVLVSTQPNPARQPLSEF--FLQLGPEQYLLLQL  305

Query  2549  ---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--S  2388
                ++V    +   +  S + + G +    +     K   S+   N + G  LL+ +   
Sbjct  306   NNGQIVTLRDFKPAMLASFA-TAGEKTVAAVMSPKNKTACSINLFNAETGRRLLDTTLIY  364

Query  2387  AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDV  2211
              +D   G   K+++  +++ D S G+R ++  EDH+L  LQQ G ++W+RE+ L+ +V +
Sbjct  365   NLDPNGGKPEKLYVQAFLKKDDSVGYRVMVQTEDHALAFLQQPGRVMWTREEALSDVVTM  424

Query  2210  TTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM---  2061
                +LP+       E +    + ++  L   +   L      L       +A + ++   
Sbjct  425   EMVDLPLTGTQAELEGEFGKKAAIQDGLMSMVMKRLSSQLILLQAW----IAHLWKLFYD  480

Query  2060  --RLKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSE  1902
               + +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   ++ +  + 
Sbjct  481   ARKPRSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWKHYLDNVPSNA  540

Query  1901  TCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKP  1725
                     K+   +   H       ++L+  K  GL     + L   +   GK+  I  P
Sbjct  541   ------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGKKSHITPP  589

Query  1724  V--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN  1551
                  I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++
Sbjct  590   ALPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSS  649

Query  1550  N-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTT  1374
                L G+ ++ +           +T+ +W VV P+E ++I++   ++ NE VH+Q +V  
Sbjct  650   QGRLSGYRLRTD----------LSTELIWEVVIPTEVQKIVSIKGKRPNEHVHSQGRVMG  699

Query  1373  DRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQG  1194
             DR V+YKY++ N+L V T     + D+     + S++ + LID VTGRI+H    + ++G
Sbjct  700   DRSVLYKYLNPNLLAVVT----ESTDLHQ---ERSFVGILLIDGVTGRIIHEAVQRKARG  752

Query  1193  PVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLR  1014
             PVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    
Sbjct  753   PVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----  802

Query  1013  PEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQ  834
             P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    T+
Sbjct  803   PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVTE  860

Query  833   AEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLA  654
               +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ 
Sbjct  861   QSREENLIPYAPELIIRTEWFINYNQTVSRVRGIYTAPSGLESTCLVVAYGLDIYQTRVY  920

Query  653   PSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  921   PSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_007246404.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Astyanax 
mexicanus]
Length=964

 Score =   348 bits (894),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 295/1019 (29%), Positives = 493/1019 (48%), Gaps = 99/1019 (10%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             ++ +  L +L FS+A     ++EDQVG  DW Q+++GKV+ A+F T     K+++V+TE+
Sbjct  6     SVFSVCLCLLGFSAA-----VFEDQVGKFDWRQQFVGKVQFALFDTHSQASKKLLVATEK  60

Query  3278  NVLASLDLRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWE  3105
             N+ ASL+ R GD+FWRHV   G    I+ + +     V+ + +G  LR+W    G + WE
Sbjct  61    NIFASLNSRTGDLFWRHVDKTGPDGHINTLMMHGQDAVVVVGNGRLLRSWETTVGGLNWE  120

Query  3104  SFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             + L +GS  S + + V     V R   +L  S+  LH +SS  G   W + L        
Sbjct  121   TVLDTGSFQSAAYIGVQD---VVRYVAVLKKSAISLHYLSS--GHQKWVENLPESDTVQY  175

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKV  2754
               V+  G   V+ +G+  +S  V  + N   GE++K +S+  P          +V S  +
Sbjct  176   QTVYSGGNGQVFVLGVVPNSHIVIVEYNIEDGEIMKQKSVAAPWLSSLQSSCVMVGSGVL  235

Query  2753  VALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAV------LLPSKLTGMVAIHIN  2592
             +  D T   L +   +       Q  +  ++ +  G  V      +L S         ++
Sbjct  236   LCADPTTKSLYTFPLQSA----DQTTMTPILLESLGVEVAAGFQPVLISTQPHPARPPLS  291

Query  2591  KFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQ-AFGLIKHGVGKIHLSVKS----  2427
             +F L L   Y   L++ D      ++S     +  +  AF           +S K+    
Sbjct  292   EFFLQLGPDYHILLQLKD-----GLVSTLRDFNPSYLVAFATTGEKTVAAVMSPKNETAS  346

Query  2426  -IN----DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLL  2268
              IN    D G  LL+ +   ++D   G   K++I+ +++ D S G+R L+  ED  L  L
Sbjct  347   VINLYSADTGRRLLDTTIIYSMDPNGGKPAKLYIHTFLKKDDSVGYRVLVQTEDLVLTFL  406

Query  2267  QQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgt  2106
             QQ G +VWSRE+ LA +V +   +LP+     E +G    K +  L   LK    +    
Sbjct  407   QQPGRVVWSREEALADVVTMEMVDLPLTGTQAELEGEFGKKADGLLPMVLKRLSSQFILL  466

Query  2105  lmLATPDDVAAIQQMRLKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRI  1941
                 +          + +S  K+++T     RD    +K++++++ SGKL+ + +  G +
Sbjct  467   QAWMSHLWKLFYDARKPRSHVKNEVTFETLSRDEFNLQKMMVMVTASGKLFGIDSKSGTV  526

Query  1940  VWSFLVNALRKSETCENPNGL-KIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSF  1767
             +W   +  ++       PN + K+   +   H       ++LV  K  GL S     L  
Sbjct  527   LWKQYLENIQ-------PNSVFKLMVQRTTAHFPHPPQCTLLVKDKDTGLGS-----LYV  574

Query  1766  VDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFK  1593
              +   GK+  I  P     I Q + LP  D    ++ LLID       +P T   L   +
Sbjct  575   FNPIFGKKSHISVPALPRPILQSLLLPLMDQDYSKVLLLIDDQYKVTAFPSTKNVLQQLQ  634

Query  1592  RELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATR  1416
                 +I++Y VD++   L G  ++++           +T+ +W VV P+E ++I+    +
Sbjct  635   EMASSIFFYLVDSSQGRLSGFRLRKD----------LSTELIWEVVIPTEVQKIVGVKGK  684

Query  1415  KLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVT  1236
             + NE VH+Q +V  DR V+YKY++ N+L V T +  +  +        S++ ++LID VT
Sbjct  685   RANEHVHSQGRVMGDRSVLYKYLNPNLLAVVTESTDSHQE-------RSFVGIFLIDGVT  737

Query  1235  GRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVL  1056
             GRI+H    + ++ PVH V SENWVVY Y+N ++ R E SV+E+++     N  +     
Sbjct  738   GRIVHEAVQRKARRPVHFVHSENWVVYVYWNTKSRRNEFSVLELFEGMELYNSTVFS---  794

Query  1055  GKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALD  876
                +L +P      P+VL   QSY F   + T+  T T KGITS+ LL+G     +++L 
Sbjct  795   ---SLDRPRP----PQVL--QQSYIFPSPISTLEATLTEKGITSRHLLVGLPSGAIVSLP  845

Query  875   KRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTL  696
             K FLDPRR    +   +E+ +IP +  +PI  + ++ +      +RGI T P+ LEST L
Sbjct  846   KMFLDPRRPEVASDQSREENLIPYSPEMPIRTEWFINYNQTVSRVRGIYTAPSGLESTCL  905

Query  695   VFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             V AYG+D++ T++ PSK +D L DD+ Y L+   ++ L  A  I+   +E K L   WR
Sbjct  906   VVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLLGLFFATMISKRLAEVKLLNRAWR  964



>ref|XP_007246403.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Astyanax 
mexicanus]
Length=967

 Score =   348 bits (892),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 294/1022 (29%), Positives = 492/1022 (48%), Gaps = 102/1022 (10%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             ++ +  L +L FS+A     ++EDQVG  DW Q+++GKV+ A+F T     K+++V+TE+
Sbjct  6     SVFSVCLCLLGFSAA-----VFEDQVGKFDWRQQFVGKVQFALFDTHSQASKKLLVATEK  60

Query  3278  NVLASLDLRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWE  3105
             N+ ASL+ R GD+FWRHV   G    I+ + +     V+ + +G  LR+W    G + WE
Sbjct  61    NIFASLNSRTGDLFWRHVDKTGPDGHINTLMMHGQDAVVVVGNGRLLRSWETTVGGLNWE  120

Query  3104  SFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQ  2928
             + L +GS  S + + V     V R   +L  S+  LH +SS  G   W + L        
Sbjct  121   TVLDTGSFQSAAYIGVQD---VVRYVAVLKKSAISLHYLSS--GHQKWVENLPESDTVQY  175

Query  2927  HIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKV  2754
               V+  G   V+ +G+  +S  V  + N   GE++K +S+  P          +V S  +
Sbjct  176   QTVYSGGNGQVFVLGVVPNSHIVIVEYNIEDGEIMKQKSVAAPWLSSLQSSCVMVGSGVL  235

Query  2753  VALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAV------LLPSKLTGMVAIHIN  2592
             +  D T   L +   +       Q  +  ++ +  G  V      +L S         ++
Sbjct  236   LCADPTTKSLYTFPLQSA----DQTTMTPILLESLGVEVAAGFQPVLISTQPHPARPPLS  291

Query  2591  KFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQ-AFGLIKHGVGKIHLSVKS----  2427
             +F L L   Y   L++ D      ++S     +  +  AF           +S K+    
Sbjct  292   EFFLQLGPDYHILLQLKD-----GLVSTLRDFNPSYLVAFATTGEKTVAAVMSPKNETAS  346

Query  2426  -IN----DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLL  2268
              IN    D G  LL+ +   ++D   G   K++I+ +++ D S G+R L+  ED  L  L
Sbjct  347   VINLYSADTGRRLLDTTIIYSMDPNGGKPAKLYIHTFLKKDDSVGYRVLVQTEDLVLTFL  406

Query  2267  QQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklk  2112
             QQ G +VWSRE+ LA +V +   +LP+       E +    + ++  L   +   L    
Sbjct  407   QQPGRVVWSREEALADVVTMEMVDLPLTGTQAELEGEFGKKAAIQDGLLPMVLKRLSSQF  466

Query  2111  gtlmLATPDDVAAIQQMR-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGD  1950
               L              R  +S  K+++T     RD    +K++++++ SGKL+ + +  
Sbjct  467   ILLQAWMSHLWKLFYDARKPRSHVKNEVTFETLSRDEFNLQKMMVMVTASGKLFGIDSKS  526

Query  1949  GRIVWSFLVNALRKSETCENPNGL-KIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSV  1776
             G ++W   +  ++       PN + K+   +   H       ++LV  K  GL S     
Sbjct  527   GTVLWKQYLENIQ-------PNSVFKLMVQRTTAHFPHPPQCTLLVKDKDTGLGS-----  574

Query  1775  LSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
             L   +   GK+  I  P     I Q + LP  D    ++ LLID       +P T   L 
Sbjct  575   LYVFNPIFGKKSHISVPALPRPILQSLLLPLMDQDYSKVLLLIDDQYKVTAFPSTKNVLQ  634

Query  1601  IFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
               +    +I++Y VD++   L G  ++++           +T+ +W VV P+E ++I+  
Sbjct  635   QLQEMASSIFFYLVDSSQGRLSGFRLRKD----------LSTELIWEVVIPTEVQKIVGV  684

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
               ++ NE VH+Q +V  DR V+YKY++ N+L V T +  +  +        S++ ++LID
Sbjct  685   KGKRANEHVHSQGRVMGDRSVLYKYLNPNLLAVVTESTDSHQE-------RSFVGIFLID  737

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
              VTGRI+H    + ++ PVH V SENWVVY Y+N ++ R E SV+E+++     N  +  
Sbjct  738   GVTGRIVHEAVQRKARRPVHFVHSENWVVYVYWNTKSRRNEFSVLELFEGMELYNSTVFS  797

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVL  885
                   +L +P      P+VL   QSY F   + T+  T T KGITS+ LL+G     ++
Sbjct  798   ------SLDRPRP----PQVL--QQSYIFPSPISTLEATLTEKGITSRHLLVGLPSGAIV  845

Query  884   ALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLES  705
             +L K FLDPRR    +   +E+ +IP +  +PI  + ++ +      +RGI T P+ LES
Sbjct  846   SLPKMFLDPRRPEVASDQSREENLIPYSPEMPIRTEWFINYNQTVSRVRGIYTAPSGLES  905

Query  704   TTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEK  525
             T LV AYG+D++ T++ PSK +D L DD+ Y L+   ++ L  A  I+   +E K L   
Sbjct  906   TCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLLGLFFATMISKRLAEVKLLNRA  965

Query  524   WR  519
             WR
Sbjct  966   WR  967



>ref|XP_005057879.1| PREDICTED: ER membrane protein complex subunit 1, partial [Ficedula 
albicollis]
Length=1004

 Score =   348 bits (893),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 284/994 (29%), Positives = 471/994 (47%), Gaps = 120/994 (12%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A     + G K++VV+TEENV+A+L+ R G+I WRHV   
Sbjct  34    YEDQVGKFDWRQQYVGKLKFASLEASQ-GSKKLVVATEENVVAALNSRSGEILWRHV--D  90

Query  3215  KDVIDG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    +++ +P  
Sbjct  91    KGTPEGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQGAALVGLPEA  150

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L  ++  LH +S  +G   W + L         +++  GT  ++ VG+   
Sbjct  151   VKY---VAVLKKAALSLHYLS--NGHQKWVEHLPESESTQYQLLYSRGTGVIHVVGIVPQ  205

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S       N   GE+ K   +  P  G   G  + V  E V+      +  + +   D  
Sbjct  206   SHLNVLTFNVEDGEITKQVRLAAPWLGALQGSCA-VLGEAVLLCVDAAARALHVCALDTE  264

Query  2696  INFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------L  2574
              + + + +  L  +F          T  +V   S+    + +  + F L          L
Sbjct  265   QDLRHIPLQSLELEFADDFQARILATQPSVTSASRTQFFLQLSPSHFSLLQYKQGLLSHL  324

Query  2573  RVTYEGKL---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIH---------LSVK  2430
             R   +  L       +    AV++    L  G  + GL  HG  ++           S +
Sbjct  325   RDFQQAALVSFATTGEKTVAAVLTCRNELKPG-SSDGL--HGGSRLEDVRRQDSLTCSNQ  381

Query  2429  SIN------DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLL  2274
             + N      + G  LL+ +   + ++G     +++I  +++ D S G+RAL+  EDH L+
Sbjct  382   TYNINLYLVETGQRLLDTTITFNLEQGGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLM  441

Query  2273  LLQQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllk  2118
              LQQ G++VWSRE+ LA +V +   +LP+       E +    + ++  L       L  
Sbjct  442   FLQQPGKVVWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSS  501

Query  2117  lkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHT  1956
                 L   T          R   S          + RD    +K++++++ SGKL+ + +
Sbjct  502   QLILLQAWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIES  561

Query  1955  GDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSV  1776
               G I+W   +  +R   +       K+   +   H       ++L+        D  + 
Sbjct  562   SSGTILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLI-------KDKETK  608

Query  1775  LSFVDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
             +SF+  +    GK+ ++  PV    I Q + LP  D    ++ LLID +     +P T  
Sbjct  609   MSFLYVFNPIFGKKSQVTPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKN  668

Query  1610  ALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
              L   +    +IY+Y VDA    L G  +K++           +T+  W V  P+E ++I
Sbjct  669   VLRQLEEIAHSIYFYLVDAEQGKLSGFRLKKD----------LSTEESWEVAIPTEVQRI  718

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
             +A   ++ NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +Y
Sbjct  719   VAVKGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIY  771

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             L+D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N  
Sbjct  772   LMDGVTGRIIHSSVQKKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNAT  831

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
                      +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG    
Sbjct  832   AFS------SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSG  879

Query  893   QVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAK  714
              +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ 
Sbjct  880   AILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSG  939

Query  713   LESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             LEST LV AYG+D+F T++ PSK +D L DD+ Y
Sbjct  940   LESTCLVVAYGLDIFQTRVYPSKQFDVLKDDYDY  973



>ref|XP_007553495.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Poecilia 
formosa]
Length=962

 Score =   345 bits (885),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 284/1007 (28%), Positives = 491/1007 (49%), Gaps = 102/1007 (10%)
 Frame = -2

Query  3413  YTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFW  3234
             +   +++EDQVG  DW Q+Y+GKV+ + F TQ    K+V+V+TE NV A+L+ R G++FW
Sbjct  16    FVVHAVFEDQVGKFDWRQQYVGKVRFSHFDTQLQSSKKVLVATESNVFAALNSRTGELFW  75

Query  3233  RHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             RHV   G +  ID +       V+ + +G  LR+W++  G + WE  L   S  RS  LV
Sbjct  76    RHVDKTGPEGNIDALLHHAQDAVLVVGNGRMLRSWDINVGGLNWEMLLDTGS-FRSACLV  134

Query  3059  PSNLKVDRDSLI--LIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYA  2889
                  V   +++   + S  YL     ++G   W + L  +E +D Q  V+  G   V+ 
Sbjct  135   GQQGTVKHVAVLKKTVISVHYL-----SNGHQKWVENLPESETVDYQ-TVYSGGNGQVFV  188

Query  2888  VGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSI  2715
             +G+   S       +   GE++K  S+  P         ++V    ++ +DST   L ++
Sbjct  189   LGIVPHSHITIVVYSMEDGEIIKQVSVEAPWLSNIPASCAVVGQGMLMCVDSTTMSLNTL  248

Query  2714  IFKDGL----INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL-  2550
                  L    I  Q + + ++  DF  + V   S         +++F  FL++  E  L 
Sbjct  249   DLHQQLQMTQIPLQSLGL-EVDPDFHPSLV---SHQPNPAQKPLSEF--FLQLGPERYLL  302

Query  2549  ------EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
                   ++V    +   +  S + + G +    +     K   S+   + D G  LL+ +
Sbjct  303   LQLNNGQIVTLRDFKPALLASFA-TTGEKTVAAVMSPKNKTACSINLYSADTGRRLLDTT  361

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   ++ +  +++ D S G+R ++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  362   LIFTVDPNGGKPERLHVQAFLKKDDSVGYRVMVQTEDHALTFIQQPGRVMWTREEALSDV  421

Query  2219  VDVTTSELPV-------------EKDG---VSVSKVEQNLFEWlkghllklkgtlmLATP  2088
             V +   +LP+             + DG   + + ++   L           K       P
Sbjct  422   VTMEMVDLPLTGTQAELEGEFGKKADGLLSMVLKRLSSQLIMLQAWIAHLWKLFYDARKP  481

Query  2087  DDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRK  1908
                    Q++ + S ++ ++RD    +K++++++ SGKL+ + +  G I+W   +N + K
Sbjct  482   RS-----QVKNEVSIEN-LSRDEFNLQKMMVMVTSSGKLFGIDSKTGGILWKHYLNNVPK  535

Query  1907  SETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKIL  1731
             +         K+   +   H       ++L+  K  GL     + L   +   G++ +++
Sbjct  536   NA------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPMFGRKSQVM  584

Query  1730  KPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD  1557
              P     I Q + LP  D    ++ LL+D       +P T   L   +    +I+++ VD
Sbjct  585   PPALPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQETASSIFFFLVD  644

Query  1556  ANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKV  1380
             ++   L G+ ++ +           +T+ VW VV P+E ++I++   ++ NE VH+Q +V
Sbjct  645   SSQGRLSGYRLRTD----------LSTEQVWEVVVPTEVQKIVSVKGKRPNEHVHSQGRV  694

Query  1379  TTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGS  1200
               DR V+YKY++ N+L V T       +   V  + S++ + LID VTGRI+H    + +
Sbjct  695   MGDRSVLYKYLNPNLLAVVT-------ESTDVHQERSFIGILLIDGVTGRIIHEAVQRKA  747

Query  1199  QGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSY  1020
             +GPVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +  
Sbjct  748   RGPVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA--  799

Query  1019  LRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNP  840
               P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    
Sbjct  800   --PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEII  855

Query  839   TQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQ  660
             ++  +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T+
Sbjct  856   SEQSREENLIPYAPELIIRTEWFINYNQTVGRVRGIHTAPSGLESTCLVVAYGLDIYQTR  915

Query  659   LAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             + PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  916   VYPSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  962



>ref|XP_007553494.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Poecilia 
formosa]
Length=965

 Score =   345 bits (884),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 284/1005 (28%), Positives = 491/1005 (49%), Gaps = 95/1005 (9%)
 Frame = -2

Query  3413  YTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFW  3234
             +   +++EDQVG  DW Q+Y+GKV+ + F TQ    K+V+V+TE NV A+L+ R G++FW
Sbjct  16    FVVHAVFEDQVGKFDWRQQYVGKVRFSHFDTQLQSSKKVLVATESNVFAALNSRTGELFW  75

Query  3233  RHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             RHV   G +  ID +       V+ + +G  LR+W++  G + WE  L   S  RS  LV
Sbjct  76    RHVDKTGPEGNIDALLHHAQDAVLVVGNGRMLRSWDINVGGLNWEMLLDTGS-FRSACLV  134

Query  3059  PSNLKVDRDSLI--LIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYA  2889
                  V   +++   + S  YL     ++G   W + L  +E +D Q  V+  G   V+ 
Sbjct  135   GQQGTVKHVAVLKKTVISVHYL-----SNGHQKWVENLPESETVDYQ-TVYSGGNGQVFV  188

Query  2888  VGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSI  2715
             +G+   S       +   GE++K  S+  P         ++V    ++ +DST   L ++
Sbjct  189   LGIVPHSHITIVVYSMEDGEIIKQVSVEAPWLSNIPASCAVVGQGMLMCVDSTTMSLNTL  248

Query  2714  IFKDGL----INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL-  2550
                  L    I  Q + + ++  DF  + V   S         +++F  FL++  E  L 
Sbjct  249   DLHQQLQMTQIPLQSLGL-EVDPDFHPSLV---SHQPNPAQKPLSEF--FLQLGPERYLL  302

Query  2549  ------EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
                   ++V    +   +  S + + G +    +     K   S+   + D G  LL+ +
Sbjct  303   LQLNNGQIVTLRDFKPALLASFA-TTGEKTVAAVMSPKNKTACSINLYSADTGRRLLDTT  361

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   ++ +  +++ D S G+R ++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  362   LIFTVDPNGGKPERLHVQAFLKKDDSVGYRVMVQTEDHALTFIQQPGRVMWTREEALSDV  421

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATP-------DD  2082
             V +   +LP+       E +    + ++  L   +   L      L            D 
Sbjct  422   VTMEMVDLPLTGTQAELEGEFGKKAAIQDGLLSMVLKRLSSQLIMLQAWIAHLWKLFYDA  481

Query  2081  VAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSE  1902
                  Q++ + S ++ ++RD    +K++++++ SGKL+ + +  G I+W   +N + K+ 
Sbjct  482   RKPRSQVKNEVSIEN-LSRDEFNLQKMMVMVTSSGKLFGIDSKTGGILWKHYLNNVPKNA  540

Query  1901  TCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKP  1725
                     K+   +   H       ++L+  K  GL     + L   +   G++ +++ P
Sbjct  541   ------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPMFGRKSQVMPP  589

Query  1724  V--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN  1551
                  I Q + LP  D    ++ LL+D       +P T   L   +    +I+++ VD++
Sbjct  590   ALPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQETASSIFFFLVDSS  649

Query  1550  N-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTT  1374
                L G+ ++ +           +T+ VW VV P+E ++I++   ++ NE VH+Q +V  
Sbjct  650   QGRLSGYRLRTD----------LSTEQVWEVVVPTEVQKIVSVKGKRPNEHVHSQGRVMG  699

Query  1373  DRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQG  1194
             DR V+YKY++ N+L V T       +   V  + S++ + LID VTGRI+H    + ++G
Sbjct  700   DRSVLYKYLNPNLLAVVT-------ESTDVHQERSFIGILLIDGVTGRIIHEAVQRKARG  752

Query  1193  PVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLR  1014
             PVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    
Sbjct  753   PVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----  802

Query  1013  PEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQ  834
             P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++
Sbjct  803   PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIISE  860

Query  833   AEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLA  654
               +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ 
Sbjct  861   QSREENLIPYAPELIIRTEWFINYNQTVGRVRGIHTAPSGLESTCLVVAYGLDIYQTRVY  920

Query  653   PSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  921   PSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_002731135.2| PREDICTED: ER membrane protein complex subunit 1-like, partial 
[Saccoglossus kowalevskii]
Length=954

 Score =   344 bits (883),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 306/1022 (30%), Positives = 501/1022 (49%), Gaps = 141/1022 (14%)
 Frame = -2

Query  3374  MDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL--GHKDVID  3201
              D  ++Y+GK +   F    AGR RV+V+TE NVLASL  R G+I WR V   G    ID
Sbjct  4     FDRRKQYVGKTQFMAFDQTSAGR-RVLVATESNVLASLHARTGEIAWRQVFRSGAGGKID  62

Query  3200  GIDIALGKYVITLS-SGSTLRAWNLPDGQMVWESFL----SGSSPSRSILLVPSNLKVDR  3036
              + +    Y+IT+S +G  LR+W+   G +VWE       S S PS +       +   +
Sbjct  63    AM-LHNESYLITVSGNGKILRSWDAGTGSLVWEEVAAVTESTSKPSHA-----QAVFAGQ  116

Query  3035  DSLILIYSSG-YLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVGLTSSSQF  2862
             D + ++ SS  Y+H++   DG  +W KEL N E ++ Q I H  G D +Y +GL  +S  
Sbjct  117   DMMAVLTSSNVYVHSLK--DGTSLWSKELPNSESVNYQWI-HCGG-DVIYVIGLVENSHI  172

Query  2861  --VAYKINARKGELLKHESMVFPGGFSG----DISLVTSEKVVALDSTGSILVSIIFKDG  2700
               V+Y++N   GE     S+  P  ++        +V +  +V ++S  + L S++ K+G
Sbjct  173   SIVSYQLN-NDGEPNPQRSL--PAAWASVTGVSCIVVGNSNLVCVESLTNSLHSVVLKEG  229

Query  2699  LINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTY------EGK-----  2553
                     IA  + +   A    P KLT +  +   +F L L  T+      EG      
Sbjct  230   ASFISSPVIALGLPE---AETETP-KLTALNPVRA-EFTLHLTPTHTALMRQEGNSIKVV  284

Query  2552  LEVVDKVAYGAVISES----LSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSA  2385
             L++   +  GA    S    L+L    Q   +I     K  + +K      +  L   S 
Sbjct  285   LDLPKVILTGAATFGSQEVILTLEPKTQLVYVISCFDAKTGVKIKDTKQLVALPLHNGSP  344

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVT  2208
                ++ L        + + +  +G+R L+  +D+SL L+QQ G+IVWSRE+ L+ I    
Sbjct  345   TQMKEFL--------FSKKESQFGYRILLQTQDYSLSLIQQPGKIVWSREEALSRI----  392

Query  2207  TSELPVEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQ--MRLK------  2052
                L VE   + V+  E    +        +    +       A IQ   M LK      
Sbjct  393   ---LSVEMVDLPVTDTEAKFEDEFGHQGDDVISMFLRRLTTQFAQIQTYIMSLKRRMRHG  449

Query  2051  ------SSGKSK------------------MTRDHNGFRKLLIVLSRSGKLYALHTGDGR  1944
                   ++  SK                  + RD     K++I +  SGKLY L + DG 
Sbjct  450   HHHEHLTAEDSKPDRTNNANDDDDDDDDEYLRRDQFNLHKMIIAVCESGKLYGLDSEDGS  509

Query  1943  IVWSFLVNALRKSETCEN-PNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSF  1767
             I+W   +  L+  E  +  P  ++      PH       P   +VG+  ++    +++  
Sbjct  510   IIWRQFIPNLQYFERSKTLPLFIQRTTAHFPH------PPQAAIVGRDKISGQ--TLMYS  561

Query  1766  VDSYTGKELKILKPV-----HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
              +  TGK   +  P+     + + QV  LP  D    ++ +L+DT+   H+ P   EA  
Sbjct  562   FNPITGKPSDVKNPLGKVLNYQLQQVTLLPLMDQEFLKIMILMDTEYKIHVIPA--EAKS  619

Query  1601  IFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
             + + +L +++ ++ +A++  L G+A+      DVG+++   ++ VW+V  P + ++II+ 
Sbjct  620   LLQEKLSSLFLFTANASDGSLAGYALV-----DVGNEH-LHSEMVWNVQLPDD-QRIISI  672

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
             A ++  E VH+Q +V  DR V+Y+Y++ N++ +A      AG        + +L +YL+D
Sbjct  673   AAKRPTEHVHSQGRVLGDRSVLYRYLNPNLVAIAAEGIDTAG--------KQFLNMYLVD  724

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
             TVTG ++    H+ S GPVH V SENW+VY Y+N R  R+E++V+E+Y+ ++  N  +  
Sbjct  725   TVTGSLVFTANHKKSTGPVHMVQSENWIVYEYWNSRHRRHEVTVLELYEGTKDRNSTVFS  784

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVL  885
                   +L  P      P ++ + QSY   ++++ I VTST KGIT+K L+       V+
Sbjct  785   ------SLDPP-----EPPIVMR-QSYILPYALQDIGVTSTEKGITNKALIFCLQSGGVV  832

Query  884   ALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLES  705
                K +LDPRR + PT   KE+GIIP    LPI  ++Y+ +     G+RG+ T PA LES
Sbjct  833   HFPKAYLDPRRPLVPTTLHKEEGIIPYLPELPISTEAYINYNKTVLGVRGVQTAPAGLES  892

Query  704   TTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEK  525
             T+LV  YG+DLF+T++ PSK +D L DDF Y L++  ++ L+ A  IT   +  K L++ 
Sbjct  893   TSLVLVYGLDLFYTRVFPSKMFDVLKDDFDYYLIITVVIGLLAASVITQKLASMKTLKKA  952

Query  524   WR  519
             WR
Sbjct  953   WR  954



>ref|XP_002606692.1| hypothetical protein BRAFLDRAFT_72541 [Branchiostoma floridae]
 gb|EEN62702.1| hypothetical protein BRAFLDRAFT_72541 [Branchiostoma floridae]
Length=940

 Score =   343 bits (879),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 276/963 (29%), Positives = 473/963 (49%), Gaps = 110/963 (11%)
 Frame = -2

Query  3407  TFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRH  3228
             T  +YEDQ+G  DWHQ+YIG V+ A F       KR+ V TE NV+A+++ R G + WRH
Sbjct  26    TSGMYEDQIGKFDWHQQYIGAVRQAAFDQSAPVSKRIFVGTESNVVAAINSRTGQLAWRH  85

Query  3227  VLGHKDVIDGIDIALGK---YVITLSSGSTLRAWNLPDGQMVWESFLS---GSSPSRSIL  3066
             V    D   G+D+ L K    V   S G  +RAW+   G ++WE FL+     SP++++L
Sbjct  86    VQERGDPW-GVDVVLHKGNVLVTVCSGGDAVRAWDPASGTLLWE-FLAKEKNDSPAKALL  143

Query  3065  LVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG-LDIQHIVHPDGTDDVYA  2889
             +     +      + + +   L  +S+ DG  +   E+ + G      ++H      +Y+
Sbjct  144   VEGKQDERSHVESVAVLTKKTLRILSAVDGHEMVSTEVWSGGETGGTSVLHQASNGQLYS  203

Query  2888  VGLTSSS--QFVAYKINARKG-ELLKHESMVFPGGFSGDISLVTSEKVVALDSTGSILVS  2718
             V ++S +  Q V+Y     KG E +K    V P G++   S  +++ VV  D+       
Sbjct  204   VSISSQAAVQIVSYTHVPGKGYEAVKR---VIPAGWA---SPQSTQCVVTGDNV------  251

Query  2717  IIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKF---VLFLRVTYEGKLE  2547
             ++  +   N   +H   LV     +AV L       +++  N +    L +     G+ E
Sbjct  252   LVCSEASTN--SLHTMSLVDGSGFSAVTL-------LSLGFNSWQPDSLAISAVQVGRKE  302

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKG  2367
             V+            L L++ H  + L++     I + +K +     N+   ++A    + 
Sbjct  303   VL------------LRLAQDH--YVLLQATADTITV-LKDL----PNVYATTTARSQDRD  343

Query  2366  LVHKVFINNYIRTDRSYGFRALIVLEDHSLLLL-----QQGEIVWSREDGLASIVDVTTS  2202
             ++  V +  +++ D S G+RAL+ +ED +LL+L      QG ++W R + LASI  V   
Sbjct  344   IMFLVTVYTFLKRDGSTGYRALLQMEDQTLLMLQQLQGNQGHVMWQRNEALASISAVDQV  403

Query  2201  ELPVEKDGVSVSKVEQ-----NLFEWlkghllklkgtlmLA-TPDDVAAIQQMRLKSSGK  2040
             +LPV +      +        +L  W             L    D     ++ R K   K
Sbjct  404   DLPVSETESKFEEEFGEESEEDLSIWQMFTRRITTQLEQLKDLADKFEEYRKPRAKQVEK  463

Query  2039  SKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQ  1860
              ++ RD    RK+++ ++ +GKLY L + +G IVW + +  +R    C     + ++  +
Sbjct  464   -QLERDPFNLRKMIVAVTSAGKLYGLDSANGDIVWQYFLPNIR----CFGQGEMYLFVQR  518

Query  1859  VPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELK------ILKPVHSIAQVIP  1698
                H      P  ++V +     +   V +F +  TG+ +       IL+P   + Q I 
Sbjct  519   TTAH--FPHPPQAMLVAQDKATGNG-LVFTF-NPTTGQPVNTTATSGILQPF-KVLQAIL  573

Query  1697  LPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNILRGHAVKE  1521
             LP  ++      +++D+D   H++P +   L + K+  G I+ ++ D   + L G ++  
Sbjct  574   LPVMNNHHLHPVMIVDSDHGVHIFPPSSSVLSVLKKNNGKIFLHAADLEKSTLTGFSLTT  633

Query  1520  NYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISK  1341
                KD   +   A    W +  P  S++I++   R+ NE VH+Q +V +DR VMYKY++ 
Sbjct  634   --LKDGKVELAQA----WHLSLPIPSQKIVSVVPRRANEHVHSQGRVLSDRSVMYKYLNP  687

Query  1340  NMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWV  1161
             N+L V T           +  D   L +YL+D VTG++++ M H+ + GPVH V SENWV
Sbjct  688   NLLAVMTEG---------IERDIPLLTLYLVDAVTGQVVYSMQHKRASGPVHLVHSENWV  738

Query  1160  VYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYF  981
             VYHY+N +  R+E++V+E+++ S+ D        L   +L         P VL   Q+Y 
Sbjct  739   VYHYWNGKFRRHEVTVLELFE-SQGDRNSTTFSSLSTQSL---------PLVL--QQAYI  786

Query  980   FAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLT  801
             F   +  +AV++T +GIT++ LL+      ++ L K  LDPRR + PT+  +E+G+ P  
Sbjct  787   FPMGLSAMAVSNTERGITARSLLLALPNGGLMTLPKNILDPRRPIIPTKQHQEEGVYPYI  846

Query  800   DSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDD  621
               L + P + +T+    EG+RGI    A LEST++V AYG+DLF+T++ PS+ +D L +D
Sbjct  847   PELHVNPMTLLTYNQSIEGIRGIHIGAAGLESTSVVLAYGLDLFYTRIMPSQMFDVLKED  906

Query  620   FSY  612
             F Y
Sbjct  907   FDY  909



>ref|XP_005528439.1| PREDICTED: ER membrane protein complex subunit 1 [Pseudopodoces 
humilis]
Length=992

 Score =   344 bits (882),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 282/988 (29%), Positives = 474/988 (48%), Gaps = 111/988 (11%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A     + G K++VV+TEENV+A+L+ R G+I WRHV   
Sbjct  25    YEDQVGKFDWRQQYVGKLKFASLEASQ-GSKKLVVATEENVVAALNSRSGEILWRHV--D  81

Query  3215  KDVIDG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    +++ +P  
Sbjct  82    KGTAEGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQGAALVGLPEG  141

