BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25774_g2_i2 len=1408 path=[4632:0-712 5345:713-1274 1397:1275-1310
1433:1311-1407]

Length=1408
                                                                      Score     E

ref|XP_004237255.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     404   6e-134   
ref|XP_009621528.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    402   3e-133   
ref|XP_009618248.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    402   5e-133   
ref|XP_009764323.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    399   9e-132   
ref|XP_002515156.1|  monoxygenase, putative                             366   5e-119   Ricinus communis
ref|XP_009351385.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    365   1e-118   
ref|XP_009351387.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    363   1e-117   
gb|AHL20262.1|  monoxygenase                                            360   2e-116   
ref|XP_006283836.1|  hypothetical protein CARUB_v10004937mg             353   8e-114   
ref|XP_008237398.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    352   2e-113   
ref|XP_010930384.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    351   4e-113   
ref|XP_010111252.1|  3-hydroxybenzoate 6-hydroxylase 1                  344   2e-110   
ref|XP_002868183.1|  monooxygenase                                      338   3e-108   
ref|XP_008791370.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    338   5e-108   
ref|XP_008231661.1|  PREDICTED: uncharacterized protein LOC103330826    338   7e-108   
ref|XP_010930394.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    337   1e-107   
ref|XP_010551060.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    336   3e-107   
ref|XP_007020077.1|  Monooxygenase, putative                            336   3e-107   
ref|XP_007200114.1|  hypothetical protein PRUPE_ppa018848mg             335   5e-107   
ref|XP_004506359.1|  PREDICTED: putative oxidoreductase YetM-like       335   6e-107   
ref|XP_010688731.1|  PREDICTED: kynurenine 3-monooxygenase-like i...    335   7e-107   
ref|XP_008237399.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    334   1e-106   
ref|XP_008786384.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    334   1e-106   
ref|XP_008786386.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    333   3e-106   
ref|XP_010434923.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    333   3e-106   
gb|KEH29341.1|  FAD/NAD(P)-binding oxidoreductase family protein        347   6e-106   
ref|XP_008231659.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    332   1e-105   
ref|XP_010930386.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    330   4e-105   
ref|XP_010449894.1|  PREDICTED: kynurenine 3-monooxygenase-like         329   1e-104   
ref|XP_010930385.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    329   2e-104   
ref|XP_009136712.1|  PREDICTED: kynurenine 3-monooxygenase              328   2e-104   
ref|XP_009107859.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     328   5e-104   
ref|XP_003533524.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    327   5e-104   
gb|KDP45200.1|  hypothetical protein JCGZ_15065                         327   6e-104   
dbj|BAD44627.1|  unnamed protein product                                327   7e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22754.1|  BnaA08g05840D                                          327   1e-103   
ref|XP_003540567.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    327   1e-103   
ref|XP_006414451.1|  hypothetical protein EUTSA_v10025403mg             327   1e-103   
emb|CDP11536.1|  unnamed protein product                                326   3e-103   
emb|CDY09743.1|  BnaC07g33180D                                          325   6e-103   
emb|CAA07574.1|  monooxygenase                                          324   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283848.1|  hypothetical protein CARUB_v10004954mg             324   1e-102   
ref|NP_193311.6|  monooxygenase 1                                       324   2e-102   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44358.1|  unnamed protein product                                323   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131324.1|  hypothetical protein PHAVU_011G004100g             323   3e-102   
dbj|BAD43328.1|  unnamed protein product                                322   5e-102   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43227.1|  unnamed protein product                                322   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190738.1|  monooxygenase 1                                    320   6e-101   
ref|XP_010440252.1|  PREDICTED: uncharacterized protein LOC104723571    318   3e-100   
ref|XP_010449893.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    318   3e-100   
ref|XP_010548939.1|  PREDICTED: kynurenine 3-monooxygenase              317   6e-100   
ref|XP_009361911.1|  PREDICTED: uncharacterized protein LOC103952109    316   1e-99    
ref|XP_010434921.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    316   2e-99    
ref|XP_006414450.1|  hypothetical protein EUTSA_v10025376mg             315   5e-99    
ref|XP_008375335.1|  PREDICTED: uncharacterized protein LOC103438584    310   3e-97    
ref|XP_002868182.1|  hypothetical protein ARALYDRAFT_355191             310   5e-97    
ref|XP_010440251.1|  PREDICTED: uncharacterized protein LOC104723568    308   1e-96    
ref|XP_010065076.1|  PREDICTED: LOW QUALITY PROTEIN: kynurenine 3...    308   2e-96    
ref|XP_002454010.1|  hypothetical protein SORBIDRAFT_04g023020          307   5e-96    Sorghum bicolor [broomcorn]
ref|XP_010930395.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    305   5e-95    
ref|XP_010524529.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    300   2e-93    
ref|XP_010688732.1|  PREDICTED: uncharacterized protein LOC104902...    297   3e-92    
ref|XP_010688730.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    297   3e-92    
ref|XP_010688727.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    296   5e-92    
ref|NP_001046834.1|  Os02g0471300                                       296   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007032109.1|  Monooxygenase, putative isoform 1                  295   3e-91    
gb|EAY85810.1|  hypothetical protein OsI_07170                          293   3e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001137114.1|  hypothetical protein                               291   5e-90    Zea mays [maize]
ref|XP_006340107.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    288   7e-90    
ref|XP_002532447.1|  monoxygenase, putative                             287   2e-88    Ricinus communis
ref|XP_004952758.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    287   3e-88    
dbj|BAK04829.1|  predicted protein                                      286   4e-88    
ref|XP_010694352.1|  PREDICTED: kynurenine 3-monooxygenase-like         286   9e-88    
ref|XP_002452285.1|  hypothetical protein SORBIDRAFT_04g023000          282   2e-86    Sorghum bicolor [broomcorn]
dbj|BAD44160.1|  unnamed protein product                                279   2e-86    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44136.1|  unnamed protein product                                277   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008681331.1|  PREDICTED: hypothetical protein isoform X2         280   4e-85    
emb|CAB10354.1|  hypothetical protein                                   282   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952767.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    273   8e-83    
ref|XP_004952763.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    262   1e-78    
gb|ABK24681.1|  unknown                                                 257   1e-76    Picea sitchensis
ref|XP_010551061.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    252   7e-76    
dbj|BAD43234.1|  unnamed protein product                                252   9e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074709.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    254   1e-75    
dbj|BAD16528.1|  putative monooxygenase 1                               254   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791371.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    251   7e-75    
ref|XP_010930387.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    249   3e-74    
ref|XP_010260971.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   2e-73    
emb|CDX72750.1|  BnaC07g47720D                                          248   3e-73    
gb|KDO68112.1|  hypothetical protein CISIN_1g015061mg                   248   4e-73    
ref|XP_006486714.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   4e-73    
ref|XP_008645820.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   4e-73    
ref|XP_010526550.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   5e-73    
ref|XP_010466864.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    246   3e-72    
ref|XP_007032110.1|  Monooxygenase, putative isoform 2                  244   4e-72    
ref|XP_010930388.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    243   4e-72    
ref|XP_006422567.1|  hypothetical protein CICLE_v10028550mg             245   5e-72    
ref|XP_008807125.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    244   6e-72    
ref|XP_010466863.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    244   7e-72    
ref|XP_006851406.1|  hypothetical protein AMTR_s00040p00065120          244   1e-71    
ref|XP_009101939.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     243   2e-71    
ref|XP_008786383.1|  PREDICTED: uncharacterized protein LOC103704750    241   3e-71    
ref|XP_010920086.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    243   3e-71    
ref|XP_006411647.1|  hypothetical protein EUTSA_v10025344mg             242   5e-71    
ref|XP_008807123.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    242   7e-71    
ref|XP_010028757.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    241   9e-71    
gb|KDO68113.1|  hypothetical protein CISIN_1g015061mg                   241   1e-70    
ref|XP_009408212.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    241   1e-70    
ref|XP_010910536.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    241   1e-70    
ref|XP_006486713.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    241   1e-70    
gb|EYU36808.1|  hypothetical protein MIMGU_mgv1a007451mg                241   1e-70    
ref|XP_010028758.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    240   2e-70    
ref|XP_008807124.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    241   2e-70    
ref|XP_006858560.1|  hypothetical protein AMTR_s00071p00172540          241   3e-70    
ref|XP_004245095.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    239   6e-70    
ref|XP_004288321.1|  PREDICTED: FAD-dependent urate hydroxylase-like    239   7e-70    
ref|NP_196151.1|  FAD/NAD(P)-binding oxidoreductase family protein      239   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447940.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    238   1e-69    
ref|XP_008645819.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    239   1e-69    
ref|XP_010260765.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    238   2e-69    
ref|XP_010028760.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    238   2e-69    
ref|XP_009794919.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   2e-69    
ref|NP_001137002.1|  uncharacterized protein LOC100217165               238   3e-69    Zea mays [maize]
ref|XP_010028754.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    238   3e-69    
ref|XP_007199879.1|  hypothetical protein PRUPE_ppa006387mg             238   3e-69    
ref|XP_003535754.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    238   4e-69    
ref|XP_010028756.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    237   4e-69    
ref|XP_010446363.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    237   5e-69    
ref|XP_009355644.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    237   5e-69    
ref|XP_004251850.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    237   5e-69    
ref|XP_004144855.1|  PREDICTED: FAD-dependent urate hydroxylase-like    237   6e-69    
ref|XP_006605859.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    237   7e-69    
ref|XP_010524530.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    234   7e-69    
ref|XP_004497186.1|  PREDICTED: FAD-dependent urate hydroxylase-like    236   7e-69    
ref|XP_010252441.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    235   8e-69    
ref|XP_008645821.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    236   8e-69    
gb|AAM61460.1|  monooxygenase                                           236   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436949.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    236   2e-68    
gb|KHN11493.1|  3-hydroxybenzoate 6-hydroxylase 1                       236   2e-68    
ref|XP_008386050.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    235   2e-68    
ref|XP_006299765.1|  hypothetical protein CARUB_v10015961mg             235   2e-68    
ref|XP_006358984.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    235   3e-68    
emb|CDP09665.1|  unnamed protein product                                234   7e-68    
ref|XP_010930471.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    231   7e-68    
gb|KEH43301.1|  FAD/NAD(P)-binding oxidoreductase family protein        233   1e-67    
ref|XP_003536718.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   1e-67    
ref|XP_010230267.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   2e-67    
ref|XP_007199878.1|  hypothetical protein PRUPE_ppa006383mg             233   2e-67    
ref|XP_006299566.1|  hypothetical protein CARUB_v10015741mg             233   2e-67    
ref|XP_003558784.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   2e-67    
ref|XP_006358986.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   2e-67    
ref|XP_006301569.1|  hypothetical protein CARUB_v10022007mg             232   3e-67    
ref|XP_002866806.1|  hypothetical protein ARALYDRAFT_490619             232   3e-67    
ref|XP_009787875.1|  PREDICTED: uncharacterized protein LOC104235761    227   3e-67    
ref|XP_002468485.1|  hypothetical protein SORBIDRAFT_01g046710          232   4e-67    Sorghum bicolor [broomcorn]
ref|NP_001049002.1|  Os03g0154100                                       232   4e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74541.1|  hypothetical protein OsI_10065                          231   9e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_008645818.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    232   9e-67    
ref|XP_007142809.1|  hypothetical protein PHAVU_007G018600g             231   1e-66    
emb|CDP07354.1|  unnamed protein product                                231   1e-66    
ref|XP_007142791.1|  hypothetical protein PHAVU_007G017100g             231   1e-66    
ref|XP_009405099.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    231   1e-66    
ref|XP_008236046.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    230   2e-66    
ref|XP_010696596.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    231   2e-66    
ref|XP_009628234.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    230   2e-66    
ref|XP_006342708.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    228   8e-66    
ref|XP_011092960.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    228   1e-65    
ref|XP_010431792.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    228   3e-65    
ref|XP_009355537.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    227   3e-65    
ref|XP_010028755.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    227   3e-65    
ref|XP_002272352.2|  PREDICTED: zeaxanthin epoxidase, chloroplastic     227   3e-65    Vitis vinifera
ref|XP_006358985.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    227   4e-65    
ref|XP_003555852.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    227   4e-65    
emb|CDP01501.1|  unnamed protein product                                227   4e-65    
ref|XP_006836913.1|  hypothetical protein AMTR_s00099p00135090          229   4e-65    
ref|XP_002284737.3|  PREDICTED: zeaxanthin epoxidase, chloroplast...    228   4e-65    Vitis vinifera
ref|XP_006427866.1|  hypothetical protein CICLE_v10025675mg             227   6e-65    
ref|XP_006427865.1|  hypothetical protein CICLE_v10025675mg             226   8e-65    
gb|EAY88588.1|  hypothetical protein OsI_10063                          226   9e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_009355536.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    227   1e-64    
ref|XP_010030694.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    226   1e-64    
gb|EMS68723.1|  3-hydroxybenzoate 6-hydroxylase 1                       226   1e-64    
ref|XP_004144922.1|  PREDICTED: FAD-dependent urate hydroxylase-like    226   1e-64    
ref|XP_003558786.2|  PREDICTED: zeaxanthin epoxidase, chloroplast...    226   1e-64    
ref|XP_008231570.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    225   1e-64    
ref|XP_009349776.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    225   1e-64    
gb|KGN43265.1|  hypothetical protein Csa_7G014510                       227   2e-64    
ref|XP_008386052.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    224   2e-64    
dbj|BAJ99036.1|  predicted protein                                      224   3e-64    
ref|XP_004144856.1|  PREDICTED: FAD-dependent urate hydroxylase-like    226   3e-64    
gb|KGN43266.1|  hypothetical protein Csa_7G014520                       224   4e-64    
ref|XP_010649434.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    224   4e-64    
ref|XP_004289394.1|  PREDICTED: FAD-dependent urate hydroxylase-like    224   4e-64    
ref|XP_004162912.1|  PREDICTED: FAD-dependent urate hydroxylase-like    224   5e-64    
ref|XP_004497185.1|  PREDICTED: FAD-dependent urate hydroxylase-like    224   5e-64    
gb|KFK30455.1|  hypothetical protein AALP_AA7G263400                    224   5e-64    
ref|XP_003558783.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    224   5e-64    
ref|XP_004307200.1|  PREDICTED: 3-hydroxybenzoate 6-hydroxylase 1...    219   5e-64    
ref|XP_006384582.1|  hypothetical protein POPTR_0004s18310g             224   6e-64    
ref|NP_001049000.1|  Os03g0153900                                       223   7e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386051.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    225   8e-64    
gb|AFK34459.1|  unknown                                                 224   8e-64    
ref|NP_195566.1|  FAD/NAD(P)-binding oxidoreductase family protein      223   8e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162913.1|  PREDICTED: FAD-dependent urate hydroxylase-like    225   9e-64    
ref|XP_009769331.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    223   2e-63    
ref|XP_009624704.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    222   3e-63    
ref|XP_004288322.1|  PREDICTED: FAD-dependent urate hydroxylase-like    222   3e-63    
gb|KEH44372.1|  FAD-dependent urate hydroxylase-like protein            221   4e-63    
ref|XP_008231579.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    221   4e-63    
gb|EAY88589.1|  hypothetical protein OsI_10064                          222   4e-63    Oryza sativa Indica Group [Indian rice]
ref|NP_001049001.1|  Os03g0154000                                       221   7e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236047.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     221   7e-63    
ref|XP_009769330.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    221   7e-63    
gb|AFW89684.1|  hypothetical protein ZEAMMB73_408646                    219   8e-63    
ref|XP_007041787.1|  FAD/NAD(P)-binding oxidoreductase family pro...    221   8e-63    
ref|XP_010088731.1|  3-hydroxybenzoate 6-hydroxylase 1                  221   8e-63    
ref|XP_008808978.1|  PREDICTED: uncharacterized protein LOC103720836    215   1e-62    
ref|XP_010057480.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    220   2e-62    
ref|XP_004985657.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    219   2e-62    
ref|XP_007212261.1|  hypothetical protein PRUPE_ppa006635mg             219   3e-62    
ref|XP_010690341.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    219   5e-62    
gb|KDP35312.1|  hypothetical protein JCGZ_09471                         219   5e-62    
ref|XP_006649421.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    218   5e-62    
ref|XP_010027723.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    218   5e-62    
ref|XP_010028762.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    218   5e-62    
gb|KCW70989.1|  hypothetical protein EUGRSUZ_F04098                     215   7e-62    
gb|KCW54307.1|  hypothetical protein EUGRSUZ_I00271                     218   8e-62    
ref|XP_004985658.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    218   8e-62    
ref|XP_009624703.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    218   9e-62    
ref|XP_002530077.1|  monoxygenase, putative                             219   1e-61    Ricinus communis
ref|XP_009387320.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    217   2e-61    
ref|XP_010030377.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    217   2e-61    
gb|ACL52795.1|  unknown                                                 218   2e-61    Zea mays [maize]
gb|KDP29688.1|  hypothetical protein JCGZ_18850                         217   2e-61    
gb|KCW54311.1|  hypothetical protein EUGRSUZ_I00275                     217   2e-61    
ref|XP_004497187.1|  PREDICTED: FAD-dependent urate hydroxylase-like    217   2e-61    
ref|XP_010057477.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    217   2e-61    
dbj|BAJ98283.1|  predicted protein                                      217   2e-61    
dbj|BAJ99546.1|  predicted protein                                      217   4e-61    
ref|XP_004290734.1|  PREDICTED: FAD-dependent urate hydroxylase-like    216   4e-61    
ref|XP_002306191.2|  hypothetical protein POPTR_0004s18290g             216   5e-61    Populus trichocarpa [western balsam poplar]
ref|XP_006422564.1|  hypothetical protein CICLE_v10028549mg             216   5e-61    
ref|XP_010041421.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    216   6e-61    