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L   +  LH +S  +G   W + L         +++  GT  ++ +G+   
Sbjct  142   VKY---VAVLKKMALSLHYLS--NGHQKWVEHLPESENTQYQLLYSRGTGVIHVLGIVPQ  196

Query  2870  SQFVAYKINARKGELLKHESMVFPG--GFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S       N   GE+ +   +  P      G   ++    +V +D+    L  +   D  
Sbjct  197   SHLNVVTFNVEDGEITRQVRVAAPWLVALQGSCGVLGEAVLVCVDTAARSL-HVCALDTE  255

Query  2696  INFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------L  2574
              + + + +  L  +F          T  +V   S+    + +  + F L          L
Sbjct  256   QDMRHIPLQSLELEFADDFQARILTTQPSVTSASRTQFFLQLSPSHFSLLQYKQGLLSHL  315

Query  2573  RVTYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----  2427
             R   +  L       +    AV++    L    S+G  A   ++    +  L+  +    
Sbjct  316   RDFQQAALVSFATTGEKTVAAVLTCRSELKPGSSDGLHAGSTLEDARRQDSLTCSNQTYN  375

Query  2426  IN----DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLLLLQ  2265
             IN    + G  LL+ +     ++G     +++I  +++ D S G+RAL+  EDH L+ LQ
Sbjct  376   INLYLVETGQRLLDTTITFSLEQGGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQ  435

Query  2264  Q-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtl  2103
             Q G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L    
Sbjct  436   QPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQ  495

Query  2102  mLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIV  1938
                           + +S  K++     + RD    +K++++++ SGKL+ + +  G I+
Sbjct  496   AWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTIL  555

Query  1937  WSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDS  1758
             W   +  +R   +       K+   +   H       ++LV        D  + +SF+  
Sbjct  556   WKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYV  602

Query  1757  YT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFK  1593
             +    GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +
Sbjct  603   FNPIFGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKNVLRQLE  662

Query  1592  RELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATR  1416
                 +IY+Y VDA    L G  +K++           +T+  W V  P+E ++I+    +
Sbjct  663   EIAHSIYFYLVDAEQGKLSGFRLKKD----------LSTEESWEVAIPTEVQRIVTVKGK  712

Query  1415  KLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVT  1236
             + NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YL+D VT
Sbjct  713   RSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLLDGVT  765

Query  1235  GRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVL  1056
             GRI+H    + ++GPVH V SENWVVY Y+N +A R E++V+E+Y+ +   N        
Sbjct  766   GRIIHSSVQRKAKGPVHMVHSENWVVYQYWNTKARRNELTVLELYEGTEQYNATAFS---  822

Query  1055  GKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALD  876
                +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L 
Sbjct  823   ---SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLP  873

Query  875   KRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTL  696
             K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST L
Sbjct  874   KALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCL  933

Query  695   VFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             V AYG+D+F T++ PSK +D L DD+ Y
Sbjct  934   VVAYGLDIFQTRVYPSKQFDVLKDDYDY  961



>ref|XP_005800159.1| PREDICTED: ER membrane protein complex subunit 1-like [Xiphophorus 
maculatus]
Length=965

 Score =   343 bits (880),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 283/1001 (28%), Positives = 491/1001 (49%), Gaps = 95/1001 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F TQ    K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTQLQSSKKVLVATESNVFAALNSRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
              +G +  ID +       V+ + +G  LR+W++  G + WE  L   S  RS  LV    
Sbjct  80    KIGPEGNIDALLHHAQDAVLVVGNGRMLRSWDVNVGGLNWEMLLDTGS-FRSACLVGQQG  138

Query  3047  KVDRDSLI--LIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYAVGLT  2877
              V   +++   + S  YL     ++G   W + L  +E +D Q  V+  G   V+ +G+ 
Sbjct  139   TVKHVAVLKKTVISVHYL-----SNGHQKWVENLPESETVDYQ-TVYSGGNGQVFVLGIV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S       +   GE++K  S+  P         ++V    ++ +DST   L ++    
Sbjct  193   PHSHITIVVYSMEDGEIIKQVSVEAPWLSNIPASCAVVGQGTLMCVDSTTMSLNTLDLHQ  252

Query  2702  GL----INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL-----  2550
              L    I  Q + + ++  DF  + V   S         +++F  FL++  E  L     
Sbjct  253   QLQMTQIPLQSLGL-EVDPDFHPSLV---SHQPNPAQKPLSEF--FLQLGPERYLLLQLN  306

Query  2549  --EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--SA  2385
               ++V    +   +  S  ++ G +    +     K   S+   + D G  LL+ +    
Sbjct  307   NGQIVTLRDFKPALLSSF-VTTGEKTVAAVMSPKNKTACSINLFSSDTGRRLLDTTLIFT  365

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVT  2208
             +D   G   ++ +  +++ D S G+R ++  EDH+L  +QQ G ++W+RE+ L+ +V + 
Sbjct  366   VDPNGGKPERLHVQAFLKKDDSVGYRVMVQTEDHTLTFIQQPGRVMWTREEALSDVVTME  425

Query  2207  TSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATP-------DDVAAI  2070
               +LP+       E +    + ++  L   +   L      L            D     
Sbjct  426   MVDLPLTGTQAELEGEFGKKAAIQDGLLPMVLKRLSSQLIMLQAWIAHLWKLFYDARKPR  485

Query  2069  QQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
              Q++ + S ++ ++RD    +K++++++ SGKL+ + +  G I+W   ++ + K+     
Sbjct  486   SQVKNEVSIEN-LSRDEFNLQKMMVMVTSSGKLFGIDSKTGGILWKHYLDNVPKNA----  540

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
                 K+   +   H       ++L+  K  GL     + L   +   G++ ++  P    
Sbjct  541   --AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGRKSQVTPPALPQ  593

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-IL  1542
              I Q + LP  D    ++ LL+D       +P T   L   +    +I+++ VD++   L
Sbjct  594   PILQSLLLPLMDQDYAKVLLLVDNQYKVSAFPSTKNVLQQLQETASSIFFFLVDSSQGRL  653

Query  1541  RGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDV  1362
              G+ ++ +           +T+ VW VV P+E ++I++   ++ NE VH+Q +V  DR V
Sbjct  654   SGYRLRTD----------LSTEQVWEVVIPTEVQKIVSVKGKRPNEHVHSQGRVMGDRSV  703

Query  1361  MYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHA  1182
             +YKY++ N+L V T       +   V  + S++ + LID VTGRI+H    + ++GPVH 
Sbjct  704   LYKYLNPNLLAVVT-------ESTDVHQERSFIGILLIDGVTGRIIHEAVQRKARGPVHV  756

Query  1181  VLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVL  1002
             V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL
Sbjct  757   VHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL  806

Query  1001  AKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE  822
                QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E
Sbjct  807   --QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIISEQSRE  864

Query  821   DGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKT  642
             + +IP +  L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK 
Sbjct  865   ENLIPYSPELIIRTEWFINYNQTVGRVRGIHTAPSGLESTCLVVAYGLDIYQTRVYPSKQ  924

Query  641   YDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  925   FDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_010898641.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Esox 
lucius]
Length=978

 Score =   343 bits (879),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 281/1021 (28%), Positives = 497/1021 (49%), Gaps = 88/1021 (9%)
 Frame = -2

Query  3470  PSAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVV  3291
             PSA   +   LL + F     + +++EDQVG  DW ++Y+GKV  A F +     K++ V
Sbjct  9     PSAKMAKLVPLLAVFFYLVCVSEAVFEDQVGKFDWRRQYVGKVLFASFDSPSQSSKKLFV  68

Query  3290  STEENVLASLDLRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQ  3117
             +T++N+ ASL+ R GD+FWRHV  +G +  +D + +     ++ +  G  LR+W+   G 
Sbjct  69    ATDKNIFASLNSRTGDLFWRHVDKMGPEGAVDTLLVNAQDALMVIGDGRLLRSWDTNVGG  128

Query  3116  MVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
             + WE  L +GS  +   + +   +K      +L  ++  LH +S  +G   W + L +  
Sbjct  129   LNWEVVLDTGSFQAACFVGIQDTVK---HVAVLKKTAISLHYLS--NGHQKWVENLPDSD  183

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                   V+  G ++V+ +G+   S       +   GE+++  S+  P   S + S V   
Sbjct  184   TVKYQAVYSGGGEEVFVLGMVPHSHLTITVYSLEDGEIIRQRSVEAPWLSSVESSCVVVG  243

Query  2759  KVVAL---DSTGSILVSIIFKDGLINFQQVHIADL----VQDFTGAAVLLPSKLTGMVAI  2601
             + V +   + T ++   +I  +    F+QV +  L     QDF    V   S        
Sbjct  244   RGVLMCVDNYTQALYTLVIQAEDSPQFRQVLLQSLDLEVSQDFQPVLV---STQPHPARS  300

Query  2600  HINKFVL--------FLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKI  2445
              +++F L         L+++ +G      +    A +    +  E   A  +        
Sbjct  301   PLSEFFLQLGPDHHILLQLSEDGSTIAPLRDFQPAFLVSFATTGEKTVAAVMAPKNTTAC  360

Query  2444  HLSVKSINDWGSNLLEESS--AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLL  2271
              +++ S  D G  LL+ +    +D+  G   K++++ +++ D S G+R L+  EDH+L  
Sbjct  361   AVNLFS-ADSGRRLLDTTVIFPLDANGGKPQKLYVHAFLKKDDSVGYRVLVQTEDHALTF  419

Query  2270  LQQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkg  2109
             +QQ G +VW+RE+ LA +V +   +LP+     E +G    K +  L   +K    ++  
Sbjct  420   IQQPGRVVWTREEALADVVTMEMVDLPLTGTQAELEGEFGKKADGLLPMVMKRLSSQVIL  479

Query  2108  tlmLATPDDVAAIQQMRLKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGR  1944
                          +  + +S  K+++T     RD    +K++++++ SGKL+ + +  G 
Sbjct  480   LQAWMAHLWKLFYEARKPRSQIKNEVTIETLSRDEFNLQKMMVMVTASGKLFGIDSKSGT  539

Query  1943  IVWS-FLVNALRKSETCENPNG-LKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVL  1773
             I+W  +L N          PN   K+   +   H       ++L+  K  GL     + L
Sbjct  540   ILWKHYLENV--------QPNAAFKLIVQRTTAHFPHPPQCTLLIKDKDTGL-----ATL  586

Query  1772  SFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGI  1599
                +   G++ +I  P     I Q + LP  D    +  LL+D       +P T   +  
Sbjct  587   HVFNPIFGRKSQISLPALPRPILQSLLLPVIDQDYAKCLLLVDDQYKVTAFPSTKNVMQQ  646

Query  1598  FKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
              +    +I++Y VD+    L G  ++++           +++ +W VV P+E ++I+A  
Sbjct  647   LQEMASSIFFYLVDSEQGTLSGFRLRKD----------LSSELIWEVVLPTEVQKIVAVK  696

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
              ++ +E VH+Q +V  DR V+YKY++ N+L V T +           P+ +++ ++L+D 
Sbjct  697   GKRPSEHVHSQGRVMGDRSVLYKYLNPNLLAVVTESTDTH-------PERAFVGMFLVDG  749

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             VTGRI+H    + ++GP+H V SENWVVY Y+N ++ R E SV+E+++ +   N  +   
Sbjct  750   VTGRIIHEAVQRKARGPIHFVHSENWVVYEYWNTKSRRNEFSVLELFEGTELYNSTVFS-  808

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
                  +L +P   +L P+VL   QSY F   + T+  T T KGITS+ LL+G     +L+
Sbjct  809   -----SLDRP---HL-PQVL--QQSYIFPSPITTMEATLTEKGITSRHLLVGLPSGAILS  857

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             L K FLDPRR     +  +E+ +IP    +PI  + ++ +      L+GI T P+ LEST
Sbjct  858   LPKMFLDPRRPEVVNEHSREENLIPYAPEMPIRTEWFINYNQTISRLKGIYTAPSGLEST  917

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKW  522
              LV AYG+D++ T++ PSK +D L DD+ Y L+   + AL  A  I+   +E K L   W
Sbjct  918   CLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFALFFATMISKRLAEVKLLNRAW  977

Query  521   R  519
             R
Sbjct  978   R  978



>ref|XP_010898640.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Esox 
lucius]
Length=981

 Score =   343 bits (879),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 281/1024 (27%), Positives = 496/1024 (48%), Gaps = 91/1024 (9%)
 Frame = -2

Query  3470  PSAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVV  3291
             PSA   +   LL + F     + +++EDQVG  DW ++Y+GKV  A F +     K++ V
Sbjct  9     PSAKMAKLVPLLAVFFYLVCVSEAVFEDQVGKFDWRRQYVGKVLFASFDSPSQSSKKLFV  68

Query  3290  STEENVLASLDLRHGDIFWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQ  3117
             +T++N+ ASL+ R GD+FWRHV  +G +  +D + +     ++ +  G  LR+W+   G 
Sbjct  69    ATDKNIFASLNSRTGDLFWRHVDKMGPEGAVDTLLVNAQDALMVIGDGRLLRSWDTNVGG  128

Query  3116  MVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
             + WE  L +GS  +   + +   +K      +L  ++  LH +S  +G   W + L +  
Sbjct  129   LNWEVVLDTGSFQAACFVGIQDTVK---HVAVLKKTAISLHYLS--NGHQKWVENLPDSD  183

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                   V+  G ++V+ +G+   S       +   GE+++  S+  P   S + S V   
Sbjct  184   TVKYQAVYSGGGEEVFVLGMVPHSHLTITVYSLEDGEIIRQRSVEAPWLSSVESSCVVVG  243

Query  2759  KVVAL---DSTGSILVSIIFKDGLINFQQVHIADL----VQDFTGAAVLLPSKLTGMVAI  2601
             + V +   + T ++   +I  +    F+QV +  L     QDF    V   S        
Sbjct  244   RGVLMCVDNYTQALYTLVIQAEDSPQFRQVLLQSLDLEVSQDFQPVLV---STQPHPARS  300

Query  2600  HINKFVL--------FLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKI  2445
              +++F L         L+++ +G      +    A +    +  E   A  +        
Sbjct  301   PLSEFFLQLGPDHHILLQLSEDGSTIAPLRDFQPAFLVSFATTGEKTVAAVMAPKNTTAC  360

Query  2444  HLSVKSINDWGSNLLEESS--AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLL  2271
              +++ S  D G  LL+ +    +D+  G   K++++ +++ D S G+R L+  EDH+L  
Sbjct  361   AVNLFS-ADSGRRLLDTTVIFPLDANGGKPQKLYVHAFLKKDDSVGYRVLVQTEDHALTF  419

Query  2270  LQQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllkl  2115
             +QQ G +VW+RE+ LA +V +   +LP+       E +    + ++  L   +   L   
Sbjct  420   IQQPGRVVWTREEALADVVTMEMVDLPLTGTQAELEGEFGKKAAIQDGLLPMVMKRLSSQ  479

Query  2114  kgtlmLATPDDVAAIQQMR-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTG  1953
                L            + R  +S  K+++T     RD    +K++++++ SGKL+ + + 
Sbjct  480   VILLQAWMAHLWKLFYEARKPRSQIKNEVTIETLSRDEFNLQKMMVMVTASGKLFGIDSK  539

Query  1952  DGRIVWS-FLVNALRKSETCENPNG-LKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAP  1782
              G I+W  +L N          PN   K+   +   H       ++L+  K  GL     
Sbjct  540   SGTILWKHYLENV--------QPNAAFKLIVQRTTAHFPHPPQCTLLIKDKDTGL-----  586

Query  1781  SVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
             + L   +   G++ +I  P     I Q + LP  D    +  LL+D       +P T   
Sbjct  587   ATLHVFNPIFGRKSQISLPALPRPILQSLLLPVIDQDYAKCLLLVDDQYKVTAFPSTKNV  646

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             +   +    +I++Y VD+    L G  ++++           +++ +W VV P+E ++I+
Sbjct  647   MQQLQEMASSIFFYLVDSEQGTLSGFRLRKD----------LSSELIWEVVLPTEVQKIV  696

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
             A   ++ +E VH+Q +V  DR V+YKY++ N+L V T +           P+ +++ ++L
Sbjct  697   AVKGKRPSEHVHSQGRVMGDRSVLYKYLNPNLLAVVTESTDTH-------PERAFVGMFL  749

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             +D VTGRI+H    + ++GP+H V SENWVVY Y+N ++ R E SV+E+++ +   N  +
Sbjct  750   VDGVTGRIIHEAVQRKARGPIHFVHSENWVVYEYWNTKSRRNEFSVLELFEGTELYNSTV  809

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P   +L P+VL   QSY F   + T+  T T KGITS+ LL+G     
Sbjct  810   FS------SLDRP---HL-PQVL--QQSYIFPSPITTMEATLTEKGITSRHLLVGLPSGA  857

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K FLDPRR     +  +E+ +IP    +PI  + ++ +      L+GI T P+ L
Sbjct  858   ILSLPKMFLDPRRPEVVNEHSREENLIPYAPEMPIRTEWFINYNQTISRLKGIYTAPSGL  917

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQ  531
             EST LV AYG+D++ T++ PSK +D L DD+ Y L+   + AL  A  I+   +E K L 
Sbjct  918   ESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFALFFATMISKRLAEVKLLN  977

Query  530   EKWR  519
               WR
Sbjct  978   RAWR  981



>ref|XP_004554132.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X2 [Maylandia zebra]
Length=965

 Score =   342 bits (876),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 279/997 (28%), Positives = 483/997 (48%), Gaps = 87/997 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLV--GQQ  137

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVGLTSS  2871
                +   +L  +   LH +S  +G   W + L + E +D Q  V+  G  +VYA+G+   
Sbjct  138   GTVKHVAVLEKNIISLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALGIVPH  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S  V    +   GE++K  S+  P         +++    ++ +DS    L        +
Sbjct  195   SHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNLNPNM  254

Query  2696  INFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVTYE-G  2556
              + Q   I       ++  DF    V   S         +++F L      FL + +  G
Sbjct  255   DDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQFNNG  311

Query  2555  KLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--SA  2385
             ++  +       ++S +   + G +    +     K   S+   + + G  LL+ +    
Sbjct  312   QIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTTLIFV  368

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVT  2208
             +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +V + 
Sbjct  369   MDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDVVTME  428

Query  2207  TSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSG  2043
               +LP+     E +G    K +  +    K    +L       +          + +S  
Sbjct  429   MVDLPLTGTQAELEGEFGKKADGLMSMVFKRLSSQLILLQAWISHLWKLFYDARKPRSQV  488

Query  2042  KSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGL  1878
             K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +         
Sbjct  489   KNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA------AF  542

Query  1877  KIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQ  1707
             K+   +   H       ++L+  K  GL +     L   +   GK+  +  P     I Q
Sbjct  543   KLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPALPQPILQ  597

Query  1706  VIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHA  1530
              + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L G+ 
Sbjct  598   SLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRLSGYR  657

Query  1529  VKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKY  1350
             ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  DR V+YKY
Sbjct  658   LRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGDRSVLYKY  707

Query  1349  ISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSE  1170
             ++ N+L V T +     +        S++ + LID VTGRI+H    + ++GPVH V SE
Sbjct  708   LNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGPVHIVHSE  760

Query  1169  NWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQ  990
             NWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL   Q
Sbjct  761   NWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL--QQ  808

Query  989   SYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGII  810
             SY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E+ +I
Sbjct  809   SYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQSREENLI  868

Query  809   PLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSL  630
             P    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L
Sbjct  869   PYAPELMIRTEWFINYNQSISRVRGIHTSPSGLESTCLVVAYGLDIYQTRVYPSKQFDVL  928

Query  629   TDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
              DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  929   KDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_004554131.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X1 [Maylandia zebra]
Length=968

 Score =   342 bits (876),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 279/1000 (28%), Positives = 482/1000 (48%), Gaps = 90/1000 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNL  3048
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLV--GQQ  137

Query  3047  KVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVGLTSS  2871
                +   +L  +   LH +S  +G   W + L + E +D Q  V+  G  +VYA+G+   
Sbjct  138   GTVKHVAVLEKNIISLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALGIVPH  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S  V    +   GE++K  S+  P         +++    ++ +DS    L        +
Sbjct  195   SHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNLNPNM  254

Query  2696  INFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVTYE-G  2556
              + Q   I       ++  DF    V   S         +++F L      FL + +  G
Sbjct  255   DDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQFNNG  311

Query  2555  KLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--SA  2385
             ++  +       ++S +   + G +    +     K   S+   + + G  LL+ +    
Sbjct  312   QIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTTLIFV  368

Query  2384  IDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVT  2208
             +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +V + 
Sbjct  369   MDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDVVTME  428

Query  2207  TSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMR-LK  2052
               +LP+       E +    + ++  L   +   L      L              R  +
Sbjct  429   MVDLPLTGTQAELEGEFGKKAAIQDGLMSMVFKRLSSQLILLQAWISHLWKLFYDARKPR  488

Query  2051  SSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENP  1887
             S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +      
Sbjct  489   SQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA-----  543

Query  1886  NGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HS  1716
                K+   +   H       ++L+  K  GL +     L   +   GK+  +  P     
Sbjct  544   -AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPALPQP  597

Query  1715  IAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILR  1539
             I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L 
Sbjct  598   ILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRLS  657

Query  1538  GHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVM  1359
             G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  DR V+
Sbjct  658   GYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGDRSVL  707

Query  1358  YKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAV  1179
             YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GPVH V
Sbjct  708   YKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGPVHIV  760

Query  1178  LSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLA  999
              SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL 
Sbjct  761   HSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL-  809

Query  998   KSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKED  819
               QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E+
Sbjct  810   -QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQSREE  868

Query  818   GIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTY  639
              +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +
Sbjct  869   NLIPYAPELMIRTEWFINYNQSISRVRGIHTSPSGLESTCLVVAYGLDIYQTRVYPSKQF  928

Query  638   DSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  929   DVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  968



>ref|XP_006785514.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X2 [Neolamprologus brichardi]
Length=965

 Score =   341 bits (874),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 280/1001 (28%), Positives = 485/1001 (48%), Gaps = 95/1001 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVIVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWIREEALSDV  424

Query  2219  VDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL  2055
             V +   +LP+     E +G    K +  +    K    +L       +          + 
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKADGLMSMVFKRLSSQLILLQAWISHLWKLFYDARKP  484

Query  2054  KSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +     
Sbjct  485   RSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA----  540

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
                 K+   +   H       ++L+  K  GL +     L   +   GK+  +  P    
Sbjct  541   --AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPALPQ  593

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-IL  1542
              I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L
Sbjct  594   PILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRL  653

Query  1541  RGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDV  1362
              G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  DR V
Sbjct  654   SGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGDRSV  703

Query  1361  MYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHA  1182
             +YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GPVH 
Sbjct  704   LYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGPVHI  756

Query  1181  VLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVL  1002
             V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL
Sbjct  757   VHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL  806

Query  1001  AKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE  822
                QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E
Sbjct  807   --QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQSRE  864

Query  821   DGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKT  642
             + +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK 
Sbjct  865   ENLIPYAPELMIRTEWFINYNQSISRVRGIHTSPSGLESTCLVVAYGLDIYQTRVYPSKQ  924

Query  641   YDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   FDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_006785513.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X1 [Neolamprologus brichardi]
Length=968

 Score =   341 bits (874),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 280/1004 (28%), Positives = 484/1004 (48%), Gaps = 98/1004 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVIVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWIREEALSDV  424

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM  2061
             V +   +LP+       E +    + ++  L   +   L      L              
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKAAIQDGLMSMVFKRLSSQLILLQAWISHLWKLFYDA  484

Query  2060  R-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSET  1899
             R  +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +  
Sbjct  485   RKPRSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA-  543

Query  1898  CENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV  1722
                    K+   +   H       ++L+  K  GL +     L   +   GK+  +  P 
Sbjct  544   -----AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPA  593

Query  1721  --HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN  1548
                 I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++ 
Sbjct  594   LPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQ  653

Query  1547  -ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTD  1371
               L G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  D
Sbjct  654   GRLSGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGD  703

Query  1370  RDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGP  1191
             R V+YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GP
Sbjct  704   RSVLYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGP  756

Query  1190  VHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRP  1011
             VH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P
Sbjct  757   VHIVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----P  806

Query  1010  EVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQA  831
             +VL   QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++ 
Sbjct  807   QVL--QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQ  864

Query  830   EKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAP  651
              +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ P
Sbjct  865   SREENLIPYAPELMIRTEWFINYNQSISRVRGIHTSPSGLESTCLVVAYGLDIYQTRVYP  924

Query  650   SKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             SK +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   SKQFDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  968



>ref|XP_007896029.1| PREDICTED: ER membrane protein complex subunit 1 [Callorhinchus 
milii]
Length=957

 Score =   340 bits (872),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 280/970 (29%), Positives = 475/970 (49%), Gaps = 98/970 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQ G  DW  +Y+GK + A F       K++VV+TE NV+ASL+ R+G I WR V 
Sbjct  15    AIYEDQAGKFDWRCQYVGKPQFAYFDAPTQASKKIVVATENNVIASLNTRNGKILWRQV-  73

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFLSGSSPSRSILLVPS  3054
               K  ++G +D+ L  G+  +T+S G   LR+W+   G + WE  L   S     L+V +
Sbjct  74    -DKAGVEGAVDLMLLHGQDALTVSGGGRMLRSWDTNIGGLNWEFLLEPGSFQTGCLVVSA  132

Query  3053  NLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVGLT  2877
               +  R   I+   S  LH +S  +G   W + L + EG+  + +V+  G D V+ VG+ 
Sbjct  133   --EGVRFIAIVKKESISLHYLS--NGHQKWTEALPDSEGIHYE-LVYSGGDDAVHLVGVV  187

Query  2876  SSSQFVAYKINARKGELLKHESMVFPGGFS---GDISLVTSEKVVA-LDSTGSILVSIIF  2709
             S SQ      +   G++++  S  F   +     D+  V  E ++A +DS    L  +  
Sbjct  188   SRSQLHITTYDVADGKVVRQIS--FETSWIQHLKDLCGVIGEGILACVDSESHSLHLLPL  245

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLL-PSKLTGMVA---IHI---NKFVLFLRV  2568
             +    + + V IA       L + F G  V   PS +    A   +H+   N  +L LR 
Sbjct  246   QS---DQEPVQIALQSLDLKLDEGFKGKIVTTQPSPMGAAGAQFFLHLSDTNGVLLQLR-  301

Query  2567  TYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESS  2388
                  L  + K    +++S +   + G +    +     +   S+   +      L +++
Sbjct  302   --HMALSSLRKFVQASLMSFA---TTGDKTVAAVMTAKNRTAFSINLYSAENGRWLLDTA  356

Query  2387  ---AIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                +++   G   +++I  +++ D S G+RAL+   DH+L  +QQ G IVW+RE+ LA +
Sbjct  357   MDFSLNPHVGSPEQLYIQPFLKKDDSVGYRALLQTIDHTLTYIQQPGRIVWTREEALAEV  416

Query  2219  VDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL  2055
             V +   +LP+     E +G    K +  +  ++K    +L                  + 
Sbjct  417   VTMEMVDLPLTGTQAELEGEFGKKADGPMGMFMKRISSQLVLLQAWCYQLLKMFYDARKP  476

Query  2054  KSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             +S  K+++T     RD    +K++++++  GKL+ + +  G I+W   +      E  + 
Sbjct  477   RSQSKNEITIENLARDEFNLQKMMVMVTACGKLFGIDSSSGTILWKHYL------ENVKP  530

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
              +  K+   +   H       ++++  K  GL+S     L   +   GK   +  P    
Sbjct  531   GSSFKLAVQRTTAHFPHPPQCTLIIKDKETGLSS-----LHVFNPIFGKRSYVTPPALDR  585

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD-ANNIL  1542
              I Q + LP  D    ++ LLID +     +P +   L   +     IY+Y VD     L
Sbjct  586   PILQSLLLPIVDQDYAKVLLLIDAEHKVTAFPSSRNILQQLQTSASVIYFYLVDPVQGKL  645

Query  1541  RGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDV  1362
              G  ++E+          F T+ +W V  P+E+++I+    ++ NE VH+Q +V  DR V
Sbjct  646   NGFHLRED----------FGTEEIWEVAIPTETQRIVTVKGKRSNEHVHSQGRVMGDRSV  695

Query  1361  MYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHA  1182
             +YKY++ N+L V T +            + +++ +YLID VTGRI+H+   + ++GPV+ 
Sbjct  696   LYKYLNPNLLAVITESTDTH-------QERAFICIYLIDGVTGRIIHQSVQRKARGPVYV  748

Query  1181  VLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVL  1002
             V SENW+VY Y+N ++ R EM+V+E+Y+ +   N           +L +P+S    P + 
Sbjct  749   VHSENWLVYQYWNTKSRRNEMTVLELYEGTEQYNSTAFS------SLDRPLS----PIIF  798

Query  1001  AKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE  822
                QSY F  ++  +  T T KGITS+ LLIG     +L+L K FLDPRR   P++  +E
Sbjct  799   --QQSYIFPSAINLVEATITEKGITSRHLLIGLHSGGILSLPKAFLDPRRPEVPSEQSRE  856

Query  821   DGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKT  642
             + +IP    LPI  + ++ +      +RGI T P+ LEST LV AYG+D+F T++ PSK 
Sbjct  857   ENLIPYAPELPIRSEWFINYNQSVSRVRGIHTAPSGLESTCLVVAYGLDIFQTRVYPSKQ  916

Query  641   YDSLTDDFSY  612
             +D L DD+ Y
Sbjct  917   FDVLKDDYDY  926



>ref|XP_005941216.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X1 [Haplochromis burtoni]
Length=968

 Score =   340 bits (872),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 279/1004 (28%), Positives = 485/1004 (48%), Gaps = 98/1004 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSAPPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDV  424

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM  2061
             V +   +LP+       E +    + ++  L   +   L      L              
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKAAIQDGLMSMVFKRLSSQLILLQAWISHLWKLFYDA  484

Query  2060  R-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSET  1899
             R  +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +  
Sbjct  485   RKPRSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA-  543

Query  1898  CENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV  1722
                    K+   +   H       ++L+  K  GL +     L   +   GK+  +  P 
Sbjct  544   -----AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPA  593

Query  1721  --HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN  1548
                 I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++ 
Sbjct  594   LPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQ  653

Query  1547  -ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTD  1371
               L G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  D
Sbjct  654   GRLSGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGD  703

Query  1370  RDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGP  1191
             R V+YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GP
Sbjct  704   RSVLYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGP  756

Query  1190  VHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRP  1011
             VH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P
Sbjct  757   VHIVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----P  806

Query  1010  EVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQA  831
             +VL   QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++ 
Sbjct  807   QVL--QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQ  864

Query  830   EKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAP  651
              +E+ +IP    L I  + ++ +      ++GI T P+ LEST LV AYG+D++ T++ P
Sbjct  865   SREENLIPYAPELMIRTEWFINYNQSISRVQGIHTSPSGLESTCLVVAYGLDIYQTRVYP  924

Query  650   SKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             SK +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   SKQFDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  968



>ref|XP_005941217.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X2 [Haplochromis burtoni]
Length=965

 Score =   340 bits (871),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 279/1001 (28%), Positives = 486/1001 (49%), Gaps = 95/1001 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSAPPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTACSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDV  424

Query  2219  VDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL  2055
             V +   +LP+     E +G    K +  +    K    +L       +          + 
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKADGLMSMVFKRLSSQLILLQAWISHLWKLFYDARKP  484

Query  2054  KSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +     
Sbjct  485   RSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA----  540

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
                 K+   +   H       ++L+  K  GL +     L   +   GK+  +  P    
Sbjct  541   --AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPALPQ  593

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-IL  1542
              I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L
Sbjct  594   PILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRL  653

Query  1541  RGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDV  1362
              G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  DR V
Sbjct  654   SGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGDRSV  703

Query  1361  MYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHA  1182
             +YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GPVH 
Sbjct  704   LYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGPVHI  756

Query  1181  VLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVL  1002
             V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL
Sbjct  757   VHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL  806

Query  1001  AKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE  822
                QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E
Sbjct  807   --QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQSRE  864

Query  821   DGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKT  642
             + +IP    L I  + ++ +      ++GI T P+ LEST LV AYG+D++ T++ PSK 
Sbjct  865   ENLIPYAPELMIRTEWFINYNQSISRVQGIHTSPSGLESTCLVVAYGLDIYQTRVYPSKQ  924

Query  641   YDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   FDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_003963316.1| PREDICTED: ER membrane protein complex subunit 1-like [Takifugu 
rubripes]
Length=951

 Score =   339 bits (869),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 285/999 (29%), Positives = 494/999 (49%), Gaps = 82/999 (8%)
 Frame = -2

Query  3419  SAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDI  3240
              A T  +++EDQVG  DW Q+Y+GKV+ + F     G K+V+++TE NV A+L+ R GD+
Sbjct  3     CAITIDAVFEDQVGKFDWRQQYVGKVRFSYFDAHVQGTKKVLLATENNVFAALNTRTGDL  62

Query  3239  FWRHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFL-SGSSPSRSI  3069
             FWRHV   G +  ID + +     V+ + +G  LR+W++  G + WE  L SGS  +  +
Sbjct  63    FWRHVDKAGPEGNIDILMLHGQDAVMVVGNGRLLRSWDVNVGGLNWEVVLDSGSYQAACL  122

Query  3068  LLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVY  2892
             +    N+K     ++L  +   LH +S  +G   W + L  ++ +D Q  V+  G  +V 
Sbjct  123   VGFQDNVK---HVVVLKKAIISLHYLS--NGHQKWIENLPESDSVDYQ-TVYSFGNGEVV  176

Query  2891  AVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVS  2718
             A+GL   S       +   GE+LK  S+  P         +L+    +  +D   S+ + 
Sbjct  177   ALGLVPHSHITIVAYSVEDGEILKQISVDAPWLSDIQSSCALIGKGMLTCVDP-ASLSLH  235

Query  2717  IIFKDGLINFQQVHIADLVQDFT-GAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL---  2550
             +I         Q+ +  L  + + G   +L S         +++F  FL++  E  L   
Sbjct  236   MINLHSEAEMTQIPLQSLGLEVSPGFHPVLISSQPNPARQPLSEF--FLQLGPERYLLLQ  293

Query  2549  ----EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES--  2391
                 ++V    +   +  S + + G +    +     K   S+   + + G  LL+ +  
Sbjct  294   LNNGQIVTLRDFNPAMLVSFA-TTGEKNVAAVMSPKNKTASSLNLFSAETGRRLLDTTIN  352

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVD  2214
               +D   G   K+++  +++ D + G+R ++  EDH+L  LQQ G ++W+RE+ L+ +V 
Sbjct  353   FNLDPNGGKPEKLYVQAFLKKDDAVGYRVMVQTEDHALTFLQQPGRVMWTREEALSDVVT  412

Query  2213  VTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKS  2049
             +   +LP+     E +G    K +  L   LK    +L       +          +  S
Sbjct  413   MEMVDLPLTGTQAELEGEFGKKADGLLSMVLKRLSSQLILLQAWISHLWKLFYDARKPHS  472

Query  2048  SGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPN  1884
               K+++T     RD    +K++++++ +GKL+ + +  G I+W   ++++  +       
Sbjct  473   QVKNEVTIENLSRDEFNLQKMMVMVTAAGKLFGIDSKTGIILWKHYLDSIPTNAV-----  527

Query  1883  GLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSI  1713
               K+   +   H       ++L+  K  GL     + L   +   GK+  +  P     I
Sbjct  528   -FKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGKKSHVTPPALPQPI  581

Query  1712  AQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRG  1536
              Q + LP  D    ++ LL+D       +P T   L   +    +I++Y +D++   L G
Sbjct  582   LQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLIDSSQGRLTG  641

Query  1535  HAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMY  1356
             + ++ +           +T+ +W VV P+E ++I++   ++ NE VH+Q +V  DR V+Y
Sbjct  642   YRLRTD----------LSTELIWEVVIPTEIQRIVSVKGKRPNEHVHSQGRVMGDRSVLY  691

Query  1355  KYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVL  1176
             KY++ N+L V T     + D+     + S++ + LID VTGRI+H    + ++GPVH V 
Sbjct  692   KYLNPNLLAVVT----ESTDLHQ---ERSFVGMILIDGVTGRIIHEAVQRKARGPVHIVH  744

Query  1175  SENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAK  996
             SENWVVY Y++ ++ R E SVIE+Y+ +   N  +        +L +P +    P+VL  
Sbjct  745   SENWVVYEYWSTKSRRNEFSVIELYEGTELYNSTVFS------SLDRPYA----PQVL--  792

Query  995   SQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDG  816
              QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    T+  +E+ 
Sbjct  793   QQSYIFPSSIATVEATLTEKGITSRHLLIGLQSGGILSLPKMFLDPRRPEIITEQSREEN  852

Query  815   IIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYD  636
             +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D
Sbjct  853   LIPYAPELLIRTEWFINYNQSVSRVRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFD  912

Query  635   SLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
              L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  913   VLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  951



>ref|XP_005733075.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X1 [Pundamilia nyererei]
Length=968

 Score =   338 bits (868),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 279/1004 (28%), Positives = 485/1004 (48%), Gaps = 98/1004 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTASSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDV  424

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM  2061
             V +   +LP+       E +    + ++  L   +   L      L              
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKAAIQDGLMSMVFKRLSSQLILLQAWISHLWKLFYDA  484

Query  2060  R-LKSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSET  1899
             R  +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +  
Sbjct  485   RKPRSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA-  543

Query  1898  CENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV  1722
                    K+   +   H       ++L+  K  GL +     L   +   GK+  +  P 
Sbjct  544   -----AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPA  593

Query  1721  --HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN  1548
                 I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++ 
Sbjct  594   LPQPILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQ  653

Query  1547  -ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTD  1371
               L G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  D
Sbjct  654   GRLSGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGD  703

Query  1370  RDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGP  1191
             R V+YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GP
Sbjct  704   RSVLYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGP  756

Query  1190  VHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRP  1011
             VH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P
Sbjct  757   VHIVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----P  806

Query  1010  EVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQA  831
             +VL   QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++ 
Sbjct  807   QVL--QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQ  864

Query  830   EKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAP  651
              +E+ +IP    L I  + ++ +      ++GI T P+ LEST LV AYG+D++ T++ P
Sbjct  865   SREENLIPYAPELMIRTEWFINYNQSISRVQGIHTSPSGLESTCLVVAYGLDIYQTRVYP  924

Query  650   SKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             SK +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   SKQFDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  968



>ref|XP_005444047.1| PREDICTED: ER membrane protein complex subunit 1, partial [Falco 
cherrug]
Length=974

 Score =   338 bits (868),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 283/991 (29%), Positives = 480/991 (48%), Gaps = 113/991 (11%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A     + G K+V+V+TE+NV+A+L+ R G+I WRHV 
Sbjct  5     AVYEDQVGKFDWRQQYVGKLKFASLEASQ-GAKKVIVATEKNVVAALNSRSGEILWRHV-  62

Query  3221  GHKDVIDG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    S++ + 
Sbjct  63    -DKGTPEGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQ  121

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
               +K      +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+ 
Sbjct  122   DTVKY---VAVLKKAAISLHYLS--NGHQKWVEYLPESESTQYQLLYSHGTGVIHVLGIV  176

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFK  2706
               S       +   GE+ K   +  P     +G  S+V    +V +D  T S+ V  +  
Sbjct  177   PQSHVNILTFSVEDGEITKQSRVAAPWLKSLNGVCSVVGEAVLVCMDMDTHSLYVCSLGM  236

Query  2705  DGLINFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF-------  2577
             +     +Q+ +  L  +F          T  +V+  S+    + +  + F L        
Sbjct  237   EQ--EMKQIPLQSLDLEFADGFQPRILATQPSVISASRTQFFLQLSPSHFSLLQYKHGLL  294

Query  2576  --LRVTYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS-  2427
               LR   +  L       +    AV++    L    S+G  A   ++    +  L+  + 
Sbjct  295   SHLRDFQQAALVSFATTGEKTVAAVLTCRSELKPGSSDGLHAGSTLESSRKQESLTCSNQ  354

Query  2426  ---IN----DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLL  2274
                IN    + G  LL+ +   +  +G     ++++  +++ D S G+RAL+  EDH L+
Sbjct  355   TYNINLYLVETGQRLLDTTITFNLDQGGAKPQQLYVQVFLKKDDSVGYRALVQTEDHMLM  414

Query  2273  LLQQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklk  2112
              LQQ G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L 
Sbjct  415   FLQQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLI  474

Query  2111  gtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDG  1947
                              + +S  K++     + RD    +K++++++ SGKL+ + +  G
Sbjct  475   LLQAWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSG  534

Query  1946  RIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSF  1767
              I+W   +  +R   +       K+   +   H       ++LV        D  + +SF
Sbjct  535   TILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSF  581

Query  1766  VDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
             +  +    GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L 
Sbjct  582   LYVFNPIFGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLR  641

Query  1601  IFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
               +    +I++Y VDA    L G  +K++            T+  W V+ P+E ++I+  
Sbjct  642   QLEEIAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVIIPTEVQRIVTV  691

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
               ++ NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID
Sbjct  692   KGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLID  744

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
              VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N     
Sbjct  745   GVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS  804

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVL  885
                   +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L
Sbjct  805   ------SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAIL  852

Query  884   ALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLES  705
             +L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LES
Sbjct  853   SLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLES  912

Query  704   TTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             T LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  913   TCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  943



>ref|XP_005733076.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X2 [Pundamilia nyererei]
Length=965

 Score =   338 bits (867),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 279/1001 (28%), Positives = 486/1001 (49%), Gaps = 95/1001 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHV-  3225
             +++EDQVG  DW Q+Y+GKV+ + F T     K+V+V+TE NV A+L+ R G++FWRHV 
Sbjct  20    AVFEDQVGKFDWRQQYVGKVRFSHFDTHVQSSKKVLVATENNVFAALNTRTGELFWRHVD  79

Query  3224  -LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILL----V  3060
               G +  ID +       ++ + +G  LR+W++  G + WE  L   S  ++ L+     
Sbjct  80    KSGPEGNIDALLHHGQDAILVVGNGRLLRSWDVNVGGLNWEIVLDSGSFQKACLVGQQGT  139

Query  3059  PSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELAN-EGLDIQHIVHPDGTDDVYAVG  2883
               ++ V + ++I       LH +S  +G   W + L + E +D Q  V+  G  +VYA+G
Sbjct  140   VKHVAVLKKNII------SLHYLS--NGHQKWIENLPDSETVDYQ-TVYSGGNGEVYALG  190

Query  2882  LTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIF  2709
             +   S  V    +   GE++K  S+  P         +++    ++ +DS    L     
Sbjct  191   IVPHSHIVIIAYSTDDGEIIKQISVEAPWLSNIVASCAVIGQGVLICVDSATPSLYMYNL  250

Query  2708  KDGLINFQQVHIA------DLVQDFTGAAVLLPSKLTGMVAIHINKFVL------FLRVT  2565
                + + Q   I       ++  DF    V   S         +++F L      FL + 
Sbjct  251   NPNMDDLQMTQIPLQSLGLEVAPDFQPVLV---SHQPNSAHQPLSEFFLQLGPDNFLLLQ  307

Query  2564  YE-GKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
             +  G++  +       ++S +   + G +    +     K   S+   + + G  LL+ +
Sbjct  308   FNNGQIVTLRDFKPALLVSFA---TTGEKTIAAVMSPKNKTASSINLFSAETGRRLLDTT  364

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   K++I  +++ D S G+RA++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  365   LIFVMDPNGGKPEKIYIQPFLKKDDSVGYRAMVQTEDHTLTFIQQPGRVMWTREEALSDV  424

Query  2219  VDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL  2055
             V +   +LP+     E +G    K +  +    K    +L       +          + 
Sbjct  425   VTMEMVDLPLTGTQAELEGEFGKKADGLMSMVFKRLSSQLILLQAWISHLWKLFYDARKP  484

Query  2054  KSSGKSKMT-----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             +S  K+++T     RD    +K++++++ SGKL+ + +  G I+W   +N +  +     
Sbjct  485   RSQVKNEVTIENLSRDEFNLQKMMVMVTASGKLFGIDSKTGSILWRHYLNDVPSNA----  540

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
                 K+   +   H       ++L+  K  GL +     L   +   GK+  +  P    
Sbjct  541   --AFKLMVQRTTAHFPHPPQCTLLIKDKDTGLTT-----LHVFNPIFGKKSHVTPPALPQ  593

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-IL  1542
              I Q + LP  D    ++ LL+D       +P T   L   +    +I++Y VD++   L
Sbjct  594   PILQSLLLPLMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFYLVDSSQGRL  653

Query  1541  RGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDV  1362
              G+ ++ +           +T+ +W VV P E ++I++   ++ NE VH+Q +V  DR V
Sbjct  654   SGYRLRTD----------LSTEQIWEVVIPMEIQRIVSVKGKRPNEHVHSQGRVMGDRSV  703

Query  1361  MYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHA  1182
             +YKY++ N+L V T +     +        S++ + LID VTGRI+H    + ++GPVH 
Sbjct  704   LYKYLNPNLLAVVTESTDTHQE-------RSFVGIILIDGVTGRIIHEAVQRKARGPVHI  756

Query  1181  VLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVL  1002
             V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    P+VL
Sbjct  757   VHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----PQVL  806

Query  1001  AKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKE  822
                QSY F  ++ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++  +E
Sbjct  807   --QQSYIFPSAISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIVSEQSRE  864

Query  821   DGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKT  642
             + +IP    L I  + ++ +      ++GI T P+ LEST LV AYG+D++ T++ PSK 
Sbjct  865   ENLIPYAPELMIRTEWFINYNQSISRVQGIHTSPSGLESTCLVVAYGLDIYQTRVYPSKQ  924

Query  641   YDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             +D L DD+ Y L+   ++AL  A  I+   +E K L   WR
Sbjct  925   FDVLKDDYDYMLISSVLLALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_008411701.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Poecilia 
reticulata]
Length=965

 Score =   337 bits (865),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 281/1005 (28%), Positives = 490/1005 (49%), Gaps = 95/1005 (9%)
 Frame = -2

Query  3413  YTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFW  3234
             +   +++EDQVG  DW Q+Y+GKV+ + F TQ    K+V+V+TE NV A+L+ R G++FW
Sbjct  16    FAVHAVFEDQVGKFDWRQQYVGKVRFSHFDTQLQSSKKVLVATESNVFAALNSRTGELFW  75

Query  3233  RHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             RHV   G +  ID +       V+ + +G  LR+W++  G + WE  L   S  +S  LV
Sbjct  76    RHVDKTGPEGNIDALLHHAQDAVLVVGNGRMLRSWDINVGGLNWEMLLDTGS-FQSACLV  134

Query  3059  PSNLKVDRDSLI--LIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYA  2889
                  V   +++   + S  YL     ++G   W + L  +E +D Q  V+  G   V+ 
Sbjct  135   GQQGTVKHVAVLKKTVISVHYL-----SNGHQKWVENLPESETVDYQ-TVYSGGNGQVFV  188

Query  2888  VGLTSSSQFVAYKINARKGELLKHESM--VFPGGFSGDISLVTSEKVVALDSTGSILVSI  2715
             +G+   S       +   GE++K  S+   +        ++V    ++ +DST   L ++
Sbjct  189   LGIVPHSHITIVVYSMEDGEIIKQVSVEVSWLSNIPASCAVVGQGMLMCVDSTTMSLNTL  248

Query  2714  IFKDGL----INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL-  2550
                  L    I  Q + + ++  DF  + V   S         +++F  FL++  E  L 
Sbjct  249   DLHQQLQMTQIPLQSLGL-EVDPDFHPSLV---SHQPNPAQKPLSEF--FLQLGPERYLL  302

Query  2549  ------EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
                   ++V    +   +  S + + G +    +     K   S+   + D G  LL+ +
Sbjct  303   LQLNNGQIVTLRDFKPALLASFA-TTGEKTVAAVMSPKNKTACSINLFSADTGRRLLDTT  361

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   ++ +  +++ D S G+R ++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  362   LIFTVDPSGGKPERLHVQAFLKKDDSVGYRVMVQTEDHALTFIQQPGRVMWTREEALSDV  421

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATP-------DD  2082
             V +   +LP+       E +    + ++  L   +   L      L            D 
Sbjct  422   VTMEMVDLPLTGTQAELEGEFGKKAAIQDGLLSMVLKRLSSQLIMLQAWIAHLWKLFYDA  481

Query  2081  VAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSE  1902
                  Q++ + S ++ ++RD    +K++++++ SGKL+ + +  G I+W   ++ + K+ 
Sbjct  482   RKPRSQVKNEVSIEN-LSRDEFNLQKMMVMVTSSGKLFGIDSKTGGILWKHYLDNVPKNA  540

Query  1901  TCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKP  1725
                     K+   +   H       ++L+  K  GL     + L   +   G++ ++  P
Sbjct  541   ------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGRKSQVTPP  589

Query  1724  V--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN  1551
                  I Q + LP+ D    ++ LL+D       +P T   L   +    +I+++ VD++
Sbjct  590   ALPQPILQSLLLPFMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFFLVDSS  649

Query  1550  N-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTT  1374
                L G+ ++ +           +T+ VW VV P+E ++I+    ++ NE VH+Q +V  
Sbjct  650   QGRLSGYRLRTD----------LSTEQVWEVVVPTEVQKIVTVKGKRPNEHVHSQGRVMG  699

Query  1373  DRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQG  1194
             DR V+YKY++ N+L V T       +   V  + S++ + LID VTGRI+H    + ++G
Sbjct  700   DRSVLYKYLNPNLLAVVT-------ESTDVHQERSFIGILLIDGVTGRIIHEAVQRKARG  752

Query  1193  PVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLR  1014
             PVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +    
Sbjct  753   PVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA----  802

Query  1013  PEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQ  834
             P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    ++
Sbjct  803   PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEIISE  860

Query  833   AEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLA  654
               +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ 
Sbjct  861   QSREENLIPYAPELIIRTEWFINYNQTVGRVRGIHTAPSGLESTCLVVAYGLDIYQTRVY  920

Query  653   PSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  921   PSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  965



>ref|XP_008411702.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Poecilia 
reticulata]
Length=962

 Score =   337 bits (864),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 281/1007 (28%), Positives = 490/1007 (49%), Gaps = 102/1007 (10%)
 Frame = -2

Query  3413  YTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFW  3234
             +   +++EDQVG  DW Q+Y+GKV+ + F TQ    K+V+V+TE NV A+L+ R G++FW
Sbjct  16    FAVHAVFEDQVGKFDWRQQYVGKVRFSHFDTQLQSSKKVLVATESNVFAALNSRTGELFW  75

Query  3233  RHV--LGHKDVIDGIDIALGKYVITLSSGSTLRAWNLPDGQMVWESFLSGSSPSRSILLV  3060
             RHV   G +  ID +       V+ + +G  LR+W++  G + WE  L   S  +S  LV
Sbjct  76    RHVDKTGPEGNIDALLHHAQDAVLVVGNGRMLRSWDINVGGLNWEMLLDTGS-FQSACLV  134

Query  3059  PSNLKVDRDSLI--LIYSSGYLHAVSSTDGEVIWKKELA-NEGLDIQHIVHPDGTDDVYA  2889
                  V   +++   + S  YL     ++G   W + L  +E +D Q  V+  G   V+ 
Sbjct  135   GQQGTVKHVAVLKKTVISVHYL-----SNGHQKWVENLPESETVDYQ-TVYSGGNGQVFV  188

Query  2888  VGLTSSSQFVAYKINARKGELLKHESM--VFPGGFSGDISLVTSEKVVALDSTGSILVSI  2715
             +G+   S       +   GE++K  S+   +        ++V    ++ +DST   L ++
Sbjct  189   LGIVPHSHITIVVYSMEDGEIIKQVSVEVSWLSNIPASCAVVGQGMLMCVDSTTMSLNTL  248

Query  2714  IFKDGL----INFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKL-  2550
                  L    I  Q + + ++  DF  + V   S         +++F  FL++  E  L 
Sbjct  249   DLHQQLQMTQIPLQSLGL-EVDPDFHPSLV---SHQPNPAQKPLSEF--FLQLGPERYLL  302

Query  2549  ------EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN-DWGSNLLEES  2391
                   ++V    +   +  S + + G +    +     K   S+   + D G  LL+ +
Sbjct  303   LQLNNGQIVTLRDFKPALLASFA-TTGEKTVAAVMSPKNKTACSINLFSADTGRRLLDTT  361

Query  2390  --SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASI  2220
                 +D   G   ++ +  +++ D S G+R ++  EDH+L  +QQ G ++W+RE+ L+ +
Sbjct  362   LIFTVDPSGGKPERLHVQAFLKKDDSVGYRVMVQTEDHALTFIQQPGRVMWTREEALSDV  421

Query  2219  VDVTTSELPV-------------EKDG---VSVSKVEQNLFEWlkghllklkgtlmLATP  2088
             V +   +LP+             + DG   + + ++   L           K       P
Sbjct  422   VTMEMVDLPLTGTQAELEGEFGKKADGLLSMVLKRLSSQLIMLQAWIAHLWKLFYDARKP  481

Query  2087  DDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRK  1908
                    Q++ + S ++ ++RD    +K++++++ SGKL+ + +  G I+W   ++ + K
Sbjct  482   RS-----QVKNEVSIEN-LSRDEFNLQKMMVMVTSSGKLFGIDSKTGGILWKHYLDNVPK  535

Query  1907  SETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKIL  1731
             +         K+   +   H       ++L+  K  GL     + L   +   G++ ++ 
Sbjct  536   NA------AFKLMVQRTTAHFPHPPQCTLLIKDKDTGL-----ATLHVFNPIFGRKSQVT  584

Query  1730  KPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD  1557
              P     I Q + LP+ D    ++ LL+D       +P T   L   +    +I+++ VD
Sbjct  585   PPALPQPILQSLLLPFMDQDYAKVLLLVDDQYKVSAFPSTKNVLQQLQEMASSIFFFLVD  644

Query  1556  ANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKV  1380
             ++   L G+ ++ +           +T+ VW VV P+E ++I+    ++ NE VH+Q +V
Sbjct  645   SSQGRLSGYRLRTD----------LSTEQVWEVVVPTEVQKIVTVKGKRPNEHVHSQGRV  694

Query  1379  TTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGS  1200
               DR V+YKY++ N+L V T       +   V  + S++ + LID VTGRI+H    + +
Sbjct  695   MGDRSVLYKYLNPNLLAVVT-------ESTDVHQERSFIGILLIDGVTGRIIHEAVQRKA  747

Query  1199  QGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSY  1020
             +GPVH V SENWVVY Y++ ++ R E SVIE+Y+     N  +        +L +P +  
Sbjct  748   RGPVHVVHSENWVVYEYWSTKSRRNEFSVIELYEGMELYNSTVFS------SLDRPHA--  799

Query  1019  LRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNP  840
               P+VL   QSY F  S+ T+  T T KGITS+ LLIG     +L+L K FLDPRR    
Sbjct  800   --PQVL--QQSYIFPSSISTMEATLTEKGITSRHLLIGLPSGGILSLPKMFLDPRRPEII  855

Query  839   TQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQ  660
             ++  +E+ +IP    L I  + ++ +      +RGI T P+ LEST LV AYG+D++ T+
Sbjct  856   SEQSREENLIPYAPELIIRTEWFINYNQTVGRVRGIHTAPSGLESTCLVVAYGLDIYQTR  915

Query  659   LAPSKTYDSLTDDFSYalllltivalvvaifiTWIWSEQKELQEKWR  519
             + PSK +D L DD+ Y L+   + AL  A  I+   +E K L   WR
Sbjct  916   VYPSKQFDVLKDDYDYMLISSVLFALFFATMISKRLAEVKLLNRAWR  962



>ref|XP_005846272.1| hypothetical protein CHLNCDRAFT_58253 [Chlorella variabilis]
 gb|EFN54170.1| hypothetical protein CHLNCDRAFT_58253 [Chlorella variabilis]
Length=956

 Score =   335 bits (860),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 284/980 (29%), Positives = 452/980 (46%), Gaps = 102/980 (10%)
 Frame = -2

Query  3437  LVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLD  3258
             LVL+ +      ++ EDQ G  DW Q+Y+G+VK A   T    R R+ V++E   LA+L 
Sbjct  10    LVLLCACPGAVLAILEDQAGQYDWLQQYVGRVKLAQLATTP--RPRLYVASEAGALAALS  67

Query  3257  LRHGDIFWRHVLGHKDVIDGIDIALGKYVITLSSGS-TLRAWNLPDGQMVWESFLS-GSS  3084
                G + WR VL   D    + + LG  V+TLS G   L AW+   G  VW + ++ G+ 
Sbjct  68    PTDGSLLWRKVLAEGDTFTHL-LVLGTRVVTLSDGGRQLLAWDAATGGAVWAATVATGAE  126

Query  3083  PSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGT  2904
              +  + L     K      + +   G + A + TDG  +W   L  +G   Q     DG 
Sbjct  127   LAGGVDLAAVGSKA-----VAVAVGGTVKAFAVTDGRELWTASL--DGGSAQLFAAADG-  178

Query  2903  DDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGG-FSGDISLVTSEKVVALDSTGSI  2727
               V+A  L S    +A    +  G++ +  S+   GG  +G    V    V AL + GS 
Sbjct  179   -GVWAASLPSGGSQLALASLSADGQVSQQPSLAADGGQLTGAQLAVGEAGVAALSADGSS  237

Query  2726  LV----SIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYE  2559
             L     S +   GL       ++         A L+P   +    + +      L +   
Sbjct  238   LCAAAQSALACQGLAALVPAGVS------VAGARLVPGSCSAHAVLQVAGGAAVLALGGS  291

Query  2558  GKLEVV----DKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES  2391
                 +V    D  A G  + +    ++      L       + + V S  D GS++ E +
Sbjct  292   SGASMVKFVPDATASGCFLGQG---ADATPLVALATPSTAGLRVQVVSAAD-GSSVQEAA  347

Query  2390  -SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQGEIVWSREDGLASIVD  2214
               ++  Q    H V +        S     L+V +D SL L++ G + W R + LAS+ D
Sbjct  348   LPSLAPQLVTSHAVGVAALFAAPSSG--TQLVVFDDDSLALVEGGALAWLRHEELASVTD  405

Query  2213  VTTSELPV-----------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQ  2067
             V  ++LP             + G++ +   Q L              L LA+P++   ++
Sbjct  406   VLFTDLPAPTPENEAQWLASQPGLAETLRAQAL---TLKVQAGQLANLALASPEERREVE  462

Query  2066  QMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENP  1887
             + +  ++ K + TRD +GFRK L+VL+ SGK+ ALHTGDGR++WS      R +      
Sbjct  463   RYKAVTNDKLRPTRDPDGFRKQLVVLTASGKVMALHTGDGRLLWSLDFG--RGAAMS---  517

Query  1886  NGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPVHSIAQ  1707
                K+  W+VPH    D       VG         +  + ++++TG  L  L    + A 
Sbjct  518   ---KLGLWRVPHEVQHDVEVVAFDVGVA-------ATAAIINAHTGAILDTLAAPVAAAD  567

Query  1706  VIPLP---YTDSTEQRLHLLIDTD--GHGHLYPRTPEALGIFKRELGNI---YWYSVDAN  1551
             ++ LP   +  + +Q ++ L+     G   L P T  ALG            +W + +  
Sbjct  568   LLHLPQAAHDGTADQHVYALVPAGEGGEPQLLPDT--ALGRAAFAAARPTLSFWRADEQA  625

Query  1550  NILRGHAVKENYFKDVGDDYYFATKYVWSVVF-PSES-EQIIATATRKLNEVVHTQAKVT  1377
               +RG    E+           A +  WS V  P+ S  +I+A A     E V++ A+V 
Sbjct  626   GTIRGLGFTESG----------AVEERWSAVLAPAGSGRRILAVAAHLPGETVYSPARVL  675

Query  1376  TDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQ  1197
              + ++ +KY++ N L VA V P A G        E  L V L+D VTGR L    H+G+ 
Sbjct  676   GNGELKFKYLNPNTLLVA-VGPPAGGR------GEQTLTVALLDAVTGRTLFSQAHEGAS  728

Query  1196  GPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYL  1017
             GPVHAVL+EN   YH+++  AHR++M+ +E+YD S    K +  L  G+ NLT   SS+ 
Sbjct  729   GPVHAVLTENMAAYHFWSSEAHRWQMATVELYDASPPTLK-VSDLAFGETNLTS--SSWD  785

Query  1016  RPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTV---  846
              P + A SQ++     V  ++VT + +G T+KQ+++ T   QV  LD+RFLDPRR +   
Sbjct  786   VPPLEAGSQTFLCRLPVVGLSVTRSLRGNTAKQVMLLTQAGQVYLLDRRFLDPRRPIVPP  845

Query  845   --NPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDL  672
                PT  +  + +      LP+    + T   + + LRG+    A+LEST L+  +G+DL
Sbjct  846   GQKPTPEQAAEQLPAYQAELPLSGPMFATLNHEVKRLRGVAVEAAELESTMLMLGHGLDL  905

Query  671   FFTQLAPSKTYDSLTDDFSY  612
             F+T+L PSK++D + DDF Y
Sbjct  906   FYTRLTPSKSFDMVPDDFPY  925



>gb|KFV66609.1| ER membrane protein complex subunit 1, partial [Picoides pubescens]
Length=970

 Score =   334 bits (856),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 281/992 (28%), Positives = 471/992 (47%), Gaps = 115/992 (12%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV 
Sbjct  1     AVYEDQVGKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV-  58

Query  3221  GHKDVIDGIDIAL---GKYVITLS-SGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPS  3054
               K   +G+  A+   G+  IT+S +G  LR+W    G + WE+ L   S   + L+   
Sbjct  59    -DKGTPEGVIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVAGLVGLQ  117

Query  3053  NLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTS  2874
             +  V +   +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+  
Sbjct  118   D--VVKYVAVLKKAAISLHYLS--NGHQKWVEHLPESEATQYQMLYSHGTGVIHVLGVVP  173

Query  2873  SSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKD  2703
              S       +   GE+ +   +  P      G   +V    +V +D  T S+ V  +  +
Sbjct  174   QSHLTILTFSVEDGEVTRQVRVAAPWLKSLDGLCGVVGEAVLVCVDMDTQSLYVCSLETE  233

Query  2702  GLINFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF--------  2577
                  +Q+ +  L  +F          T   V+  S+    + +  + F L         
Sbjct  234   Q--EMKQIPLQSLDLEFADDFQPRILATQPNVIGASRTQFFLQLSPSHFSLLQYKQGLLS  291

Query  2576  -LRVTYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS--  2427
              LR   +  L       +    AV++    L    +EG  A G ++    +  L+  +  
Sbjct  292   HLRDFEQAALVSFATTGEKTVAAVLTCRSELKPGSAEGLHAGGSLEEARKQDSLTCSNQT  351

Query  2426  --IN----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLL  2271
               IN    + G  LL+ +      Q G    +++I  +++ D S G+RAL+  EDH L+ 
Sbjct  352   YNINLYLVETGQRLLDTTITFTLEQSGTKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMF  411

Query  2270  LQQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkg  2109
             LQQ G++VWSRE+ LA +V +   +LP+     E +G    K    L       L     
Sbjct  412   LQQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEG-EFGKKADGLLGMFLKRLSSQLI  470

Query  2108  tlmLATP-------DDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGD  1950
              L   T        D      Q+R        + RD    +K++++++ SGKL+ + +  
Sbjct  471   LLQAWTAHLWKMFYDARKPRSQIR-NEINIDNLARDEFNLQKMMVMVTASGKLFGIESSS  529

Query  1949  GRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLS  1770
             G I+W   +  +R   +       K+   +   H       ++LV        D  + +S
Sbjct  530   GTILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMS  576

Query  1769  FVDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEAL  1605
             F+  +    GK  ++  PV    + Q + LP  D    ++ LLID +     +P T   L
Sbjct  577   FLYVFNPIFGKRSQVAPPVLKRPVLQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKNVL  636

Query  1604  GIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
                +    +I++Y VDA    L G  +K++            T+  W VV P+E ++I+A
Sbjct  637   RQLEEIAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVVIPTEVQRIVA  686

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
                ++ NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLI
Sbjct  687   VKGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLI  739

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N    
Sbjct  740   DGVTGRIIHSSVQKKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYN----  795

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
                    +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LL+G     +
Sbjct  796   --ATAYSSLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGAI  847

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LE
Sbjct  848   LSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLE  907

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  908   STCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  939



>ref|XP_008122171.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1 [Anolis carolinensis]
Length=993

 Score =   334 bits (856),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 287/1009 (28%), Positives = 474/1009 (47%), Gaps = 118/1009 (12%)
 Frame = -2

Query  3440  LLVLIFSSAYTTF-----SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEEN  3276
             L    FSS +  F     ++YEDQVG  DW Q+Y+GK++ A   + + G K+++V+TE+N
Sbjct  6     LRACFFSSFFVAFLLPTSAVYEDQVGKFDWRQQYVGKLRFASLESSQ-GSKKLIVATEKN  64

Query  3275  VLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVW  3108
             V+A+L+ R GDI WRHV   K   +G +D  L  G+  IT+S+G   LR+W    G + W
Sbjct  65    VVAALNSRTGDILWRHV--DKGTPEGAVDAMLIHGQDAITVSNGGRILRSWETNIGGLNW  122

Query  3107  E-SFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI  2931
             E S  +GS  + +++ +   +K      + +   G L     ++G   W + L       
Sbjct  123   EISLDAGSFQTAALVGLQEAVKY-----VAVLKKGALSLHYLSNGHQKWVEALPESDFAQ  177

Query  2930  QHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEK  2757
                V   GT  V+ +G+   S       +   GE+ K   +  P     SG  S V    
Sbjct  178   YQAVCSHGTGSVHVLGVAPRSHLNVITFSIEDGEITKQVQVPAPWLSSLSGTCSAVGEAV  237

Query  2756  VVALDSTGSILVSI-IFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKF  2586
             VV +D+  + L  + +  +G ++   V +  L  +F       LLPS+     A   ++ 
Sbjct  238   VVCVDAAANALHFLPLGAEGEVDL--VPLQSLGLEFADGFQPSLLPSQPNPAGA---SRA  292

Query  2585  VLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAF----GLIKHGVGKI  2445
               FLR++          EG L ++      A+ + + +  +   A     G +K G  + 
Sbjct  293   QFFLRLSPSHLALLQYKEGVLSLLRDFPQAALATFATTSEKTVAAVLTCKGDVKAGHPEA  352

Query  2444  HLSVKS-------------------INDWGSNLLEESSAIDSQKG--LVHKVFINNYIRT  2328
               SV+                    + + G  LL+ +     +K      +++I  +++ 
Sbjct  353   STSVRETPTQEPLTCFNQSYAVNLYLAETGQRLLDTTIGFTLEKSSSRPEQLYIQVFLKK  412

Query  2327  DRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVS  2172
             D S G+RAL+  EDH LL LQQ G+I+WSRE+ LA +V +   +LP+       E +   
Sbjct  413   DDSVGYRALVQTEDHMLLFLQQPGKILWSREESLAEVVSLEMVDLPLTGAQAELEGEFGK  472

Query  2171  VSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGF  2010
              + ++  L       L      L   T          R   S          + RD    
Sbjct  473   KAAIQDGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEVNIDNLARDEFNL  532

Query  2009  RKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDEN  1830
             +K+++V++ SGKL+ + +  G I+W   +  ++   + E      +   +   H      
Sbjct  533   QKMIVVVTASGKLFGIESSSGTILWKQFLPDVKPGSSFE------LMVQRTTAHFPHPPQ  586

Query  1829  PSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHL  1659
              ++LV  K  GL+S     L   +   GK  ++  P     + Q + LP  D    ++ L
Sbjct  587   CTLLVKDKESGLSS-----LFVFNPIXGKWSQVAPPALPRPVLQSLLLPIMDQDYAKVLL  641

Query  1658  LIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFAT  1479
             LID +    ++P T   L   +    ++ +Y  DA    +G  +     KD+       T
Sbjct  642   LIDDEYKVTVFPATRNVLRQLEEMAPSVSFYLADAE---KGKLMGRRLRKDL------TT  692

Query  1478  KYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAG  1299
             +  W +  P + ++I+    +K NE VH+Q +V  DR V+YK ++ N+L V T +  +  
Sbjct  693   EETWEISIPPDLQRIVTVKGKKSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESADSHQ  752

Query  1298  DIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEM  1119
             +        +++ +YLID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E 
Sbjct  753   E-------RTFIGIYLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNAKARRNEF  805

Query  1118  SVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTA  939
             +V+E+Y+ +   N           +L +P    L P+VL   QSY F  ++  + VT T 
Sbjct  806   TVLELYEGTEQHNATAFS------SLDRP----LLPQVL--QQSYIFPSAICAMEVTITE  853

Query  938   KGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHA  759
             +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ + 
Sbjct  854   RGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQTREENLIPYSPDVQIHAERFINYN  913

Query  758   VKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
                  +RGI T P+ LEST LV AYG+DL+ T++ PSK +D L DD+ Y
Sbjct  914   QTISRMRGIYTAPSGLESTCLVVAYGLDLYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_009897796.1| PREDICTED: ER membrane protein complex subunit 1, partial [Picoides 
pubescens]
Length=982

 Score =   333 bits (855),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 281/991 (28%), Positives = 470/991 (47%), Gaps = 115/991 (12%)
 Frame = -2

Query  3398  LYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLG  3219
             +YEDQVG  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV  
Sbjct  14    VYEDQVGKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--  70

Query  3218  HKDVIDGIDIAL---GKYVITLS-SGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSN  3051
              K   +G+  A+   G+  IT+S +G  LR+W    G + WE+ L   S   + L+   +
Sbjct  71    DKGTPEGVIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVAGLVGLQD  130

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
               V +   +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+   
Sbjct  131   --VVKYVAVLKKAAISLHYLS--NGHQKWVEHLPESEATQYQMLYSHGTGVIHVLGVVPQ  186

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDG  2700
             S       +   GE+ +   +  P      G   +V    +V +D  T S+ V  +  + 
Sbjct  187   SHLTILTFSVEDGEVTRQVRVAAPWLKSLDGLCGVVGEAVLVCVDMDTQSLYVCSLETEQ  246

Query  2699  LINFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------  2577
                 +Q+ +  L  +F          T   V+  S+    + +  + F L          
Sbjct  247   --EMKQIPLQSLDLEFADDFQPRILATQPNVIGASRTQFFLQLSPSHFSLLQYKQGLLSH  304

Query  2576  LRVTYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS---  2427
             LR   +  L       +    AV++    L    +EG  A G ++    +  L+  +   
Sbjct  305   LRDFEQAALVSFATTGEKTVAAVLTCRSELKPGSAEGLHAGGSLEEARKQDSLTCSNQTY  364

Query  2426  -IN----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLL  2268
              IN    + G  LL+ +      Q G    +++I  +++ D S G+RAL+  EDH L+ L
Sbjct  365   NINLYLVETGQRLLDTTITFTLEQSGTKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFL  424

Query  2267  QQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgt  2106
             QQ G++VWSRE+ LA +V +   +LP+     E +G    K    L       L      
Sbjct  425   QQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEG-EFGKKADGLLGMFLKRLSSQLIL  483

Query  2105  lmLATP-------DDVAAIQQMRLKSSGKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDG  1947
             L   T        D      Q+R        + RD    +K++++++ SGKL+ + +  G
Sbjct  484   LQAWTAHLWKMFYDARKPRSQIR-NEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSG  542

Query  1946  RIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSF  1767
              I+W   +  +R   +       K+   +   H       ++LV        D  + +SF
Sbjct  543   TILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSF  589

Query  1766  VDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
             +  +    GK  ++  PV    + Q + LP  D    ++ LLID +     +P T   L 
Sbjct  590   LYVFNPIFGKRSQVAPPVLKRPVLQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKNVLR  649