gb|KDO68119.1|  hypothetical protein CISIN_1g015331mg                   215   8e-61    
ref|XP_004290735.1|  PREDICTED: FAD-dependent urate hydroxylase-like    215   9e-61    
gb|ACG30427.1|  monooxygenase                                           215   1e-60    Zea mays [maize]
gb|EAY88586.1|  hypothetical protein OsI_10060                          214   3e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_006486711.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    214   3e-60    
gb|KCW55567.1|  hypothetical protein EUGRSUZ_I01437                     213   5e-60    
gb|KCW74677.1|  hypothetical protein EUGRSUZ_E03410                     213   5e-60    
gb|KDP29684.1|  hypothetical protein JCGZ_18846                         212   2e-59    
ref|XP_007142810.1|  hypothetical protein PHAVU_007G018700g             212   3e-59    
ref|XP_010690340.1|  PREDICTED: uncharacterized protein LOC104903902    211   5e-59    
gb|KEH44375.1|  FAD/NAD(P)-binding oxidoreductase family protein        218   5e-59    
ref|XP_006427870.1|  hypothetical protein CICLE_v10025686mg             211   5e-59    
ref|XP_009401177.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    211   5e-59    
emb|CBI37633.3|  unnamed protein product                                209   5e-59    
ref|XP_002530075.1|  monoxygenase, putative                             210   8e-59    Ricinus communis
ref|XP_009355645.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    210   9e-59    
ref|XP_002272608.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    210   1e-58    Vitis vinifera
ref|XP_002530074.1|  monoxygenase, putative                             210   1e-58    Ricinus communis
gb|EPS69276.1|  hypothetical protein M569_05491                         209   1e-58    
ref|XP_010027722.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    209   2e-58    
gb|KCW54301.1|  hypothetical protein EUGRSUZ_I00263                     210   2e-58    
ref|XP_010088730.1|  Zeaxanthin epoxidase                               209   2e-58    
ref|XP_010677116.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    210   2e-58    
ref|XP_010027720.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    209   2e-58    
ref|XP_006836914.1|  hypothetical protein AMTR_s00099p00135820          206   3e-58    
ref|XP_006858559.1|  hypothetical protein AMTR_s00071p00171840          209   3e-58    
ref|XP_004985659.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    208   3e-58    
ref|XP_010030378.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    213   4e-58    
gb|KEH44373.1|  FAD-dependent urate hydroxylase-like protein            206   2e-57    
ref|XP_010088729.1|  3-hydroxybenzoate 6-hydroxylase 1                  206   2e-57    
ref|NP_001048999.2|  Os03g0153500                                       204   8e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007209130.1|  hypothetical protein PRUPE_ppa005571mg             206   8e-57    
gb|KFK36463.1|  hypothetical protein AALP_AA4G127900                    206   9e-57    
ref|XP_008373658.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    206   1e-56    
ref|XP_010104831.1|  Zeaxanthin epoxidase                               205   1e-56    
ref|XP_008377723.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    204   1e-56    
ref|XP_002468487.1|  hypothetical protein SORBIDRAFT_01g046730          204   2e-56    
ref|XP_010111254.1|  hypothetical protein L484_027907                   197   3e-56    
gb|EAZ25623.1|  hypothetical protein OsJ_09451                          204   3e-56    
ref|XP_010027721.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    203   4e-56    
ref|XP_008347512.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    203   5e-56    
ref|XP_009141505.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    203   6e-56    
gb|EPS73596.1|  hypothetical protein M569_01159                         202   9e-56    
emb|CDY32097.1|  BnaC04g44690D                                          202   1e-55    
gb|ACN37030.1|  unknown                                                 196   2e-55    
ref|XP_004301737.1|  PREDICTED: FAD-dependent urate hydroxylase-like    202   3e-55    
emb|CDY40447.1|  BnaA04g20700D                                          201   3e-55    
ref|NP_565814.1|  protein CTF2A                                         201   6e-55    
gb|AAM61201.1|  putative monooxygenase                                  201   6e-55    
ref|XP_010509581.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    200   8e-55    
gb|KCW74688.1|  hypothetical protein EUGRSUZ_E03418                     199   9e-55    
gb|KDP35311.1|  hypothetical protein JCGZ_09470                         199   1e-54    
ref|XP_011012594.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    199   1e-54    
gb|AAD08696.1|  CTF2A                                                   200   1e-54    
ref|XP_001751837.1|  predicted protein                                  199   1e-54    
gb|EAZ25626.1|  hypothetical protein OsJ_09454                          199   1e-54    
ref|XP_010059347.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    198   1e-54    
gb|EAY88587.1|  hypothetical protein OsI_10062                          202   2e-54    
ref|XP_011046339.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    199   2e-54    
ref|XP_011045737.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    198   2e-54    
gb|EYU36809.1|  hypothetical protein MIMGU_mgv1a007451mg                197   2e-54    
gb|EMS65106.1|  3-hydroxybenzoate 6-hydroxylase 1                       198   3e-54    
dbj|BAJ92071.1|  predicted protein                                      199   3e-54    
ref|XP_006410733.1|  hypothetical protein EUTSA_v10016655mg             198   4e-54    
gb|EPS73288.1|  hypothetical protein M569_01468                         197   5e-54    
gb|EYU37970.1|  hypothetical protein MIMGU_mgv1a007358mg                197   5e-54    
ref|XP_010258755.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    198   8e-54    
emb|CBI18932.3|  unnamed protein product                                196   9e-54    
ref|XP_006370918.1|  hypothetical protein POPTR_0019s01740g             196   9e-54    
ref|XP_002531782.1|  monoxygenase, putative                             197   1e-53    
gb|EMT26383.1|  3-hydroxybenzoate 6-hydroxylase 1                       196   1e-53    
gb|KFK23454.1|  hypothetical protein AALP_AAs48803U000100               191   1e-53    
gb|AAD09951.1|  CTF2A                                                   197   1e-53    
gb|EMT14347.1|  hypothetical protein F775_52577                         194   2e-53    
gb|EMT26384.1|  Zeaxanthin epoxidase, chloroplastic                     195   2e-53    
ref|XP_010505085.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    196   4e-53    
gb|KDO68114.1|  hypothetical protein CISIN_1g015061mg                   192   6e-53    
ref|XP_010538404.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    195   6e-53    
ref|XP_010516762.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    195   7e-53    
gb|KDP39934.1|  hypothetical protein JCGZ_03465                         195   8e-53    
ref|XP_010538403.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    195   8e-53    
ref|XP_011046338.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    193   1e-52    
dbj|BAJ85967.1|  predicted protein                                      194   1e-52    
ref|XP_008377799.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    193   1e-52    
dbj|BAJ90045.1|  predicted protein                                      194   1e-52    
ref|XP_006296076.1|  hypothetical protein CARUB_v10025226mg             194   1e-52    
gb|ACN36222.1|  unknown                                                 191   2e-52    
ref|XP_002298720.2|  hypothetical protein POPTR_0001s31500g             193   2e-52    
ref|XP_009770791.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    192   2e-52    
ref|XP_004511727.1|  PREDICTED: FAD-dependent urate hydroxylase-like    193   2e-52    
ref|XP_011046660.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    194   2e-52    
ref|XP_002879566.1|  hypothetical protein ARALYDRAFT_482529             194   2e-52    
ref|XP_009772156.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    194   2e-52    
ref|XP_003581231.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    192   5e-52    
gb|KCW47586.1|  hypothetical protein EUGRSUZ_K01334                     189   6e-52    
gb|KCW55575.1|  hypothetical protein EUGRSUZ_I01445                     191   6e-52    
ref|XP_006477107.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    193   6e-52    
ref|XP_006422565.1|  hypothetical protein CICLE_v10028550mg             189   7e-52    
ref|XP_011046337.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    192   7e-52    
ref|XP_006370921.1|  hypothetical protein POPTR_0019s01770g             191   1e-51    
ref|XP_009608102.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    192   1e-51    
ref|XP_007156581.1|  hypothetical protein PHAVU_002G000800g             191   2e-51    
ref|XP_010524531.1|  PREDICTED: uncharacterized protein LOC104802572    185   8e-51    
ref|XP_006838554.1|  hypothetical protein AMTR_s00002p00203960          189   8e-51    
ref|XP_006370920.1|  hypothetical protein POPTR_0019s01760g             188   9e-51    
ref|XP_004241987.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    189   1e-50    
ref|XP_004245813.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    189   1e-50    
gb|AAD09952.1|  CTF2B                                                   188   2e-50    
ref|XP_006440202.1|  hypothetical protein CICLE_v10020057mg             189   2e-50    
ref|XP_007039717.1|  FAD/NAD(P)-binding oxidoreductase family pro...    189   2e-50    
ref|XP_003611372.1|  Zeaxanthin epoxidase                               188   2e-50    
ref|XP_003611371.1|  Zeaxanthin epoxidase                               188   3e-50    
ref|XP_010490114.1|  PREDICTED: uncharacterized protein LOC104767841    191   3e-50    
gb|AFW71839.1|  hypothetical protein ZEAMMB73_473575                    182   4e-50    
gb|KHN37394.1|  6-hydroxynicotinate 3-monooxygenase                     186   4e-50    
ref|XP_009389261.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    187   5e-50    
gb|AHW57725.1|  humulone synthase 1                                     187   7e-50    
gb|KHN42665.1|  Zeaxanthin epoxidase, chloroplastic                     186   8e-50    
ref|XP_006368961.1|  monooxygenase family protein                       187   8e-50    
ref|XP_011047582.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    187   9e-50    
dbj|BAC23045.1|  monooxygenase                                          184   1e-49    
ref|XP_006370916.1|  hypothetical protein POPTR_0019s01720g             184   1e-49    
emb|CDP08357.1|  unnamed protein product                                187   1e-49    
ref|XP_006359228.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    186   1e-49    
ref|XP_003516652.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    186   2e-49    
ref|XP_002973417.1|  hypothetical protein SELMODRAFT_98780              185   2e-49    
gb|EAZ30747.1|  hypothetical protein OsJ_14811                          186   2e-49    
gb|KCW55571.1|  hypothetical protein EUGRSUZ_I01441                     183   3e-49    
ref|XP_002976490.1|  hypothetical protein SELMODRAFT_416512             183   8e-49    
ref|XP_004170307.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    184   9e-49    
ref|XP_008798816.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    183   1e-48    
ref|XP_008663198.1|  PREDICTED: uncharacterized protein LOC103641642    183   1e-48    
gb|EEC77271.1|  hypothetical protein OsI_15897                          184   2e-48    
gb|AAM64878.1|  putative monooxygenase                                  182   2e-48    
ref|XP_011081273.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    183   2e-48    
gb|KCW55566.1|  hypothetical protein EUGRSUZ_I01436                     180   2e-48    
ref|NP_565688.1|  CTF2B like oxidoreductase                             182   2e-48    
gb|KGN60465.1|  hypothetical protein Csa_3G912970                       183   2e-48    
ref|XP_004148358.1|  PREDICTED: FAD-dependent urate hydroxylase-like    183   3e-48    
gb|ABF94037.1|  FAD binding domain containing protein, expressed        179   3e-48    
gb|KCW71027.1|  hypothetical protein EUGRSUZ_F04127                     181   3e-48    
gb|KCW55572.1|  hypothetical protein EUGRSUZ_I01442                     179   5e-48    
ref|XP_009766505.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    182   5e-48    
ref|XP_010919743.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    182   6e-48    
ref|XP_010919744.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    181   7e-48    
gb|EYU19461.1|  hypothetical protein MIMGU_mgv1a006589mg                181   1e-47    
ref|XP_002521279.1|  monoxygenase, putative                             177   1e-47    
ref|XP_002446470.1|  hypothetical protein SORBIDRAFT_06g016500          181   1e-47    
ref|XP_003562068.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    179   1e-47    
gb|AHW57726.1|  humulone synthase 2                                     180   2e-47    
emb|CBI29521.3|  unnamed protein product                                180   3e-47    
ref|XP_002265622.3|  PREDICTED: zeaxanthin epoxidase, chloroplast...    180   5e-47    
dbj|BAJ97297.1|  predicted protein                                      176   1e-46    
ref|XP_004985660.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    176   1e-46    
ref|XP_002881066.1|  hypothetical protein ARALYDRAFT_481889             175   9e-46    
ref|XP_009610067.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    176   1e-45    
ref|XP_010690698.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    173   1e-45    
ref|XP_004975611.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    175   2e-45    
ref|XP_006370922.1|  hypothetical protein POPTR_0019s01780g             173   3e-45    
ref|NP_680702.4|  FAD/NAD(P)-binding oxidoreductase family protein      169   4e-45    
ref|XP_008807155.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    168   4e-44    
ref|XP_008786560.1|  PREDICTED: uncharacterized protein LOC103704863    162   7e-44    
ref|XP_006370919.1|  hypothetical protein POPTR_0019s01750g             169   8e-44    
gb|KCW74691.1|  hypothetical protein EUGRSUZ_E03421                     169   9e-44    
ref|XP_006370917.1|  hypothetical protein POPTR_0019s01730g             169   1e-43    
ref|XP_006829013.1|  hypothetical protein AMTR_s00001p00248220          166   1e-43    
gb|EMT14349.1|  3-hydroxybenzoate 6-hydroxylase 1                       167   2e-43    
ref|XP_010647177.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    170   2e-43    
ref|XP_007199966.1|  hypothetical protein PRUPE_ppa026071mg             166   6e-43    
gb|ABF94041.1|  FAD binding domain containing protein, expressed        166   7e-43    
ref|XP_002447702.1|  hypothetical protein SORBIDRAFT_06g013780          164   1e-42    
ref|NP_001140710.1|  uncharacterized protein LOC100272785               167   1e-42    
ref|XP_008645822.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    165   2e-42    
tpg|DAA62752.1|  TPA: hypothetical protein ZEAMMB73_262897              167   2e-42    
gb|ACN28693.1|  unknown                                                 163   4e-42    
ref|XP_010436561.1|  PREDICTED: uncharacterized protein LOC104720339    157   6e-42    
ref|XP_002462877.1|  hypothetical protein SORBIDRAFT_02g033700          165   6e-42    
ref|XP_008651072.1|  PREDICTED: uncharacterized protein LOC100272...    166   8e-42    
dbj|BAJ90682.1|  predicted protein                                      165   9e-42    
dbj|BAJ84994.1|  predicted protein                                      164   1e-41    
gb|ABR16293.1|  unknown                                                 161   1e-41    
ref|XP_006486712.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    162   2e-41    
gb|EMS67104.1|  3-hydroxybenzoate 6-hydroxylase 1                       161   2e-41    
gb|KFK44985.1|  hypothetical protein AALP_AA1G329000                    155   3e-41    
ref|XP_008645823.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    160   8e-41    
ref|XP_003560188.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    162   1e-40    
ref|XP_006285799.1|  hypothetical protein CARUB_v10007274mg             158   1e-40    
ref|XP_008651071.1|  PREDICTED: uncharacterized protein LOC100272...    162   2e-40    
ref|XP_004957744.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    161   2e-40    
ref|XP_006836912.1|  hypothetical protein AMTR_s00099p00134580          157   2e-40    
gb|AFW71842.1|  hypothetical protein ZEAMMB73_415743                    157   4e-40    
gb|KCW55565.1|  hypothetical protein EUGRSUZ_I01436                     156   8e-40    
dbj|BAD16531.1|  putative monooxygenase                                 155   9e-40    
gb|EAZ23459.1|  hypothetical protein OsJ_07152                          155   1e-39    
ref|XP_009624705.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    156   1e-39    
ref|XP_008357304.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    155   1e-39    
gb|KCW54300.1|  hypothetical protein EUGRSUZ_I00262                     157   1e-39    
gb|KCW74678.1|  hypothetical protein EUGRSUZ_E03410                     156   2e-39    
gb|KCW74679.1|  hypothetical protein EUGRSUZ_E03410                     155   2e-39    
gb|EMT13558.1|  Zeaxanthin epoxidase, chloroplastic                     157   2e-39    
ref|XP_008238393.1|  PREDICTED: uncharacterized protein LOC103337031    155   2e-39    
gb|EMT05444.1|  3-hydroxybenzoate 6-hydroxylase 1                       157   7e-39    
gb|KCW74669.1|  hypothetical protein EUGRSUZ_E034002                    153   1e-38    
ref|XP_010088732.1|  Zeaxanthin epoxidase                               154   2e-38    
gb|EAZ03925.1|  hypothetical protein OsI_26059                          154   6e-38    
gb|KCW55570.1|  hypothetical protein EUGRSUZ_I01440                     149   2e-37    
ref|XP_010107642.1|  RNA-binding protein 39                             156   2e-37    
ref|NP_001059681.2|  Os07g0491900                                       152   2e-37    
gb|EMS68722.1|  3-hydroxybenzoate 6-hydroxylase 1                       149   2e-37    
ref|XP_010038742.1|  PREDICTED: uncharacterized protein LOC104427334    144   6e-37    
gb|KDO53381.1|  hypothetical protein CISIN_1g044609mg                   144   2e-36    
ref|XP_001751453.1|  predicted protein                                  146   4e-36    
gb|KDO51363.1|  hypothetical protein CISIN_1g048694mg                   140   3e-35    
ref|XP_002530076.1|  monoxygenase, putative                             144   7e-35    
gb|KDO57088.1|  hypothetical protein CISIN_1g022277mg                   142   7e-35    
gb|KDO57089.1|  hypothetical protein CISIN_1g022277mg                   142   8e-35    
gb|EMT14350.1|  3-hydroxybenzoate 6-hydroxylase 1                       142   1e-34    
ref|XP_008447938.1|  PREDICTED: uncharacterized protein LOC103490272    139   2e-34    
ref|XP_010509582.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    140   4e-34    
ref|XP_009141506.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    140   8e-34    
ref|XP_009343924.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    140   9e-34    
ref|XP_008373660.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    139   2e-33    
dbj|BAD94026.1|  hypothetical protein                                   135   2e-33    
ref|XP_005647816.1|  FAD/NAD(P)-binding domain-containing protein       138   2e-33    
ref|XP_006410732.1|  hypothetical protein EUTSA_v10016655mg             138   3e-33    
ref|NP_973606.1|  protein CTF2A                                         138   3e-33    
ref|XP_010505087.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    137   4e-33    
ref|XP_010516763.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    137   7e-33    
ref|XP_010258756.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    136   1e-32    
ref|WP_005268384.1|  FAD-dependent oxidoreductase                       137   2e-32    
gb|KCW74681.1|  hypothetical protein EUGRSUZ_E03411                     134   4e-32    
ref|XP_006477108.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    135   5e-32    
gb|EAZ39863.1|  hypothetical protein OsJ_24302                          136   5e-32    
ref|XP_010538405.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    134   8e-32    
ref|XP_008447939.1|  PREDICTED: uncharacterized protein LOC103490273    132   8e-32    
ref|XP_009591001.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    132   1e-31    
ref|XP_006440199.1|  hypothetical protein CICLE_v10020057mg             133   2e-31    
ref|XP_008786387.1|  PREDICTED: kynurenine 3-monooxygenase-like         127   4e-31    
ref|WP_011781117.1|  MULTISPECIES: FAD-binding monooxygenase            132   1e-30    
ref|XP_008465885.1|  PREDICTED: uncharacterized protein LOC103503469    128   1e-30    
ref|XP_006427869.1|  hypothetical protein CICLE_v10025686mg             129   3e-30    
gb|AFW89683.1|  hypothetical protein ZEAMMB73_408646                    129   3e-30    
ref|WP_014397527.1|  FAD-dependent oxidoreductase                       130   3e-30    
ref|WP_024983880.1|  2-polyprenyl-6-methoxyphenol hydroxylase           130   5e-30    
ref|WP_029112782.1|  FAD-binding monooxygenase                          129   8e-30    
ref|XP_010053524.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    128   1e-29    
ref|XP_010053523.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    128   1e-29    
ref|WP_003387708.1|  hypothetical protein                               129   1e-29    
gb|KHN37379.1|  Zeaxanthin epoxidase, chloroplastic                     127   1e-29    
ref|XP_010057482.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    124   2e-29    
ref|XP_006648748.1|  PREDICTED: uncharacterized protein LOC102701893    125   4e-29    
ref|XP_007156580.1|  hypothetical protein PHAVU_002G000800g             125   6e-29    
ref|XP_010111253.1|  hypothetical protein L484_027906                   120   9e-29    
ref|WP_024447926.1|  FAD-binding monooxygenase                          126   1e-28    
ref|WP_036442610.1|  FAD-binding monooxygenase                          125   1e-28    
emb|CDO26873.1|  salicylate hydroxylase                                 125   1e-28    
gb|KCW77840.1|  hypothetical protein EUGRSUZ_D02120                     124   2e-28    