Query  1601  IFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIAT  1425
               +    +I++Y VDA    L G  +K++            T+  W VV P+E ++I+A 
Sbjct  650   QLEEIAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVVIPTEVQRIVAV  699

Query  1424  ATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLID  1245
               ++ NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID
Sbjct  700   KGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLID  752

Query  1244  TVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLK  1065
              VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N     
Sbjct  753   GVTGRIIHSSVQKKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYN-----  807

Query  1064  LVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVL  885
                   +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LL+G     +L
Sbjct  808   -ATAYSSLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGAIL  860

Query  884   ALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLES  705
             +L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LES
Sbjct  861   SLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLES  920

Query  704   TTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             T LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  921   TCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  951



>ref|XP_010410820.1| PREDICTED: ER membrane protein complex subunit 1, partial [Corvus 
cornix cornix]
Length=941

 Score =   332 bits (851),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 271/964 (28%), Positives = 457/964 (47%), Gaps = 100/964 (10%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDI  3189
              Q+Y+GK+K A     + G K++VV+TEENV+A+L+ R G+I WRHV   K   +G ID 
Sbjct  1     RQQYVGKLKFASLEASQ-GSKKLVVATEENVVAALNSRSGEILWRHV--DKGTPEGAIDA  57

Query  3188  AL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLIL  3021
              L  G+  IT+S +G  LR+W    G + WE+ L +GS    +++ +P  +K      +L
Sbjct  58    MLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQGAALVGLPEAVKY---VAVL  114

Query  3020  IYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINA  2841
               ++  LH +S  +G   W + L         +++  GT  +  VG+   S       N 
Sbjct  115   KKAALSLHYLS--NGHQKWVEHLPESESTQYQLLYSRGTGVIQVVGIVPQSHLNVLMFNV  172

Query  2840  RKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIAD  2667
               GE+ K   +  P      G   +V  E V+    T +  + +   D   + + + +  
Sbjct  173   EDGEITKQVRVAAPWLRALEGSCGVV-GEAVLVCADTAARSLHVCALDTEQDMRHIPLQS  231

Query  2666  LV----QDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTY-------EGKLEVVDKVAYGA  2520
             L      DF    +     +TG       +F L L  ++       +G L  +      A
Sbjct  232   LELEFEDDFQARILATQPSVTGASR---TQFFLQLSPSHFSLLQYKQGLLSHLRDFQQAA  288

Query  2519  VISESLSLSEGHQAFGLIKHGVGKIHLSVKSIN------DWGSNLLEESSAIDSQKGLV-  2361
             ++S + +  +   A    +  +  +  S ++ N      + G  LL+ +   + ++G   
Sbjct  289   LVSFATTGEKTVAAVLTCRSELDSLTCSNQTYNINLYLVETGQRLLDTTITFNLEQGGAK  348

Query  2360  -HKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVTTSELPV-  2190
               +++I  +++ D S G+RAL+  EDH L+ LQQ G++VWSRE+ LA +V +   +LP+ 
Sbjct  349   PQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVVWSREESLAEVVSLEMVDLPLT  408

Query  2189  ------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------  2046
                   E +    + ++  L       L      L   T          R   S      
Sbjct  409   GAQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEI  468

Query  2045  GKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQ  1866
                 + RD    +K++++++ SGKL+ + +  G I+W   +  +R   +       K+  
Sbjct  469   NIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLRNVRPGSS------FKLMV  522

Query  1865  WQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---GKELKILKPV--HSIAQVI  1701
              +   H       ++LV        D  + +SF+  +    GK  ++  PV    I Q +
Sbjct  523   QRTTAHFPHPPQCTLLV-------KDKETRMSFLYVFNPIFGKRSQVAPPVLKRPILQTL  575

Query  1700  PLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVK  1524
              LP  D    ++ LLID +     +P T   L   +    +IY+Y VDA    L G  +K
Sbjct  576   LLPIMDQDYAKVLLLIDDEYKVTPFPATKNVLRQLEEIAHSIYFYLVDAEQGKLSGFRLK  635

Query  1523  ENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYIS  1344
             ++           +T+  W V  P+E ++I+    ++ NE VH+Q +V  DR V+YK ++
Sbjct  636   KD----------LSTEESWEVAIPTEVQRIVMVKGKRSNEHVHSQGRVMGDRSVLYKSLN  685

Query  1343  KNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENW  1164
              N+L V T +     +        +++ +YL+D VTGRI+H    + ++GPVH V SENW
Sbjct  686   PNLLAVVTESTDTHHE-------RTFIGIYLMDGVTGRIIHSSVQKKAKGPVHMVHSENW  738

Query  1163  VVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSY  984
             VVY Y+N +A R E +V+E+Y+ +   N           +L +P+     P+VL   QSY
Sbjct  739   VVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPI----LPQVL--QQSY  786

Query  983   FFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPL  804
              F  ++  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP 
Sbjct  787   IFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPY  846

Query  803   TDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTD  624
             +  + I  + ++ +      +RGI T P+ LEST LV AYG+D+F T++ PSK +D L D
Sbjct  847   SPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGLDIFQTRVYPSKQFDVLKD  906

Query  623   DFSY  612
             D+ Y
Sbjct  907   DYDY  910



>ref|XP_005229729.1| PREDICTED: ER membrane protein complex subunit 1, partial [Falco 
peregrinus]
Length=961

 Score =   332 bits (852),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 281/986 (28%), Positives = 475/986 (48%), Gaps = 113/986 (11%)
 Frame = -2

Query  3386  QVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDV  3207
             QVG  DW Q+Y+GK+K A     + G K+V+V+TE+NV+A+L+ R G+I WRHV   K  
Sbjct  1     QVGKFDWRQQYVGKLKFASLEASQ-GAKKVIVATEKNVVAALNSRSGEILWRHV--DKGT  57

Query  3206  IDG-IDIAL--GKYVITLSS-GSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKV  3042
              +G ID  L  G+  IT+SS G  LR+W    G + WE+ L +GS    S++ +   +K 
Sbjct  58    PEGAIDAMLIHGQDAITVSSAGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQDTVKY  117

Query  3041  DRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQF  2862
                  +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+   S  
Sbjct  118   ---VAVLKKAAISLHYLS--NGHQKWVEYLPESESTQYQLLYSHGTGVIHVLGIVPQSHV  172

Query  2861  VAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLIN  2691
                  +   GE+ K   +  P     +G  S+V    +V +D  T S+ V  +  +    
Sbjct  173   NILTFSVEDGEITKQSRVAAPWLKSLNGVCSVVGEAVLVCMDMDTHSLYVCSLGMEQ--E  230

Query  2690  FQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRV  2568
              +Q+ +  L  +F          T  +V+  S+    + +  + F L          LR 
Sbjct  231   MKQIPLQSLDLEFADGFQPRILATQPSVISASRTQFFLQLSPSHFSLLQYKHGLLSHLRD  290

Query  2567  TYEGKL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----IN  2421
               +  L       +    AV++    L    S+G  A   ++    +  L+  +    IN
Sbjct  291   FQQAALVSFATTGEKTVAAVLTCRSELKPGSSDGLHAGSTLESSRKQESLTCSNQTYNIN  350

Query  2420  ----DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-  2262
                 + G  LL+ +   +  +G     ++++  +++ D S G+RAL+  EDH L+ LQQ 
Sbjct  351   LYLVETGQRLLDTTITFNLDQGGAKPQQLYVQVFLKKDDSVGYRALVQTEDHMLMFLQQP  410

Query  2261  GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmL  2097
             G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L      
Sbjct  411   GKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAW  470

Query  2096  ATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWS  1932
                         + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W 
Sbjct  471   TAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWK  530

Query  1931  FLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT  1752
               +  +R   +       K+   +   H       ++LV        D  + +SF+  + 
Sbjct  531   QYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFN  577

Query  1751  ---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRE  1587
                GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +  
Sbjct  578   PIFGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEI  637

Query  1586  LGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKL  1410
               +I++Y VDA    L G  +K++            T+  W V+ P+E ++I+    ++ 
Sbjct  638   AHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVIIPTEVQRIVTVKGKRS  687

Query  1409  NEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGR  1230
             NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTGR
Sbjct  688   NEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGR  740

Query  1229  ILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGK  1050
             I+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N          
Sbjct  741   IIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS-----  795

Query  1049  HNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKR  870
              +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K 
Sbjct  796   -SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKA  848

Query  869   FLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVF  690
              LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV 
Sbjct  849   LLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVV  908

Query  689   AYGVDLFFTQLAPSKTYDSLTDDFSY  612
             AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   AYGLDIYQTRVYPSKQFDVLKDDYDY  934



>ref|XP_002943252.2| PREDICTED: ER membrane protein complex subunit 1 [Xenopus (Silurana) 
tropicalis]
Length=990

 Score =   332 bits (852),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 276/1007 (27%), Positives = 470/1007 (47%), Gaps = 112/1007 (11%)
 Frame = -2

Query  3449  AFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVL  3270
             A   + L+ +S   + ++YEDQVG  DW Q+++G++K A   +   G K+++ +T++N++
Sbjct  4     ALCWVSLLVASLALSGAVYEDQVGKFDWRQQFVGRIKFASLES-GLGAKKLIAATDKNII  62

Query  3269  ASLDLRHGDIFWRHVLGHKDVIDG-ID--IALGKYVITLSSGSTLRAWNLPDGQMVWESF  3099
             A+L+ R GD+ WRHV   KD  +G +D  + LG+  IT+S G  LR+W    G + WE+ 
Sbjct  63    AALNSRTGDLLWRHV--DKDTSEGSVDALMMLGQDAITVSGGRLLRSWETNIGALNWEAS  120

Query  3098  LSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIV  2919
             L   S  +++    S   + R   +L  S   LH +S  +G + W + L         ++
Sbjct  121   LEPGS-FQAVSFAGSQ-DMARYVAVLKNSVLSLHFLS--NGHLKWSESLPESDTVQYQLL  176

Query  2918  HPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--------GGFSGDISLVTS  2763
             H      VY VGL   S       +   G +     ++ P         G  G+  LV  
Sbjct  177   HSPYKGSVYVVGLVPQSHLTILTFSVEDGSISHQVRVLTPWLRTLHGTCGVVGEGVLVCG  236

Query  2762  EKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFV  2583
             ++ +A     S+L     +    + Q + I +L +D T   V+   +    +   + +F 
Sbjct  237   DEPMASVHVVSLLSG--EETTRHSLQSLGI-ELAEDLTQLDVITAPQ--NAIGASLPQFF  291

Query  2582  L------FLRVTYE----------GKLEVVDKVAYG--AVISESLSLSEGHQAFGLIKHG  2457
             L      FL + Y            ++ +V+    G   V++     SEG+Q  G     
Sbjct  292   LQIAPRRFLLMQYRDGVITPLRDFSQVSLVNFAVAGEKTVVAVMQCKSEGNQKSGAEPEN  351

Query  2456  VGKIHLSVK---------SIN----DWGSNLLEESSAIDSQKGLVH--KVFINNYIRTDR  2322
                   + +         SIN    D G  LLE + +    +  V     ++  ++R D 
Sbjct  352   PTGQSCAQEPWYCPGHTYSINLYMADSGRRLLETTMSFTLDQSCVRPDSFYLQTFLRKDD  411

Query  2321  SYGFRALIVLEDHSLLLLQQ-GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVS  2166
             S G+RAL+  ED+ LL LQQ G+++W RE+ LA +V +   +LP+       E +    +
Sbjct  412   SVGYRALVQTEDNQLLFLQQPGKLIWLREESLADVVTMEMVDLPLTGAQAELEGEFGKKA  471

Query  2165  KVEQNLFEWlkghllklkgtlmLATP-------DDVAAIQQMRLKSSGKSKMTRDHNGFR  2007
              ++  L   +   L      L   +        D      Q+R        + RD    +
Sbjct  472   AIQDGLLGMVLKRLSSQLILLQSWSAHLWKMFCDARKPRSQIR-NEVNVDTLARDDFNLQ  530

Query  2006  KLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENP  1827
             K++++++ SGKL+ + +  G I+W F +  +    +       K+   +   H       
Sbjct  531   KMMVMVTASGKLFGIESSSGSILWKFYLQGVHPGSS------FKLLVQRTTAHFPHPPQC  584

Query  1826  SVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLI  1653
             ++LV  K        S +   +   GK  ++  P     I Q + LP  D+   ++ LL+
Sbjct  585   TLLVKDKI----TEKSAMYVFNPIFGKLSQLAPPPLNRPILQSLLLPIMDNDYAKVLLLL  640

Query  1652  DTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKY  1473
             D       +P T   L   +     I++Y VDA    +G        KD+      +T+ 
Sbjct  641   DDQHKVIAFPATKYVLQQLQELAPTIFFYLVDAE---KGKMTGLRLHKDL------STEE  691

Query  1472  VWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDI  1293
             +W V+ P++ ++I     ++ NE VH+Q +V  DR V+YKY++ N+L + T +       
Sbjct  692   IWEVLLPADLQRITVIKGKRSNEHVHSQGRVMGDRSVLYKYLNPNLLALVTESTDTH---  748

Query  1292  GSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSV  1113
                 P+  ++ +YLID VTGRI+H    + ++GPV  V SENWVVY Y+N +A R E++V
Sbjct  749   ----PERCFIGIYLIDGVTGRIIHSSVQRRARGPVEIVHSENWVVYQYWNSKARRNELTV  804

Query  1112  IEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKG  933
             +E+Y+ +   N           +L +P    L P VL   QSY F  +++ +  T T +G
Sbjct  805   LELYEGTEQYNSTNFS------SLDRP----LLPHVL--QQSYIFPSAIRAMEATITERG  852

Query  932   ITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVK  753
             ITS+ +LIG     +L+L K  LDPRR   P +  +E+ +IP T  + I  + ++ +   
Sbjct  853   ITSRHVLIGLPSGAILSLPKALLDPRRPEIPNEYTREENLIPYTPDIQIHAERFINYNQT  912

Query  752   AEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
                +RG+ T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  913   ISRMRGLYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  959



>ref|XP_009447861.1| PREDICTED: ER membrane protein complex subunit 1 isoform X5 [Pan 
troglodytes]
Length=975

 Score =   332 bits (850),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 287/992 (29%), Positives = 479/992 (48%), Gaps = 96/992 (10%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL--SVK  2430
             +H++     L   + G L ++      A++S + +  +   A    ++ V  +       
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVDSLACFNQTY  352

Query  2429  SIN----DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLL  2268
             +IN    + G  LL+ +   +++       +++I  +++ D S G+RAL+  EDH LL L
Sbjct  353   TINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFL  412

Query  2267  QQ--GEIV-WSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllk  2118
             QQ  G++V WSRE+ LA +V +   +LP+       E +    + ++  L       L  
Sbjct  413   QQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSS  472

Query  2117  lkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHT  1956
                 L   T          R   S          + RD    +K++++++ SGKL+ + +
Sbjct  473   QLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIES  532

Query  1955  GDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAP  1782
               G I+W  +L N    S         K+   +   H       ++LV  K  G++S   
Sbjct  533   SSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS---  582

Query  1781  SVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
               L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   
Sbjct  583   --LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNV  640

Query  1607  LGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
             L        +I++Y VDA    +G        KD+       T+  W +  P E ++I+ 
Sbjct  641   LRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIVK  691

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
                ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A  +        +++ ++LI
Sbjct  692   VKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE-------RTFIGIFLI  744

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N    
Sbjct  745   DGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAF  804

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
                    +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     +
Sbjct  805   S------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAI  852

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LE
Sbjct  853   LSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLE  912

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  913   STCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  944



>ref|XP_008965353.1| PREDICTED: ER membrane protein complex subunit 1 isoform X8 [Pan 
paniscus]
Length=975

 Score =   332 bits (850),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 287/992 (29%), Positives = 479/992 (48%), Gaps = 96/992 (10%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL--SVK  2430
             +H++     L   + G L ++      A++S + +  +   A    ++ V  +       
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVDSLACFNQTY  352

Query  2429  SIN----DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLL  2268
             +IN    + G  LL+ +   +++       +++I  +++ D S G+RAL+  EDH LL L
Sbjct  353   TINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFL  412

Query  2267  QQ--GEIV-WSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllk  2118
             QQ  G++V WSRE+ LA +V +   +LP+       E +    + ++  L       L  
Sbjct  413   QQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSS  472

Query  2117  lkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHT  1956
                 L   T          R   S          + RD    +K++++++ SGKL+ + +
Sbjct  473   QLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIES  532

Query  1955  GDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAP  1782
               G I+W  +L N    S         K+   +   H       ++LV  K  G++S   
Sbjct  533   SSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS---  582

Query  1781  SVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
               L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   
Sbjct  583   --LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNV  640

Query  1607  LGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
             L        +I++Y VDA    +G        KD+       T+  W +  P E ++I+ 
Sbjct  641   LRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIVK  691

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
                ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A  +        +++ ++LI
Sbjct  692   VKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE-------RTFIGIFLI  744

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N    
Sbjct  745   DGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAF  804

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
                    +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     +
Sbjct  805   S------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAI  852

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LE
Sbjct  853   LSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLE  912

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  913   STCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  944



>ref|XP_004850477.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Heterocephalus 
glaber]
Length=991

 Score =   332 bits (850),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 285/1017 (28%), Positives = 489/1017 (48%), Gaps = 124/1017 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGGCGLVA  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHIN  2592
                +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  +
Sbjct  232   EAVLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         ++G L ++      A++S +   + G +    +     ++  
Sbjct  288   RPQFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKP  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
             S  S + +  N +E+SSA DS                                      +
Sbjct  345   S-SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPER  403

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV---  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ G++V WSRE+ LA +V +   +LP+   
Sbjct  404   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGA  463

Query  2189  --EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----M  2031
               E +G    K +  L  +LK    +L       +          + +S  K++     +
Sbjct  464   QAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTL  523

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPH  1851
              RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   
Sbjct  524   ARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTA  577

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  578   HFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVMDQ  632

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDV  1503
                ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++     
Sbjct  633   DYAKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD-----  687

Query  1502  GDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVA  1323
                    T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V 
Sbjct  688   -----LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVV  742

Query  1322  TVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFN  1143
             T +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N
Sbjct  743   TESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWN  795

Query  1142  LRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVK  963
              +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+ 
Sbjct  796   TKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSIS  843

Query  962   TIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPII  783
              +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I 
Sbjct  844   AMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIH  903

Query  782   PQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  904   AERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  960



>ref|XP_004850476.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Heterocephalus 
glaber]
Length=992

 Score =   331 bits (849),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 285/1018 (28%), Positives = 489/1018 (48%), Gaps = 125/1018 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGGCGLVA  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHIN  2592
                +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  +
Sbjct  232   EAVLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         ++G L ++      A++S +   + G +    +     ++  
Sbjct  288   RPQFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKP  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
             S  S + +  N +E+SSA DS                                      +
Sbjct  345   S-SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPER  403

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV--  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ  G++V WSRE+ LA +V +   +LP+  
Sbjct  404   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTG  463

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----  2034
                E +G    K +  L  +LK    +L       +          + +S  K++     
Sbjct  464   AQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDT  523

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVP  1854
             + RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +  
Sbjct  524   LARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTT  577

Query  1853  HHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTD  1683
              H       ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D
Sbjct  578   AHFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVMD  632

Query  1682  STEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKD  1506
                 ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++    
Sbjct  633   QDYAKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD----  688

Query  1505  VGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFV  1326
                     T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V
Sbjct  689   ------LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAV  742

Query  1325  ATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYF  1146
              T +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+
Sbjct  743   VTESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYW  795

Query  1145  NLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSV  966
             N +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+
Sbjct  796   NTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSI  843

Query  965   KTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPI  786
               +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I
Sbjct  844   SAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQI  903

Query  785   IPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
               + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  904   HAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>gb|KFQ95684.1| ER membrane protein complex subunit 1, partial [Nipponia nippon]
Length=959

 Score =   330 bits (847),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 287/987 (29%), Positives = 476/987 (48%), Gaps = 117/987 (12%)
 Frame = -2

Query  3383  VGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVI  3204
             VG  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   
Sbjct  1     VGKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTP  57

Query  3203  DG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  3036
             +G ID  L  G+  IT+S +G  LR+W    G + WE+ L   S   + L+   ++   +
Sbjct  58    EGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVARLVGLQDMV--K  115

Query  3035  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  2856
                +L  ++  LH +S  +G   W + L         +++  GT  ++ VG+   S    
Sbjct  116   YVAVLKKAAISLHYLS--NGHQKWVEHLPESETTQYQLLYSHGTGVIHVVGIVPQSHLNV  173

Query  2855  YKINARKGELLKHESMVFPGGFS-GDISLVTSEKV-VALD-STGSILVSIIFKDGLINFQ  2685
                +   GE+ K   +  P   S  D+  V  E V V +D  T S+ V  +  +     +
Sbjct  174   LTFSVEDGEITKQIRVAAPWLKSLNDVCSVVGEAVLVCVDMDTHSLYVCSLETEQ--EMK  231

Query  2684  QVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTY  2562
             Q+ +  L  +F          T  +V+  S+    + +  + F L          LR  +
Sbjct  232   QIPLQSLDLEFADGFQPRILATQPSVISASRTQFFLQLSPSHFSLLQYKHGLLSHLRDFH  291

Query  2561  EGKL---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVK-----------SI  2424
             +  L       +    AV++    L  G  + GL  HG G +  S K           +I
Sbjct  292   QAALVSFATTGEKTVAAVLACRSELKPG-SSDGL--HGGGTLEDSRKQESLTCSNQTYNI  348

Query  2423  N----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ  2262
             N    + G  LL+ +   +  Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ
Sbjct  349   NLYLVETGQRLLDTTITFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQ  408

Query  2261  -GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlm  2100
              G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L     
Sbjct  409   PGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQA  468

Query  2099  LATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW  1935
                          + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W
Sbjct  469   WTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILW  528

Query  1934  SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSY  1755
                +  +R   +       K+   +   H       ++LV        D  + +SF+  +
Sbjct  529   KQYLGNVRLGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVF  575

Query  1754  T---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKR  1590
                 GK  +++ PV   SI Q + LP  D    ++ LLID +     +P T   L   + 
Sbjct  576   NPIFGKRSQVVPPVLKRSILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEE  635

Query  1589  ELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRK  1413
                +I++Y VDA    L G  +K++            T+  W VV P+E ++I+    ++
Sbjct  636   IAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVVIPTEVQRIVTVKGKR  685

Query  1412  LNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTG  1233
              NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTG
Sbjct  686   SNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTG  738

Query  1232  RILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLG  1053
             RI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N         
Sbjct  739   RIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS----  794

Query  1052  KHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDK  873
               +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K
Sbjct  795   --SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPK  846

Query  872   RFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLV  693
               LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV
Sbjct  847   ALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLV  906

Query  692   FAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              AYG+D++ T++ PSK +D L DD+ Y
Sbjct  907   VAYGLDIYQTRVYPSKQFDVLKDDYDY  933



>ref|XP_009461713.1| PREDICTED: ER membrane protein complex subunit 1, partial [Nipponia 
nippon]
Length=976

 Score =   331 bits (848),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 287/987 (29%), Positives = 476/987 (48%), Gaps = 117/987 (12%)
 Frame = -2

Query  3383  VGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVI  3204
             VG  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   
Sbjct  1     VGKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTP  57

Query  3203  DG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFLSGSSPSRSILLVPSNLKVDR  3036
             +G ID  L  G+  IT+S +G  LR+W    G + WE+ L   S   + L+   ++   +
Sbjct  58    EGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVARLVGLQDMV--K  115

Query  3035  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  2856
                +L  ++  LH +S  +G   W + L         +++  GT  ++ VG+   S    
Sbjct  116   YVAVLKKAAISLHYLS--NGHQKWVEHLPESETTQYQLLYSHGTGVIHVVGIVPQSHLNV  173

Query  2855  YKINARKGELLKHESMVFPGGFS-GDISLVTSEKV-VALD-STGSILVSIIFKDGLINFQ  2685
                +   GE+ K   +  P   S  D+  V  E V V +D  T S+ V  +  +     +
Sbjct  174   LTFSVEDGEITKQIRVAAPWLKSLNDVCSVVGEAVLVCVDMDTHSLYVCSLETEQ--EMK  231

Query  2684  QVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTY  2562
             Q+ +  L  +F          T  +V+  S+    + +  + F L          LR  +
Sbjct  232   QIPLQSLDLEFADGFQPRILATQPSVISASRTQFFLQLSPSHFSLLQYKHGLLSHLRDFH  291

Query  2561  EGKL---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVK-----------SI  2424
             +  L       +    AV++    L  G  + GL  HG G +  S K           +I
Sbjct  292   QAALVSFATTGEKTVAAVLACRSELKPG-SSDGL--HGGGTLEDSRKQESLTCSNQTYNI  348

Query  2423  N----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ  2262
             N    + G  LL+ +   +  Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ
Sbjct  349   NLYLVETGQRLLDTTITFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQ  408

Query  2261  -GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlm  2100
              G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L     
Sbjct  409   PGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQA  468

Query  2099  LATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW  1935
                          + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W
Sbjct  469   WTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILW  528

Query  1934  SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSY  1755
                +  +R   +       K+   +   H       ++LV        D  + +SF+  +
Sbjct  529   KQYLGNVRLGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVF  575

Query  1754  T---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKR  1590
                 GK  +++ PV   SI Q + LP  D    ++ LLID +     +P T   L   + 
Sbjct  576   NPIFGKRSQVVPPVLKRSILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEE  635

Query  1589  ELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRK  1413
                +I++Y VDA    L G  +K++            T+  W VV P+E ++I+    ++
Sbjct  636   IAHSIFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVVIPTEVQRIVTVKGKR  685

Query  1412  LNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTG  1233
              NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTG
Sbjct  686   SNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTG  738

Query  1232  RILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLG  1053
             RI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N         
Sbjct  739   RIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS----  794

Query  1052  KHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDK  873
               +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K
Sbjct  795   --SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPK  846

Query  872   RFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLV  693
               LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV
Sbjct  847   ALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLV  906

Query  692   FAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              AYG+D++ T++ PSK +D L DD+ Y
Sbjct  907   VAYGLDIYQTRVYPSKQFDVLKDDYDY  933



>ref|XP_006766714.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Myotis 
davidii]
Length=975

 Score =   331 bits (848),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 283/997 (28%), Positives = 483/997 (48%), Gaps = 100/997 (10%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A+A R +L   L+  +A    ++YEDQVG  DW Q+YIGK+K A       G K++VV+
Sbjct  3     AAVACRFWLWAALLIPAA----AVYEDQVGKFDWRQQYIGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R GDI WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGDILWRHV--DKGTAEGAVDAMLLYGQDAVTVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHQLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKL-TGMVAIHIN  2592
                 +V  D +   L ++  +      +++ +  L  D   A+   P  L T    +  +
Sbjct  231   DEAVLVCPDPSSRSLQTLALETEW-ELREIPLQSL--DLEYASGFQPRVLSTQPNPVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         + G L ++  +   A++S + +  +   A    ++    +  
Sbjct  288   RAQFFLQLSPSHYALLHYHHGVLSLLKNLPQTALVSFATTGEKTVAAVMTCRNEADTLAC  347

Query  2438  --SVKSIN----DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDH  2283
                  +IN    + G  LL+ +   +++       +++I  +++ D S G+RAL+  EDH
Sbjct  348   FNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERLYIQVFLKKDDSVGYRALVQTEDH  407

Query  2282  SLLLLQQ---GEIVWSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlk  2133
              LL LQQ     ++WSRE+ LA +V +   +LP+       E +    + ++  L     
Sbjct  408   LLLFLQQLAGKAVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFL  467

Query  2132  ghllklkgtlmLATPDDVAAIQQMRL-KSSGKSKMT-----RDHNGFRKLLIVLSRSGKL  1971
               L      L   T          R  +S  K++++     RD    +K+++ ++ SGKL
Sbjct  468   KRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEISIDTLARDEFNLQKMVVTVTASGKL  527

Query  1970  YALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGL  1797
             + + +  G I+W  +L N    S         K+   +   H       ++LV  K  G+
Sbjct  528   FGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKETGM  580

Query  1796  NSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYP  1623
             +S     L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P
Sbjct  581   SS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDYAKVLLLIDDEYKVTAFP  635

Query  1622  RTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSES  1443
              T   L        +I++Y VDA    +G        KD+       T+  W +  P E 
Sbjct  636   ATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEV  686

Query  1442  EQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWL  1263
             ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++
Sbjct  687   QRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFI  739

Query  1262  IVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRAD  1083
              ++L+D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E++V+E+Y+ +   
Sbjct  740   GIFLVDGVTGRIVHSSVQRKAKGPVHIVHSENWVVYQYWNTKARRNELTVLELYEGTEQY  799

Query  1082  NKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGT  903
             N           +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG 
Sbjct  800   NATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGL  847

Query  902   IGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTV  723
                 +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T 
Sbjct  848   PSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTA  907

Query  722   PAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  908   PSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  944



>ref|XP_008965351.1| PREDICTED: ER membrane protein complex subunit 1 isoform X6 [Pan 
paniscus]
Length=992

 Score =   331 bits (848),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 292/1012 (29%), Positives = 487/1012 (48%), Gaps = 119/1012 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    + LE+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  469

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L       +          + +S  K++     + RD  
Sbjct  470   GEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEF  529

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  530   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  582

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  583   PPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAK  637

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  638   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-----  689

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  
Sbjct  690   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTD  748

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  749   AHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR  801

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  802   NEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  849

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  850   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  909

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>gb|KFO59600.1| ER membrane protein complex subunit 1, partial [Corvus brachyrhynchos]
Length=948

 Score =   330 bits (845),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 284/983 (29%), Positives = 473/983 (48%), Gaps = 121/983 (12%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDI  3189
              Q+Y+GK+K A     + G K++VV+TEENV+A+L+ R G+I WRHV   K   +G ID 
Sbjct  1     RQQYVGKLKFASLEASQ-GSKKLVVATEENVVAALNSRSGEILWRHV--DKGTPEGAIDA  57

Query  3188  AL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLIL  3021
              L  G+  IT+S +G  LR+W    G + WE+ L +GS    +++ +P  +K      +L
Sbjct  58    MLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQGAALVGLPEAVKY---VAVL  114

Query  3020  IYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINA  2841
               ++  LH +S  +G   W + L         +++  GT  ++ VG+   S       N 
Sbjct  115   KKAALSLHYLS--NGHQKWVEHLPESESTQYQLLYSRGTGVIHVVGIVPQSHLNVLMFNV  172

Query  2840  RKGELLKHESMVFP--------GGFSGDISLVTSEK------VVALDSTGSILVSIIFKD  2703
               GE+ K   +  P         G  G+  LV ++       V ALD T   +  I  + 
Sbjct  173   EDGEITKQVRVAAPWLRALEGSCGVVGEAVLVCADTAARSLHVCALD-TEQDMRHIPLQS  231

Query  2702  GLINFQ---QVHIADLVQDFTGAA------VLLPSKLT------GMVAIHINKFVLFLRV  2568
               + F+   Q  I       TGA+       L PS  +      G+++ H+  F     V
Sbjct  232   LELEFEDDFQARILATQPSVTGASRTQFFLQLSPSHFSLLQYKQGLLS-HLRDFQQAALV  290

Query  2567  TYEGKLEVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----IN---  2421
             ++        +    AV++    L    S+G  A   ++    +  L+  +    IN   
Sbjct  291   SFA----TTGEKTVAAVLTCRSELKPGSSDGLHAGSALEDARRQDSLTCSNQTYNINLYL  346

Query  2420  -DWGSNLLEESSAIDSQKGLV--HKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEI  2253
              + G  LL+ +   + ++G     +++I  +++ D S G+RAL+  EDH L+ LQQ G++
Sbjct  347   VETGQRLLDTTITFNLEQGGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKV  406

Query  2252  VWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATP  2088
             VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L         
Sbjct  407   VWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAH  466

Query  2087  DDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLV  1923
                      + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   +
Sbjct  467   LWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYL  526

Query  1922  NALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---  1752
               +R   +       K+   +   H       ++LV        D  + +SF+  +    
Sbjct  527   RNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETRMSFLYVFNPIF  573

Query  1751  GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGN  1578
             GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +    +
Sbjct  574   GKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTPFPATKNVLRQLEEIAHS  633

Query  1577  IYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEV  1401
             IY+Y VDA    L G  +K++           +T+  W V  P+E ++I+    ++ NE 
Sbjct  634   IYFYLVDAEQGKLSGFRLKKD----------LSTEESWEVAIPTEVQRIVMVKGKRSNEH  683

Query  1400  VHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILH  1221
             VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YL+D VTGRI+H
Sbjct  684   VHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLMDGVTGRIIH  736

Query  1220  RMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNL  1041
                 + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L
Sbjct  737   SSVQKKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SL  790

Query  1040  TKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLD  861
              +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K  LD
Sbjct  791   DRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKALLD  844

Query  860   PRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYG  681
             PRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG
Sbjct  845   PRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYG  904

Query  680   VDLFFTQLAPSKTYDSLTDDFSY  612
             +D+F T++ PSK +D L DD+ Y
Sbjct  905   LDIFQTRVYPSKQFDVLKDDYDY  927



>ref|XP_004850475.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Heterocephalus 
glaber]
Length=995

 Score =   330 bits (847),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 283/1021 (28%), Positives = 482/1021 (47%), Gaps = 128/1021 (13%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGGCGLVA  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHIN  2592
                +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  +
Sbjct  232   EAVLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         ++G L ++      A++S +   + G +    +     ++  
Sbjct  288   RPQFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKP  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
             S  S + +  N +E+SSA DS                                      +
Sbjct  345   S-SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPER  403

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV--  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ  G++V WSRE+ LA +V +   +LP+  
Sbjct  404   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTG  463

Query  2189  -----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------G  2043
                  E +    + ++  L       L      L   T          R   S       
Sbjct  464   AQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEIN  523

Query  2042  KSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQW  1863
                + RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   
Sbjct  524   IDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQ  577

Query  1862  QVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLP  1692
             +   H       ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP
Sbjct  578   RTTAHFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLP  632

Query  1691  YTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENY  1515
               D    ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++ 
Sbjct  633   VMDQDYAKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD-  691

Query  1514  FKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNM  1335
                        T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+
Sbjct  692   ---------LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNL  742

Query  1334  LFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVY  1155
             L V T +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY
Sbjct  743   LAVVTESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVY  795

Query  1154  HYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFA  975
              Y+N +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F 
Sbjct  796   QYWNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFP  843

Query  974   HSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDS  795
              S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  
Sbjct  844   SSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPD  903

Query  794   LPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  615
             + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ 
Sbjct  904   VQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYD  963

Query  614   Y  612
             Y
Sbjct  964   Y  964



>ref|XP_009232435.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Pongo 
abelii]
Length=972

 Score =   330 bits (846),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 279/969 (29%), Positives = 478/969 (49%), Gaps = 87/969 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+ VIT+S+G   +R+W    G + WE  L +GS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDTGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGILS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL--SVKSIN----DWGSNLLEES--  2391
             ++      A++S + +  +   A    ++ V  +       +IN    + G  LL+ +  
Sbjct  312   LLKNFPQTALVSFATTGEKTVAAVMACRNEVDSLACFNQTYTINLYLVETGRRLLDTTIT  371

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASI  2220
              +++       +++I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +
Sbjct  372   FSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEV  431

Query  2219  VDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL  2055
             V +   +LP+     E +G    K +  L  +LK    +L       +          + 
Sbjct  432   VCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKP  491

Query  2054  KSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCEN  1890
             +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   + +++   +   
Sbjct  492   RSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS---  548

Query  1889  PNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--H  1719
                 K+   +   H       ++LV  K  G++S     L   +   GK  ++  PV   
Sbjct  549   ---FKLMVQRTTAHFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKR  600

Query  1718  SIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILR  1539
              I Q + LP  D    ++ LLID +     +P T   L        +I++Y VDA    +
Sbjct  601   PILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---Q  657

Query  1538  GHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVM  1359
             G        KD+       T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+
Sbjct  658   GRLCGYRLRKDL------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVL  711

Query  1358  YKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAV  1179
             YK ++ N+L V T +  A  +        +++ ++LID VTGRI+H    + ++GPVH V
Sbjct  712   YKSLNPNLLAVVTESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIV  764