>ref|XP_004237255.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   404 bits (1039),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 278/410 (68%), Gaps = 19/410 (5%)
 Frame = -2

Query  1392  MEST--DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRA  1219
             MES+  D   EIVIVGGG+CGLATALALHRKG+KS+VLE+S+ LRSEG  IGVLPNGW+A
Sbjct  1     MESSGCDEMQEIVIVGGGLCGLATALALHRKGVKSVVLEKSESLRSEGAAIGVLPNGWKA  60

Query  1218  LDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAG  1042
             LDQLG+  +LRT ALPLQ  R  ++ +  E+   Y + G+VRC+ R+D++ + ADALP  
Sbjct  61    LDQLGVAPYLRTTALPLQGMRITWMDKGNEKFTPYKNIGEVRCLKRSDIVETFADALPPR  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRFGC++ SV+ D +T    +LLSNG+ I A++LIGCDG RSIVA  LGLKPAK F   
Sbjct  121   TIRFGCDIVSVEMDPITSLPSILLSNGNRIGAKVLIGCDGSRSIVASFLGLKPAKTFRTC  180

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT+YPN HS P+EF R   G   VG LPI+  LVHWFV+   +Q T  KFP+D   
Sbjct  181   AIRGLTSYPNGHSFPLEFVRLIVGQTAVGRLPITDKLVHWFVS--VQQGTDAKFPQDTQV  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IKQ  +E +      PA V+E+I   + +SL FSHL+YR P +L+ G  R+ TVTVAGDA
Sbjct  239   IKQRAMEAV---IGHPADVQEMIKKCDLDSLWFSHLRYRAPWDLMFGNFREKTVTVAGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG S +EDAVVL R L         ++G   +      EEA+ +Y+KER+
Sbjct  296   MHVMGPFLGQGGSSGIEDAVVLGRNLA------KTINGSCFDH-----EEAVNQYIKERK  344

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MRV +L+  +YL G        L K+     MA+FFRN +A  +YDCG L
Sbjct  345   MRVVKLATQSYLTGLLFENRPMLTKIVIVAVMAIFFRNPSAHTQYDCGLL  394



>ref|XP_009621528.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=396

 Score =   402 bits (1034),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 221/410 (54%), Positives = 277/410 (68%), Gaps = 17/410 (4%)
 Frame = -2

Query  1392  MEST--DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRA  1219
             MES   +  HEIVIVGGG+CGLATALALH+KGLKS+VLE+S+ LR+ G  IGVLPNGWRA
Sbjct  1     MESAGCEEMHEIVIVGGGLCGLATALALHKKGLKSVVLEKSETLRAAGAAIGVLPNGWRA  60

Query  1218  LDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAG  1042
             LDQLG+GSHLR+ ALPLQ  R  ++ + KEQ     + G+VRC+ R+D++ + ADALP  
Sbjct  61    LDQLGVGSHLRSTALPLQGTRMTWIDKGKEQYTPNKNIGEVRCLKRSDIVETFADALPPK  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
              IRFGCE+ SV+ D +T    +LLSNG    A+ILIGCDG RSIV+  LG+KP + F + 
Sbjct  121   AIRFGCEIVSVEMDRLTSLPCILLSNGKRSGAKILIGCDGSRSIVSSFLGVKPTRTFRIS  180

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT+YPN HS P+EF R   G + VG LPI+  LVHWF+    +Q T   FP D   
Sbjct  181   AIRGLTSYPNGHSFPLEFVRLISGKIAVGRLPITDKLVHWFIG--VQQGTDTTFPHDPEL  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IKQ     +E     P  V+E+I   + +SLSF+HL+YR P +L+LG  R+ TVTVAGDA
Sbjct  239   IKQ---RALEATSGHPVDVQEMIEECDLDSLSFTHLRYRAPWDLMLGNFREKTVTVAGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG + +EDAVVLAR L  A  +K   D         ++ EAL++YVKERR
Sbjct  296   MHVMGPFLGQGGSAGIEDAVVLARNL--AKTIKGGFD-------HEKVGEALDQYVKERR  346

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MRV +L+  +YL    +  T  L K      MALFFRN +A  EYDCG L
Sbjct  347   MRVVKLATQSYLTALLVENTPLLTKFFVIAVMALFFRNPSAHVEYDCGHL  396



>ref|XP_009618248.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=396

 Score =   402 bits (1033),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 272/401 (68%), Gaps = 15/401 (4%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             HEIVIVGGG+CGLATALALH+KGLKS+VLE+S+ LR+ G  IGVLPNGWRALDQLG+GSH
Sbjct  10    HEIVIVGGGLCGLATALALHKKGLKSVVLEKSETLRAAGAAIGVLPNGWRALDQLGVGSH  69

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
             LR+ +LPLQ  R  ++ E KEQ     + G+VRC+ R+D++ + ADALP  TIRFGCE++
Sbjct  70    LRSTSLPLQGTRMTWIDEGKEQYTHNKNIGEVRCLKRSDIVETFADALPPKTIRFGCEIA  129

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             SV+ D +T    ++LSNG  I A+ILIGCDG RS+V+  LG+KP K F + A RGLT+YP
Sbjct  130   SVEMDPLTSLPCIVLSNGKRIGAKILIGCDGSRSVVSSFLGVKPTKTFRISAIRGLTSYP  189