Query  1178  LSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLA  999
              SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P      P+VL 
Sbjct  765   HSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL-  813

Query  998   KSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKED  819
               QSY F  S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+
Sbjct  814   -QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREE  872

Query  818   GIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTY  639
              +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +
Sbjct  873   NLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQF  932

Query  638   DSLTDDFSY  612
             D L DD+ Y
Sbjct  933   DVLKDDYDY  941



>ref|XP_008965352.1| PREDICTED: ER membrane protein complex subunit 1 isoform X7 [Pan 
paniscus]
Length=991

 Score =   330 bits (846),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 294/1012 (29%), Positives = 486/1012 (48%), Gaps = 120/1012 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS  LE+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  468

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L       +          + +S  K++     + RD  
Sbjct  469   GEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEF  528

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  529   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  581

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  582   PPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAK  636

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  637   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-----  688

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  
Sbjct  689   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTD  747

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  748   AHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR  800

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  801   NEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  848

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  849   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  908

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  960



>ref|XP_003814479.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Pan 
paniscus]
Length=993

 Score =   330 bits (846),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 292/1013 (29%), Positives = 487/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    + LE+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_004903413.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Heterocephalus 
glaber]
Length=988

 Score =   330 bits (846),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 285/1015 (28%), Positives = 489/1015 (48%), Gaps = 123/1015 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                  +V+  G+  V+A+G+   S     K N   GE+++  S  +    +G   LV   
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVR-VSTPWLQRLTGGCGLVAEA  230

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKF  2586
              +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  ++ 
Sbjct  231   VLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPSRP  286

Query  2585  VLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSV  2433
               FL+++         ++G L ++      A++S +   + G +    +     ++  S 
Sbjct  287   QFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKPS-  342

Query  2432  KSINDWGSNLLEESSAIDSQKGL--------------------------------VHKVF  2349
              S + +  N +E+SSA DS                                      +++
Sbjct  343   SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPERLY  402

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----  2190
             I  +++ D S G+RAL+  +DH LL LQQ G++V WSRE+ LA +V +   +LP+     
Sbjct  403   IQVFLKKDDSVGYRALVQTQDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQA  462

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTR  2025
             E +G    K +  L  +LK    +L       +          + +S  K++     + R
Sbjct  463   ELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLAR  522

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             D    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   H 
Sbjct  523   DEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHF  576

Query  1844  AMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTE  1674
                   ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D   
Sbjct  577   PHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVMDQDY  631

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGD  1497
              ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++       
Sbjct  632   AKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD-------  684

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
                  T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T 
Sbjct  685   ---LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTE  741

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N +
Sbjct  742   STDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTK  794

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +
Sbjct  795   ARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAM  842

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
               T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  +
Sbjct  843   EATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAE  902

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  903   RFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  957



>ref|NP_001258357.1| ER membrane protein complex subunit 1 isoform 3 precursor [Homo 
sapiens]
Length=992

 Score =   330 bits (846),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 292/1012 (29%), Positives = 485/1012 (48%), Gaps = 119/1012 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKSSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  469

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L       +          + +S  K++     + RD  
Sbjct  470   GEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEF  529

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  530   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  582

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  583   PPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAK  637

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  638   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-----  689

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  
Sbjct  690   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTD  748

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  749   AHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR  801

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  802   NEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  849

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  850   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  909

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>emb|CAH56165.1| hypothetical protein [Homo sapiens]
Length=992

 Score =   330 bits (845),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 292/1012 (29%), Positives = 485/1012 (48%), Gaps = 119/1012 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDLSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKSSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAEPE  469

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L       +          + +S  K++     + RD  
Sbjct  470   GEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEF  529

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  530   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  582

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  583   PPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAK  637

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  638   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-----  689

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  
Sbjct  690   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTD  748

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
             A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  749   AHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR  801

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  802   NEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  849

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  850   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  909

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>emb|CAH56140.1| hypothetical protein [Homo sapiens]
Length=993

 Score =   330 bits (845),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 292/1013 (29%), Positives = 485/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRLWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKSSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_008965350.1| PREDICTED: ER membrane protein complex subunit 1 isoform X5 [Pan 
paniscus]
Length=992

 Score =   330 bits (845),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 294/1013 (29%), Positives = 486/1013 (48%), Gaps = 121/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS  LE+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  582   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  636

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  637   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  689

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  690   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  747

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  748   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|NP_055862.1| ER membrane protein complex subunit 1 isoform 1 precursor [Homo 
sapiens]
 sp|Q8N766.1|EMC1_HUMAN RecName: Full=ER membrane protein complex subunit 1; Flags: Precursor 
[Homo sapiens]
 gb|AAH34589.1| KIAA0090 [Homo sapiens]
 gb|EAW94872.1| KIAA0090, isoform CRA_c [Homo sapiens]
 gb|AIC50908.1| KIAA0090, partial [synthetic construct]
Length=993

 Score =   330 bits (845),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 292/1013 (29%), Positives = 485/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKSSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_004903412.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Heterocephalus 
glaber]
Length=989

 Score =   330 bits (845),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 285/1016 (28%), Positives = 489/1016 (48%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                  +V+  G+  V+A+G+   S     K N   GE+++  S  +    +G   LV   
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVR-VSTPWLQRLTGGCGLVAEA  230

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKF  2586
              +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  ++ 
Sbjct  231   VLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPSRP  286

Query  2585  VLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSV  2433
               FL+++         ++G L ++      A++S +   + G +    +     ++  S 
Sbjct  287   QFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKPS-  342

Query  2432  KSINDWGSNLLEESSAIDSQKGL--------------------------------VHKVF  2349
              S + +  N +E+SSA DS                                      +++
Sbjct  343   SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPERLY  402

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV----  2190
             I  +++ D S G+RAL+  +DH LL LQQ  G++V WSRE+ LA +V +   +LP+    
Sbjct  403   IQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQ  462

Query  2189  -EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MT  2028
              E +G    K +  L  +LK    +L       +          + +S  K++     + 
Sbjct  463   AELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  522

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   H
Sbjct  523   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAH  576

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  577   FPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVMDQD  631

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVG  1500
               ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++      
Sbjct  632   YAKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD------  685

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  686   ----LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  741

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  742   ESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  794

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  795   KARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  842

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  843   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  902

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  903   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  958



>ref|XP_008965349.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Pan 
paniscus]
Length=995

 Score =   329 bits (844),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 290/1015 (29%), Positives = 480/1015 (47%), Gaps = 122/1015 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    + LE+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-------E  2187
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+       E
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  469

Query  2186  KDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMTR  2025
              +    + ++  L       L      L   T          R   S          + R
Sbjct  470   GEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLAR  529

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             D    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H
Sbjct  530   DEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAH  582

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  583   FPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQD  637

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGD  1497
               ++ LLID +     +P T   L        +I++Y VDA    +G        KD+  
Sbjct  638   YAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL--  692

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
                  T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T 
Sbjct  693   ----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTE  748

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +
Sbjct  749   STDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTK  801

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +
Sbjct  802   ARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAM  849

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
               T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  +
Sbjct  850   EATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAE  909

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   RFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_004024832.1| PREDICTED: ER membrane protein complex subunit 1 isoform 1 [Gorilla 
gorilla gorilla]
Length=993

 Score =   329 bits (843),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 292/1010 (29%), Positives = 487/1010 (48%), Gaps = 114/1010 (11%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIH------  2442
             +H++     L   + G L ++      A++S + +  +   A    ++ V K        
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKTSNSEDGS  352

Query  2441  ---LSVKSIN------------------DWGSNLLEES--SAIDSQKGLVHKVFINNYIR  2331
                 S KSI+                  + G  LL+ +   +++       +++I  +++
Sbjct  353   MGSFSEKSISKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLK  412

Query  2330  TDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGV  2175
              D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G 
Sbjct  413   KDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGE  472

Query  2174  SVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGF  2010
                K +  L  +LK    +L       +          + +S  K++     + RD    
Sbjct  473   FGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNL  532

Query  2009  RKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDE  1833
             +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H     
Sbjct  533   QKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPP  585

Query  1832  NPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLH  1662
               ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    ++ 
Sbjct  586   QCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVL  640

Query  1661  LLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFA  1482
             LLID +     +P T   L        +I++Y VDA    +G        KD+       
Sbjct  641   LLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------T  691

Query  1481  TKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAA  1302
             T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A 
Sbjct  692   TELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAH  751

Query  1301  GDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYE  1122
              +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E
Sbjct  752   HE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNE  804

Query  1121  MSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTST  942
              +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T T
Sbjct  805   FTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATIT  852

Query  941   AKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTH  762
              +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +
Sbjct  853   ERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINY  912

Query  761   AVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
                   +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  913   NQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_008965347.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Pan 
paniscus]
Length=996

 Score =   329 bits (843),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 290/1016 (29%), Positives = 480/1016 (47%), Gaps = 123/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    + LE+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  470   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  529

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  530   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  582

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  583   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  637

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  638   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  693

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  694   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  748

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  749   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  801

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  802   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  849

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  850   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  909

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>gb|EHB14730.1| hypothetical protein GW7_09682 [Heterocephalus glaber]
Length=989

 Score =   328 bits (842),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 285/1016 (28%), Positives = 489/1016 (48%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                  +V+  G+  V+A+G+   S     K N   GE+++  S  +    +G   LV   
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVR-VSTPWLQRLTGGCGLVAEA  230

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKF  2586
              +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  ++ 
Sbjct  231   VLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPSRP  286

Query  2585  VLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSV  2433
               FL+++         ++G L ++      A++S +   + G +    +     ++  S 
Sbjct  287   QFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKPS-  342

Query  2432  KSINDWGSNLLEESSAIDSQKGL--------------------------------VHKVF  2349
              S + +  N +E+SSA DS                                      +++
Sbjct  343   SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPERLY  402

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV----  2190
             I  +++ D S G+RAL+  +DH LL LQQ  G++V WSRE+ LA +V +   +LP+    
Sbjct  403   IQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQ  462

Query  2189  -EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MT  2028
              E +G    K +  L  +LK    +L       +          + +S  K++     + 
Sbjct  463   AELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  522

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   H
Sbjct  523   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAH  576

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  577   FPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVMDQD  631

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVG  1500
               ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++      
Sbjct  632   YAKVLLLINDEYKVLSFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD------  685

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  686   ----LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  741

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  742   ESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  794

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  795   KARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  842

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  843   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  902

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  903   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  958



>ref|XP_004903411.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Heterocephalus 
glaber]
Length=992

 Score =   328 bits (842),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 283/1019 (28%), Positives = 482/1019 (47%), Gaps = 127/1019 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             S +  R +   VL+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     SVLCSRLWFWAVLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFLSGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
              + WE  L  SS  +++ LV     V R  ++L  ++  LH +SS  G + W + L    
Sbjct  116   GLNWEITLDSSS-FQALGLVGLQESV-RYIVVLKKTTLALHHLSS--GHLKWAEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPGGFSGDISLVTSE  2760
                  +V+  G+  V+A+G+   S     K N   GE+++  S  +    +G   LV   
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNTVKFNVEDGEIVR-VSTPWLQRLTGGCGLVAEA  230

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKF  2586
              +V  D +   L ++  +      QQ+ +  L  +F       +LP++      +  ++ 
Sbjct  231   VLVCPDPSSRSLYTLALETEW-ELQQIPLQSLDLEFGSGFQPRVLPTQPN---PVDPSRP  286

Query  2585  VLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSV  2433
               FL+++         ++G L ++      A++S +   + G +    +     ++  S 
Sbjct  287   QFFLQLSPSHYALLHYHQGTLSLLKNFPQTALVSFA---TTGEKTVAAVMTCRNEVKPS-  342

Query  2432  KSINDWGSNLLEESSAIDSQKGL--------------------------------VHKVF  2349
              S + +  N +E+SSA DS                                      +++
Sbjct  343   SSEDGFMGNFVEKSSAQDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNHTQPERLY  402

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV----  2190
             I  +++ D S G+RAL+  +DH LL LQQ  G++V WSRE+ LA +V +   +LP+    
Sbjct  403   IQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQ  462

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKS  2037
                E +    + ++  L       L      L   T          R   S         
Sbjct  463   AELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINID  522

Query  2036  KMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQV  1857
              + RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   + 
Sbjct  523   TLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRT  576

Query  1856  PHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYT  1686
               H       ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  
Sbjct  577   TAHFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVATPVLKRPILQSLLLPVM  631

Query  1685  DSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFK  1509
             D    ++ LLI+ +     +P T   L        +I++Y VDA    L G+ ++++   
Sbjct  632   DQDYAKVLLLINDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGWLSGYRLRKD---  688

Query  1508  DVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLF  1329
                      T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L 
Sbjct  689   -------LTTELSWELTIPPEIQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLA  741

Query  1328  VATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHY  1149
             V T +  A  +        +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y
Sbjct  742   VVTESTDAHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQY  794

Query  1148  FNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHS  969
             +N +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S
Sbjct  795   WNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSS  842

Query  968   VKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLP  789
             +  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + 
Sbjct  843   ISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQ  902

Query  788   IIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  903   IHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>dbj|BAF84307.1| unnamed protein product [Homo sapiens]
Length=993

 Score =   328 bits (841),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 291/1013 (29%), Positives = 485/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_008965348.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Pan 
paniscus]
Length=995

 Score =   328 bits (841),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 292/1016 (29%), Positives = 479/1016 (47%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-CPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS  LE+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  469   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  528

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  529   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  581

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  582   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  636

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  637   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  692

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  693   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  747

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  748   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  800

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  801   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  848

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  849   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  908

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_005245844.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Homo 
sapiens]
Length=996

 Score =   328 bits (841),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 290/1016 (29%), Positives = 478/1016 (47%), Gaps = 123/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKSSSSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  470   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  529

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  530   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  582

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  583   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  637

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  638   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  693

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  694   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  748

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  749   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  801

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  802   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  849

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  850   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  909

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>dbj|BAA07645.2| KIAA0090 [Homo sapiens]
Length=991

 Score =   328 bits (840),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 293/1013 (29%), Positives = 484/1013 (48%), Gaps = 121/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  5     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  59

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  60    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  117

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  118   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  172

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  173   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  232

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  233   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  291

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  292   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKSSSSED  348

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  349   GSMGS-FSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  407

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  408   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  467

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  468   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  527

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  528   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  580

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  581   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  635

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  636   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  688

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  689   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  746

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  747   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  799

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  800   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  847

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  848   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  907

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  908   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  960



>ref|NP_001258356.1| ER membrane protein complex subunit 1 isoform 2 precursor [Homo 
sapiens]
 dbj|BAG10291.1| KIAA0090 protein [synthetic construct]
Length=992

 Score =   328 bits (840),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 293/1013 (29%), Positives = 484/1013 (48%), Gaps = 121/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKSSSSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  582   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  636

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  637   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  689

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  690   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  747

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  748   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_001162981.2| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Pan 
troglodytes]
Length=993

 Score =   328 bits (840),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 291/1013 (29%), Positives = 486/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_009198835.1| PREDICTED: ER membrane protein complex subunit 1 isoform X5 [Papio 
anubis]
Length=975

 Score =   327 bits (839),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 279/973 (29%), Positives = 468/973 (48%), Gaps = 92/973 (9%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+  IT+S+G   +R+W    G + WE  L SGS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFRSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL--SVKSIN----DWGSNLLEES--  2391
             ++      A++S + +  +   A    ++ V  +       +IN    + G  LL+ +  
Sbjct  312   LLKNFPQTALVSFATTGEKTVAAVMACRNEVDSLACFNQTYTINLYLVETGRRLLDTTIT  371

Query  2390  SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASI  2220
              +++       +++I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +
Sbjct  372   FSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEV  431

Query  2219  VDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM  2061
             V +   +LP+       E +    + ++  L       L      L   T          
Sbjct  432   VCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDA  491

Query  2060  RLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSE  1902
             R   S          + RD    +K++++++ SGKL+ + +  G I+W  +L N    S 
Sbjct  492   RKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-  550

Query  1901  TCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKP  1725
                     K+   +   H       ++LV  K  G++S     L   +   GK  ++  P
Sbjct  551   ------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPP  599

Query  1724  V--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN  1551
             V    I Q + LP  D    ++ LLID +     +P T   L        +I++Y VDA 
Sbjct  600   VLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE  659

Query  1550  NILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTD  1371
                +G        KD+       T+  W +  P E ++I+    ++ +E VH+Q +V  D
Sbjct  660   ---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGD  710

Query  1370  RDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGP  1191
             R V+YK ++ N+L V T +     +        +++ ++LID VTGRI+H    + ++GP
Sbjct  711   RSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGP  763

Query  1190  VHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRP  1011
             VH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P      P
Sbjct  764   VHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LP  813

Query  1010  EVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQA  831
             +VL   QSY F  S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+ 
Sbjct  814   QVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQ  871

Query  830   EKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAP  651
              +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ P
Sbjct  872   SREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYP  931

Query  650   SKTYDSLTDDFSY  612
             SK +D L DD+ Y
Sbjct  932   SKQFDVLKDDYDY  944



>ref|NP_001168216.1| hypothetical protein [Zea mays]
 gb|ACN27477.1| unknown [Zea mays]
Length=200

 Score =   303 bits (775),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 179/201 (89%), Gaps = 1/201 (0%)
 Frame = -2

Query  1121  MSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTST  942
             M+VIEIYDQSRA NKD+ KL+LGKHNL  P++SY RPEV  KSQSYFF HSVK +AVT T
Sbjct  1     MAVIEIYDQSRAGNKDVTKLILGKHNLLAPITSYARPEVAVKSQSYFFTHSVKAMAVTQT  60

Query  941   AKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTH  762
             AKGITSKQLL+GTIGDQVLALDKR+LDPRR+VNPTQ EKE+GIIPLTDSLPIIPQS+VTH
Sbjct  61    AKGITSKQLLLGTIGDQVLALDKRYLDPRRSVNPTQQEKEEGIIPLTDSLPIIPQSFVTH  120

Query  761   AVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltival  582
             + + E LR IV++PAKLES T+VF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+TI  L
Sbjct  121   SHQVEALRAIVSIPAKLES-TIVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLITIAVL  179

Query  581   vvaifiTWIWSEQKELQEKWR  519
             V AI  TWIWSE+KEL++KWR
Sbjct  180   VAAIIGTWIWSEKKELRDKWR  200



>ref|XP_009447860.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Pan 
troglodytes]
Length=992

 Score =   327 bits (839),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 293/1013 (29%), Positives = 485/1013 (48%), Gaps = 121/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  582   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  636

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  637   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  689

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  690   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  747

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
              A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  748   DAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_007933833.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Orycteropus 
afer afer]
Length=992

 Score =   327 bits (839),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 285/1013 (28%), Positives = 486/1013 (48%), Gaps = 117/1013 (12%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             A+  R +L  +L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+T
Sbjct  4     ALVSRFWLWTLLLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVAT  58

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQ  3117
             E+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G 
Sbjct  59    EKNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAVTVSNGGRIMRSWETNIGG  116

Query  3116  MVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
             + WE  L SGS  +  ++ V  ++K      +L  ++  LH +SS  G + W + L    
Sbjct  117   LNWEITLDSGSFQALGLVGVQESVKY---IAVLKKTTLTLHHLSS--GHLKWVEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLRSLTGACGVVD  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKLT  2616
                +V  D +   L ++  +      +Q+ +  L  +F          T    + PS+  
Sbjct  232   EAALVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRILATQPNPVDPSRAQ  290

Query  2615  GMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS-----------LSEGHQAFGL  2469
               + +  N + L     + G L ++   +  A++S + +           L+E  +   L
Sbjct  291   FFLQLSPNHYALLH--YHHGVLSLLKNFSQTALVSFATTGEKTVAAVMTCLNEVQKPSNL  348

Query  2468  IKHGVGKIHLSVK------------SIN----DWGSNLLEES--SAIDSQKGLVHKVFIN  2343
              +  +G I    +            +IN    + G  LL+ +   +++       +++I 
Sbjct  349   EEGSMGSISEKSRPKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERLYIQ  408

Query  2342  NYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
              +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   VFLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L                  + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K+++V + SGK++ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVVATASGKIFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                  ++LV  K        S L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  582   HPPQCTLLVKDK----ETGMSALYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDYAK  637

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDY  1491
             + LLID +     +P T   L        +I++Y VDA    L G+ ++++         
Sbjct  638   VLLLIDDEYKVTAFPATRNVLRQLHELASSIFFYLVDAEQGQLSGYRLRKD---------  688

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T   
Sbjct  689   -LTTELSWELTIPPEVQRIVTVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT---  744

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
                 +   V  + +++ ++LID +TGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  745   ----ESTDVHHERTFIGIFLIDGITGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_007933831.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Orycteropus 
afer afer]
Length=993

 Score =   327 bits (838),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 285/1014 (28%), Positives = 486/1014 (48%), Gaps = 118/1014 (12%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             A+  R +L  +L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+T
Sbjct  4     ALVSRFWLWTLLLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVAT  58

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQ  3117
             E+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G 
Sbjct  59    EKNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAVTVSNGGRIMRSWETNIGG  116

Query  3116  MVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
             + WE  L SGS  +  ++ V  ++K      +L  ++  LH +SS  G + W + L    
Sbjct  117   LNWEITLDSGSFQALGLVGVQESVKY---IAVLKKTTLTLHHLSS--GHLKWVEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLRSLTGACGVVD  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKLT  2616
                +V  D +   L ++  +      +Q+ +  L  +F          T    + PS+  
Sbjct  232   EAALVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRILATQPNPVDPSRAQ  290

Query  2615  GMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLS-----------LSEGHQAFGL  2469
               + +  N + L     + G L ++   +  A++S + +           L+E  +   L
Sbjct  291   FFLQLSPNHYALLH--YHHGVLSLLKNFSQTALVSFATTGEKTVAAVMTCLNEVQKPSNL  348

Query  2468  IKHGVGKIHLSVK------------SIN----DWGSNLLEES--SAIDSQKGLVHKVFIN  2343
              +  +G I    +            +IN    + G  LL+ +   +++       +++I 
Sbjct  349   EEGSMGSISEKSRPKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERLYIQ  408

Query  2342  NYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----E  2187
              +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E
Sbjct  409   VFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAE  468

Query  2186  KDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRD  2022
              +G    K +  L  +LK    +L                  + +S  K++     + RD
Sbjct  469   LEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDTLARD  528

Query  2021  HNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
                 +K+++V + SGK++ + +  G I+W  +L N    S         K+   +   H 
Sbjct  529   EFNLQKMMVVATASGKIFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHF  581

Query  1844  AMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                   ++LV  K        S L   +   GK  ++  PV    I Q + LP  D    
Sbjct  582   PHPPQCTLLVKDK----ETGMSALYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDD  1494
             ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++        
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELASSIFFYLVDAEQGQLSGYRLRKD--------  689

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
                 T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T  
Sbjct  690   --LTTELSWELTIPPEVQRIVTVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT--  745

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
                  +   V  + +++ ++LID +TGRI+H    + ++GPVH V SENWVVY Y+N +A
Sbjct  746   -----ESTDVHHERTFIGIFLIDGITGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKA  800

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
              R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S+  + 
Sbjct  801   RRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAME  848

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
              T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + 
Sbjct  849   ATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAER  908

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   FINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_005317580.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Ictidomys 
tridecemlineatus]
Length=992

 Score =   327 bits (837),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 285/1018 (28%), Positives = 483/1018 (47%), Gaps = 125/1018 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             + +A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     ATLASRCWLWAALLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W ++L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQDSV---RYVAVLKRTTLALHHLSS--GHLKWVEQLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPG--GFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLHRLTGACGLV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKL  2619
               E V+     GS  +  +  +     +Q+ +  L  +F          T    + PS+ 
Sbjct  231   -DEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPTPVDPSRA  289

Query  2618  TGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
                + +  N + L     + G L ++      A++S     + G +    +     ++  
Sbjct  290   QFFLQLSPNHYALLH--YHHGALSLLKNFPQTALVSFG---TTGEKTVAAVMTCRNEVQK  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
                S +    +  E+SSA DS                                      +
Sbjct  345   PSNSEDGSMGSFSEKSSAQDSLACFNQTYTINLYLVETGRRLLDTAISFSLEQNDTRPER  404

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV---  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ G++V W+RE+ LA +V +   +LP+   
Sbjct  405   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLGKVVLWTREESLAEVVCLEMVDLPLTGA  464

Query  2189  --EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----M  2031
               E +G    K +  L  +LK    +L       +          + +S  K++     +
Sbjct  465   QAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTL  524

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVP  1854
              RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +  
Sbjct  525   ARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTT  577

Query  1853  HHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTD  1683
              H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D
Sbjct  578   AHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMD  632

Query  1682  STEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKD  1506
                 ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++    
Sbjct  633   QDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD----  688

Query  1505  VGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFV  1326
                     T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V
Sbjct  689   ------LTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAV  742

Query  1325  ATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYF  1146
              T       +   V  + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+
Sbjct  743   VT-------ESMDVHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYW  795

Query  1145  NLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSV  966
             N +A R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S+
Sbjct  796   NTKARRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSI  843

Query  965   KTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPI  786
               +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I
Sbjct  844   SAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQI  903

Query  785   IPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
               + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  904   HAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_005317578.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Ictidomys 
tridecemlineatus]
Length=993

 Score =   327 bits (837),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 285/1019 (28%), Positives = 483/1019 (47%), Gaps = 126/1019 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             + +A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     ATLASRCWLWAALLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W ++L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQDSV---RYVAVLKRTTLALHHLSS--GHLKWVEQLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPG--GFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLHRLTGACGLV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKL  2619
               E V+     GS  +  +  +     +Q+ +  L  +F          T    + PS+ 
Sbjct  231   -DEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPTPVDPSRA  289

Query  2618  TGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
                + +  N + L     + G L ++      A++S     + G +    +     ++  
Sbjct  290   QFFLQLSPNHYALLH--YHHGALSLLKNFPQTALVSFG---TTGEKTVAAVMTCRNEVQK  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
                S +    +  E+SSA DS                                      +
Sbjct  345   PSNSEDGSMGSFSEKSSAQDSLACFNQTYTINLYLVETGRRLLDTAISFSLEQNDTRPER  404

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV--  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ  G++V W+RE+ LA +V +   +LP+  
Sbjct  405   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWTREESLAEVVCLEMVDLPLTG  464

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----  2034
                E +G    K +  L  +LK    +L       +          + +S  K++     
Sbjct  465   AQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDT  524

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQV  1857
             + RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   + 
Sbjct  525   LARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRT  577

Query  1856  PHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYT  1686
               H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  
Sbjct  578   TAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVM  632

Query  1685  DSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFK  1509
             D    ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++   
Sbjct  633   DQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD---  689

Query  1508  DVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLF  1329
                      T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L 
Sbjct  690   -------LTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLA  742

Query  1328  VATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHY  1149
             V T       +   V  + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y
Sbjct  743   VVT-------ESMDVHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQY  795

Query  1148  FNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHS  969
             +N +A R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S
Sbjct  796   WNTKARRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSS  843

Query  968   VKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLP  789
             +  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + 
Sbjct  844   ISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQ  903

Query  788   IIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  904   IHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_009447846.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Pan 
troglodytes]
Length=996

 Score =   327 bits (837),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 289/1016 (28%), Positives = 479/1016 (47%), Gaps = 123/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  +  S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  470   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  529

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  530   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  582

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  583   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  637

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  638   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  693

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  694   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  748

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  749   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  801

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  802   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  849

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  850   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  909

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>ref|XP_004425702.1| PREDICTED: ER membrane protein complex subunit 1 isoform 1 [Ceratotherium 
simum simum]
Length=993

 Score =   327 bits (837),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 283/990 (29%), Positives = 479/990 (48%), Gaps = 112/990 (11%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV   
Sbjct  23    YEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV--D  79

Query  3215  KDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G +D  L  G+  IT+S+G   +R+W    G + WE  L SGS  +  ++ +  +
Sbjct  80    KGTAEGAVDAMLLYGQDAITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQES  139

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +   R   +L  ++  LH +S+  G + W + L         +V+  G+  V+A+G+   
Sbjct  140   V---RYIAVLKKTTLALHHLST--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVAPF  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S     K N   GE+++   +  P   G +G   +V    +V LD +   L ++  +   
Sbjct  195   SHVNIVKFNVEDGEIVQQVRVSTPWLQGLTGACGVVDEAVLVCLDPSSRSLQTLALETEW  254

Query  2696  INFQQVHIADLVQDFTGAAVLLPSKL-TGMVAIHINKFVLFLRVT---------YEGKLE  2547
                +Q+ +  L  D   A+   P  L T    +  ++   FL+++         +  +L 
Sbjct  255   -ELRQIPLQSL--DLEFASEFQPRVLPTQPSPVGPSRAQFFLQLSPSHYALLHYHHAELS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLS-----------------------  2436
             ++      A++S + +  +   A    ++ V K   S                       
Sbjct  312   LLKNFPQTALVSFATTGEKTVAAVMTCRNEVQKPGSSEDGSMGSFSEKASPQDSLACFNQ  371

Query  2435  VKSIN----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLL  2274
               +IN    + G  LL+ +      QKG    +++I  +++ D S G+RAL+  EDH LL
Sbjct  372   TYTINLYLVETGRRLLDTTITFSLEQKGTQPERLYIQVFLKKDDSVGYRALVQTEDHLLL  431

Query  2273  LLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllk  2118
              LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +
Sbjct  432   FLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQ  491

Query  2117  lkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTG  1953
             L       +          + +S  K++     + RD    +K++++++ SGKL+ + + 
Sbjct  492   LILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESS  551

Query  1952  DGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSV  1776
              G I+W   + +++        +  K+   +   H       ++LV  K  G++S     
Sbjct  552   SGTILWKQYLPSVKPD------SSFKLMVQRTTAHFPHPPQCTLLVKDKETGMSS-----  600

Query  1775  LSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALG  1602
             L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L 
Sbjct  601   LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLR  660

Query  1601  IFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATA  1422
                    +I++Y VDA    +G        KD+       T+  W +  P+E ++I+   
Sbjct  661   QLHELTPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTVPAEVQRIVQVK  711

Query  1421  TRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDT  1242
              ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++ ++L+D 
Sbjct  712   GKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFIGIFLVDG  764

Query  1241  VTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKL  1062
             VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N      
Sbjct  765   VTGRIIHSSVQRKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS-  823

Query  1061  VLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLA  882
                  +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     +L+
Sbjct  824   -----SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILS  872

Query  881   LDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLEST  702
             L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST
Sbjct  873   LPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLEST  932

Query  701   TLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  933   CLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_005245845.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Homo 
sapiens]
Length=995

 Score =   327 bits (837),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 291/1016 (29%), Positives = 477/1016 (47%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKSSSSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  469   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  528

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  529   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  581

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  582   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  636

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  637   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  692

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  693   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  747

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  748   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  800

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  801   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  848

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  849   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  908

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_009447853.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Pan 
troglodytes]
Length=995

 Score =   326 bits (836),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 291/1016 (29%), Positives = 478/1016 (47%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L   L+  +A    ++YEDQVG  DW Q+Y+GKVK A       G K++VV+TE+
Sbjct  6     ASRFWLWATLLIPAA----AVYEDQVGKFDWRQQYVGKVKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+ VIT+S+G   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHE--SMVFPGGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++    S ++    SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTLWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  469   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  528

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  529   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  581

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  582   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  636

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  637   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  692

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  693   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  747

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  748   ESTDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  800

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  801   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  848

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  849   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  908

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_005317579.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Ictidomys 
tridecemlineatus]
Length=992

 Score =   326 bits (836),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 287/1019 (28%), Positives = 483/1019 (47%), Gaps = 127/1019 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             + +A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     ATLASRCWLWAALLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W ++L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQDSV---RYVAVLKRTTLALHHLSS--GHLKWVEQLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPG--GFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLHRLTGACGLV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKL  2619
               E V+     GS  +  +  +     +Q+ +  L  +F          T    + PS+ 
Sbjct  231   -DEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPTPVDPSRA  289

Query  2618  TGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
                + +  N + L     + G L ++      A++S     + G +    +     ++  
Sbjct  290   QFFLQLSPNHYALLH--YHHGALSLLKNFPQTALVSFG---TTGEKTVAAVMTCRNEVKP  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
             S       GS   E+SSA DS                                      +
Sbjct  345   SNSEDGSMGS-FSEKSSAQDSLACFNQTYTINLYLVETGRRLLDTAISFSLEQNDTRPER  403

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV--  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ  G++V W+RE+ LA +V +   +LP+  
Sbjct  404   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWTREESLAEVVCLEMVDLPLTG  463

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----  2034
                E +G    K +  L  +LK    +L       +          + +S  K++     
Sbjct  464   AQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDT  523

Query  2033  MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQV  1857
             + RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   + 
Sbjct  524   LARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRT  576

Query  1856  PHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYT  1686
               H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  
Sbjct  577   TAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVM  631

Query  1685  DSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFK  1509
             D    ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++   
Sbjct  632   DQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD---  688

Query  1508  DVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLF  1329
                      T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L 
Sbjct  689   -------LTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLA  741

Query  1328  VATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHY  1149
             V T       +   V  + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y
Sbjct  742   VVT-------ESMDVHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQY  794

Query  1148  FNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHS  969
             +N +A R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S
Sbjct  795   WNTKARRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSS  842

Query  968   VKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLP  789
             +  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + 
Sbjct  843   ISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQ  902

Query  788   IIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  903   IHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_005317577.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Ictidomys 
tridecemlineatus]
Length=996

 Score =   326 bits (835),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 283/1022 (28%), Positives = 476/1022 (47%), Gaps = 129/1022 (13%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             + +A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     ATLASRCWLWAALLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W ++L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQDSV---RYVAVLKRTTLALHHLSS--GHLKWVEQLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFPG--GFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   LV
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLHRLTGACGLV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKL  2619
               E V+     GS  +  +  +     +Q+ +  L  +F          T    + PS+ 
Sbjct  231   -DEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPTPVDPSRA  289

Query  2618  TGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
                + +  N + L     + G L ++      A++S     + G +    +     ++  
Sbjct  290   QFFLQLSPNHYALLH--YHHGALSLLKNFPQTALVSFG---TTGEKTVAAVMTCRNEVQK  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGL--------------------------------VHK  2355
                S +    +  E+SSA DS                                      +
Sbjct  345   PSNSEDGSMGSFSEKSSAQDSLACFNQTYTINLYLVETGRRLLDTAISFSLEQNDTRPER  404

Query  2354  VFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV--  2190
             ++I  +++ D S G+RAL+  +DH LL LQQ  G++V W+RE+ LA +V +   +LP+  
Sbjct  405   LYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLAGKVVLWTREESLAEVVCLEMVDLPLTG  464

Query  2189  -----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------G  2043
                  E +    + ++  L       L      L   T          R   S       
Sbjct  465   AQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEIN  524

Query  2042  KSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQ  1866
                + RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+  
Sbjct  525   IDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMV  577

Query  1865  WQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPL  1695
              +   H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + L
Sbjct  578   QRTTAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLL  632

Query  1694  PYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKEN  1518
             P  D    ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++
Sbjct  633   PVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD  692

Query  1517  YFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKN  1338
                         T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N
Sbjct  693   ----------LTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPN  742

Query  1337  MLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVV  1158
             +L V T       +   V  + +++ ++LID VTGRI+H    + ++GPVH V SENWVV
Sbjct  743   LLAVVT-------ESMDVHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVV  795

Query  1157  YHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFF  978
             Y Y+N +A R E++ +E+Y+ +   N           +L +P      P+VL   QSY F
Sbjct  796   YQYWNTKARRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIF  843

Query  977   AHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTD  798
               S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP + 
Sbjct  844   PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP  903

Query  797   SLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDF  618
              + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+
Sbjct  904   DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY  963

Query  617   SY  612
              Y
Sbjct  964   DY  965



>ref|XP_005544658.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Macaca 
fascicularis]
Length=992

 Score =   325 bits (834),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 290/1012 (29%), Positives = 482/1012 (48%), Gaps = 119/1012 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++     S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKPSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFPEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  469

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L       +          + +S  K++     + RD  
Sbjct  470   GEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEF  529

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  530   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  582

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    +
Sbjct  583   PPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAK  637