Query  834   NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI  655
             N HS P+EF R   G  + G LPI+  LVHWF+       T  KFP++   IKQ     +
Sbjct  190   NGHSFPLEFVRLISGQTKFGRLPINDKLVHWFIN--VHHGTDSKFPQEPELIKQ---RAL  244

Query  654   EKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLG  475
             E   D P  V+E+I   + +SLSF+HL+Y  P +L+LG  R+ TVTVAGDAMHVMGPFLG
Sbjct  245   EATSDHPKDVQEIIEGCDLDSLSFTHLRYHKPWDLMLGNFREKTVTVAGDAMHVMGPFLG  304

Query  474   QGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMH  295
             QGG + +EDAVVLAR L  A  +K   D         ++ EAL++Y+KERRMRV +L+  
Sbjct  305   QGGSAGIEDAVVLARNL--AKTLKGGFD-------HEKVGEALDQYIKERRMRVVKLATQ  355

Query  294   TYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              YL    +     L K      MALFF+N  A  EYDCG L
Sbjct  356   AYLTALLIENRPILTKFIVIAVMALFFKNPNAHVEYDCGHL  396



>ref|XP_009764323.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=396

 Score =   399 bits (1024),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 278/410 (68%), Gaps = 17/410 (4%)
 Frame = -2

Query  1392  MEST--DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRA  1219
             MES   +  HEIVIVGGG+CGLATALALH+KG+KS+VLE+S+ LR+ G  IGV+PNGWRA
Sbjct  1     MESAGCEEMHEIVIVGGGLCGLATALALHKKGIKSVVLEKSETLRAAGAAIGVMPNGWRA  60

Query  1218  LDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAG  1042
             LDQLG+GSHLR+ ALPLQ  R  ++ + KEQ     + G+VRC+ R+D++ + ADALP  
Sbjct  61    LDQLGVGSHLRSTALPLQGTRMTWIDKGKEQYTPNKNIGEVRCLKRSDIVETFADALPRK  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRFGCE++SV+ D +T    +LLSNG  I A+ILIGCDG RS+V+  LG+KP + F + 
Sbjct  121   TIRFGCEIASVEMDPLTSLPCILLSNGKRIGAKILIGCDGSRSVVSSFLGVKPTRTFRIS  180

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT+YPN HS P+EF R       VG LPI+  LVHWF+    +Q T   FP D   
Sbjct  181   AIRGLTSYPNGHSFPLEFVRLISDKTAVGRLPITDMLVHWFIG--VQQGTDTIFPHDPEL  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IKQ     +E     PA V+E+I   + +SLSF+HL+YR P +L+LG  R+ TVTVAGDA
Sbjct  239   IKQ---RALEATSGRPADVQEMIEGCDLDSLSFTHLRYRAPWDLMLGNFREKTVTVAGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG + +EDAVVLAR L  A  +K   D         ++ EAL++YVKERR
Sbjct  296   MHVMGPFLGQGGSAGIEDAVVLARNL--AKTLKGGFD-------HEKVGEALDQYVKERR  346

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MRV +L+  +YL    +  T  L K      MALFFRN +A   YDCG L
Sbjct  347   MRVVKLATQSYLTALLVENTPLLIKFVVIAVMALFFRNPSAHVLYDCGHL  396



>ref|XP_002515156.1| monoxygenase, putative [Ricinus communis]
 gb|EEF47140.1| monoxygenase, putative [Ricinus communis]
Length=397

 Score =   366 bits (939),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 202/404 (50%), Positives = 263/404 (65%), Gaps = 19/404 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVGGGICGLATALALHRKG++S+VLERS+ LR+ G GI VL NGWRALD+LG+GS +
Sbjct  8     ELVIVGGGICGLATALALHRKGIRSVVLERSETLRAAGAGIAVLTNGWRALDELGVGSKI  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R  ALPLQR   I +      +I    G+ RC+ R+DLI +LAD LP GTIRFGC++ SV
Sbjct  68    RPTALPLQRYHPILIAPIVMIEI----GEARCVKRSDLIEALADDLPLGTIRFGCDILSV  123

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             + D    F  L LSNGS I+A+ LIGCDG  S+V++ L LKP K F + A RG T YPN 
Sbjct  124   NLDPEISFPILQLSNGSSIKAKALIGCDGANSVVSDFLELKPKKLFSLCAVRGFTHYPNG  183

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVT---FPTRQLTGEKFPRDENAIKQMVIEN  658
             H L  E  R  KG+V  G +P+  +LV WF+    FP         P+D   ++Q  +E+
Sbjct  184   HGLAPELIRMVKGNVLCGRVPVDDNLVFWFIIQNFFP----KDTNIPKDPELMRQFSLES  239

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
             I   +D P +  E++   E  SLS +HL+YR P E+ LG+ R+GT TVAGDAMH+MGPF+
Sbjct  240   I---KDFPTERLEMVKNCEVTSLSLTHLRYRTPWEIYLGKFRRGTATVAGDAMHIMGPFI  296

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVAQL  304
             GQGG +++EDAVVLARCL   +A    V  ++      S +I EA + YVKERRMR+  L
Sbjct  297   GQGGSAAIEDAVVLARCL---SAKMQEVGQLKSSSHIMSQKIGEAFDDYVKERRMRLVWL  353

Query  303   SMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             S  TYL G+ +  +S+L K++   AM + F N      YDCG L
Sbjct  354   STQTYLYGSLLQNSSRLVKVSIAVAMIVLFGNPIYHTRYDCGPL  397



>ref|XP_009351385.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=407

 Score =   365 bits (938),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/410 (49%), Positives = 267/410 (65%), Gaps = 6/410 (1%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D +  I IVGGGICGLATALALHRKG  S+VLERS+ LR+ GGGI +  NGWRALD
Sbjct  1     MEVGDEELGIAIVGGGICGLATALALHRKGFTSVVLERSESLRATGGGITIRANGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             +LG+ S LR  ALPLQ  RDI+L   K+QKI Y  G+ RC+ R+DLI +LA++LP GTIR
Sbjct  61    ELGVASKLRQTALPLQGARDIYLHNGKQQKISYGGGEARCLKRSDLITTLAESLPVGTIR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              GC+  SV  DS+T +  L L NGS I+A+++IGCDG +S+VA+ +G+KP+K F +   R
Sbjct  121   LGCQAISVKLDSLTSYPTLQLHNGSTIKAKVVIGCDGTKSVVADFIGVKPSKPFMLSEVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVR-VGILPISHDLVHWFVTFPT--RQLTGEKFPRDENA  682
             G T Y + H+   EF    KGD   +G LP+  +LV+WFVT     RQ    K  +D   
Sbjct  181   GFTVYADGHNFGNEF-VQVKGDKNTIGRLPVHENLVYWFVTHQVHGRQADPSKVSKDPEL  239

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             I+Q  +++I  L++ P+++ ++I  SE ES+S   L+YRPP E+L+   RKG+VTVAGDA
Sbjct  240   IRQFTLQSI--LEEFPSEMVDMIRKSELESVSQVRLRYRPPWEILVQNFRKGSVTVAGDA  297

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPF+GQGG + +EDA+V+AR L  A A  +      +      + EA +KYVKERR
Sbjct  298   MHVMGPFIGQGGAAGIEDAIVIARSLAPALAKNHYKKWSGRNGMMVEVGEAFDKYVKERR  357

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MR+  LS  TYL+G     +  + K      MA  F +      YDCG+L
Sbjct  358   MRLVMLSTQTYLVGLLQQDSGSMLKFVCLILMATLFSDVIRHTRYDCGRL  407



>ref|XP_009351387.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=406

 Score =   363 bits (932),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/412 (49%), Positives = 269/412 (65%), Gaps = 11/412 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D +  I IVGGGICGLATALALHRKG  S+VLERS+ LR+ GGGI +  NGWRALD
Sbjct  1     MEVGDEELGIAIVGGGICGLATALALHRKGFTSVVLERSESLRATGGGITIRANGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             +LG+ S LR  ALPLQ  RDI+L   K+QKI Y  G+ RC+ R+DLI +LA++LP GTIR
Sbjct  61    ELGVASKLRQTALPLQGARDIYLHNGKQQKISYGGGEARCLKRSDLITTLAESLPVGTIR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              GC+  SV  DS+T +  L L NGS I+A+++IGCDG +S+VA+ +G+KP+K F +   R
Sbjct  121   LGCQAISVKLDSLTSYPTLQLHNGSTIKAKVVIGCDGTKSVVADFIGVKPSKPFMLSEVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVR-VGILPISHDLVHWFVTFPTRQLTGEKFP----RDE  688
             G T Y + H+   EF    KGD   +G LP+  +LV+WFV   T Q+ G + P    +D 
Sbjct  181   GFTVYADGHNFGNEF-VQVKGDKNTIGRLPVHENLVYWFV---THQVHGRQDPSKVSKDP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               I+Q  +++I  L++ P+++ ++I  SE ES+S   L+YRPP E+L+   RKG+VTVAG
Sbjct  237   ELIRQFTLQSI--LEEFPSEMVDMIRKSELESVSQVRLRYRPPWEILVQNFRKGSVTVAG  294

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKE  328
             DAMHVMGPF+GQGG + +EDA+V+AR L  A A  +      +      + EA +KYVKE
Sbjct  295   DAMHVMGPFIGQGGAAGIEDAIVIARSLAPALAKNHYKKWSGRNGMMVEVGEAFDKYVKE  354

Query  327   RRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             RRMR+  LS  TYL+G     +  + K      MA  F +      YDCG+L
Sbjct  355   RRMRLVMLSTQTYLVGLLQQDSGSMLKFVCLILMATLFSDVIRHTRYDCGRL  406



>gb|AHL20262.1| monoxygenase [Olea europaea]
Length=403

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/408 (48%), Positives = 262/408 (64%), Gaps = 6/408 (1%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             +M S +   +IVIVGGGICGLATALALHRKGL+SI+LE+S+ LR  G  IG+  NGWRAL
Sbjct  2     DMNSVEETRDIVIVGGGICGLATALALHRKGLRSIILEKSETLRDTGAAIGIRANGWRAL  61

Query  1215  DQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTI  1036
             +QLG+ S LR  A  + R RDI++   K+Q+I  V G+ RC+ R DLI+ LAD LP GT+
Sbjct  62    EQLGVASDLRLKADTIHRMRDIWMDVGKQQEIPEV-GECRCVKRKDLIKVLADNLPPGTV  120

Query  1035  RFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             RFG  + SV+ D  T +  L L     I A++LIGCDG RS VA+ LGLK  K F +++ 
Sbjct  121   RFGSPIVSVNMDRETSYPTLQLYGEKSIRAKVLIGCDGSRSTVADFLGLKSTKMFAILSV  180

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK  676
             RGLT+YPN H+   EF R  +G + VG  PI+  LV+WFV  P    + E+  +D   IK
Sbjct  181   RGLTSYPNGHAFDCEFTRMRRGKISVGRAPITDKLVYWFVALPWTP-SDERLTQDPEVIK  239

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
              +      K+   P+ + E+I  ++ +SLS + L++R P +LLL   RKGTVTVAGDAMH
Sbjct  240   WL---TSSKVSGFPSDIMEMIEKAKVDSLSLTRLRHRAPWDLLLTTFRKGTVTVAGDAMH  296

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
             VMGPFLGQGG ++LEDAVVLARCL      + ++    K+     + EA+++YVKERR R
Sbjct  297   VMGPFLGQGGSAALEDAVVLARCLARKVRAE-DLSNCGKQILINEVGEAIDQYVKERRKR  355

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +  LS  TY+ G  +   S L K+     + + FR+     +YDCG+L
Sbjct  356   LVALSTRTYITGLLLETRSWLVKLVVIMLLVILFRDPVGHTKYDCGRL  403



>ref|XP_006283836.1| hypothetical protein CARUB_v10004937mg, partial [Capsella rubella]
 gb|EOA16734.1| hypothetical protein CARUB_v10004937mg, partial [Capsella rubella]
Length=410

 Score =   353 bits (906),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 192/401 (48%), Positives = 268/401 (67%), Gaps = 12/401 (3%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
             I+IVGGGI GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR
Sbjct  19    ILIVGGGIAGLATSLALHRKGIKSVVLERAEQVRSEGAGIGTLTNGWRALDQLGVGHRLR  78

Query  1185  TVALPLQRGRDIFLGEDKEQK-IEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
               +L + + R + +   K Q+ +  ++ + RC+ RNDL+ +LADALP GTIRFG ++ S+
Sbjct  79    LTSLLIHKARTMLIENGKTQEFVLTIADEARCIKRNDLVEALADALPQGTIRFGSQIVSI  138

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             + D  T F  + LSNG  I+A+ILIGCDG  S+V++ L L P K F   A RG T YPN 
Sbjct  139   NEDQTTSFPVVQLSNGKTIKAKILIGCDGANSVVSDYLQLGPRKAFSCRAVRGFTNYPNG  198

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP-RDENAIKQMVIENIE  652
             H  P E  R  KG++ VG LP++ + V WF+      +    +   D+ +I  + ++ ++
Sbjct  199   HGFPQELLRIKKGNILVGRLPLTENQVFWFLV----HMQDNHYKVEDQESIANLCLKWVD  254

Query  651   KLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQ  472
                ++  + KE++ +   ESLS +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFLGQ
Sbjct  255   ---EMSQEWKEMVKICNVESLSLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLGQ  311

Query  471   GGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHT  292
             GG ++LEDAVVLARCL  A  V  +   + K+     IEE +++YVKERRMR+  LS+ T
Sbjct  312   GGSAALEDAVVLARCL--ARKVGPDQGDLLKDCSMRSIEEGIDEYVKERRMRLLGLSVQT  369

Query  291   YLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             YL G S+   SK+ ++ F   + L F R+     +YDCG+L
Sbjct  370   YLTGRSLQTPSKVVRLMFIVLLVLLFGRDQIRHTKYDCGRL  410



>ref|XP_008237398.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Prunus mume]
Length=404

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 258/404 (64%), Gaps = 12/404 (3%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             EI IVGGGICGLATALALHRKGL+S+VLERS+ LR+ G GI +  NGWRALD+LG+ S L
Sbjct  8     EIAIVGGGICGLATALALHRKGLRSVVLERSESLRATGAGITIRTNGWRALDELGVASKL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R  A+PLQ  RDI L   K+++I    G+ RC+ R DLI +LA++LP GTIR GC+  SV
Sbjct  68    RQTAMPLQGARDICLNSGKQREIPLGGGETRCLKRMDLITALAESLPRGTIRLGCQALSV  127