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  638   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-----  689

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  
Sbjct  690   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTD  748

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
                +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  749   THHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARR  801

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  802   NEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  849

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  850   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  909

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_004678612.1| PREDICTED: ER membrane protein complex subunit 1 [Condylura cristata]
Length=995

 Score =   325 bits (834),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 285/1015 (28%), Positives = 491/1015 (48%), Gaps = 117/1015 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A   R +L + L+  +A    ++YEDQVG  DW Q+Y+GK+K A      A +K ++V+
Sbjct  4     AAATGRFWLWVALLLPAA----AVYEDQVGKFDWRQQYVGKLKFASLEFSPASKK-LIVA  58

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   +   +G +D  L  G+  +T+S+G   +R+W    G
Sbjct  59    TEKNVIAALNSRTGEILWRHV--DRGTAEGTVDAMLLQGQDAVTVSNGGRIMRSWETNIG  116

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G V W + L   
Sbjct  117   GLNWEITLDSGSFQALGLVGLQDSV---RFVAVLKKTTLALHHLSS--GHVKWVEHLPES  171

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  172   DSIHYQMVYSRGSGAVWALGVVPFSHVNVVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV  231

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHI  2595
                 +V  D +   L ++  +      +Q+ +  L  +F       +LP++    VA   
Sbjct  232   GEAVLVCPDPSSWSLQTLALETEW-ELRQIPLQHLDLEFADGFQPRVLPTQ-PNPVAPSR  289

Query  2594  NKFVLFLRVTY-------EGKLEVVDKVAYGAVISESL--------------------SL  2496
              +F L L  ++       +G + ++      A++S +                     S 
Sbjct  290   AQFFLQLSPSHYALLHYHDGAVSLLRNFPQTALVSFATTGEKTVAAVMTCRNDAVSRPSS  349

Query  2495  SEGHQAFGLIKHGVGKIHLSV----KSIN----DWGSNLLEES--SAIDSQKGLVHKVFI  2346
             SE     GL +    +  L+      +IN    + G  LL+ +    ++       ++FI
Sbjct  350   SEDGPVGGLAEKAGPQDSLTCFNQTYTINLYLVETGRRLLDTTITFTLEQNGTRPERLFI  409

Query  2345  NNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----  2190
               +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     
Sbjct  410   QVFLKKDDSAGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQA  469

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTR  2025
             E +G    K +  L  +LK    +L       +          + +S  K++     + R
Sbjct  470   ELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLAR  529

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             D    +K++++++ SGKL+ + +  G I+W   + ++R   +       K+   +   H 
Sbjct  530   DEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVRPDSS------FKLMVQRTTAHF  583

Query  1844  AMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTE  1674
                   ++LV  K  G++S     L   +   GK  ++  PV  H I Q + LP  D   
Sbjct  584   PHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKHPILQSLLLPIMDQDY  638

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGD  1497
              ++ LLID +     +P T   L        +I++Y VD+    L G+ ++++       
Sbjct  639   AKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDSEQGRLSGYRLRKD-------  691

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
                  T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T 
Sbjct  692   ---LTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-  747

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
                   +   V  + +++ V+L+D VTGRI+H    + ++GPVH V +ENWVVY Y+N +
Sbjct  748   ------ESTDVHHERTFVGVFLVDGVTGRIIHSSVQRRAKGPVHIVHAENWVVYQYWNTK  801

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +
Sbjct  802   ARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAV  849

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
               T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  +
Sbjct  850   EATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAE  909

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   RFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_009994097.1| PREDICTED: ER membrane protein complex subunit 1 [Chaetura pelagica]
Length=964

 Score =   325 bits (832),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 276/978 (28%), Positives = 466/978 (48%), Gaps = 110/978 (11%)
 Frame = -2

Query  3371  DWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-I  3195
             D  Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +G I
Sbjct  8     DQRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTPEGAI  64

Query  3194  DIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSL  3027
             D  L  G+  IT+S +G  LR+W    G + WE+ L +GS     ++ +   +K      
Sbjct  65    DAMLIHGQDAITVSHAGRILRSWETNIGGLNWETSLDTGSFQMAGLVGLQDAVKY---VA  121

Query  3026  ILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKI  2847
             +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+   S F     
Sbjct  122   VLKKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSHGTGVIHVLGIVPQSHFNILTF  179

Query  2846  NARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLINFQQVH  2676
             N   GE+ K   +  P     SG  S+V    +V LD  T S+ V  +  +     +Q+ 
Sbjct  180   NVEDGEITKQLRVAAPWLKSLSGMCSVVGEAVLVCLDMDTQSLYVCSLEMEQ--EMKQIP  237

Query  2675  IADLVQDFTG----------AAVLLPSKLTGMVAIHINKFVLF---------LRVTYEGK  2553
             +  L  +FT            + +  S+    + +  + F LF         LR   +  
Sbjct  238   LQSLDLEFTDDFQPRILATQPSAVGASRAQFFLQLSASHFSLFQYKHGLLSHLRDFQQAA  297

Query  2552  L---EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGK---IHLSVKSIN------DWGS  2409
             L       +    AV++    L  G    G       K   +  S ++ N      + G 
Sbjct  298   LVSFATTGEKTVAAVLTCRSELKPGSSDAGSALETARKQESLTCSNQTYNINLYLVETGQ  357

Query  2408  NLLEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSRE  2238
              LL+ +    ++       +++I  +++ D S G+RAL+  EDH L+ LQQ G++VWSRE
Sbjct  358   RLLDTTITFTLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVVWSRE  417

Query  2237  DGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAA  2073
             + LA +V +   +LP+     E +G    K +  L  +LK    +L              
Sbjct  418   ESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMF  477

Query  2072  IQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRK  1908
                 + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   +  +R 
Sbjct  478   YDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLRNVRP  537

Query  1907  SETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---GKELK  1737
               +       K+   +   H       ++LV        D  + +SF+  +    GK  +
Sbjct  538   GSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPIFGKRSQ  584

Query  1736  ILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYS  1563
             +  PV    I Q + LP  D    ++ LLID +     +P T   L   +    +I++Y 
Sbjct  585   VAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAHSIFFYL  644

Query  1562  VDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQA  1386
             VDA    L G  +K++            T+  W V+ P+E ++I+    ++ NE VH+Q 
Sbjct  645   VDAEQGKLSGFRLKKD----------LTTEESWDVIIPTEVQRIVTVKGKRSNEHVHSQG  694

Query  1385  KVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQ  1206
             +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTGRI+H    +
Sbjct  695   RVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGRIIHSSVQR  747

Query  1205  GSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVS  1026
              ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P+ 
Sbjct  748   KAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPI-  800

Query  1025  SYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTV  846
                 P+VL   QSY F  ++  +  T T +GITS+ LL+G     +L+L K  LDPRR  
Sbjct  801   ---LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGAILSLPKALLDPRRPE  855

Query  845   NPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFF  666
              PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ 
Sbjct  856   IPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGLDIYQ  915

Query  665   TQLAPSKTYDSLTDDFSY  612
             T++ PSK +D L DD+ Y
Sbjct  916   TRVYPSKQFDVLKDDYDY  933



>ref|NP_001248047.1| ER membrane protein complex subunit 1 precursor [Macaca mulatta]
 ref|XP_005544656.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Macaca 
fascicularis]
 gb|EHH14388.1| hypothetical protein EGK_00308 [Macaca mulatta]
 gb|EHH49592.1| hypothetical protein EGM_00281 [Macaca fascicularis]
Length=993

 Score =   325 bits (833),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 290/1013 (29%), Positives = 482/1013 (48%), Gaps = 120/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++     S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKPSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFPEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  470   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  529

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  530   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  582

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  583   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  637

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  638   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  690

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  691   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  748

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
                 +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  749   DTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  801

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  802   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  849

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  850   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  909

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_009232431.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Pongo 
abelii]
Length=993

 Score =   325 bits (832),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 281/993 (28%), Positives = 478/993 (48%), Gaps = 114/993 (11%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+ VIT+S+G   +R+W    G + WE  L +GS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDTGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGILS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDS---  2376
             ++      A++S +   + G +    +     ++  +  S +    +  E+SS+ DS   
Sbjct  312   LLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSEDGSMGSFSEKSSSKDSLAC  368

Query  2375  ----------------------------QKGL-VHKVFINNYIRTDRSYGFRALIVLEDH  2283
                                         Q G    +++I  +++ D S G+RAL+  EDH
Sbjct  369   FNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDH  428

Query  2282  SLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkgh  2127
              LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK  
Sbjct  429   LLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRL  488

Query  2126  llklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYAL  1962
               +L       +          + +S  K++     + RD    +K++++++ SGKL+ +
Sbjct  489   SSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGI  548

Query  1961  HTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDA  1785
              +  G I+W   + +++   +       K+   +   H       ++LV  K  G++S  
Sbjct  549   ESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLVKDKESGMSS--  600

Query  1784  PSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
                L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T  
Sbjct  601   ---LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRN  657

Query  1610  ALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
              L        +I++Y VDA    +G        KD+       T+  W +  P E ++I+
Sbjct  658   VLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIV  708

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
                 ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A  +        +++ ++L
Sbjct  709   KVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE-------RTFIGIFL  761

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N   
Sbjct  762   IDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATA  821

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     
Sbjct  822   FS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGA  869

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ L
Sbjct  870   ILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGL  929

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             EST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  930   ESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_010284953.1| PREDICTED: ER membrane protein complex subunit 1, partial [Phaethon 
lepturus]
Length=957

 Score =   324 bits (830),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 278/984 (28%), Positives = 471/984 (48%), Gaps = 113/984 (11%)
 Frame = -2

Query  3380  GLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVID  3201
             G  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +
Sbjct  1     GKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGSPE  57

Query  3200  G-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDR  3036
             G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    S++ +   +K   
Sbjct  58    GAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQDVVKY--  115

Query  3035  DSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVA  2856
                +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+   S    
Sbjct  116   -VAVLKKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSHGTGVIHVLGIVPQSHLNI  172

Query  2855  YKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLINFQ  2685
                +   GE+ K   +  P     +G  S+V    +V +D  T S+ V  +  D     +
Sbjct  173   LTFSVEDGEITKQGRVAAPWLKSLNGACSMVGEAVLVCVDVDTHSLYVCSLEMDK--EMK  230

Query  2684  QVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTY  2562
             Q+ +  L  +F          T   V+  S+    + +  + F L          LR  +
Sbjct  231   QIPLQSLDLEFADGFQPRILTTQPNVISASRTQFFLQLSPSHFSLLQYKHGLLSHLRDFH  290

Query  2561  EGKL---EVVDKVAYGAVISESLSLSEGH----QAFGLIKHGVGKIHLSVKS----IN--  2421
             +  L       +    AV++    L  G      A   ++    +  L+  +    IN  
Sbjct  291   QAALVSFATTGEKTVAAVLTCRSELKPGSSDDLHAGSTLEDSQKQESLTCSNQTYNINLY  350

Query  2420  --DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GE  2256
               + G  LL+ +   +  Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ G+
Sbjct  351   LVETGQRLLDTTITFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGK  410

Query  2255  IVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLAT  2091
             +VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L        
Sbjct  411   VVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTA  470

Query  2090  PDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFL  1926
                       + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   
Sbjct  471   HLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQY  530

Query  1925  VNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT--  1752
             +  +R   +       K+   +   H       ++LV        D  + +SF+  +   
Sbjct  531   LRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPI  577

Query  1751  -GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELG  1581
              GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +    
Sbjct  578   FGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAH  637

Query  1580  NIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNE  1404
             ++++Y VDA    L G  +K++            T+  W V+ P+E ++I+    ++ NE
Sbjct  638   SVFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVIIPTEVQRIVTVKGKRSNE  687

Query  1403  VVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRIL  1224
              VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTGRI+
Sbjct  688   HVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGRII  740

Query  1223  HRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHN  1044
             H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +
Sbjct  741   HSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------S  794

Query  1043  LTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFL  864
             L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K  L
Sbjct  795   LDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKALL  848

Query  863   DPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAY  684
             DPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AY
Sbjct  849   DPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAY  908

Query  683   GVDLFFTQLAPSKTYDSLTDDFSY  612
             G+D++ T++ PSK +D L DD+ Y
Sbjct  909   GLDIYQTRVYPSKQFDVLKDDYDY  932



>ref|XP_004377247.1| PREDICTED: ER membrane protein complex subunit 1 isoform 1 [Trichechus 
manatus latirostris]
Length=993

 Score =   325 bits (832),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 287/1016 (28%), Positives = 489/1016 (48%), Gaps = 120/1016 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A+  R +L  +L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     AALVSRFWLWALLLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHHLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNMEDGEIVQQVRVSTPWLQSLTGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKL  2619
                 +V  D +   L ++  +      +Q+ +  L  +F          T    + PS+ 
Sbjct  231   DEAVLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFESGFQPRILATQPNPVDPSRA  289

Query  2618  TGMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
                + +  + + L     ++G L ++  +   A++S + +  +   A    ++ V K   
Sbjct  290   QFFLQLSPSHYALLH--YHQGVLSLLKNLPQTALVSFATTGEKTVAAVMTCRNEVQKPSS  347

Query  2438  S-----------------------VKSIN----DWGSNLLEE--SSAIDSQKGLVHKVFI  2346
             S                         +IN    + G  LL+   + +++       ++FI
Sbjct  348   SEDGSMGSISEKASPKDSLACFNQTYTINLYLVETGRRLLDTMITFSLEQNGTRPERLFI  407

Query  2345  NNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----  2190
               +++ D S G+RAL+ +EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     
Sbjct  408   QVFLKKDDSVGYRALVQMEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQA  467

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTR  2025
             E +G    K +  L  +LK    +L                  R +S  K++     + R
Sbjct  468   ELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARRPRSQIKNEINIDTLAR  527

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             D    +K+++V + SGKL+ + +  G I+W  +L N    S         K+   +   H
Sbjct  528   DEFNLQKMMVVATASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAH  580

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++L+  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  581   FPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQD  635

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDAN-NILRGHAVKENYFKDVG  1500
               ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++      
Sbjct  636   YAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAELGRLSGYRLRKD------  689

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  690   ----LTTELSWELTIPPEVQRIVTVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  745

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
                  + D+     + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  746   ----ESTDMHH---ERTFIGIFLIDGVTGRIIHSSLQKKAKGPVHIVHSENWVVYQYWNT  798

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  799   KARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  846

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  847   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  906

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  907   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_004637725.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Octodon 
degus]
Length=993

 Score =   325 bits (832),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 280/993 (28%), Positives = 474/993 (48%), Gaps = 118/993 (12%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV   
Sbjct  23    YEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV--D  79

Query  3215  KDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G +D  L  G+  IT+SSG   +R+W    G + WE  L SGS  +  ++ +  +
Sbjct  80    KGTAEGTVDAMLLHGQDAITVSSGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQES  139

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+   
Sbjct  140   VKY---VAVLKRTTLALHHLSS--GHLKWVEHLPESDNIHYQMVYSYGSGVVWALGVVPF  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S     K N   GE+++   +  P     +G   +V    +V  D +   L ++  +   
Sbjct  195   SHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGACGVVEEAVLVCPDPSSGSLHTLALETEW  254

Query  2696  INFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFLRVTY-------EGKLEV  2544
                +Q+ +  L  +F       +LP++    V     +F L L  T+       +G L +
Sbjct  255   -ELRQIPLQSLDLEFGSGFQPRVLPTQ-PNPVDPSRPQFFLQLSPTHYALLHYHQGTLSL  312

Query  2543  VDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGL  2364
             +      A++S +   + G +    +     ++  +  S +    + LE SSA DS    
Sbjct  313   LRNFPQTALVSFA---TTGEKTVAAVMTCRNEVQKASNSEDGSLGSFLETSSAQDSLACF  369

Query  2363  --------------------------------VHKVFINNYIRTDRSYGFRALIVLEDHS  2280
                                               +++I  +++ D S G+RAL+  +DH 
Sbjct  370   NQTYTINLYLAETGRRLLDTTITFSLEQNDTRPERLYIQVFLKKDDSVGYRALVQTQDHL  429

Query  2279  LLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghl  2124
             LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK   
Sbjct  430   LLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLS  489

Query  2123  lklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALH  1959
              +L       +          + +S  K++     + RD    +K++++++ SGKL+ + 
Sbjct  490   SQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIE  549

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAP  1782
             +  G I+W   + +++   +       K+   +   H       ++L+  K  G++S   
Sbjct  550   SSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLIKDKETGMSS---  600

Query  1781  SVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
               L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   
Sbjct  601   --LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNV  658

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             L        +I++Y VDA    L G+ ++++            T+  W +  P E ++I+
Sbjct  659   LRQLHELAPSIFFYLVDAEQGRLSGYRLRKD----------LTTELSWELTIPPEVQRIV  708

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
                 ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++ V+L
Sbjct  709   KVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFIGVFL  761

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E + +E+Y+ +   N   
Sbjct  762   IDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATA  821

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     
Sbjct  822   FS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGA  869

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ L
Sbjct  870   ILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGL  929

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             EST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  930   ESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_005544657.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Macaca 
fascicularis]
Length=992

 Score =   324 bits (831),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 292/1013 (29%), Positives = 482/1013 (48%), Gaps = 121/1013 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKPSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FPEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L       +          + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D    
Sbjct  582   HPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYA  636

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  637   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL----  689

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T + 
Sbjct  690   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTEST  747

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
                 +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  748   DTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_004637726.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Octodon 
degus]
Length=992

 Score =   324 bits (831),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 280/992 (28%), Positives = 474/992 (48%), Gaps = 117/992 (12%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV   
Sbjct  23    YEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV--D  79

Query  3215  KDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G +D  L  G+  IT+SSG   +R+W    G + WE  L SGS  +  ++ +  +
Sbjct  80    KGTAEGTVDAMLLHGQDAITVSSGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQES  139

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+   
Sbjct  140   VKY---VAVLKRTTLALHHLSS--GHLKWVEHLPESDNIHYQMVYSYGSGVVWALGVVPF  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S     K N   GE+++   +  P     +G   +V    +V  D +   L ++  +   
Sbjct  195   SHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGACGVVEEAVLVCPDPSSGSLHTLALETEW  254

Query  2696  INFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFLRVTY-------EGKLEV  2544
                +Q+ +  L  +F       +LP++    V     +F L L  T+       +G L +
Sbjct  255   -ELRQIPLQSLDLEFGSGFQPRVLPTQ-PNPVDPSRPQFFLQLSPTHYALLHYHQGTLSL  312

Query  2543  VDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGL  2364
             +      A++S +   + G +    +     ++  +  S +    + LE SSA DS    
Sbjct  313   LRNFPQTALVSFA---TTGEKTVAAVMTCRNEVQKASNSEDGSLGSFLETSSAQDSLACF  369

Query  2363  --------------------------------VHKVFINNYIRTDRSYGFRALIVLEDHS  2280
                                               +++I  +++ D S G+RAL+  +DH 
Sbjct  370   NQTYTINLYLAETGRRLLDTTITFSLEQNDTRPERLYIQVFLKKDDSVGYRALVQTQDHL  429

Query  2279  LLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghll  2121
             LL LQQ G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK    
Sbjct  430   LLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSS  489

Query  2120  klkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHT  1956
             +L       +          + +S  K++     + RD    +K++++++ SGKL+ + +
Sbjct  490   QLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIES  549

Query  1955  GDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPS  1779
               G I+W   + +++   +       K+   +   H       ++L+  K  G++S    
Sbjct  550   SSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLIKDKETGMSS----  599

Query  1778  VLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEAL  1605
              L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   L
Sbjct  600   -LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVL  658

Query  1604  GIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIA  1428
                     +I++Y VDA    L G+ ++++            T+  W +  P E ++I+ 
Sbjct  659   RQLHELAPSIFFYLVDAEQGRLSGYRLRKD----------LTTELSWELTIPPEVQRIVK  708

Query  1427  TATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLI  1248
                ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++ V+LI
Sbjct  709   VKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFIGVFLI  761

Query  1247  DTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLL  1068
             D VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E + +E+Y+ +   N    
Sbjct  762   DGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAF  821

Query  1067  KLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQV  888
                    +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     +
Sbjct  822   S------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAI  869

Query  887   LALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLE  708
             L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LE
Sbjct  870   LSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLE  929

Query  707   STTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  930   STCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_009232432.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Pongo 
abelii]
Length=992

 Score =   324 bits (831),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 283/993 (28%), Positives = 477/993 (48%), Gaps = 115/993 (12%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+ VIT+S+G   +R+W    G + WE  L +GS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDTGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGILS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDS---  2376
             ++      A++S +   + G +    +     ++  S       GS   E+SS+ DS   
Sbjct  312   LLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKTSNSEDGSMGS-FSEKSSSKDSLAC  367

Query  2375  ----------------------------QKGL-VHKVFINNYIRTDRSYGFRALIVLEDH  2283
                                         Q G    +++I  +++ D S G+RAL+  EDH
Sbjct  368   FNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDH  427

Query  2282  SLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkgh  2127
              LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK  
Sbjct  428   LLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRL  487

Query  2126  llklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYAL  1962
               +L       +          + +S  K++     + RD    +K++++++ SGKL+ +
Sbjct  488   SSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGI  547

Query  1961  HTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDA  1785
              +  G I+W   + +++   +       K+   +   H       ++LV  K  G++S  
Sbjct  548   ESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLVKDKESGMSS--  599

Query  1784  PSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPE  1611
                L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T  
Sbjct  600   ---LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRN  656

Query  1610  ALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
              L        +I++Y VDA    +G        KD+       T+  W +  P E ++I+
Sbjct  657   VLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIV  707

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
                 ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A  +        +++ ++L
Sbjct  708   KVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE-------RTFIGIFL  760

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N   
Sbjct  761   IDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATA  820

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     
Sbjct  821   FS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGA  868

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ L
Sbjct  869   ILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGL  928

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             EST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  929   ESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_004637727.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Octodon 
degus]
Length=992

 Score =   324 bits (831),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 282/993 (28%), Positives = 473/993 (48%), Gaps = 119/993 (12%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV   
Sbjct  23    YEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV--D  79

Query  3215  KDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G +D  L  G+  IT+SSG   +R+W    G + WE  L SGS  +  ++ +  +
Sbjct  80    KGTAEGTVDAMLLHGQDAITVSSGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQES  139

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+   
Sbjct  140   VKY---VAVLKRTTLALHHLSS--GHLKWVEHLPESDNIHYQMVYSYGSGVVWALGVVPF  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S     K N   GE+++   +  P     +G   +V    +V  D +   L ++  +   
Sbjct  195   SHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGACGVVEEAVLVCPDPSSGSLHTLALETEW  254

Query  2696  INFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFLRVTY-------EGKLEV  2544
                +Q+ +  L  +F       +LP++    V     +F L L  T+       +G L +
Sbjct  255   -ELRQIPLQSLDLEFGSGFQPRVLPTQ-PNPVDPSRPQFFLQLSPTHYALLHYHQGTLSL  312

Query  2543  VDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGL  2364
             +      A++S +   + G +    +     ++  S       GS  LE SSA DS    
Sbjct  313   LRNFPQTALVSFA---TTGEKTVAAVMTCRNEVKASNSEDGSLGS-FLETSSAQDSLACF  368

Query  2363  --------------------------------VHKVFINNYIRTDRSYGFRALIVLEDHS  2280
                                               +++I  +++ D S G+RAL+  +DH 
Sbjct  369   NQTYTINLYLAETGRRLLDTTITFSLEQNDTRPERLYIQVFLKKDDSVGYRALVQTQDHL  428

Query  2279  LLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghl  2124
             LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK   
Sbjct  429   LLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLS  488

Query  2123  lklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALH  1959
              +L       +          + +S  K++     + RD    +K++++++ SGKL+ + 
Sbjct  489   SQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIE  548

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAP  1782
             +  G I+W   + +++   +       K+   +   H       ++L+  K  G++S   
Sbjct  549   SSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLIKDKETGMSS---  599

Query  1781  SVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEA  1608
               L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T   
Sbjct  600   --LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNV  657

Query  1607  LGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQII  1431
             L        +I++Y VDA    L G+ ++++            T+  W +  P E ++I+
Sbjct  658   LRQLHELAPSIFFYLVDAEQGRLSGYRLRKD----------LTTELSWELTIPPEVQRIV  707

Query  1430  ATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYL  1251
                 ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++ V+L
Sbjct  708   KVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFIGVFL  760

Query  1250  IDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDL  1071
             ID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E + +E+Y+ +   N   
Sbjct  761   IDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATA  820

Query  1070  LKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQ  891
                     +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG     
Sbjct  821   FS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGA  868

Query  890   VLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKL  711
             +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ L
Sbjct  869   ILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGL  928

Query  710   ESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             EST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  929   ESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>gb|KFU88223.1| ER membrane protein complex subunit 1, partial [Chaetura pelagica]
Length=949

 Score =   323 bits (829),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 275/976 (28%), Positives = 465/976 (48%), Gaps = 110/976 (11%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDI  3189
              Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +G ID 
Sbjct  1     RQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTPEGAIDA  57

Query  3188  AL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLIL  3021
              L  G+  IT+S +G  LR+W    G + WE+ L +GS     ++ +   +K      +L
Sbjct  58    MLIHGQDAITVSHAGRILRSWETNIGGLNWETSLDTGSFQMAGLVGLQDAVKY---VAVL  114

Query  3020  IYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINA  2841
               ++  LH +S  +G   W + L         +++  GT  ++ +G+   S F     N 
Sbjct  115   KKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSHGTGVIHVLGIVPQSHFNILTFNV  172

Query  2840  RKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLINFQQVHIA  2670
               GE+ K   +  P     SG  S+V    +V LD  T S+ V  +  +     +Q+ + 
Sbjct  173   EDGEITKQLRVAAPWLKSLSGMCSVVGEAVLVCLDMDTQSLYVCSLEMEQ--EMKQIPLQ  230

Query  2669  DLVQDFTG----------AAVLLPSKLTGMVAIHINKFVLF---------LRVTYEGKL-  2550
              L  +FT            + +  S+    + +  + F LF         LR   +  L 
Sbjct  231   SLDLEFTDDFQPRILATQPSAVGASRAQFFLQLSASHFSLFQYKHGLLSHLRDFQQAALV  290

Query  2549  --EVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGK---IHLSVKSIN------DWGSNL  2403
                   +    AV++    L  G    G       K   +  S ++ N      + G  L
Sbjct  291   SFATTGEKTVAAVLTCRSELKPGSSDAGSALETARKQESLTCSNQTYNINLYLVETGQRL  350

Query  2402  LEES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSREDG  2232
             L+ +    ++       +++I  +++ D S G+RAL+  EDH L+ LQQ G++VWSRE+ 
Sbjct  351   LDTTITFTLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVVWSREES  410

Query  2231  LASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQ  2067
             LA +V +   +LP+     E +G    K +  L  +LK    +L                
Sbjct  411   LAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYD  470

Query  2066  QMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSE  1902
               + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   +  +R   
Sbjct  471   ARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLRNVRPG-  529

Query  1901  TCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---GKELKIL  1731
                  +  K+   +   H       ++LV        D  + +SF+  +    GK  ++ 
Sbjct  530   -----SSFKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPIFGKRSQVA  577

Query  1730  KPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVD  1557
              PV    I Q + LP  D    ++ LLID +     +P T   L   +    +I++Y VD
Sbjct  578   PPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAHSIFFYLVD  637

Query  1556  ANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKV  1380
             A    L G  +K++            T+  W V+ P+E ++I+    ++ NE VH+Q +V
Sbjct  638   AEQGKLSGFRLKKD----------LTTEESWDVIIPTEVQRIVTVKGKRSNEHVHSQGRV  687

Query  1379  TTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGS  1200
               DR V+YK ++ N+L V T +     +        +++ +YLID VTGRI+H    + +
Sbjct  688   MGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGRIIHSSVQRKA  740

Query  1199  QGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSY  1020
             +GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P+   
Sbjct  741   KGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPI---  791

Query  1019  LRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNP  840
               P+VL   QSY F  ++  +  T T +GITS+ LL+G     +L+L K  LDPRR   P
Sbjct  792   -LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGAILSLPKALLDPRRPEIP  848

Query  839   TQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQ  660
             T+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T+
Sbjct  849   TEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGLDIYQTR  908

Query  659   LAPSKTYDSLTDDFSY  612
             + PSK +D L DD+ Y
Sbjct  909   VYPSKQFDVLKDDYDY  924



>gb|KFQ67260.1| ER membrane protein complex subunit 1, partial [Phaethon lepturus]
Length=968

 Score =   324 bits (830),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 281/995 (28%), Positives = 475/995 (48%), Gaps = 122/995 (12%)
 Frame = -2

Query  3386  QVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDV  3207
             QVG  DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K  
Sbjct  1     QVGKFDWRQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGS  57

Query  3206  IDG-IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKV  3042
              +G ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS    S++ +   +K 
Sbjct  58    PEGAIDAMLIHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQDVVKY  117

Query  3041  DRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDI---------QHIVHPDGTDDVYA  2889
                  +L  ++  LH +S  +G   W + L     +I           +++  GT  ++ 
Sbjct  118   ---VAVLKKAAISLHYLS--NGHQKWVEHLPERQENIFLVEVESTQYQLLYSHGTGVIHV  172

Query  2888  VGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVS  2718
             +G+   S       +   GE+ K   +  P     +G  S+V    +V +D  T S+ V 
Sbjct  173   LGIVPQSHLNILTFSVEDGEITKQGRVAAPWLKSLNGACSMVGEAVLVCVDVDTHSLYVC  232

Query  2717  IIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---  2577
              +  D     +Q+ +  L  +F          T   V+  S+    + +  + F L    
Sbjct  233   SLEMDK--EMKQIPLQSLDLEFADGFQPRILTTQPNVISASRTQFFLQLSPSHFSLLQYK  290

Query  2576  ------LRVTYEGKL---EVVDKVAYGAVISESLSLSEGH----QAFGLIKHGVGKIHLS  2436
                   LR  ++  L       +    AV++    L  G      A   ++    +  L+
Sbjct  291   HGLLSHLRDFHQAALVSFATTGEKTVAAVLTCRSELKPGSSDDLHAGSTLEDSQKQESLT  350

Query  2435  VKS----IN----DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLED  2286
               +    IN    + G  LL+ +   +  Q G    +++I  +++ D S G+RAL+  ED
Sbjct  351   CSNQTYNINLYLVETGQRLLDTTITFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTED  410

Query  2285  HSLLLLQQ-GEIVWSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghl  2124
             H L+ LQQ G++VWSRE+ LA +V +   +LP+     E +G    K +  L  +LK   
Sbjct  411   HMLMFLQQPGKVVWSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLS  470

Query  2123  lklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALH  1959
              +L                  + +S  K++     + RD    +K++++++ SGKL+ + 
Sbjct  471   SQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIE  530

Query  1958  TGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPS  1779
             +  G I+W   +  +R   +       K+   +   H       ++LV        D  +
Sbjct  531   SSSGTILWKQYLRNVRPGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKET  577

Query  1778  VLSFVDSYT---GKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTP  1614
              +SF+  +    GK  ++  PV    I Q + LP  D    ++ LLID +     +P T 
Sbjct  578   KMSFLYVFNPIFGKRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATK  637

Query  1613  EALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQ  1437
               L   +    ++++Y VDA    L G  +K++            T+  W V+ P+E ++
Sbjct  638   NVLRQLEEIAHSVFFYLVDAEQGKLSGFRLKKD----------LTTEESWEVIIPTEVQR  687

Query  1436  IIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIV  1257
             I+    ++ NE VH+Q +V  DR V+YK ++ N+L V T +     +        +++ +
Sbjct  688   IVTVKGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGI  740

Query  1256  YLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNK  1077
             YLID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N 
Sbjct  741   YLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNA  800

Query  1076  DLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIG  897
                       +L +P+     P+VL   QSY F  ++  +  T T +GITS+ LLIG   
Sbjct  801   TAFS------SLDRPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPS  848

Query  896   DQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPA  717
               +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+
Sbjct  849   GAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPS  908

Query  716   KLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   GLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  943



>ref|XP_005544662.1| PREDICTED: ER membrane protein complex subunit 1 isoform X8 [Macaca 
fascicularis]
Length=996

 Score =   324 bits (831),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 288/1016 (28%), Positives = 475/1016 (47%), Gaps = 123/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++     S 
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKPSNSE  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
             +    +  E+SS+ DS                               Q G    +++I  
Sbjct  350   DGSMGSFPEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  409

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  410   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  469

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  470   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  529

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  530   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  582

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  583   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  637

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  638   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  693

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  694   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  748

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +     +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  749   ESTDTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  801

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  802   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  849

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  850   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  909

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  910   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>ref|XP_010612524.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Fukomys 
damarensis]
Length=1015

 Score =   325 bits (832),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 282/1022 (28%), Positives = 493/1022 (48%), Gaps = 121/1022 (12%)
 Frame = -2

Query  3470  PSAMAIRAFLLLVLIFSSAY-------TTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKA  3312
             P+A    A ++  ++FS  +          ++YEDQVG  DW Q+YIGK+K A       
Sbjct  15    PAADCAGAAVMAAVLFSGLWLWAVLLVPAAAVYEDQVGKFDWRQQYIGKLKFASLEF-SP  73

Query  3311  GRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TL  3144
             G K++VV+TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +
Sbjct  74    GSKKLVVATEKNVIAALNSRTGEILWRHV--DKGSAEGAVDAMLLHGQDAVTVSNGGRIM  131

Query  3143  RAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVI  2967
             R+W    G + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + 
Sbjct  132   RSWETNIGGLNWEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLSLHHLSS--GHLK  186

Query  2966  WKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GG  2793
             W + L         +V+  G+  V+A+G+   S   A K N   GE+++   +  P    
Sbjct  187   WVEHLPESDSIHYQVVYSYGSGVVWALGVVPFSHVNAVKFNVEDGEIVQQVRVSTPWLQR  246

Query  2792  FSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKL  2619
              +G   +V +E V+     GS  +  +  +     +Q+ +  L  DF       +LP++ 
Sbjct  247   LTGACGMV-AEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLDFGSGFQPRVLPTQP  305

Query  2618  TGMVAIHINKFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLI  2466
                  +  ++   FL+++         ++G L ++      A++S + +  +   A    
Sbjct  306   N---PVDPSRPQFFLQLSPSHYALLHYHQGTLSLLRHFPQTALVSFATTGEKTVAAVMTC  362

Query  2465  KHGV----------------GKIHLSVKSIN----------DWGSNLLEES--SAIDSQK  2370
             ++ V                  +  SV   N          + G  LL+ +   +++   
Sbjct  363   RNEVKPSSSEDGSLGSFLEKATVQDSVACFNQTYTVNLYLVETGRRLLDTTITFSLEQND  422

Query  2369  GLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSEL  2196
                 +++I  +++ D S G+RAL+  +DH LL LQQ G++V WSRE+ LA +V +   +L
Sbjct  423   TRPERLYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDL  482

Query  2195  PV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-  2034
             P+     E +G    K +  L  +LK    +L       +          + +S  K++ 
Sbjct  483   PLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEI  542

Query  2033  ----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQ  1866
                 + RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+  
Sbjct  543   NIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMV  596

Query  1865  WQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPL  1695
              +   H       ++L+  K  G++S     L   +   GK  ++  PV    + Q + L
Sbjct  597   QRTTAHFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRRVLQSLLL  651

Query  1694  PYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKEN  1518
             P  D    ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++
Sbjct  652   PVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD  711

Query  1517  YFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKN  1338
                        +T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N
Sbjct  712   ----------LSTELSWELTIPLEVQRIVRVKGKRSSEHVHSQGRVMGDRSVLYKSLNPN  761

Query  1337  MLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVV  1158
             +L V T +     +        +++ V+LID VTGRI+H    + ++GPVH V SENWVV
Sbjct  762   LLAVVTESTDGHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVV  814

Query  1157  YHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFF  978
             Y Y+N +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F
Sbjct  815   YQYWNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIF  862

Query  977   AHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTD  798
               SV  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP + 
Sbjct  863   PSSVSAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP  922

Query  797   SLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDF  618
              + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+
Sbjct  923   DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY  982