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
               DS T    L L NGS I+A++LIGCDG  S+VA+ L L P+K F +   RG T YP+ 
Sbjct  128   RLDSSTSSPSLHLQNGSSIKAKVLIGCDGTNSVVADFLDLNPSKLFSLSEVRGFTMYPSG  187

Query  828   HSLPIEFHRHF---KGD-VRVGILPISHDLVHWFVTFPTRQ-LTGEKFPRDENAIKQMVI  664
             H+    F  HF   KGD   VG +PI + LV+WFVT        G + P+D   I+Q+ +
Sbjct  188   HN----FGNHFVQVKGDKCTVGRIPIHNKLVYWFVTQKVMYGRGGLEVPKDPELIRQLTL  243

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
             E I   +D P+++ ++I  S+ ESLS + L+YR P ++L+G  RKG+VTVAGDAMH MGP
Sbjct  244   EAI---KDFPSEMIDMISKSDTESLSNTRLRYRSPWDILVGNFRKGSVTVAGDAMHTMGP  300

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQL  304
             FLGQGG + +ED++V+ARCL    A   +     +     ++EEAL+KYVKERRMR+  L
Sbjct  301   FLGQGGSAGIEDSIVIARCLAQKLAENYDKKSRARHIMMMKVEEALDKYVKERRMRLVLL  360

Query  303   SMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             S  TYL G     +  + K      M   F +      YDCG L
Sbjct  361   STQTYLAGLLQQDSGLIVKFVCIILMTALFSDMTRHTRYDCGCL  404



>ref|XP_010930384.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=402

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/408 (45%), Positives = 264/408 (65%), Gaps = 7/408 (2%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG++S+VLE+   +R+ G  IGV  N WRALD
Sbjct  1     MGSVEEHHDIVIVGGGICGLATALALHRKGIRSLVLEKYNTIRATGAAIGVFINAWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G+ LRT A+ +   +D++  ++  +       ++RC+ RNDLI +L + LP  ++R
Sbjct  61    QLGVGAELRTKAVLVPENQDVWRNKNATRLNSCRKEELRCLKRNDLIETLYNNLPVNSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V  D +T F  L   +G  I+A++LIGCDG  SI+++ LGLKP K       R
Sbjct  121   FGCQIVAVGTDPLTSFPILYTHDGIIIKAKVLIGCDGSNSIISKSLGLKPPKSLTNCVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GLT YPN H++   F RH +G +  G +PI ++LVHWFV +P     G   P+D   I +
Sbjct  181   GLTNYPNGHNIGNYFLRHLEGCMIFGRIPIDNNLVHWFVDWPYPDKEG---PKDPKFIIE  237

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             + I  I   +D PA++ E++  S+P SL+F+ ++Y+ P  L+LG   +GT+TVAGDAMHV
Sbjct  238   LAIRQI---KDYPAEMIEMVKNSDPASLTFTRIRYQTPWHLVLGNFCRGTITVAGDAMHV  294

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             MGPFLGQGG ++LEDAVVLAR L     +         EE   R E AL+ YVKER++RV
Sbjct  295   MGPFLGQGGGAALEDAVVLARSLAEMMPMGYFEANASDEELRKRTETALKNYVKERKLRV  354

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
              +L+M + L+G  M++ SK+ ++     + LFF   A +  ++DCG L
Sbjct  355   LRLAMQSVLVGLLMSSPSKVKRLVSLVLLILFFGGPALSHTQFDCGHL  402



>ref|XP_010111252.1| 3-hydroxybenzoate 6-hydroxylase 1 [Morus notabilis]
 gb|EXC30730.1| 3-hydroxybenzoate 6-hydroxylase 1 [Morus notabilis]
Length=404

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 195/401 (49%), Positives = 254/401 (63%), Gaps = 6/401 (1%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GICGLATALALHRKG+KS+VLERS+ LR+ G  I +L NGWRALDQLGIG  L
Sbjct  8     DIVIVGAGICGLATALALHRKGIKSVVLERSETLRAFGSAIAILTNGWRALDQLGIGPKL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R  ALPLQ  RDI+L  +K+++     G+ RC+ R+DLI  LA  LP GTIRFGC +  V
Sbjct  68    RQTALPLQGVRDIWLDGNKQRRGPLSKGEARCVKRSDLINMLAQDLPHGTIRFGCHILFV  127

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             + D +T F  L L +G  I+A+ILIGCDG  S+VAE L +KP K F     RGLT YP+ 
Sbjct  128   ELDPLTNFPILQLRDGRAIKAKILIGCDGASSVVAEYLKVKPKKSFPAFGIRGLTYYPSP  187

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEK  649
             H    EF R    +V  G   I+ +LV WF+  P      E F +D   IKQM +E    
Sbjct  188   HGFDPEFVRTHGNNVVCGRSTINQNLVFWFLLLPGYLKDSEIF-KDPELIKQMALEKTN-  245

Query  648   LQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQG  469
                 P +  E+I   +  SLS +HL YRP  ++LLG  RKG VT+AGD+MHVMGPFLGQG
Sbjct  246   -DAFPKETIEMIKDCDITSLSLTHLWYRPAWDILLGTFRKGMVTLAGDSMHVMGPFLGQG  304

Query  468   GCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR--IEEALEKYVKERRMRVAQLSMH  295
             G +++EDAVVLARCL +      +++G E      R  +EEA++ YVKERRMR+ +LS  
Sbjct  305   GSAAMEDAVVLARCLANKIH-GESINGFEGNNGLFRKKMEEAMDLYVKERRMRLVRLSAQ  363

Query  294   TYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +Y+ G   ++ S + K+     + + F++      YDCG L
Sbjct  364   SYVTGLLFSSASMIGKILLLALIIVLFQDPIRHTRYDCGHL  404



>ref|XP_002868183.1| monooxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44442.1| monooxygenase [Arabidopsis lyrata subsp. lyrata]
Length=397

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 188/393 (48%), Positives = 261/393 (66%), Gaps = 14/393 (4%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVGDRLRLTSRLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K+Q  E+VS    + RC+ RNDL+ +LADALP GTIRFG ++ S++ D  T 
Sbjct  75    RTMLIENGKKQ--EFVSTLVDEARCIKRNDLVEALADALPEGTIRFGSQIVSIEEDKSTS  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ IEA++LIGCDG  SIV+E L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLTNGNTIEAKVLIGCDGANSIVSEYLQLNPKKAFACRAVRGFTNYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAK  628
              R  +G++ +G LP++ +LV WF+             +D+ +I  + ++  E   DL   
Sbjct  193   LRIKQGNILIGRLPLTDNLVFWFL---VHMQDNNHNGKDQESIANLCLKWAE---DLSED  246

Query  627   VKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLED  448
              KE++ + + ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++LED
Sbjct  247   WKEMVKICDVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAALED  306

Query  447   AVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMA  268
             AVVLARCL  A  V  +   + K+     IEEA+++YV+ERRMR+  LS+ TYL G S+ 
Sbjct  307   AVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVEERRMRLLGLSVQTYLTGRSLQ  364

Query  267   ATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
              +SK+ ++ F    + LF R+    + YDCG+L
Sbjct  365   TSSKVLRLMFIALLLLLFGRDQIRHSRYDCGRL  397



>ref|XP_008791370.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Phoenix dactylifera]
Length=403

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 259/411 (63%), Gaps = 12/411 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+S  LR+ G  IG+  NGWRALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKSDTLRAAGAAIGIYINGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G+ LRT A+P+   RD++L ++K Q       ++RC+ R+DLI +LA  LP  ++R
Sbjct  61    QLGLGTELRTKAIPITEIRDMWLHKNKMQVTSCRKEELRCLKRSDLIETLAKNLPTQSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D +T F  L  ++G+ I+A++LI CDG  S+VA+ LGL+  K F + A R
Sbjct  121   FGCQIVAVESDPITSFPVLYTNDGATIKAKVLIXCDGSNSVVAKSLGLQAPKVFPISAVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGD-VRVGILPISHDLVHWFV--TFPTRQLTGEKFPRDENA  682
             G T+Y + HS    F R  +GD V +G LP+   LV+WFV    P++     K P     
Sbjct  181   GFTSYSDGHSFDSHFIR-LRGDGVLLGRLPVDEKLVYWFVGRLSPSQDSDVRKVP---EL  236

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IK+  +E I   ++ P ++ E++   +  SLS +H+ YR P  LL     +GT+TVAGDA
Sbjct  237   IKEFTLETI---REFPPEIIEMVKHCDSSSLSLTHIWYRAPWHLLFANFWQGTMTVAGDA  293

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG + LEDA+VLARCL     +      I   E   RI  A+ KYV ERR
Sbjct  294   MHVMGPFLGQGGSAGLEDAIVLARCLSQEMPMGPE-GAISDRELCRRIGRAMSKYVNERR  352

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG-AAQNEYDCGQL  172
             +RV +LS  +YL G+ + A+S + K+     + +F   G  +   YDCG L
Sbjct  353   LRVMRLSAQSYLTGSVVVASSWVKKLVCLAILVVFLGGGLLSHTNYDCGSL  403



>ref|XP_008231661.1| PREDICTED: uncharacterized protein LOC103330826 [Prunus mume]
Length=399

 Score =   338 bits (866),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 181/410 (44%), Positives = 255/410 (62%), Gaps = 14/410 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D+K  IVIVGGGICGLATALALHRKG++S+VLERS  LR+ G  I V PNGWRALD
Sbjct  1     MEIGDTKENIVIVGGGICGLATALALHRKGIRSVVLERSNALRATGAAIIVHPNGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+ SHLR  A+P+  G+   L  D+ ++I     ++RC+ R DLI  LA++LP  T+ 
Sbjct  61    QLGVASHLRETAIPILSGKFHSLNNDELKEIPVGKEELRCLKRTDLIDILANSLPRNTLH  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGCEV S+  D +T    L L  G  + A+++IGCDG  S ++ +LG+K  K F +   R
Sbjct  121   FGCEVLSIKLDPITSSPVLQLQGGRLLNAKVVIGCDGVNSAISNMLGVKAEKIFTISVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK--FPRDENAI  679
             G T+YPN H L  +F    K D +VG LP+S +LV+WF+   TR+ T +     + +  +
Sbjct  181   GFTSYPNGHELGSQFRLTKKDDTQVGQLPMSENLVYWFI---TRKCTCQDSMASKSQKLV  237

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFS-HLKYrppgelllgrlRKGTVTVAGDA  502
             + + ++++E     P  + E+    E +SL  + +L+Y  P + L  R R+GTV +AGDA
Sbjct  238   RNLALDSVES---FPTSITEMAKNCELDSLHLTEYLRYHAPWDTLRRRFREGTVALAGDA  294

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH MGPFL QGG + LEDAVVLARCL     +  N  G + +     +EEA ++Y+KER+
Sbjct  295   MHAMGPFLAQGGSACLEDAVVLARCLARTIHIDRNGRGTKMQ-----VEEAFDEYLKERK  349

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MR+ +LS+  YLIG  + A+S+  K      +A+ F +      YDCG L
Sbjct  350   MRILRLSLQMYLIGKMLDASSQFVKFICIILLAVLFSDSHGHTRYDCGSL  399



>ref|XP_010930394.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=403

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/411 (45%), Positives = 258/411 (63%), Gaps = 12/411 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+   LR+ G  I V  NGW ALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKFDTLRASGAAITVYINGWHALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLGIG  LR  A+PL   RDI+L ++K Q        +RC  R DLI +LA  LP G+IR
Sbjct  61    QLGIGMELRRKAIPLTEIRDIWLHKNKMQVTSCRKEALRCFKRRDLIETLAKNLPVGSIR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +++ D  + F  L  ++G+ I+A++LIGCDG  S++A+ LGL+  K   + A R
Sbjct  121   FGCQIVAIELDPFSSFPILYTNDGATIKAKVLIGCDGSNSVIAKSLGLQAPKVCPISAVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRV-GILPISHDLVHWFVT--FPTRQLTGEKFPRDENA  682
             GLT+Y N H+    F R  +GD  V G LP++ +LVHWFV    P++    +K   D   
Sbjct  181   GLTSYSNGHNFDSHFIR-LRGDGAVLGRLPVNENLVHWFVIQQCPSQDSDVQK---DPEL  236

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IK++ +E    L++ P +V E++   +  SLS +H++YR P  L   +  +GT TVAGDA
Sbjct  237   IKKVTLET---LKEFPPEVIEMVEHCDSSSLSLTHIRYRAPWHLFFAKFWQGTTTVAGDA  293

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG + LEDA+VLARC+     +          E   RI  AL KYVKERR
Sbjct  294   MHVMGPFLGQGGSAGLEDAIVLARCIAEEMPMGPE-GATNDREMVKRIGIALSKYVKERR  352

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             +R+ +LS  +YLIG+ +  +S + K+     + +F R G+ + + YDCG L
Sbjct  353   LRIMRLSTQSYLIGSMITTSSWVKKLVQLAILIVFLRGGSLSHSNYDCGSL  403



>ref|XP_010551060.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=393

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 257/401 (64%), Gaps = 16/401 (4%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
             IVIVGGGI GLAT+LALHRKG+KS+VLER++ LRS+G  +GV  NGW+AL+QLG+   LR
Sbjct  6     IVIVGGGIAGLATSLALHRKGIKSVVLERAESLRSDGAALGVQTNGWKALEQLGVAHILR  65

Query  1185  TVALPLQRGRDIFL--GEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
               +LP  + R + +  G+  E       G+ RC+ RNDL++ LADALP GTIRFGC V+S
Sbjct  66    LSSLPFYQIRSVLVENGKRYESAAPVSYGEARCIKRNDLVKVLADALPQGTIRFGCRVAS  125

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPN  832
             V  D  T F  + + +G+ I+A++LIGCDG  S+VAE L L   K     A RGLT+YPN
Sbjct  126   VKLDETTSFPIIRVQDGTNIKAKVLIGCDGANSVVAEFLRLNRTKVCASRAVRGLTSYPN  185

Query  831   AHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIE  652
              H    EF R    DV  G LPI+   V WF   P      + F +D+ A++++ + +I+
Sbjct  186   GHGFRHEFVRIKTDDVLCGRLPITAHSVFWFALVPNCSADSKNF-KDQEAVQKLTLRSIK  244

Query  651   KLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQ  472
             +L +   + KE++   +  SL  S L+YR P E+L G+ R GTVTVAGDAMH+MGPFLGQ
Sbjct  245   ELSE---EWKEMVKKCDKSSLYMSSLRYRTPWEILFGKFRTGTVTVAGDAMHMMGPFLGQ  301