Query  617   SY  612
              Y
Sbjct  983   DY  984



>ref|XP_007933832.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Orycteropus 
afer afer]
Length=992

 Score =   324 bits (830),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 285/1017 (28%), Positives = 481/1017 (47%), Gaps = 125/1017 (12%)
 Frame = -2

Query  3464  AMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVST  3285
             A+  R +L  +L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+T
Sbjct  4     ALVSRFWLWTLLLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVAT  58

Query  3284  EENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQ  3117
             E+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G 
Sbjct  59    EKNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAVTVSNGGRIMRSWETNIGG  116

Query  3116  MVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEG  2940
             + WE  L SGS  +  ++ V  ++K      +L  ++  LH +SS  G + W + L    
Sbjct  117   LNWEITLDSGSFQALGLVGVQESVKY---IAVLKKTTLTLHHLSS--GHLKWVEHLPESD  171

Query  2939  LDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVT  2766
                  +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V 
Sbjct  172   SIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLRSLTGACGVVD  231

Query  2765  SEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDF----------TGAAVLLPSKLT  2616
                +V  D +   L ++  +      +Q+ +  L  +F          T    + PS+  
Sbjct  232   EAALVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRILATQPNPVDPSRAQ  290

Query  2615  GMVAIHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLS  2436
               + +  N + L     + G L ++   +  A++S +   + G +    +   + ++  S
Sbjct  291   FFLQLSPNHYALLH--YHHGVLSLLKNFSQTALVSFA---TTGEKTVAAVMTCLNEVKPS  345

Query  2435  VKSINDWGSNLLEESSAIDS-------------------------------QKGL-VHKV  2352
                    GS + E+S   DS                               Q G    ++
Sbjct  346   NLEEGSMGS-ISEKSRPKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERL  404

Query  2351  FINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV---  2190
             +I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+   
Sbjct  405   YIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGA  464

Query  2189  --EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----M  2031
               E +G    K +  L  +LK    +L                  + +S  K++     +
Sbjct  465   QAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDTL  524

Query  2030  TRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVP  1854
              RD    +K+++V + SGK++ + +  G I+W  +L N    S         K+   +  
Sbjct  525   ARDEFNLQKMMVVATASGKIFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTT  577

Query  1853  HHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
              H       ++LV  K        S L   +   GK  ++  PV    I Q + LP  D 
Sbjct  578   AHFPHPPQCTLLVKDK----ETGMSALYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQ  633

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDV  1503
                ++ LLID +     +P T   L        +I++Y VDA    L G+ ++++     
Sbjct  634   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELASSIFFYLVDAEQGQLSGYRLRKD-----  688

Query  1502  GDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVA  1323
                    T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V 
Sbjct  689   -----LTTELSWELTIPPEVQRIVTVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVV  743

Query  1322  TVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFN  1143
             T       +   V  + +++ ++LID +TGRI+H    + ++GPVH V SENWVVY Y+N
Sbjct  744   T-------ESTDVHHERTFIGIFLIDGITGRIIHSSVQKKAKGPVHIVHSENWVVYQYWN  796

Query  1142  LRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVK  963
              +A R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S+ 
Sbjct  797   TKARRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSIS  844

Query  962   TIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPII  783
              +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I 
Sbjct  845   AMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIH  904

Query  782   PQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  905   AERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>gb|KFO19169.1| Putative protein KIAA0090 [Fukomys damarensis]
Length=991

 Score =   324 bits (830),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 281/1007 (28%), Positives = 489/1007 (49%), Gaps = 118/1007 (12%)
 Frame = -2

Query  3446  FLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLA  3267
             +L  VL+  +A    ++YEDQVG  DW Q+YIGK+K A       G K++VV+TE+NV+A
Sbjct  10    WLWAVLLVPAA----AVYEDQVGKFDWRQQYIGKLKFASLEF-SPGSKKLVVATEKNVIA  64

Query  3266  SLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESF  3099
             +L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G + WE  
Sbjct  65    ALNSRTGEILWRHV--DKGSAEGAVDAMLLHGQDAVTVSNGGRIMRSWETNIGGLNWEIT  122

Query  3098  L-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHI  2922
             L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L         +
Sbjct  123   LDSGSFQALGLVGLQESV---RYIAVLKKTTLSLHHLSS--GHLKWVEHLPESDSIHYQV  177

Query  2921  VHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVA  2748
             V+  G+  V+A+G+   S   A K N   GE+++   +  P     +G   +V +E V+ 
Sbjct  178   VYSYGSGVVWALGVVPFSHVNAVKFNVEDGEIVQQVRVSTPWLQRLTGACGMV-AEAVLV  236

Query  2747  LDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFL  2574
                 GS  +  +  +     +Q+ +  L  DF       +LP++      +  ++   FL
Sbjct  237   CPDPGSRSLHTLALETEWELRQIPLQSLDLDFGSGFQPRVLPTQPN---PVDPSRPQFFL  293

Query  2573  RVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGV-----------  2454
             +++         ++G L ++      A++S + +  +   A    ++ V           
Sbjct  294   QLSPSHYALLHYHQGTLSLLRHFPQTALVSFATTGEKTVAAVMTCRNEVKPSSSEDGSLG  353

Query  2453  -----GKIHLSVKSIN----------DWGSNLLEES--SAIDSQKGLVHKVFINNYIRTD  2325
                    +  SV   N          + G  LL+ +   +++       +++I  +++ D
Sbjct  354   SFLEKATVQDSVACFNQTYTVNLYLVETGRRLLDTTITFSLEQNDTRPERLYIQVFLKKD  413

Query  2324  RSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVS  2166
              S G+RAL+  +DH LL LQQ G++V WSRE+ LA +V +   +LP+     E +G    
Sbjct  414   DSVGYRALVQTQDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGK  473

Query  2165  KVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKL  2001
             K +  L  +LK    +L       +          + +S  K++     + RD    +K+
Sbjct  474   KADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKM  533

Query  2000  LIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSV  1821
             +++++ SGKL+ + +  G I+W   + +++   +       K+   +   H       ++
Sbjct  534   MVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTL  587

Query  1820  LVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLID  1650
             L+  K  G++S     L   +   GK  ++  PV    + Q + LP  D    ++ LLID
Sbjct  588   LIKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRRVLQSLLLPVMDQDYAKVLLLID  642

Query  1649  TDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKY  1473
              +     +P T   L        +I++Y VDA    L G+ ++++           +T+ 
Sbjct  643   DEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD----------LSTEL  692

Query  1472  VWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDI  1293
              W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +     + 
Sbjct  693   SWELTIPLEVQRIVRVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDGHHE-  751

Query  1292  GSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSV  1113
                    +++ V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E + 
Sbjct  752   ------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTA  805

Query  1112  IEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKG  933
             +E+Y+ +   N           +L +P      P+VL   QSY F  SV  +  T T +G
Sbjct  806   LELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSVSAMEATITERG  853

Query  932   ITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVK  753
             ITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +   
Sbjct  854   ITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQT  913

Query  752   AEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
                +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  914   VSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  960



>ref|XP_006766712.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Myotis 
davidii]
Length=993

 Score =   323 bits (829),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 287/1018 (28%), Positives = 481/1018 (47%), Gaps = 124/1018 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A+A R +L   L+  +A    ++YEDQVG  DW Q+YIGK+K A       G K++VV+
Sbjct  3     AAVACRFWLWAALLIPAA----AVYEDQVGKFDWRQQYIGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R GDI WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGDILWRHV--DKGTAEGAVDAMLLYGQDAVTVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHQLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKL-TGMVAIHIN  2592
                 +V  D +   L ++  +      +++ +  L  D   A+   P  L T    +  +
Sbjct  231   DEAVLVCPDPSSRSLQTLALETEW-ELREIPLQSL--DLEYASGFQPRVLSTQPNPVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         + G L ++  +   A++S +   + G +    +     +   
Sbjct  288   RAQFFLQLSPSHYALLHYHHGVLSLLKNLPQTALVSFA---TTGEKTVAAVMTCRNEAQK  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGLVHKVFINNY--------------------------  2337
             S  S +    +  E+SS  D+         IN Y                          
Sbjct  345   SSSSEDGSLGSFSEKSSPQDTLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPER  404

Query  2336  ------IRTDRSYGFRALIVLEDHSLLLLQQ---GEIVWSREDGLASIVDVTTSELPV--  2190
                   ++ D S G+RAL+  EDH LL LQQ     ++WSRE+ LA +V +   +LP+  
Sbjct  405   LYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKAVLWSREESLAEVVCLEMVDLPLTG  464

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT---  2028
                E +G    K +  L  +LK    +L       +          + +S  K++++   
Sbjct  465   AQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEISIDT  524

Query  2027  --RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQV  1857
               RD    +K+++ ++ SGKL+ + +  G I+W  +L N    S         K+   + 
Sbjct  525   LARDEFNLQKMVVTVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRT  577

Query  1856  PHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYT  1686
               H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  
Sbjct  578   TAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIM  632

Query  1685  DSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKD  1506
             D    ++ LLID +     +P T   L        +I++Y VDA    +G        KD
Sbjct  633   DQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKD  689

Query  1505  VGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFV  1326
             +       T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V
Sbjct  690   L------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAV  743

Query  1325  ATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYF  1146
              T       +   V  + +++ ++L+D VTGRI+H    + ++GPVH V SENWVVY Y+
Sbjct  744   VT-------ESTDVHHERTFIGIFLVDGVTGRIVHSSVQRKAKGPVHIVHSENWVVYQYW  796

Query  1145  NLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSV  966
             N +A R E++V+E+Y+ +   N           +L +P      P+VL   QSY F  S+
Sbjct  797   NTKARRNELTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSI  844

Query  965   KTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPI  786
               +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I
Sbjct  845   SAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQI  904

Query  785   IPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
               + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  905   HAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>gb|KFQ14883.1| ER membrane protein complex subunit 1, partial [Leptosomus discolor]
Length=953

 Score =   323 bits (827),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 278/979 (28%), Positives = 473/979 (48%), Gaps = 113/979 (12%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDI  3189
              Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +G ID 
Sbjct  1     RQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTPEGAIDA  57

Query  3188  AL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLIL  3021
              L  G+  IT+S+G   LR+W    G + WE+ L +GS    S++ +   +K      +L
Sbjct  58    MLIHGQDAITVSNGGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQDVVKY---VAVL  114

Query  3020  IYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINA  2841
               ++  LH +S  +G   W + L         +++  GT  ++ +G+   S       + 
Sbjct  115   KKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSRGTGVIHVLGIVPQSHLNILTFSV  172

Query  2840  RKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLINFQQVHIA  2670
               GE+ K   +  P    FSG  S+V    +V +D  T S+ V  +  +     +Q+ + 
Sbjct  173   EDGEVTKQVRVAAPWLKSFSGVCSVVGEAVLVCMDMGTRSLYVCSLETEQ--EMKQIPLQ  230

Query  2669  DLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTYEGKL-  2550
              L  +F          T   V+  S+    + +  + F L          LR   +  L 
Sbjct  231   SLDLEFADGFQPRVLATQPNVVSASRTQFFLQLSASHFSLLQYKHGLLSHLRDFQQAALV  290

Query  2549  --EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----IN----DWG  2412
                   +    AV++    L    S+G  A   ++    +  L+  +    IN    + G
Sbjct  291   SFATTGEKTVAAVLTCRSELKPGSSDGLHAGSSLEDSRKQESLTCSNQTYNINLYLVETG  350

Query  2411  SNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSR  2241
               LL+ ++  +  Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ G++VWSR
Sbjct  351   QRLLDTTTTFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVVWSR  410

Query  2240  EDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVA  2076
             E+ LA +V +   +LP+     E +G    K +  L  +LK    +L             
Sbjct  411   EESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKM  470

Query  2075  AIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALR  1911
                  + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   +  +R
Sbjct  471   FYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLRNVR  530

Query  1910  KSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---GKEL  1740
                +       K+   +   H       ++LV        D  + +SF+  +    GK  
Sbjct  531   PGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPIFGKRS  577

Query  1739  KILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWY  1566
             ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +    +I++Y
Sbjct  578   QVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAHSIFFY  637

Query  1565  SVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQ  1389
              VDA    L G  +K++           +T+ +W V+ P+E ++I+    ++ NE VH+Q
Sbjct  638   LVDAEQGKLSGFRLKKD----------LSTEEIWEVIIPTEVQRIVTVKGKRSNEHVHSQ  687

Query  1388  AKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTH  1209
              +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTGRI+H    
Sbjct  688   GRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGRIIHSSVQ  740

Query  1208  QGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPV  1029
             + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P+
Sbjct  741   KKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPI  794

Query  1028  SSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT  849
                  P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K  LDPRR 
Sbjct  795   ----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRP  848

Query  848   VNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLF  669
               PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++
Sbjct  849   EIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGLDIY  908

Query  668   FTQLAPSKTYDSLTDDFSY  612
              T++ PSK +D L DD+ Y
Sbjct  909   QTRVYPSKQFDVLKDDYDY  927



>ref|XP_009955203.1| PREDICTED: ER membrane protein complex subunit 1, partial [Leptosomus 
discolor]
Length=974

 Score =   323 bits (828),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 278/979 (28%), Positives = 473/979 (48%), Gaps = 113/979 (12%)
 Frame = -2

Query  3365  HQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDI  3189
              Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +G ID 
Sbjct  1     RQQYVGKLKFASLEASQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTPEGAIDA  57

Query  3188  AL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLIL  3021
              L  G+  IT+S+G   LR+W    G + WE+ L +GS    S++ +   +K      +L
Sbjct  58    MLIHGQDAITVSNGGRILRSWETNIGGLNWETSLDTGSFQVASLVGLQDVVKY---VAVL  114

Query  3020  IYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINA  2841
               ++  LH +S  +G   W + L         +++  GT  ++ +G+   S       + 
Sbjct  115   KKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSRGTGVIHVLGIVPQSHLNILTFSV  172

Query  2840  RKGELLKHESMVFP--GGFSGDISLVTSEKVVALD-STGSILVSIIFKDGLINFQQVHIA  2670
               GE+ K   +  P    FSG  S+V    +V +D  T S+ V  +  +     +Q+ + 
Sbjct  173   EDGEVTKQVRVAAPWLKSFSGVCSVVGEAVLVCMDMGTRSLYVCSLETEQ--EMKQIPLQ  230

Query  2669  DLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTYEGKL-  2550
              L  +F          T   V+  S+    + +  + F L          LR   +  L 
Sbjct  231   SLDLEFADGFQPRVLATQPNVVSASRTQFFLQLSASHFSLLQYKHGLLSHLRDFQQAALV  290

Query  2549  --EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----IN----DWG  2412
                   +    AV++    L    S+G  A   ++    +  L+  +    IN    + G
Sbjct  291   SFATTGEKTVAAVLTCRSELKPGSSDGLHAGSSLEDSRKQESLTCSNQTYNINLYLVETG  350

Query  2411  SNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIVWSR  2241
               LL+ ++  +  Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ G++VWSR
Sbjct  351   QRLLDTTTTFNLEQSGAKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVVWSR  410

Query  2240  EDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVA  2076
             E+ LA +V +   +LP+     E +G    K +  L  +LK    +L             
Sbjct  411   EESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKM  470

Query  2075  AIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALR  1911
                  + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   +  +R
Sbjct  471   FYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLRNVR  530

Query  1910  KSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---GKEL  1740
                +       K+   +   H       ++LV        D  + +SF+  +    GK  
Sbjct  531   PGSS------FKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPIFGKRS  577

Query  1739  KILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWY  1566
             ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +    +I++Y
Sbjct  578   QVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAHSIFFY  637

Query  1565  SVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQ  1389
              VDA    L G  +K++           +T+ +W V+ P+E ++I+    ++ NE VH+Q
Sbjct  638   LVDAEQGKLSGFRLKKD----------LSTEEIWEVIIPTEVQRIVTVKGKRSNEHVHSQ  687

Query  1388  AKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTH  1209
              +V  DR V+YK ++ N+L V T +     +        +++ +YLID VTGRI+H    
Sbjct  688   GRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIYLIDGVTGRIIHSSVQ  740

Query  1208  QGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPV  1029
             + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L +P+
Sbjct  741   KKAKGPVHMVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLDRPI  794

Query  1028  SSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRT  849
                  P+VL   QSY F  ++  +  T T +GITS+ LLIG     +L+L K  LDPRR 
Sbjct  795   ----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRP  848

Query  848   VNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLF  669
               PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++
Sbjct  849   EIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGLDIY  908

Query  668   FTQLAPSKTYDSLTDDFSY  612
              T++ PSK +D L DD+ Y
Sbjct  909   QTRVYPSKQFDVLKDDYDY  927



>ref|NP_001126319.1| ER membrane protein complex subunit 1 precursor [Pongo abelii]
 sp|Q5R7K6.1|EMC1_PONAB RecName: Full=ER membrane protein complex subunit 1; Flags: Precursor 
[Pongo abelii]
 emb|CAH92254.1| hypothetical protein [Pongo abelii]
Length=996

 Score =   323 bits (829),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 279/996 (28%), Positives = 470/996 (47%), Gaps = 117/996 (12%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+ VIT+S+G   +R+W    G + WE  L +GS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDTGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGILS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDS---  2376
             ++      A++S +   + G +    +     ++  +  S +    +  E+SS+ DS   
Sbjct  312   LLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKTSNSEDGSMGSFSEKSSSKDSLAC  368

Query  2375  ----------------------------QKGL-VHKVFINNYIRTDRSYGFRALIVLEDH  2283
                                         Q G    +++I  +++ D S G+RAL+  EDH
Sbjct  369   FNQTYTINLYLVETGRRLLDTTTTFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDH  428

Query  2282  SLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlk  2133
              LL LQQ  G++V WSRE+ LA +V +   +LP+       E +    + ++  L     
Sbjct  429   LLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFL  488

Query  2132  ghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKL  1971
               L      L   T          R   S          + RD    +K++++++ SGKL
Sbjct  489   KRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKL  548

Query  1970  YALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLN  1794
             + + +  G I+W   + +++   +       K+   +   H       ++LV  K  G++
Sbjct  549   FGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLVKDKESGMS  602

Query  1793  SDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPR  1620
             S     L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P 
Sbjct  603   S-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPA  657

Query  1619  TPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESE  1440
             T   L        +I++Y VDA    +G        KD+       T+  W +  P E  
Sbjct  658   TRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVR  708

Query  1439  QIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLI  1260
             +I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T +  A  +        +++ 
Sbjct  709   RIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE-------RTFIG  761

Query  1259  VYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADN  1080
             ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N
Sbjct  762   IFLIDGVTGRIIHSSAQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYN  821

Query  1079  KDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTI  900
                        +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG  
Sbjct  822   ATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLP  869

Query  899   GDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVP  720
                +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P
Sbjct  870   SGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAP  929

Query  719   AKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  930   SGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>ref|XP_004637724.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Octodon 
degus]
Length=996

 Score =   323 bits (829),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 278/996 (28%), Positives = 467/996 (47%), Gaps = 121/996 (12%)
 Frame = -2

Query  3395  YEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGH  3216
             YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV   
Sbjct  23    YEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV--D  79

Query  3215  KDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSN  3051
             K   +G +D  L  G+  IT+SSG   +R+W    G + WE  L SGS  +  ++ +  +
Sbjct  80    KGTAEGTVDAMLLHGQDAITVSSGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQES  139

Query  3050  LKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSS  2871
             +K      +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+   
Sbjct  140   VKY---VAVLKRTTLALHHLSS--GHLKWVEHLPESDNIHYQMVYSYGSGVVWALGVVPF  194

Query  2870  SQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKDGL  2697
             S     K N   GE+++   +  P     +G   +V    +V  D +   L ++  +   
Sbjct  195   SHVNTVKFNVEDGEIVQQVRVSTPWLQRLTGACGVVEEAVLVCPDPSSGSLHTLALETEW  254

Query  2696  INFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFLRVTY-------EGKLEV  2544
                +Q+ +  L  +F       +LP++    V     +F L L  T+       +G L +
Sbjct  255   -ELRQIPLQSLDLEFGSGFQPRVLPTQ-PNPVDPSRPQFFLQLSPTHYALLHYHQGTLSL  312

Query  2543  VDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDSQKGL  2364
             +      A++S +   + G +    +     ++  +  S +    + LE SSA DS    
Sbjct  313   LRNFPQTALVSFA---TTGEKTVAAVMTCRNEVQKASNSEDGSLGSFLETSSAQDSLACF  369

Query  2363  --------------------------------VHKVFINNYIRTDRSYGFRALIVLEDHS  2280
                                               +++I  +++ D S G+RAL+  +DH 
Sbjct  370   NQTYTINLYLAETGRRLLDTTITFSLEQNDTRPERLYIQVFLKKDDSVGYRALVQTQDHL  429

Query  2279  LLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkg  2130
             LL LQQ  G++V WSRE+ LA +V +   +LP+       E +    + ++  L      
Sbjct  430   LLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLK  489

Query  2129  hllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLY  1968
              L      L   T          R   S          + RD    +K++++++ SGKL+
Sbjct  490   RLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLF  549

Query  1967  ALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNS  1791
              + +  G I+W   + +++   +       K+   +   H       ++L+  K  G++S
Sbjct  550   GIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHFPHPPQCTLLIKDKETGMSS  603

Query  1790  DAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRT  1617
                  L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T
Sbjct  604   -----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPAT  658

Query  1616  PEALGIFKRELGNIYWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESE  1440
                L        +I++Y VDA    L G+ ++++            T+  W +  P E +
Sbjct  659   RNVLRQLHELAPSIFFYLVDAEQGRLSGYRLRKD----------LTTELSWELTIPPEVQ  708

Query  1439  QIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLI  1260
             +I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T       +   V  + +++ 
Sbjct  709   RIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-------ESTDVHHERTFIG  761

Query  1259  VYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADN  1080
             V+LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E + +E+Y+ +   N
Sbjct  762   VFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYN  821

Query  1079  KDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTI  900
                        +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG  
Sbjct  822   ATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLP  869

Query  899   GDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVP  720
                +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P
Sbjct  870   SGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAP  929

Query  719   AKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  930   SGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  965



>ref|XP_005544655.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Macaca 
fascicularis]
Length=995

 Score =   323 bits (828),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 290/1016 (29%), Positives = 475/1016 (47%), Gaps = 124/1016 (12%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------  2604
              +V  D +   L ++  +      +Q+ +  L  +F       +LP++   + A      
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFF  292

Query  2603  IHINKFVLFLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSI  2424
             +H++     L   + G L ++      A++S +   + G +    +     ++  S    
Sbjct  293   LHLSPSHYALLQYHYGTLSLLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKPSNSED  349

Query  2423  NDWGSNLLEESSAIDS-------------------------------QKGL-VHKVFINN  2340
                GS   E+SS+ DS                               Q G    +++I  
Sbjct  350   GSMGS-FPEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  469   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  528

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  529   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  581

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  582   HFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ  636

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VDA    +G        KD+ 
Sbjct  637   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL-  692

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T
Sbjct  693   -----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  747

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
              +     +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  748   ESTDTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNT  800

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  801   KARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  848

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  849   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  908

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_009232437.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Pongo 
abelii]
Length=937

 Score =   322 bits (825),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 275/955 (29%), Positives = 463/955 (48%), Gaps = 94/955 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+ VIT+S+G   +R+W    G + WE  L +GS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDTGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVLFLRVTYEGKLEVVDKVAYG  2523
                  +Q+ +   +  F         K    V    N+      V      E     ++ 
Sbjct  253   EW-ELRQIPLQTALVSFATTG----EKTVAAVMACRNE------VQKTSNSEDGSMGSFS  301

Query  2522  AVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEES--SAIDSQKGLVHKVF  2349
                S   SL+  +Q + +  + V           + G  LL+ +   +++       +++
Sbjct  302   EKSSSKDSLACFNQTYTINLYLV-----------ETGRRLLDTTITFSLEQSGTRPERLY  350

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV----  2190
             I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+    
Sbjct  351   IQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQ  410

Query  2189  -EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MT  2028
              E +G    K +  L  +LK    +L       +          + +S  K++     + 
Sbjct  411   AELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  470

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   H
Sbjct  471   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAH  524

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  525   FPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQD  579

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGD  1497
               ++ LLID +     +P T   L        +I++Y VDA    +G        KD+  
Sbjct  580   YAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL--  634

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
                  T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T 
Sbjct  635   ----TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTE  690

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
             +  A  +        +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +
Sbjct  691   STDAHHE-------RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTK  743

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             A R E +V+E+Y+ +   N           +L +P      P+VL   QSY F  S+  +
Sbjct  744   ARRNEFTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAM  791

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
               T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  +
Sbjct  792   EATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAE  851

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  852   RFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  906



>ref|XP_010075621.1| PREDICTED: ER membrane protein complex subunit 1, partial [Pterocles 
gutturalis]
Length=958

 Score =   322 bits (826),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 276/982 (28%), Positives = 472/982 (48%), Gaps = 113/982 (12%)
 Frame = -2

Query  3374  MDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-  3198
              DW Q+Y+GK+K A     + G K+++V+TE+NV+A+L+ R G+I WRHV   K   +G 
Sbjct  2     FDWRQQYVGKLKFASLEALQ-GSKKLIVATEKNVVAALNSRSGEILWRHV--DKGTAEGT  58

Query  3197  IDIAL--GKYVITLS-SGSTLRAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDS  3030
             ID  L  G+  IT+S +G  LR+W    G + WE+ L +GS  + S++ +   +K     
Sbjct  59    IDAMLTHGQDAITVSNAGRILRSWETNIGGLNWETSLDTGSFQTASLVGLQDAVKY---V  115

Query  3029  LILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYK  2850
              +L  ++  LH +S  +G   W + L         +++  GT  ++ +G+   S      
Sbjct  116   AVLKKAAISLHYLS--NGHQKWVEHLPESESTQYQLLYSHGTGVIHVLGIVPQSHLTILT  173

Query  2849  INARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDS-TGSILVSIIFKDGLINFQQV  2679
              +   G++ K   +  P     +G  S+V    +V +D  T S+ V  +  +     +Q+
Sbjct  174   FSVEDGDITKQTRVAAPWLKSLNGMCSVVGEAVLVCVDKDTRSLYVCSLETEQ--EMKQI  231

Query  2678  HIADLVQDF----------TGAAVLLPSKLTGMVAIHINKFVLF---------LRVTYEG  2556
              +  L  +F          T   V+  S+    + +  + F L          LR   + 
Sbjct  232   PLQSLELEFADGFQPRILATQPNVIAASRTQFFLQLSPSHFSLLQYKHGLLSHLRDFQQA  291

Query  2555  KL---EVVDKVAYGAVISESLSL----SEGHQAFGLIKHGVGKIHLSVKS----IN----  2421
              L       +    AV++    L    S+G +A   ++    +  L+  +    IN    
Sbjct  292   ALVSFATTGEKTVAAVLTCRSELKPGSSDGVRAGSALEDSRTQDSLTCSNQTYNINLYLV  351

Query  2420  DWGSNLLEESSAID-SQKGL-VHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV  2250
             + G  LL+ +      Q G    +++I  +++ D S G+RAL+  EDH L+ LQQ G++V
Sbjct  352   ETGQRLLDTTITFTLEQSGTKPQQLYIQVFLKKDDSVGYRALVQTEDHMLMFLQQPGKVV  411

Query  2249  WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPD  2085
             WSRE+ LA +V +   +LP+     E +G    K +  L  +LK    +L          
Sbjct  412   WSREESLAEVVSLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTAHL  471

Query  2084  DVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVN  1920
                     + +S  K++     + RD    +K++++++ SGKL+ + +  G I+W   + 
Sbjct  472   WKMFYDARKPRSQIKNEINIDNLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLR  531

Query  1919  ALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGKCGLNSDAPSVLSFVDSYT---G  1749
              +R        +  K+   +   H       ++LV        D  + +SF+  +    G
Sbjct  532   NVRPG------SSFKLMVQRTTAHFPHPPQCTLLV-------KDKETKMSFLYVFNPIFG  578

Query  1748  KELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNI  1575
             K  ++  PV    I Q + LP  D    ++ LLID +     +P T   L   +    +I
Sbjct  579   KRSQVAPPVLKRPILQTLLLPIMDQDYAKVLLLIDDEYKVTAFPATKNVLRQLEEIAHSI  638

Query  1574  YWYSVDANN-ILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVV  1398
             ++Y VDA    L G  +K++            T+  W VV P+E ++I+    ++ +E V
Sbjct  639   FFYLVDAEQGKLSGFRLKKD----------LTTEESWEVVIPTEVQRIVTVKGKRSSEHV  688

Query  1397  HTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHR  1218
             H+Q +V  DR V+YK ++ N+L V T       +      + +++ +YLID VTGRI+H 
Sbjct  689   HSQGRVMGDRSVLYKSLNPNLLAVVT-------ESADTHHERTFIGIYLIDGVTGRIIHS  741

Query  1217  MTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLT  1038
                + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N           +L 
Sbjct  742   SVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFS------SLD  795

Query  1037  KPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDP  858
             +P+     P+VL   QSY F  ++  +  T T +GITS+ LL+G     +L+L K  LDP
Sbjct  796   RPI----LPQVL--QQSYIFPSAISAMEATITERGITSRHLLVGLPSGAILSLPKALLDP  849

Query  857   RRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGV  678
             RR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+
Sbjct  850   RRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTISRMRGIYTAPSGLESTCLVVAYGL  909

Query  677   DLFFTQLAPSKTYDSLTDDFSY  612
             D++ T++ PSK +D L DD+ Y
Sbjct  910   DIYQTRVYPSKQFDVLKDDYDY  931



>ref|XP_010612523.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Fukomys 
damarensis]
Length=1018

 Score =   323 bits (828),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 280/1025 (27%), Positives = 486/1025 (47%), Gaps = 124/1025 (12%)
 Frame = -2

Query  3470  PSAMAIRAFLLLVLIFSSAY-------TTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKA  3312
             P+A    A ++  ++FS  +          ++YEDQVG  DW Q+YIGK+K A       
Sbjct  15    PAADCAGAAVMAAVLFSGLWLWAVLLVPAAAVYEDQVGKFDWRQQYIGKLKFASLEF-SP  73

Query  3311  GRKRVVVSTEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TL  3144
             G K++VV+TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  +T+S+G   +
Sbjct  74    GSKKLVVATEKNVIAALNSRTGEILWRHV--DKGSAEGAVDAMLLHGQDAVTVSNGGRIM  131

Query  3143  RAWNLPDGQMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVI  2967
             R+W    G + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + 
Sbjct  132   RSWETNIGGLNWEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLSLHHLSS--GHLK  186

Query  2966  WKKELANEGLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GG  2793
             W + L         +V+  G+  V+A+G+   S   A K N   GE+++   +  P    
Sbjct  187   WVEHLPESDSIHYQVVYSYGSGVVWALGVVPFSHVNAVKFNVEDGEIVQQVRVSTPWLQR  246

Query  2792  FSGDISLVTSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKL  2619
              +G   +V +E V+     GS  +  +  +     +Q+ +  L  DF       +LP++ 
Sbjct  247   LTGACGMV-AEAVLVCPDPGSRSLHTLALETEWELRQIPLQSLDLDFGSGFQPRVLPTQP  305

Query  2618  TGMVAIHINKFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLI  2466
                  +  ++   FL+++         ++G L ++      A++S + +  +   A    
Sbjct  306   N---PVDPSRPQFFLQLSPSHYALLHYHQGTLSLLRHFPQTALVSFATTGEKTVAAVMTC  362

Query  2465  KHGV----------------GKIHLSVKSIN----------DWGSNLLEES--SAIDSQK  2370
             ++ V                  +  SV   N          + G  LL+ +   +++   
Sbjct  363   RNEVKPSSSEDGSLGSFLEKATVQDSVACFNQTYTVNLYLVETGRRLLDTTITFSLEQND  422

Query  2369  GLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSEL  2196
                 +++I  +++ D S G+RAL+  +DH LL LQQ G++V WSRE+ LA +V +   +L
Sbjct  423   TRPERLYIQVFLKKDDSVGYRALVQTQDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDL  482

Query  2195  PV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS---  2046
             P+       E +    + ++  L       L      L   T          R   S   
Sbjct  483   PLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIK  542

Query  2045  ---GKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLK  1875
                    + RD    +K++++++ SGKL+ + +  G I+W   + +++   +       K
Sbjct  543   NEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FK  596

Query  1874  IYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQV  1704
             +   +   H       ++L+  K  G++S     L   +   GK  ++  PV    + Q 
Sbjct  597   LMVQRTTAHFPHPPQCTLLIKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRRVLQS  651

Query  1703  IPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANN-ILRGHAV  1527
             + LP  D    ++ LLID +     +P T   L        +I++Y VDA    L G+ +
Sbjct  652   LLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYRL  711

Query  1526  KENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYI  1347
             +++           +T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK +
Sbjct  712   RKD----------LSTELSWELTIPLEVQRIVRVKGKRSSEHVHSQGRVMGDRSVLYKSL  761

Query  1346  SKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSEN  1167
             + N+L V T +     +        +++ V+LID VTGRI+H    + ++GPVH V SEN
Sbjct  762   NPNLLAVVTESTDGHHE-------RTFIGVFLIDGVTGRIIHSSVQKKAKGPVHIVHSEN  814

Query  1166  WVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQS  987
             WVVY Y+N +A R E + +E+Y+ +   N           +L +P      P+VL   QS
Sbjct  815   WVVYQYWNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQS  862

Query  986   YFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIP  807
             Y F  SV  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP
Sbjct  863   YIFPSSVSAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIP  922

Query  806   LTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLT  627
              +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L 
Sbjct  923   YSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLK  982

Query  626   DDFSY  612
             DD+ Y
Sbjct  983   DDYDY  987



>ref|XP_004457492.1| PREDICTED: ER membrane protein complex subunit 1 isoform 2 [Dasypus 
novemcinctus]
Length=992

 Score =   323 bits (827),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 285/1013 (28%), Positives = 486/1013 (48%), Gaps = 119/1013 (12%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             +A R +L   ++ S+A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE
Sbjct  5     LAYRFWLWAAILISAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATE  59

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQM  3114
             +NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G +
Sbjct  60    KNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGL  117

Query  3113  VWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGL  2937
              WE  L SGS  +  ++ +   +   R   +L  ++  LH ++  +G + W ++L     
Sbjct  118   NWEITLDSGSFQALGLVGLQETV---RYIAVLKKTTLALHHLA--NGHLKWVEQLPESDS  172

Query  2936  DIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTS  2763
                 +VH  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V  
Sbjct  173   IHYQMVHSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV-D  231

Query  2762  EKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINK  2589
             E V+     GS  +  +  +     +Q+ +  L  +F       +LP++   M     ++
Sbjct  232   EAVLVCPDPGSHSLQTLALETEWELRQIPLQSLELEFGSGFQPRILPTQPNPM---DRSR  288

Query  2588  FVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKH--------  2460
                FL+++         + G L ++      A++S + +  +   A    ++        
Sbjct  289   AQFFLQLSPSHYALLHYHHGSLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEAKPGSSE  348

Query  2459  --GVGKIHL------SVKSIN----------DWGSNLLEESSAIDSQKGLVH--KVFINN  2340
                VG          S+   N          + G  LL+ +  +  ++      +++I  
Sbjct  349   DGSVGSFSEKSSPKDSLTCFNQTYTINLYLVETGRRLLDTTIMVSLEQNSTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EK  2184
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+     E 
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2183  DGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDH  2019
             +G    K +  L  +LK    +L                  + +S  K++     + RD 
Sbjct  469   EGEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDTLARDE  528

Query  2018  NGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHA  1842
                +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H  
Sbjct  529   FNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFP  581

Query  1841  MDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQ  1671
                  ++LV  K  G++S     L   +   GK  ++  P+    + Q + LP  D    
Sbjct  582   HPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPILKRPVLQSLLLPIMDQDYA  636

Query  1670  RLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDY  1491
             ++ LLID +     +P T   L        +I++Y VDA    +G        KD+    
Sbjct  637   KVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGQLCGYRLRKDL----  689

Query  1490  YFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAP  1311
                T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T   
Sbjct  690   --TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLTVVT---  744

Query  1310  KAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAH  1131
               + D+     + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A 
Sbjct  745   -ESTDMHH---ERTFIGIFLIDGVTGRIIHSSIQKKAKGPVHIVHSENWVVYQYWNTKAR  800

Query  1130  RYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAV  951
             R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  
Sbjct  801   RNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEA  848

Query  950   TSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSY  771
             T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + +
Sbjct  849   TITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERF  908

Query  770   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   INYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_003891273.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Papio 
anubis]
Length=993

 Score =   322 bits (826),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 283/994 (28%), Positives = 474/994 (48%), Gaps = 116/994 (12%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+  IT+S+G   +R+W    G + WE  L SGS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFRSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDS---  2376
             ++      A++S +   + G +    +     ++     S +    +  E+SS+ DS   
Sbjct  312   LLKNFPQTALVSFA---TTGEKTVAAVMACRNEVQKPSNSEDGSMGSFPEKSSSKDSLAC  368

Query  2375  ----------------------------QKGL-VHKVFINNYIRTDRSYGFRALIVLEDH  2283
                                         Q G    +++I  +++ D S G+RAL+  EDH
Sbjct  369   FNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDH  428

Query  2282  SLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkgh  2127
              LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK  
Sbjct  429   LLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRL  488

Query  2126  llklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYAL  1962
               +L       +          + +S  K++     + RD    +K++++++ SGKL+ +
Sbjct  489   SSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGI  548

Query  1961  HTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSD  1788
              +  G I+W  +L N    S         K+   +   H       ++LV  K  G++S 
Sbjct  549   ESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS-  600

Query  1787  APSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTP  1614
                 L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T 
Sbjct  601   ----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATR  656

Query  1613  EALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
               L        +I++Y VDA    +G        KD+       T+  W +  P E ++I
Sbjct  657   NVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRI  707

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
             +    ++ +E VH+Q +V  DR V+YK ++ N+L V T +     +        +++ ++
Sbjct  708   VKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIF  760

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N  
Sbjct  761   LIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNAT  820

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
                      +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG    
Sbjct  821   AFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSG  868

Query  893   QVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAK  714
              +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ 
Sbjct  869   AILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSG  928

Query  713   LESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  929   LESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  962



>ref|XP_004457493.1| PREDICTED: ER membrane protein complex subunit 1 isoform 3 [Dasypus 
novemcinctus]
Length=991

 Score =   322 bits (826),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 285/1012 (28%), Positives = 486/1012 (48%), Gaps = 118/1012 (12%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             +A R +L   ++ S+A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE
Sbjct  5     LAYRFWLWAAILISAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATE  59

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQM  3114
             +NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G +
Sbjct  60    KNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGL  117

Query  3113  VWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGL  2937
              WE  L SGS  +  ++ +   +   R   +L  ++  LH ++  +G + W ++L     
Sbjct  118   NWEITLDSGSFQALGLVGLQETV---RYIAVLKKTTLALHHLA--NGHLKWVEQLPESDS  172

Query  2936  DIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTS  2763
                 +VH  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V  
Sbjct  173   IHYQMVHSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV-D  231

Query  2762  EKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINK  2589
             E V+     GS  +  +  +     +Q+ +  L  +F       +LP++   M     ++
Sbjct  232   EAVLVCPDPGSHSLQTLALETEWELRQIPLQSLELEFGSGFQPRILPTQPNPM---DRSR  288

Query  2588  FVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKH--------  2460
                FL+++         + G L ++      A++S + +  +   A    ++        
Sbjct  289   AQFFLQLSPSHYALLHYHHGSLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEAKPGSSE  348

Query  2459  --GVGKIHL------SVKSIN----------DWGSNLLEESSAIDSQKGLVH--KVFINN  2340
                VG          S+   N          + G  LL+ +  +  ++      +++I  
Sbjct  349   DGSVGSFSEKSSPKDSLTCFNQTYTINLYLVETGRRLLDTTIMVSLEQNSTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----EKD  2181
             +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     E +
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQAELE  468

Query  2180  GVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHN  2016
             G    K +  L  +LK    +L                  + +S  K++     + RD  
Sbjct  469   GEFGKKADGLLGMFLKRLSSQLILLQAWTAHLWKMFYDARKPRSQIKNEINIDTLARDEF  528

Query  2015  GFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAM  1839
               +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H   
Sbjct  529   NLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPH  581

Query  1838  DENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQR  1668
                 ++LV  K  G++S     L   +   GK  ++  P+    + Q + LP  D    +
Sbjct  582   PPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPILKRPVLQSLLLPIMDQDYAK  636

Query  1667  LHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYY  1488
             + LLID +     +P T   L        +I++Y VDA    +G        KD+     
Sbjct  637   VLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGQLCGYRLRKDL-----  688

Query  1487  FATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPK  1308
               T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T    
Sbjct  689   -TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLTVVT----  743

Query  1307  AAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHR  1128
              + D+     + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R
Sbjct  744   ESTDMHH---ERTFIGIFLIDGVTGRIIHSSIQKKAKGPVHIVHSENWVVYQYWNTKARR  800

Query  1127  YEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVT  948
              E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +  T
Sbjct  801   NEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEAT  848

Query  947   STAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYV  768
              T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++
Sbjct  849   ITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI  908

Query  767   THAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  909   NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  960



>ref|XP_006145275.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1 [Tupaia chinensis]
Length=992

 Score =   322 bits (826),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 287/1016 (28%), Positives = 474/1016 (47%), Gaps = 121/1016 (12%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             M    F L  ++F  A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE
Sbjct  1     MLTLCFWLWAVLFILAA---AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATE  56

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQM  3114
             +NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G +
Sbjct  57    KNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGL  114

Query  3113  VWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGL  2937
              WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L     
Sbjct  115   NWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHYLSS--GHLKWAEHLPESDS  169

Query  2936  DIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTS  2763
                 +V+  G+  V+A+GL   S     K N   GE+     +  P     +G   +V  
Sbjct  170   IHYQMVYSYGSGMVWALGLVPFSHVNIVKFNVEDGEVFPXVRVSTPWLQHLTGACGVVDE  229

Query  2762  EKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINK  2589
               +V  D +   L ++  +      +Q+ +  L  +F       +LP++      +  ++
Sbjct  230   AVLVCPDPSSRSLQTLALETEW-ELRQIPLQSLGLEFGSGFQPRVLPTQPN---PVDPSR  285

Query  2588  FVLFLRVT---------YEGKLEVVDKVAYGAVISESL------------------SLSE  2490
                FL+++         + G L ++      A++S +                   S SE
Sbjct  286   AQFFLQLSPSHYALLHYHHGVLSLLKNFPQTALVSFATTGEKTVAAVMTCRSEVKPSSSE  345

Query  2489  GHQAFGLIKHGVGKIHLSV----KSIN----DWGSNLLEE--SSAIDSQKGLVHKVFINN  2340
                A G  +    K  L+      +IN    + G  LL+   +  ++       +++I  
Sbjct  346   DGSAGGFSEKSAPKDSLTCFNQTYTINLYLVETGRRLLDTGITFGLEQNGTRPERLYIQV  405

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  406   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  465

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSS------GKSKMT  2028
             E +    + ++  L       L      L   T          R   S          + 
Sbjct  466   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLA  525

Query  2027  RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPH  1851
             RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   
Sbjct  526   RDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTA  578

Query  1850  HHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDS  1680
             H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D 
Sbjct  579   HFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLRRPILQSLLLPVMDQ  633

Query  1679  TEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVG  1500
                ++ LLID +     +P T   L        +I++Y VD+    +G        KD+ 
Sbjct  634   DYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDSE---QGRLCGYRLRKDL-  689

Query  1499  DDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVAT  1320
                   T+  W +  P E ++I+    ++ NE VH+Q +V  DR V+YK ++ N+L V T
Sbjct  690   -----TTELSWELTIPPEVQRIVEVKGKRSNEHVHSQGRVMGDRSVLYKSLNPNLLAVVT  744

Query  1319  VAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNL  1140
                    +      + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY Y+N 
Sbjct  745   -------ESADTHHERTFIGIFLIDGVTGRIVHSSVQKKAKGPVHIVHSENWVVYQYWNT  797

Query  1139  RAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKT  960
             +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  
Sbjct  798   KARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISA  845

Query  959   IAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIP  780
             +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  
Sbjct  846   MEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHA  905

Query  779   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  906   ERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_006766713.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Myotis 
davidii]
 gb|ELK27927.1| hypothetical protein MDA_GLEAN10024282 [Myotis davidii]
Length=992

 Score =   322 bits (826),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 288/1018 (28%), Positives = 480/1018 (47%), Gaps = 125/1018 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A+A R +L   L+  +A    ++YEDQVG  DW Q+YIGK+K A       G K++VV+
Sbjct  3     AAVACRFWLWAALLIPAA----AVYEDQVGKFDWRQQYIGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R GDI WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGDILWRHV--DKGTAEGAVDAMLLYGQDAVTVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHQLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKL-TGMVAIHIN  2592
                 +V  D +   L ++  +      +++ +  L  D   A+   P  L T    +  +
Sbjct  231   DEAVLVCPDPSSRSLQTLALETEW-ELREIPLQSL--DLEYASGFQPRVLSTQPNPVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         + G L ++  +   A++S +   + G +    +     +   
Sbjct  288   RAQFFLQLSPSHYALLHYHHGVLSLLKNLPQTALVSFA---TTGEKTVAAVMTCRNEAKS  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGLVHKVFINNY--------------------------  2337
             S       GS   E+SS  D+         IN Y                          
Sbjct  345   SSSEDGSLGS-FSEKSSPQDTLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPER  403

Query  2336  ------IRTDRSYGFRALIVLEDHSLLLLQQ---GEIVWSREDGLASIVDVTTSELPV--  2190
                   ++ D S G+RAL+  EDH LL LQQ     ++WSRE+ LA +V +   +LP+  
Sbjct  404   LYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKAVLWSREESLAEVVCLEMVDLPLTG  463

Query  2189  ---EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSKMT---  2028
                E +G    K +  L  +LK    +L       +          + +S  K++++   
Sbjct  464   AQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEISIDT  523

Query  2027  --RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQV  1857
               RD    +K+++ ++ SGKL+ + +  G I+W  +L N    S         K+   + 
Sbjct  524   LARDEFNLQKMVVTVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRT  576

Query  1856  PHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYT  1686
               H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  
Sbjct  577   TAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIM  631

Query  1685  DSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKD  1506
             D    ++ LLID +     +P T   L        +I++Y VDA    +G        KD
Sbjct  632   DQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKD  688

Query  1505  VGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFV  1326
             +       T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V
Sbjct  689   L------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAV  742

Query  1325  ATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYF  1146
              T       +   V  + +++ ++L+D VTGRI+H    + ++GPVH V SENWVVY Y+
Sbjct  743   VT-------ESTDVHHERTFIGIFLVDGVTGRIVHSSVQRKAKGPVHIVHSENWVVYQYW  795

Query  1145  NLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSV  966
             N +A R E++V+E+Y+ +   N           +L +P      P+VL   QSY F  S+
Sbjct  796   NTKARRNELTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSI  843

Query  965   KTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPI  786
               +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I
Sbjct  844   SAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQI  903

Query  785   IPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
               + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  904   HAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_006766711.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Myotis 
davidii]
Length=996

 Score =   322 bits (826),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 286/1021 (28%), Positives = 478/1021 (47%), Gaps = 127/1021 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A+A R +L   L+  +A    ++YEDQVG  DW Q+YIGK+K A       G K++VV+
Sbjct  3     AAVACRFWLWAALLIPAA----AVYEDQVGKFDWRQQYIGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R GDI WRHV   K   +G +D  L  G+  +T+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGDILWRHV--DKGTAEGAVDAMLLYGQDAVTVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYVAVLKKTTLALHQLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKL-TGMVAIHIN  2592
                 +V  D +   L ++  +      +++ +  L  D   A+   P  L T    +  +
Sbjct  231   DEAVLVCPDPSSRSLQTLALETEW-ELREIPLQSL--DLEYASGFQPRVLSTQPNPVDPS  287

Query  2591  KFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL  2439
             +   FL+++         + G L ++  +   A++S +   + G +    +     +   
Sbjct  288   RAQFFLQLSPSHYALLHYHHGVLSLLKNLPQTALVSFA---TTGEKTVAAVMTCRNEAQK  344

Query  2438  SVKSINDWGSNLLEESSAIDSQKGLVHKVFINNY--------------------------  2337
             S  S +    +  E+SS  D+         IN Y                          
Sbjct  345   SSSSEDGSLGSFSEKSSPQDTLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPER  404

Query  2336  ------IRTDRSYGFRALIVLEDHSLLLLQQ---GEIVWSREDGLASIVDVTTSELP---  2193
                   ++ D S G+RAL+  EDH LL LQQ     ++WSRE+ LA +V +   +LP   
Sbjct  405   LYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKAVLWSREESLAEVVCLEMVDLPLTG  464

Query  2192  ----VEKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRL-KSSGKSKMT  2028
                 +E +    + ++  L       L      L   T          R  +S  K++++
Sbjct  465   AQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEIS  524

Query  2027  -----RDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQ  1866
                  RD    +K+++ ++ SGKL+ + +  G I+W  +L N    S         K+  
Sbjct  525   IDTLARDEFNLQKMVVTVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMV  577

Query  1865  WQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPL  1695
              +   H       ++LV  K  G++S     L   +   GK  ++  PV    I Q + L
Sbjct  578   QRTTAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLL  632

Query  1694  PYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENY  1515
             P  D    ++ LLID +     +P T   L        +I++Y VDA    +G       
Sbjct  633   PIMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRL  689

Query  1514  FKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNM  1335
              KD+       T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+
Sbjct  690   RKDL------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNL  743

Query  1334  LFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVY  1155
             L V T       +   V  + +++ ++L+D VTGRI+H    + ++GPVH V SENWVVY
Sbjct  744   LAVVT-------ESTDVHHERTFIGIFLVDGVTGRIVHSSVQRKAKGPVHIVHSENWVVY  796

Query  1154  HYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFA  975
              Y+N +A R E++V+E+Y+ +   N           +L +P      P+VL   QSY F 
Sbjct  797   QYWNTKARRNELTVLELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFP  844

Query  974   HSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDS  795
              S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  
Sbjct  845   SSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPD  904

Query  794   LPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  615
             + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ 
Sbjct  905   VQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYD  964

Query  614   Y  612
             Y
Sbjct  965   Y  965



>ref|XP_009198830.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Papio 
anubis]
Length=992

 Score =   322 bits (825),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 285/994 (29%), Positives = 474/994 (48%), Gaps = 117/994 (12%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+  IT+S+G   +R+W    G + WE  L SGS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  LH +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     SG   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVA------IHINKFVLFLRVTYEGKLE  2547
                  +Q+ +  L  +F       +LP++   + A      +H++     L   + G L 
Sbjct  253   EW-ELRQIPLQSLDLEFRSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLS  311

Query  2546  VVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLLEESSAIDS---  2376
             ++      A++S +   + G +    +     ++  S       GS   E+SS+ DS   
Sbjct  312   LLKNFPQTALVSFA---TTGEKTVAAVMACRNEVKPSNSEDGSMGS-FPEKSSSKDSLAC  367

Query  2375  ----------------------------QKGL-VHKVFINNYIRTDRSYGFRALIVLEDH  2283
                                         Q G    +++I  +++ D S G+RAL+  EDH
Sbjct  368   FNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDH  427

Query  2282  SLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-----EKDGVSVSKVEQNLFEWlkgh  2127
              LL LQQ  G++V WSRE+ LA +V +   +LP+     E +G    K +  L  +LK  
Sbjct  428   LLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRL  487

Query  2126  llklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTRDHNGFRKLLIVLSRSGKLYAL  1962
               +L       +          + +S  K++     + RD    +K++++++ SGKL+ +
Sbjct  488   SSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGI  547

Query  1961  HTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSD  1788
              +  G I+W  +L N    S         K+   +   H       ++LV  K  G++S 
Sbjct  548   ESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS-  599

Query  1787  APSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTP  1614
                 L   +   GK  ++  PV    I Q + LP  D    ++ LLID +     +P T 
Sbjct  600   ----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATR  655

Query  1613  EALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQI  1434
               L        +I++Y VDA    +G        KD+       T+  W +  P E ++I
Sbjct  656   NVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRI  706

Query  1433  IATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVY  1254
             +    ++ +E VH+Q +V  DR V+YK ++ N+L V T +     +        +++ ++
Sbjct  707   VKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIF  759

Query  1253  LIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKD  1074
             LID VTGRI+H    + ++GPVH V SENWVVY Y+N +A R E +V+E+Y+ +   N  
Sbjct  760   LIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNAT  819

Query  1073  LLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGD  894
                      +L +P      P+VL   QSY F  S+  +  T T +GITS+ LLIG    
Sbjct  820   AFS------SLDRPQ----LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSG  867

Query  893   QVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAK  714
              +L+L K  LDPRR   PT+  +E+ +IP +  + I  + ++ +      +RGI T P+ 
Sbjct  868   AILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSG  927

Query  713   LESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  928   LESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_008998778.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Callithrix 
jacchus]
Length=975

 Score =   322 bits (824),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 275/976 (28%), Positives = 468/976 (48%), Gaps = 98/976 (10%)
 Frame = -2

Query  3401  SLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVLASLDLRHGDIFWRHVL  3222
             ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+NV+A+L+ R G+I WRHV 
Sbjct  21    AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEKNVIAALNSRTGEILWRHV-  78

Query  3221  GHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMVWESFL-SGSSPSRSILLVP  3057
               K   +G +D  L  G+  IT+S+G   +R+W    G + WE  L SGS  +  ++ + 
Sbjct  79    -DKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQ  137

Query  3056  SNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLDIQHIVHPDGTDDVYAVGLT  2877
              ++   R   +L  ++  L+ +SS  G + W + L         +V+  G+  V+A+G+ 
Sbjct  138   ESV---RYIAVLKKTTLALYHLSS--GHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVV  192

Query  2876  SSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSEKVVALDSTGSILVSIIFKD  2703
               S     K N   GE+++   +  P     +G   +V    +V  D +   L ++  + 
Sbjct  193   PFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLTGACGMVDEAVLVCPDPSSRSLQTLALET  252

Query  2702  GLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINKFVLFLRVT---------YEG  2556
                  +Q+ +  L  +F       +LP++      +  ++   FL+++         + G
Sbjct  253   EW-ELRQIPLQSLDLEFGSGFQPRVLPTQPN---PVDSSRAQFFLQLSPSHYALLQYHYG  308

Query  2555  KLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHL--SVKSIN----DWGSNLLEE  2394
              L ++      A++S + +  +   A    ++ V  +       +IN    + G  LL+ 
Sbjct  309   TLSLLKNFPQTALVSFATTGEKTVTAVMTCRNEVDSLACFNQTYTINLYLVETGRRLLDT  368

Query  2393  S--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGL  2229
             +   +++       +++I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ L
Sbjct  369   TITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESL  428

Query  2228  ASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAI  2070
             A +V +   +LP+       E +    + ++  L       L      L   T       
Sbjct  429   AEVVSLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWKMF  488

Query  2069  QQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALR  1911
                R   S          + RD    +K++++++ SGKL+ + +  G I+W  +L N   
Sbjct  489   YDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKP  548

Query  1910  KSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKI  1734
              S         K+   +   H       ++LV  K  G++S     L   +   GK  ++
Sbjct  549   DS-------SFKLMVQRTTAHFPHPPQCTLLVKDKELGMSS-----LYVFNPIFGKWSQV  596

Query  1733  LKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSV  1560
               PV    I Q + LP  D    ++ LLID +     +P T   L        +I++Y V
Sbjct  597   APPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTPFPATRNVLRQLHELAPSIFFYLV  656

Query  1559  DANNILRGHAVKENYFKDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKV  1380
             DA    +G        KD+       T+  W +  P E ++I+    ++ +E VH+Q +V
Sbjct  657   DAE---QGRLCGYRLRKDL------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRV  707

Query  1379  TTDRDVMYKYISKNMLFVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGS  1200
               DR V+YK ++ N+L V T +     +        +++ ++LID VTGRI+H    + +
Sbjct  708   MGDRSVLYKSLNPNLLAVVTESTDTHHE-------RTFIGIFLIDGVTGRIIHSSVQKKA  760

Query  1199  QGPVHAVLSENWVVYHYFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSY  1020
             +GPVH V SENWVVY Y+N +A R E + +E+Y+ +   N           +L +P    
Sbjct  761   KGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ---  811

Query  1019  LRPEVLAKSQSYFFAHSVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNP  840
               P+VL   QSY F  S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   P
Sbjct  812   -LPQVL--QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIP  868

Query  839   TQAEKEDGIIPLTDSLPIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQ  660
             T+  +E+ +IP +  + I  + ++ +      +RGI T P+ LEST LV AYG+D++ T+
Sbjct  869   TEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTR  928

Query  659   LAPSKTYDSLTDDFSY  612
             + PSK +D L DD+ Y
Sbjct  929   VYPSKQFDVLKDDYDY  944



>ref|XP_004457491.1| PREDICTED: ER membrane protein complex subunit 1 isoform 1 [Dasypus 
novemcinctus]
Length=995

 Score =   322 bits (825),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 285/1020 (28%), Positives = 488/1020 (48%), Gaps = 130/1020 (13%)
 Frame = -2

Query  3461  MAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTE  3282
             +A R +L   ++ S+A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE
Sbjct  5     LAYRFWLWAAILISAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATE  59

Query  3281  ENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQM  3114
             +NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G +
Sbjct  60    KNVIAALNSRTGEILWRHV--DKGTPEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGL  117

Query  3113  VWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGL  2937
              WE  L SGS  +  ++ +   +   R   +L  ++  LH ++  +G + W ++L     
Sbjct  118   NWEITLDSGSFQALGLVGLQETV---RYIAVLKKTTLALHHLA--NGHLKWVEQLPESDS  172

Query  2936  DIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTS  2763
                 +VH  G+  V+A+G+   S     K N   GE+++   +  P     +G   +V  
Sbjct  173   IHYQMVHSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLTGACGVV-D  231

Query  2762  EKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHINK  2589
             E V+     GS  +  +  +     +Q+ +  L  +F       +LP++   M     ++
Sbjct  232   EAVLVCPDPGSHSLQTLALETEWELRQIPLQSLELEFGSGFQPRILPTQPNPM---DRSR  288

Query  2588  FVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKH--------  2460
                FL+++         + G L ++      A++S + +  +   A    ++        
Sbjct  289   AQFFLQLSPSHYALLHYHHGSLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEAKPGSSE  348

Query  2459  --GVGKIHL------SVKSIN----------DWGSNLLEESSAIDSQKGLVH--KVFINN  2340
                VG          S+   N          + G  LL+ +  +  ++      +++I  
Sbjct  349   DGSVGSFSEKSSPKDSLTCFNQTYTINLYLVETGRRLLDTTIMVSLEQNSTRPERLYIQV  408

Query  2339  YIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSREDGLASIVDVTTSELPV-------  2190
             +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+ LA +V +   +LP+       
Sbjct  409   FLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAEL  468

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQM-----RLKSSGKSK---  2034
             E +    + ++  L       L      L   T    A + +M     + +S  K++   
Sbjct  469   EGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWT----AHLWKMFYDARKPRSQIKNEINI  524

Query  2033  --MTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQW  1863
               + RD    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   
Sbjct  525   DTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQ  577

Query  1862  QVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLP  1692
             +   H       ++LV  K  G++S     L   +   GK  ++  P+    + Q + LP
Sbjct  578   RTTAHFPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPILKRPVLQSLLLP  632

Query  1691  YTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYF  1512
               D    ++ LLID +     +P T   L        +I++Y VDA    +G        
Sbjct  633   IMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGQLCGYRLR  689

Query  1511  KDVGDDYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNML  1332
             KD+       T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L
Sbjct  690   KDL------TTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLL  743

Query  1331  FVATVAPKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYH  1152
              V T     + D+     + +++ ++LID VTGRI+H    + ++GPVH V SENWVVY 
Sbjct  744   TVVT----ESTDMHH---ERTFIGIFLIDGVTGRIIHSSIQKKAKGPVHIVHSENWVVYQ  796

Query  1151  YFNLRAHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAH  972
             Y+N +A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  
Sbjct  797   YWNTKARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPS  844

Query  971   SVKTIAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSL  792
             S+  +  T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  +
Sbjct  845   SISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDV  904

Query  791   PIIPQSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              I  + ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  905   QIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  964



>ref|XP_006188333.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Camelus 
ferus]
Length=990

 Score =   322 bits (825),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 281/1014 (28%), Positives = 486/1014 (48%), Gaps = 118/1014 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  2     AAAASRFWLWAALLIPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  56

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G++ WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  57    TEKNVIAALNSRTGELLWRHV--DKGTAEGAVDAMLLYGQDAITVSNGGRIMRSWETNIG  114

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  115   GLNWEVTLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPES  169

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +++  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V
Sbjct  170   DSIHYQMMYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQSLSGACGVV  229

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHI  2595
                 +V  D +   L ++  +      +Q+ +  L  +F       +LP++      +  
Sbjct  230   DEAVLVCPDPSSRALQTLALETEW-ELRQIPLQSLDLEFANGFQPRVLPTQPN---PVDP  285

Query  2594  NKFVLFLRVT---------YEGKLEVVDKVAYGAVIS-----------------ESLSLS  2493
             ++   FL+++         + G L ++      A++S                 E+   S
Sbjct  286   SRAQFFLQLSPSHCALLHYHHGVLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEAKPSS  345

Query  2492  EGHQAFGLIKHGVGKIHLSVKSIN----------DWGSNLLEES--SAIDSQKGLVHKVF  2349
                 + G      G    S+   N          + G  LL+ +   +++       +++
Sbjct  346   SEDGSMGSFSEKSGP-QDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQNGTRPERLY  404

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----  2190
             I  +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     
Sbjct  405   IQVFLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQA  464

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTR  2025
             E +G    K +  L  +LK    +L       +          + +S  K++     + R
Sbjct  465   ELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLAR  524

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVWSFLVNALRKSETCENPNGLKIYQWQVPHHH  1845
             D    +K++++++ SGKL+ + +  G I+W   + +++   +       K+   +   H 
Sbjct  525   DEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPSVKPDSS------FKLMVQRTTAHF  578

Query  1844  AMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDSTE  1674
                   ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D   
Sbjct  579   PHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDY  633

Query  1673  QRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGDD  1494
              ++ LLID +     +P T   L        +I++Y VDA    +G        KD+   
Sbjct  634   AKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL---  687

Query  1493  YYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATVA  1314
                 T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T  
Sbjct  688   ---TTELSWELTIPPEVQRIVEVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT--  742

Query  1313  PKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLRA  1134
                  +   V  + +++ ++L+D VTGRI+H    + ++GPVH V SENWVVY Y+N +A
Sbjct  743   -----ESTDVHHERTFIGIFLVDGVTGRIIHSSVQRKAKGPVHIVHSENWVVYQYWNTKA  797

Query  1133  HRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTIA  954
              R E++ +E+Y+ +   N           +L +P      P+VL   QSY F  S+  + 
Sbjct  798   RRNELTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAME  845

Query  953   VTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQS  774
              T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + +  + 
Sbjct  846   ATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQVHAER  905

Query  773   YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
             ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  906   FINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  959



>ref|XP_005607459.1| PREDICTED: ER membrane protein complex subunit 1 isoform X6 [Equus 
caballus]
Length=992

 Score =   322 bits (825),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 288/1015 (28%), Positives = 487/1015 (48%), Gaps = 119/1015 (12%)
 Frame = -2

Query  3467  SAMAIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVS  3288
             +A A R +L   L+  +A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+
Sbjct  3     AAAASRLWLWATLLVPAA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVA  57

Query  3287  TEENVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDG  3120
             TE+NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+S+G   +R+W    G
Sbjct  58    TEKNVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLYGQDAITVSNGGRIMRSWETNIG  115

Query  3119  QMVWESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANE  2943
              + WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L   
Sbjct  116   GLNWEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPES  170

Query  2942  GLDIQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLV  2769
                   +V+  G+  V+A+G+   S     K N   GE+++   +  P      G   +V
Sbjct  171   DSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLRSLIGACGVV  230

Query  2768  TSEKVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGA--AVLLPSKLTGMVAIHI  2595
                 +V  D +   L ++  +      +Q+ +  L  +F       +LP++      +  
Sbjct  231   DEAVLVCPDPSSRSLHTLALETEW-ELRQIPLQSLDLEFASGFQPRVLPTQPN---PVDP  286

Query  2594  NKFVLFLRVT---------YEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIH  2442
             ++   FL+++         + G+L ++      A++S + +  +   A    ++ V K  
Sbjct  287   SRAQFFLQLSPSHYALLYYHHGELSLLKNFPQTALVSFATTGEKTVAAVMTCRNEVQKPG  346

Query  2441  LS-----------------------VKSIN----DWGSNLLEESSAID-SQKGL-VHKVF  2349
              S                         +IN    + G  LL+ +      QKG    +++
Sbjct  347   SSEDGSVGSFSEKPSPQDSLVCFNQTYTINLYLVETGRRLLDTTITFSLEQKGTRPERLY  406

Query  2348  INNYIRTDRSYGFRALIVLEDHSLLLLQQ-GEIV-WSREDGLASIVDVTTSELPV-----  2190
             +  +++ D S G+RAL+  EDH LL LQQ G++V WSRE+ LA +V +   +LP+     
Sbjct  407   VQVFLKKDDSVGYRALVQTEDHLLLFLQQLGKVVLWSREESLAEVVCLEMVDLPLTGAQA  466

Query  2189  EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVAAIQQMRLKSSGKSK-----MTR  2025
             E +G    K +  L  +LK    +L       +          + +S  K++     + R
Sbjct  467   ELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQVKNEINIDTLAR  526

Query  2024  DHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNALRKSETCENPNGLKIYQWQVPHH  1848
             D    +K++++++ SGKL+ + +  G I+W  +L N    S         K+   +   H
Sbjct  527   DEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDS-------SFKLMVQRTTAH  579

Query  1847  HAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKELKILKPV--HSIAQVIPLPYTDST  1677
                    ++LV  K  G++S     L   +   GK  ++  PV    I Q + LP  D  
Sbjct  580   FPHPPQCTLLVKDKETGMSS-----LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQD  634

Query  1676  EQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWYSVDANNILRGHAVKENYFKDVGD  1497
               ++ LLID +     +P T   L        +I++Y VDA    +G        KD+  
Sbjct  635   YAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAE---QGRLCGYRLRKDL--  689

Query  1496  DYYFATKYVWSVVFPSESEQIIATATRKLNEVVHTQAKVTTDRDVMYKYISKNMLFVATV  1317
                  T+  W +  P E ++I+    ++ +E VH+Q +V  DR V+YK ++ N+L V T 
Sbjct  690   ----TTELSWELTVPPEVQRIVQVEGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVT-  744

Query  1316  APKAAGDIGSVIPDESWLIVYLIDTVTGRILHRMTHQGSQGPVHAVLSENWVVYHYFNLR  1137
                   +   V  + +++ ++L+D VTGRI+H    + ++GPVH V SENWVVY Y+N +
Sbjct  745   ------ESTDVHHERTFIGIFLVDGVTGRIIHSSVQRKAKGPVHIVHSENWVVYQYWNTK  798

Query  1136  AHRYEMSVIEIYDQSRADNKDLLKLVLGKHNLTKPVSSYLRPEVLAKSQSYFFAHSVKTI  957
             A R E + +E+Y+ +   N           +L +P      P+VL   QSY F  S+  +
Sbjct  799   ARRNEFTALELYEGTEQYNATAFS------SLDRPQ----LPQVL--QQSYIFPSSISAM  846

Query  956   AVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTVNPTQAEKEDGIIPLTDSLPIIPQ  777
               T T +GITS+ LLIG     +L+L K  LDPRR   PT+  +E+ +IP +  + I  +
Sbjct  847   EATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAE  906

Query  776   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  612
              ++ +      +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y
Sbjct  907   RFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDY  961



>ref|XP_005544661.1| PREDICTED: ER membrane protein complex subunit 1 isoform X7 [Macaca 
fascicularis]
Length=940

 Score =   321 bits (822),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 282/978 (29%), Positives = 461/978 (47%), Gaps = 103/978 (11%)
 Frame = -2

Query  3458  AIRAFLLLVLIFSSAYTTFSLYEDQVGLMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEE  3279
             A R +L  VL+   A    ++YEDQVG  DW Q+Y+GK+K A       G K++VV+TE+
Sbjct  6     ASRFWLWAVLLIPVA----AVYEDQVGKFDWRQQYVGKLKFASLEF-SPGSKKLVVATEK  60

Query  3278  NVLASLDLRHGDIFWRHVLGHKDVIDG-IDIAL--GKYVITLSSGS-TLRAWNLPDGQMV  3111
             NV+A+L+ R G+I WRHV   K   +G +D  L  G+  IT+SSG   +R+W    G + 
Sbjct  61    NVIAALNSRTGEILWRHV--DKGTAEGAVDAMLLHGQDAITVSSGGRIMRSWETNIGGLN  118

Query  3110  WESFL-SGSSPSRSILLVPSNLKVDRDSLILIYSSGYLHAVSSTDGEVIWKKELANEGLD  2934
             WE  L SGS  +  ++ +  ++   R   +L  ++  LH +SS  G + W + L      
Sbjct  119   WEITLDSGSFQALGLVGLQESV---RYIAVLKKTTLALHHLSS--GHLKWVEHLPESDSI  173

Query  2933  IQHIVHPDGTDDVYAVGLTSSSQFVAYKINARKGELLKHESMVFP--GGFSGDISLVTSE  2760
                +V+  G+  V+A+G+   S     K N   GE+++   +  P     SG   +V   
Sbjct  174   HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEA  233

Query  2759  KVVALDSTGSILVSIIFKDGLINFQQVHIADLVQDFTGAAVLLPSKLTGMVAIHINKFVL  2580
              +V  D +   L ++  +      +Q+ +   +  F         K    V    N+   
Sbjct  234   VLVCPDPSSRSLQTLALETEW-ELRQIPLQTALVSFATTG----EKTVAAVMACRNE---  285

Query  2579  FLRVTYEGKLEVVDKVAYGAVISESLSLSEGHQAFGLIKHGVGKIHLSVKSINDWGSNLL  2400
                V      E     ++    S   SL+  +Q + +  + V           + G  LL
Sbjct  286   ---VQKPSNSEDGSMGSFPEKSSSKDSLACFNQTYTINLYLV-----------ETGRRLL  331

Query  2399  EES--SAIDSQKGLVHKVFINNYIRTDRSYGFRALIVLEDHSLLLLQQ--GEIV-WSRED  2235
             + +   +++       +++I  +++ D S G+RAL+  EDH LL LQQ  G++V WSRE+
Sbjct  332   DTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREE  391

Query  2234  GLASIVDVTTSELPV-------EKDGVSVSKVEQNLFEWlkghllklkgtlmLATPDDVA  2076
              LA +V +   +LP+       E +    + ++  L       L      L   T     
Sbjct  392   SLAEVVCLEMVDLPLTGAQAELEGEFGKKAAIQDGLLGMFLKRLSSQLILLQAWTSHLWK  451

Query  2075  AIQQMRLKSS------GKSKMTRDHNGFRKLLIVLSRSGKLYALHTGDGRIVW-SFLVNA  1917
                  R   S          + RD    +K++++++ SGKL+ + +  G I+W  +L N 
Sbjct  452   MFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNV  511

Query  1916  LRKSETCENPNGLKIYQWQVPHHHAMDENPSVLVVGK-CGLNSDAPSVLSFVDSYTGKEL  1740
                S         K+   +   H       ++LV  K  G++S     L   +   GK  
Sbjct  512   KPDS-------SFKLMVQRTTAHFPHPPQCTLLVKDKESGMSS-----LYVFNPIFGKWS  559

Query  1739  KILKPV--HSIAQVIPLPYTDSTEQRLHLLIDTDGHGHLYPRTPEALGIFKRELGNIYWY  1566
             ++  PV    I Q + LP  D    ++ LLID +     +P T   L        +I++Y
Sbjct  560   QVAPPVLKRPILQSLLLPVMDQDYAKVLLLID