Query  471   GGCSSLEDAVVLARCLGSAAAVKNNVDGIEK-EERSARIEEALEKYVKERRMRVAQLSMH  295
             GG S+LEDAVV+ARCL          + IEK  +   RIEE +++YV+ERRMR+  LS  
Sbjct  302   GGSSALEDAVVMARCLA---------EKIEKCGDSRKRIEEGIDEYVRERRMRLFSLSTQ  352

Query  294   TYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             TYL G  + ++S++ K+ F   + + F +      YDCG+L
Sbjct  353   TYLTGLCIESSSRVVKLMFMVFVMVLFFDPIHHTRYDCGRL  393



>ref|XP_007020077.1| Monooxygenase, putative [Theobroma cacao]
 gb|EOY17302.1| Monooxygenase, putative [Theobroma cacao]
Length=414

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 186/405 (46%), Positives = 260/405 (64%), Gaps = 14/405 (3%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + + VIVGGGICGLATALALHRKG+KS+VLE+S+ LR+ G GI + PNGWRALDQLG+ S
Sbjct  20    EQDTVIVGGGICGLATALALHRKGIKSVVLEKSETLRTTGVGIIMQPNGWRALDQLGVAS  79

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
              LR  A+ +   + I + + K  ++    G++RC+ R DL+  LA+ LP  T+ FGC+V 
Sbjct  80    KLRETAMDISSRQLIMVDDGKRLELPLGKGELRCLKRLDLVEVLAEPLPVNTVHFGCKVL  139

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             S+  D VT +  L L +GS I A+I+IGCDG  S++++ LG+ P K F   ATRG T Y 
Sbjct  140   SIVLDPVTSYPVLQLHDGSIIRAKIVIGCDGVNSVISKFLGMNPPKLFSRCATRGFTWYE  199

Query  834   NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ----MV  667
               H     F  H   +V++G LP++  LV+WF+   TR LT    P+D NA K+      
Sbjct  200   RGHDFSGVFRIHKTDNVQLGQLPVTDKLVYWFL---TRSLT----PQDSNASKKDPAYTK  252

Query  666   IENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMG  487
               ++E ++  P +  E+I  SE +SL  + L+Y PP ELL  + R GTV VAGDAMH M 
Sbjct  253   EASMEAMKGFPHETVEMIKNSEDKSLYLTELRYLPPWELLRAKFRLGTVVVAGDAMHAMC  312

Query  486   PFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQ  307
             PF+ QGG +SLEDAVVLARCL     +K       ++E+   +E+AL+ YV+ERRMR+  
Sbjct  313   PFISQGGGASLEDAVVLARCLSEKIKIKMQT---SRQEQKMMLEKALDLYVRERRMRLFW  369

Query  306   LSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             LS+ TYLIG ++  TSK+ K+    ++ L FR+  +  +YDCG+L
Sbjct  370   LSLQTYLIGMTLDNTSKVKKVLGIVSLILIFRDQRSHTDYDCGRL  414



>ref|XP_007200114.1| hypothetical protein PRUPE_ppa018848mg [Prunus persica]
 gb|EMJ01313.1| hypothetical protein PRUPE_ppa018848mg [Prunus persica]
Length=387

 Score =   335 bits (859),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 249/401 (62%), Gaps = 23/401 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             EI IVGGGICGLATALALHRKGL+S+VLERS+ LR+ G GI +  NGWRALD+LG+ S L
Sbjct  8     EIAIVGGGICGLATALALHRKGLRSVVLERSESLRATGAGITIRTNGWRALDELGVASKL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R  A+PLQ G                 G+ RC+ R DLI +LA++LP GTIR GC+  SV
Sbjct  68    RQTAMPLQGG-----------------GETRCLKRMDLITALAESLPRGTIRLGCQALSV  110

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
               DS T    L L NGS I+A++LIGCDG  S+VA+ L LKP+K F +   RG T YP+ 
Sbjct  111   RLDSSTSSPSLHLQNGSSIKAKVLIGCDGTNSVVADFLDLKPSKLFSLSEVRGFTMYPSG  170

Query  828   HSLPIEFHRHFKGD-VRVGILPISHDLVHWFVTFPTRQ-LTGEKFPRDENAIKQMVIENI  655
             H+   +F    KGD   VG +PI + LV+WFVT        G + P+D   I+Q+ +E I
Sbjct  171   HNFGNQFV-QVKGDKCTVGRIPIHNKLVYWFVTQKVMYGRGGLEVPKDPELIRQLTLEAI  229

Query  654   EKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLG  475
                +D P+++ ++I  S+ +SLS + L+YR P ++L+   RKG+VTVAGDAMH MGPFLG
Sbjct  230   ---KDFPSEMIDMISKSDTKSLSNTRLRYRSPWDILVRNFRKGSVTVAGDAMHTMGPFLG  286

Query  474   QGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMH  295
             QGG + +ED++V+ARCL    A   +     +     ++EEAL+KYVKERRMR+  LS  
Sbjct  287   QGGSAGIEDSIVIARCLAQELAENYDKKSRARNIMMMKVEEALDKYVKERRMRLVLLSTQ  346

Query  294   TYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             TYL G     +  + K      M   F +      YDCG L
Sbjct  347   TYLAGLLQQDSGLIVKFVCIFLMTALFSDMTRHTRYDCGCL  387



>ref|XP_004506359.1| PREDICTED: putative oxidoreductase YetM-like [Cicer arietinum]
Length=407

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 262/405 (65%), Gaps = 13/405 (3%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             ++E+VIVGGGICGLATALALHRK ++S+VLE+S+ LR+ G  I V  NGW ALDQLGIGS
Sbjct  6     ENEVVIVGGGICGLATALALHRKRIRSLVLEKSEKLRATGAAIIVQANGWHALDQLGIGS  65

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
              LR  A+ +QRG    L E + +++ + ++ + RC+ R DLI+++A+ LP  TIR GCEV
Sbjct  66    TLRQTAIAIQRGMFTSLSEKEPKELAFGINQEFRCLKRTDLIKAIANCLPMETIRTGCEV  125

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK--EFGVVATRGLT  844
              S++ D VT++  L+LSNG+ ++A+++IGCDG  S +A ++GL   K   F     RG T
Sbjct  126   LSIELDPVTRYPHLMLSNGTILQAKVVIGCDGVNSTIANMVGLHQTKLLRFSTCVARGFT  185

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVI  664
              YPN H    EF    +G +++G +P++H+LV+WF+T PT         +D   I+Q ++
Sbjct  186   KYPNGHQFASEFALISRGQIQLGRIPVTHNLVYWFLTRPTTS-QDSIISKDLPLIRQSLV  244

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSH-LKYrppgelllgrlRKGTVTVAGDAMHVMG  487
             E++E     P    ++I   +  SL  ++ LKYRPP +LLL   +KGT+ VAGDAMH  G
Sbjct  245   ESME---GFPILTIDMIRSCKLNSLHLTYDLKYRPPWDLLLNNFKKGTIVVAGDAMHATG  301

Query  486   PFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQ  307
             PF+ QGG +S+EDA+VLARCL  A  + N+   I        IEEA +KYVKER+MR+  
Sbjct  302   PFIAQGGSASIEDAIVLARCL--AQKMHNSTKVIIDHN---VIEEAFDKYVKERKMRIFW  356

Query  306   LSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             LS+HT+L+G  +   S + +  F   M + FR+    + Y+CG L
Sbjct  357   LSLHTFLVGKKLDTKSLMVRAVFLAIMFVLFRDPDCHSRYNCGTL  401



>ref|XP_010688731.1| PREDICTED: kynurenine 3-monooxygenase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   335 bits (859),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 253/403 (63%), Gaps = 14/403 (3%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGICGLATALALHRKG+KS+VLERS  LR+ G  IGV PNGWRAL QLG+ S L
Sbjct  8     DIVIVGGGICGLATALALHRKGIKSVVLERSDTLRATGAAIGVFPNGWRALHQLGLDSTL  67

Query  1188  RTVALPLQRGRDIFLGEDK---EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             ++ A+P QR  D+    DK    + +    G+ RC+ R+DL+ +LA+ALP+ TIRFGC++
Sbjct  68    QSTAIPFQRAVDVL--ADKGIVRETLLSEGGEARCLRRSDLVDALANALPSETIRFGCQL  125

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              SV+ +  + +  L L +GS I+A++LIGCDG  S++A  +GLKP + F   A RGLTTY
Sbjct  126   VSVNIEGSSSYAALQLHDGSLIKAKVLIGCDGANSVIASYIGLKPTRPFSTCAVRGLTTY  185

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             PN H    EF R  K    VG +PI    V+WFV     Q  GE  P+D  +I+QM    
Sbjct  186   PNGHGFAPEFLRMRKDKHLVGRIPIDEKTVYWFVVLQWIQRDGE-MPKDSTSIRQM---T  241

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
             ++     P  + ++I  S+  SLS + L+YR P  LL G  R+ TVTVAGDA HVMGPFL
Sbjct  242   LDITAGFPNDIVDMIENSDLSSLSLTRLRYRAPWNLLSGNFRRETVTVAGDAWHVMGPFL  301

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSM  298
             GQGG ++LEDAVVLARCL    +  ++   +  +      +EAL++Y+KERR RV  LS 
Sbjct  302   GQGGSAALEDAVVLARCLAKKISNADHSGHLSTQ----LAKEALDEYLKERRRRVVLLST  357

Query  297   HTYLIGASMAA-TSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              TYL G  +    S L +      + + FR+      YDCG+L
Sbjct  358   LTYLRGLLLVEDPSLLLRFLCIIIITVLFRDPLNHIRYDCGEL  400



>ref|XP_008237399.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Prunus mume]
Length=387

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/404 (48%), Positives = 250/404 (62%), Gaps = 29/404 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             EI IVGGGICGLATALALHRKGL+S+VLERS+ LR+ G GI +  NGWRALD+LG+ S L
Sbjct  8     EIAIVGGGICGLATALALHRKGLRSVVLERSESLRATGAGITIRTNGWRALDELGVASKL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R  A+PLQ G                 G+ RC+ R DLI +LA++LP GTIR GC+  SV
Sbjct  68    RQTAMPLQGG-----------------GETRCLKRMDLITALAESLPRGTIRLGCQALSV  110

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
               DS T    L L NGS I+A++LIGCDG  S+VA+ L L P+K F +   RG T YP+ 
Sbjct  111   RLDSSTSSPSLHLQNGSSIKAKVLIGCDGTNSVVADFLDLNPSKLFSLSEVRGFTMYPSG  170

Query  828   HSLPIEFHRHF---KGD-VRVGILPISHDLVHWFVTFPTRQ-LTGEKFPRDENAIKQMVI  664
             H+    F  HF   KGD   VG +PI + LV+WFVT        G + P+D   I+Q+ +
Sbjct  171   HN----FGNHFVQVKGDKCTVGRIPIHNKLVYWFVTQKVMYGRGGLEVPKDPELIRQLTL  226

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
             E I   +D P+++ ++I  S+ ESLS + L+YR P ++L+G  RKG+VTVAGDAMH MGP
Sbjct  227   EAI---KDFPSEMIDMISKSDTESLSNTRLRYRSPWDILVGNFRKGSVTVAGDAMHTMGP  283

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQL  304
             FLGQGG + +ED++V+ARCL    A   +     +     ++EEAL+KYVKERRMR+  L
Sbjct  284   FLGQGGSAGIEDSIVIARCLAQKLAENYDKKSRARHIMMMKVEEALDKYVKERRMRLVLL  343

Query  303   SMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             S  TYL G     +  + K      M   F +      YDCG L
Sbjct  344   STQTYLAGLLQQDSGLIVKFVCIILMTALFSDMTRHTRYDCGCL  387



>ref|XP_008786384.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Phoenix dactylifera]
Length=403

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 250/410 (61%), Gaps = 10/410 (2%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+S  LR+ G  IG+  NGWRALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKSDTLRAAGAAIGIYINGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G+ LRT A+P+   RD++L ++K Q       ++RC+ R DLI +LA  LP  ++R
Sbjct  61    QLGLGTELRTKAIPITEIRDMWLHKNKMQVTSCRKEELRCLKRGDLIETLAKNLPMQSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D +T F  L  ++G+ I+A++LIGCDG  S+VA+ LGL+  K   + A R
Sbjct  121   FGCQIVAVESDPITSFPILYTNDGATIKAKVLIGCDGSNSVVAKSLGLQAPKVLSLSAVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDENAI  679
             G T+Y + HS    F R     V +G LPI   LV+W      P++     K P     I
Sbjct  181   GFTSYSDGHSFGSHFIRLIGDGVMLGRLPIDEKLVYWAAARLCPSQDSDVRKVP---ELI  237

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             K+  +E I   ++ P +V E++   +  SLS +H+ YR P  LL     +GT+TVAGDAM
Sbjct  238   KEFTLETI---REFPPEVIEMVKHCDSSSLSLTHIWYRAPWHLLFANFWQGTMTVAGDAM  294

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             HVM P LGQGG + LEDA+VLARCL     +      I   E   RI  AL KYV ERR+
Sbjct  295   HVMAPVLGQGGSAGLEDAIVLARCLSQEMPMGPE-GAISDRELRRRIGRALSKYVNERRL  353

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             RV +LS  TYL    M A+S + K+     + +F R G  +   YDCG L
Sbjct  354   RVMRLSTQTYLTALVMTASSWIKKLVCLAILVVFLRGGPLSHTNYDCGSL  403



>ref|XP_008786386.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Phoenix dactylifera]
Length=401

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/408 (45%), Positives = 248/408 (61%), Gaps = 8/408 (2%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+S  LR+ G  IG+  NGWRALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKSDTLRAAGAAIGIYINGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G+ LRT A+P+   RD++L ++K Q       ++RC+ R DLI +LA  LP  ++R
Sbjct  61    QLGLGTELRTKAIPITEIRDMWLHKNKMQVTSCRKEELRCLKRGDLIETLAKNLPMQSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D +T F  L  ++G+ I+A++LIGCDG  S+VA+ LGL+  K   + A R
Sbjct  121   FGCQIVAVESDPITSFPILYTNDGATIKAKVLIGCDGSNSVVAKSLGLQAPKVLSLSAVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G T+Y + HS    F R     V +G LPI   LV+W      R    +   +    IK+
Sbjct  181   GFTSYSDGHSFGSHFIRLIGDGVMLGRLPIDEKLVYWAA---ARLCPSQDVRKVPELIKE  237

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
               +E I   ++ P +V E++   +  SLS +H+ YR P  LL     +GT+TVAGDAMHV
Sbjct  238   FTLETI---REFPPEVIEMVKHCDSSSLSLTHIWYRAPWHLLFANFWQGTMTVAGDAMHV  294

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGG + LEDA+VLARCL     +      I   E   RI  AL KYV ERR+RV
Sbjct  295   MAPVLGQGGSAGLEDAIVLARCLSQEMPMGPE-GAISDRELRRRIGRALSKYVNERRLRV  353

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
              +LS  TYL    M A+S + K+     + +F R G  +   YDCG L
Sbjct  354   MRLSTQTYLTALVMTASSWIKKLVCLAILVVFLRGGPLSHTNYDCGSL  401



>ref|XP_010434923.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=397

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 260/392 (66%), Gaps = 12/392 (3%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +L + + 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVGQRLRVTSLLIHKA  74

Query  1158  RDIFLGEDKEQK-IEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFT  982
             R + +   K+Q+ +  +  + RC+ RNDL+ +LADALP GTIRFG ++ S+  D  T F 
Sbjct  75    RTMLIENGKKQEFVLTIKDEARCIKRNDLVEALADALPEGTIRFGSQIVSIKEDQTTSFP  134

Query  981   RLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHR  802
              + L NG+ I+A++LIGCDG  S+V++ L L P K F   A RG T YPN H  P E  R
Sbjct  135   IVQLFNGTMIKAKVLIGCDGANSVVSDYLNLGPKKAFSCRAVRGFTNYPNGHGFPQELLR  194

Query  801   HFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVK  622
               KG++ +G LP++ + V WF+         +   +D+ +I ++ ++ +++L +     K
Sbjct  195   MKKGNILIGRLPLTENQVFWFL---VHMQDNDHKVKDQESIAKLCLKWVDELFE---DWK  248

Query  621   EVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAV  442
             E++   + ESLS +HL+YR P E++ G+ R+GTVTVAGDAMHVMGPFLGQGG ++LEDAV
Sbjct  249   EMVKTCDVESLSLTHLRYRAPSEIMFGKFRRGTVTVAGDAMHVMGPFLGQGGSAALEDAV  308

Query  441   VLARCLGSAAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMRVAQLSMHTYLIGASMAA  265
             VLARCL       +   G   E+ S R IEEA+++YVKERRMR+  LSM TYL G S+  
Sbjct  309   VLARCLARKVGPDH---GDLLEDCSMRSIEEAIDEYVKERRMRLLGLSMQTYLTGRSLQT  365

Query  264   TSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
              SK+ ++ F   + L F R+     +YDCG+L
Sbjct  366   PSKVVRLFFIVLLVLLFGRDQIRHTQYDCGRL  397



>gb|KEH29341.1| FAD/NAD(P)-binding oxidoreductase family protein [Medicago truncatula]
Length=884

 Score =   347 bits (889),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 268/406 (66%), Gaps = 16/406 (4%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             ++EIVIVGGGICGLATALALHRK +KS+VLERS+ LR+ G  I V  NGW ALDQLG+GS
Sbjct  481   ENEIVIVGGGICGLATALALHRKRIKSLVLERSEELRATGAAIIVQANGWHALDQLGVGS  540

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
              LR  A+ +Q G+ I LGED+ +++ + +  + RC+ R DLI+++A+ LP  TIR GC+V
Sbjct  541   ILRETAIQIQGGKFISLGEDEPKEVPFGIYKEFRCLKRTDLIKAMANCLPMETIRTGCQV  600

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK--EFGVVATRGLT  844
              S++ D +T++ +L+LSNGS ++A+++IGCDG  S +A ++GL   K   F   A RG T
Sbjct  601   VSIELDPITQYRQLVLSNGSILQAKVVIGCDGVNSTIANMVGLHETKLLRFSTCAARGFT  660

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK--FPRDENAIKQM  670
              YPN H  P EF    +G V++G++P++  LV+WFV   TR  T +     +D   I+Q 
Sbjct  661   EYPNGHQFPSEFAMMSRGQVQLGMMPMTDKLVYWFV---TRLNTAQDSIISKDPALIRQS  717

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             ++E++E     P    ++I   +  SL  + LKYRPP +LLL +  KGT+ VAGDAMH  
Sbjct  718   LMESME---GFPIHAMDMISNCKLNSLHLTDLKYRPPWDLLLNKFSKGTMVVAGDAMHAT  774

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
             GPF+ QGG +S+EDA+VLARCL  A  + N  +GI      + +EEA +KYVKERRMR+ 
Sbjct  775   GPFIAQGGSASIEDAIVLARCL--AQKMHNTTNGIMAR---STVEEAFDKYVKERRMRIF  829

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              LS++TYL+G  + A S++ +      M + FR+      Y+CG L
Sbjct  830   WLSLNTYLVGKKLDAKSRIVRFVVIAIMFVLFRDPNCHLRYNCGTL  875


 Score =   287 bits (735),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/350 (46%), Positives = 230/350 (66%), Gaps = 16/350 (5%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             ++EIVIVGGGICGLATALALHRK +KS+VLE+S+ LR+ G  I V  NGW ALDQLG+GS
Sbjct  6     ENEIVIVGGGICGLATALALHRKSIKSLVLEKSEELRATGAAIIVQANGWHALDQLGVGS  65

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
              LR  A+ +  G+ I LG+D  +++ + +  + RC+ R DLI+++A+ LP  TIR GC+V
Sbjct  66    ILRETAIQIHGGKFISLGDDGPKEVPFGIYREFRCLKRTDLIKAMANCLPMETIRTGCQV  125

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK--EFGVVATRGLT  844
              S++ D +T++++L+LSNGS ++A+++IGCDG  S +A ++ L   K   F     RG T
Sbjct  126   VSIELDPITQYSQLVLSNGSILQAKVVIGCDGVNSTIANMVTLHQTKLLHFSTCVARGFT  185

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK--FPRDENAIKQM  670
              YPN H  P EF    +G V++G +P++  LV+WFV   TR  T +     +D   I+Q 
Sbjct  186   KYPNGHQFPNEFAMISRGQVQLGRIPMTDKLVYWFV---TRLNTAQDSIISKDPTLIRQS  242

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             ++E++E     P    ++I   +  SL  + LKYRPP +LLL +  KGT+ VAGDAMH  
Sbjct  243   LMESME---GFPIHAMDMIRNCKLNSLHLTDLKYRPPWDLLLNKFSKGTMVVAGDAMHAT  299

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
             GPF+ QGG +S+EDA+VLARCL  A  + N  +GI      + +EEA +K
Sbjct  300   GPFIAQGGSASIEDAIVLARCL--AQKMHNTTNGIMAR---STVEEAFDK  344



>ref|XP_008231659.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=399

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 253/410 (62%), Gaps = 14/410 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D+K  IVIVGGGICGLATALALHRKG++S+VLERS  LR+ G  I V PNGWRALD
Sbjct  1     MEIGDTKENIVIVGGGICGLATALALHRKGIRSVVLERSNALRATGAAIIVHPNGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+ SHLR  A+P+  G+   +  D+ ++I     ++RC+ R DLI  LA++LP  T+ 
Sbjct  61    QLGVASHLRETAIPILSGQFHSVNNDELKEIPIAKEELRCLKRTDLIDILANSLPRNTLH  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGCEV S+  D +T    L L  G  + A+++IGCDG  S ++ ++G++  K F +   R
Sbjct  121   FGCEVLSIKLDPITSSPVLQLQGGRLLNAKVVIGCDGVNSAISNMMGVRAEKIFTISVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G T+YPN H L  +F    K   RVG LP++ +LV+WF+   TR  T    P    +  Q
Sbjct  181   GFTSYPNGHELGSQFRITQKDGTRVGRLPMTENLVYWFI---TRNYT---CPDSMASKTQ  234

Query  672   MVIEN--IEKLQDLPAKVKEVIHLSEPESLSFS-HLKYrppgelllgrlRKGTVTVAGDA  502
              ++ N  ++ L+  P  + E+    E +SL  + +L++  P ++L  R R+GTV +AGDA
Sbjct  235   KLVRNLALDSLESFPTSIIEMAKNCELDSLHLTEYLRFHAPWDILRRRFREGTVVLAGDA  294

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH MGPFL QGG + LEDA+VLARCL     +  N  G + +     +EEA ++Y+KER+
Sbjct  295   MHAMGPFLAQGGSACLEDAIVLARCLARTTHIDRNARGTKMQ-----VEEAFDEYLKERK  349

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             MR+ +LS+  YLIG  + A+S+  K      +A+ F +      YDCG L
Sbjct  350   MRILRLSLQMYLIGEMLHASSQFVKFICIILLAVLFCDSNGHTRYDCGSL  399



>ref|XP_010930386.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=401

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/410 (44%), Positives = 255/410 (62%), Gaps = 12/410 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+   LR+ G  IGV  NGW ALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKFDTLRTSGAAIGVFINGWHALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G  LR  A+PL   RD++L ++K Q        +RC+ R+DLI SLA  LP G+IR
Sbjct  61    QLGVGMELRRKAIPLTEIRDMWLHKNKMQVTSCRKEALRCLKRSDLIESLAKNLPVGSIR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D ++ F  L  ++G+ I+A++LIGCDG  S+VA+ LGL+  K   + A R
Sbjct  121   FGCQIVAVELDPLSSFPILYANDGATIKAKVLIGCDGSNSVVAKSLGLQAPKVCPISAVR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF--PTRQLTGEKFPRDENAI  679
               T+Y + HS    F R     V +G +P+   LV+WFV+   P++ +      +D   I
Sbjct  181   AFTSYSDGHSFDSHFIRLSGDGVLLGRVPVDEKLVYWFVSVLCPSQDVQ-----KDHELI  235

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             K++ +E    L++ P +V E++   +  SLS +H+ YR P  L      + T+TVAGDAM
Sbjct  236   KKVTLET---LKEFPTEVIEMVKHCDSSSLSLTHIWYRAPWHLFFANFWQRTMTVAGDAM  292

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             HVMGPFLGQGG + LEDA+VLARC+     +          E   RI  AL KYV ERR+
Sbjct  293   HVMGPFLGQGGSAGLEDAIVLARCIVQEMPMGPE-GATSDREMVKRIGRALSKYVNERRL  351

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             R+ +LS  +YL G+ + A+S + K+     + +F R+G+ + + YDCG L
Sbjct  352   RIMRLSTQSYLTGSVIMASSWVKKLVCLAILIVFLRSGSLSHSNYDCGSL  401



>ref|XP_010449894.1| PREDICTED: kynurenine 3-monooxygenase-like [Camelina sativa]
Length=397

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/391 (47%), Positives = 260/391 (66%), Gaps = 12/391 (3%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             LAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +L + + R
Sbjct  16    LATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVGQRLRLTSLLIHKAR  75

Query  1155  DIFLGEDKEQK-IEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTR  979
              + +   K+++ +  +  + RC+ RNDL+ +LADALP GTIRFG ++ S++ D  T F  
Sbjct  76    TMLIENGKKREFVLTIKDEARCIKRNDLVEALADALPEGTIRFGSQIVSINKDQTTSFPV  135

Query  978   LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRH  799
             + LSNG+ I+A+++IGCDG  S+V++ L L P K F   A RG T YPN H  P E  R 
Sbjct  136   VQLSNGTMIKAKVVIGCDGANSVVSDYLQLGPKKAFSCRAVRGFTNYPNGHGFPQELLRI  195

Query  798   FKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKE  619
              KG++ +G LP++ + V WF+         +   +D+ +I  + ++ +++L +     KE
Sbjct  196   KKGNILIGRLPLTENQVFWFL---VHMQDNDHEVKDQVSIANLCLKWVDELFE---DWKE  249

Query  618   VIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVV  439
             ++   + ESLS +HL+YR P E++ G+ R+GTVTVAGDAMHVMGPFLGQGG ++LEDAVV
Sbjct  250   MVKTCDVESLSLTHLRYRAPSEIMFGKFRRGTVTVAGDAMHVMGPFLGQGGSAALEDAVV  309

Query  438   LARCLGSAAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMRVAQLSMHTYLIGASMAAT  262
             LARCL       +   G   E+ S R IEEA+++YVKERRMR+  LSM TYL G S+   
Sbjct  310   LARCLARNVGTDH---GDLLEDCSMRSIEEAIDEYVKERRMRLLGLSMQTYLTGRSLQTP  366

Query  261   SKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             SK+ ++ F   + L F R+     +YDCG+L
Sbjct  367   SKVVRLIFIFLLVLLFGRDQIRHTQYDCGRL  397



>ref|XP_010930385.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=404

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/410 (43%), Positives = 259/410 (63%), Gaps = 9/410 (2%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H++VIVGGGICGLATALALHRKG+KS+VLERS  +R+ G  IGV  NGW ALD
Sbjct  1     MRSGEEHHDVVIVGGGICGLATALALHRKGVKSLVLERSDRIRATGAAIGVFMNGWCALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             +LG+G+ LR   +P+   ++++  +   Q       + RC+ R DLI++L D LP  ++R
Sbjct  61    RLGVGAVLRDKTIPIPEIQEVWHRKSAMQVKSTRIEEFRCLKRTDLIQALFDNLPVDSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              GC++ +V+ D  T F  L + +G  I+A++LIGCDG  S++++ LGL           R
Sbjct  121   LGCQIVAVERDPSTSFPILYVHDGIIIKAKVLIGCDGSNSVISKSLGLGSLNSLPNCVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFV--TFPTRQLTGEKFPRDENAI  679
             GLT YPN H+L   F RH  G +  G +PI  +LVHWFV   +P R +     P+D   +
Sbjct  181   GLTNYPNGHNLESHFLRHLDGYMAFGRIPIDDNLVHWFVDWPYPNRDIDA---PKDPKFL  237

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
              ++ ++ I   +D PA++ E++  S+P SL+ + ++YR P  L+ G  R+GT+TVAGDAM
Sbjct  238   MELAMQQI---KDYPAEMIEMVKSSDPSSLNLTRIRYRSPWHLVFGNFRRGTMTVAGDAM  294

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H+MGPFLGQGGC ++EDAVVLAR L  A  +      +   E   RIE ALE YV+ER+ 
Sbjct  295   HMMGPFLGQGGCVAMEDAVVLARNLAQAMPMGLEGGRVGDGELKKRIETALENYVRERKP  354

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             RV +L+M + L+G  ++++SK+ ++     + +FF   + +   YDCG L
Sbjct  355   RVLKLAMQSMLVGILISSSSKIKRLLSLALLLVFFGGASLSYTRYDCGPL  404



>ref|XP_009136712.1| PREDICTED: kynurenine 3-monooxygenase [Brassica rapa]
 emb|CDX90570.1| BnaA03g42110D [Brassica napus]
Length=398

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 180/393 (46%), Positives = 257/393 (65%), Gaps = 13/393 (3%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+   LR  +  + + 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVSDRLRLTSNLIHKA  74

Query  1158  RDIFLGEDKEQK--IEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKF  985
             R + + + K+++  +  +  + RC+ RNDL+ +LADALP GTIRF  ++ S++ D  T F
Sbjct  75    RTMLIEDGKKKRAFVLNIKDEARCIRRNDLVEALADALPDGTIRFNSQIVSIEEDETTSF  134

Query  984   TRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFH  805
               + LSNG+ I+A++LIGCDG  S+V++ L L P K F   A RG T YPN H  P E  
Sbjct  135   PIVCLSNGNTIKAKVLIGCDGANSVVSDYLRLGPKKAFACRAVRGFTNYPNGHGFPHELL  194

Query  804   RHFKGDVRVGILPISHDLVHWFVT-FPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAK  628
             R   G+V VG LP++ + V WFV      Q  G    +D+ +I  + ++ +++L +    
Sbjct  195   RMKTGNVLVGRLPLNANQVFWFVVHMQDSQHNG----KDQKSIANVTLKWVDELSE---D  247

Query  627   VKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLED  448
              KE++ + + ESL+ +HL+YR P E++ G+ R+GTVTVAGDAMHVMGPFLGQGG ++LED
Sbjct  248   WKEMVKICDVESLTLTHLRYRSPWEIMFGKFRRGTVTVAGDAMHVMGPFLGQGGSAALED  307

Query  447   AVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMA  268
             AVVLARCL  A  +  +   + K+     IEEA+++YV ERRMR+  LS  TYL G S+ 
Sbjct  308   AVVLARCL--ARKMGPDHGDLLKDCSVKSIEEAIDEYVNERRMRLVGLSTQTYLTGRSLQ  365

Query  267   ATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
               S + ++ F   + L F R+     +YDCG+L
Sbjct  366   TQSMVIRLMFIVLLVLLFGRDQIRHTKYDCGRL  398



>ref|XP_009107859.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brassica rapa]
Length=398

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 256/408 (63%), Gaps = 23/408 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KSIVLERS+ +RSEG   G+  NGW AL QLG+ + L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSIVLERSESVRSEGAAFGIQTNGWLALQQLGVAAKL  64

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R  +LP+ + RD+ + ++ +Q+ E V     G+VR + RND++R+LA ALP GT+R G +
Sbjct  65    RLNSLPIHQIRDVMIEKNIKQR-ESVGPASHGEVRGVIRNDMVRALAHALPVGTLRLGSQ  123

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             + SV  D  T F  + L NG  I+A++LIGCDG  SIV++ LGL P K  G  A RG T 
Sbjct  124   IVSVKLDEATSFPIVHLRNGQDIKAKVLIGCDGSNSIVSKFLGLNPTKALGSRAVRGFTN  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             YPN H    EF R    +V  G LPI+H+LV WFV          K P+D N +K    E
Sbjct  184   YPNGHVFQQEFIRIKMDNVVSGRLPITHNLVFWFVVML-------KCPQDSNNLKNQ--E  234

Query  660   NIEKLQ-----DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             ++ +L        P + KE++   + +SL  S L+YR P +++  + R+GTVTVAGD+MH
Sbjct  235   DVARLTLASVCQFPEEWKEMVKKCDIDSLYISRLRYRSPWDVMSSKFRRGTVTVAGDSMH  294

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
             +MGPF+GQG  ++LED VVLARCL S    K   DG+       +IEEA+++YV+ERR R
Sbjct  295   LMGPFIGQGCSAALEDGVVLARCLWS----KLGQDGMNNVSSRKQIEEAIDEYVRERRGR  350

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +  LS  TYL G  + A+S   K+     + + FR+      +DCG+L
Sbjct  351   LVGLSTQTYLTGRLIEASSPATKLLLIVLLMILFRDHIGHTRHDCGRL  398



>ref|XP_003533524.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
 gb|KHN11646.1| 3-hydroxybenzoate 6-hydroxylase 1 [Glycine soja]
Length=399

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 250/402 (62%), Gaps = 13/402 (3%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGICGLATALALHRK +KS+VLERS+ LR+ G  I V  NGWRALDQLGIGS L
Sbjct  8     DIVIVGGGICGLATALALHRKRIKSLVLERSENLRATGAAIIVHANGWRALDQLGIGSTL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             R  A+ +Q GR I L E +  +  + V  ++RC+ R DL++++AD LPAGTIR  C+V S
Sbjct  68    RQTAIQIQGGRFISLNEAEPMEFPFGVDQELRCLKRTDLMKAMADNLPAGTIRTNCQVLS  127

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK--EFGVVATRGLTTY  838
             ++ D +T+  +LLLSNGS ++A+++IGCDG  S +A + GL   K   F     RG T +
Sbjct  128   IELDPLTRSPQLLLSNGSILQAKVVIGCDGVNSAIANMFGLHRTKLLLFSTCVARGFTNF  187

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             PN H    EF    +  V++G +P+S  LV+WFVT P R        +D   I+Q +IE+
Sbjct  188   PNGHEFGSEFAMMSRDQVQLGRIPVSDKLVYWFVTRP-RTSKDSTIWKDPVLIRQSLIES  246

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
                ++  P    E+I   +   L  + LKYR P +L+  + RKGTVT+AGDAMH  GPF+
Sbjct  247   ---MKGFPEGAVEIIRNCKLSFLHLTELKYRAPWDLVFNKFRKGTVTIAGDAMHATGPFI  303

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSM  298
              QGG +S+EDA+VLARCL    A +        E   A  EEA ++YVKER+MR   LS+
Sbjct  304   AQGGSASIEDALVLARCLAQKKAEET------AEINIAEAEEAFDQYVKERKMRNFWLSL  357

Query  297   HTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             H++L+G  +   S + +      M + FR+    + Y CG L
Sbjct  358   HSFLVGKKLDTKSSIVRFIILAIMGILFRDPDWHSRYHCGVL  399



>gb|KDP45200.1| hypothetical protein JCGZ_15065 [Jatropha curcas]
Length=394

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 182/400 (46%), Positives = 259/400 (65%), Gaps = 16/400 (4%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + +IVIVGGGICGLATALALHRKG++SIVLE+S+ LR+ G GI +  NGWRALD+LG+ S
Sbjct  6     EEDIVIVGGGICGLATALALHRKGIRSIVLEKSETLRATGVGIIMQANGWRALDELGVAS  65

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
              LR  A  +Q  R I + + K ++I   SG+ RC+ RNDL+++LAD LPA TI+F  +V 
Sbjct  66    VLRQTAAFIQSCRQISIHDKKPKEISLGSGERRCLKRNDLLKALADNLPADTIQFSTQVK  125

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             S++ D +T +  L L NGS IEA+I+IGCDG  S++A +LGL           RG + Y 
Sbjct  126   SIEMDPITSYPVLCLVNGSVIEAKIVIGCDGLNSVIARILGLNSIAFSPTCVVRGFSHYE  185

Query  834   NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE--KFPRDENAIKQMVIE  661
             N H    +F      +V++G +P++ +L++WF+   TR+ T E  K  RD+  IK+    
Sbjct  186   NGHDYANQFLLLSDRNVQLGQVPVNDNLIYWFL---TRKSTSEDSKISRDKILIKE---S  239

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
              ++ L+D P +  E+I+ SE ESL  + L+YR P ++L    RKGTVTV GDAMH MGPF
Sbjct  240   TMDILKDFPEQAIEMINKSEHESLHLTGLRYRAPWDVLTTNFRKGTVTVGGDAMHAMGPF  299

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             L QGG +SLEDAV+LARCL  A  ++N    I KE    ++EE ++KY+K+R+MRV  L 
Sbjct  300   LAQGGSASLEDAVILARCL--AEKIQNK--AIVKE----KVEEGIDKYLKQRKMRVFWLC  351

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDC  181
             + TYL+G  +   + + K+     + + FR+     +YDC
Sbjct  352   LQTYLVGTVIQPPNLVMKVLCIFLLIILFRDPNKHTDYDC  391



>dbj|BAD44627.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD95117.1| hypothetical protein [Arabidopsis thaliana]
Length=397

 Score =   327 bits (838),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 185/395 (47%), Positives = 255/395 (65%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +  + E+K E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLI--ENEKKREFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  305   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  362

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  397



>emb|CDY22754.1| BnaA08g05840D [Brassica napus]
Length=398

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 255/408 (63%), Gaps = 23/408 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KSIVLERS+ +RSEG   G+  NGW AL QLG+ + L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSIVLERSESVRSEGAAFGIQTNGWLALQQLGVAAKL  64

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R  +LP+ + RD+ + ++ +Q+ E V     G+VR + RND++R+LA ALP GT+R G +
Sbjct  65    RLNSLPIHQIRDVMIEKNIKQR-ESVGPASHGEVRGVIRNDMVRALAHALPVGTLRLGSQ  123

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             + SV  D  T F  + L NG  I+A++LIGCDG  SIV++ LGL P K  G  A RG T 
Sbjct  124   IVSVKLDEATSFPIVHLRNGQDIKAKVLIGCDGSNSIVSKFLGLNPTKALGSRAVRGFTN  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             YPN H    EF R    +V  G LPI+H+LV WFV          K P+D N +K    E
Sbjct  184   YPNGHVFQQEFIRIKMDNVVSGRLPITHNLVFWFVVML-------KCPQDSNNLKNQ--E  234

Query  660   NIEKLQ-----DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             ++ +L          + KE++   + +SL  S L+YR P +++  + R+GTVTVAGD+MH
Sbjct  235   DVARLTLASVCQFSEEWKEMVKKCDIDSLYISRLRYRSPWDVMSSKFRRGTVTVAGDSMH  294

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
             +MGPF+GQG  ++LED VVLARCL S    K   DG+       +IEEA+++YV+ERR R
Sbjct  295   LMGPFIGQGCSAALEDGVVLARCLWS----KLGQDGMNNVSSRKQIEEAIDEYVRERRGR  350

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +  LS  TYL G  + A+S   K+     + + FR+      YDCG+L
Sbjct  351   LVGLSTQTYLTGRLIEASSPATKLLLIVLLMILFRDHIGHTRYDCGRL  398



>ref|XP_003540567.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
 gb|KHN32452.1| Putative oxidoreductase yetM [Glycine soja]
Length=397

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 255/402 (63%), Gaps = 15/402 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGICGLATALALHRK +KS+VLERS+ LR+ G  I V  NGWRALDQLGIGS L
Sbjct  8     DIVIVGGGICGLATALALHRKRIKSLVLERSENLRATGAAIIVQANGWRALDQLGIGSTL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             R  A+ ++ GR I L E +  +  + V+ ++RC+ R DL++++AD LP GTIR  C+V S
Sbjct  68    RQTAIQIEGGRFISLNEAEPMEFPFGVNQELRCLKRTDLVKAMADNLPVGTIRTNCQVVS  127

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK--EFGVVATRGLTTY  838
             ++ D +T   +LLLSNGS ++A+++IGCDG  S +A + GL   K   F     RG T +
Sbjct  128   IELDPLTHSPQLLLSNGSILQAKVVIGCDGVNSAIANMFGLHRTKLLLFSTCVARGFTNF  187

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             PN H    EF    +G V++G +P+S  LV+WFVT P R        ++   I+Q +IE+
Sbjct  188   PNGHQFASEFVVMSRGQVQLGRIPVSDQLVYWFVTRP-RTSKDSTIWKEPVLIRQSLIES  246

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
                ++  P    E+I   +   L  + LKYR P +L+L + RKGTVT+AGDAMH  GPF+
Sbjct  247   ---MKGFPEGAVEMIQNCKLSFLHLTELKYRAPWDLVLNKFRKGTVTIAGDAMHATGPFI  303

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSM  298
              QGG +S+EDA+VLARCL    A K   +G+      A  EEA ++Y+KER+MR+  LS+
Sbjct  304   AQGGSASIEDALVLARCL----AQKKFAEGMN----IADAEEAFDQYLKERKMRIFWLSL  355

Query  297   HTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             H++L+G  +   S + +      MA+ FR+    + Y CG L
Sbjct  356   HSFLVGKKLDTKSSIVRFIILAIMAILFRDPDWHSRYHCGLL  397



>ref|XP_006414451.1| hypothetical protein EUTSA_v10025403mg [Eutrema salsugineum]
 gb|ESQ55904.1| hypothetical protein EUTSA_v10025403mg [Eutrema salsugineum]
Length=394

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 251/391 (64%), Gaps = 13/391 (3%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+   LR  +  +++ 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVSHRLRLTSNLIRKA  74

Query  1158  RDIFLGEDKEQK-IEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFT  982
             R + +   K+++ +  +  + RC+ RNDL+ +LADALP  TIRFG ++ S++ D  T F 
Sbjct  75    RTMLIENGKKREFVLNIEDEARCIRRNDLVEALADALPEETIRFGSQIVSIEEDETTSFP  134

Query  981   RLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHR  802
              + L+NG+ I+A++LIGCDG  S+V++ L L P K F   A RG T YPN H  P E  R
Sbjct  135   VVHLTNGNTIKAKVLIGCDGANSVVSDYLRLSPKKAFACRAVRGFTNYPNGHGFPQELLR  194

Query  801   HFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVK  622
                G+V VG LP++ +LV WFV              D+ +I  + ++ ++KL +     +
Sbjct  195   MKTGNVLVGRLPLTDNLVFWFV---VHMQDNHHNGTDQESIANVTLKWVDKLSE---DWQ  248

Query  621   EVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAV  442
             E++   + ESL+ +HL+YR P E++  + R+GTVTVAGDAMHVMGPFLGQGG ++LEDAV
Sbjct  249   EMVQKCDVESLTITHLRYRSPWEIMFRKFRRGTVTVAGDAMHVMGPFLGQGGSAALEDAV  308

Query  441   VLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAAT  262
             VLARCL       +  D   K      IEEA+++YV++RRMR+  LS  TYL G S+   
Sbjct  309   VLARCLAKKVGPDHGEDCSMKN-----IEEAIDEYVEKRRMRLVGLSTQTYLTGRSLQTQ  363

Query  261   SKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             S + ++ F   + + F R+     +YDCG+L
Sbjct  364   SNVVRLMFIVLLVVLFGRDQIRHTKYDCGRL  394



>emb|CDP11536.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 255/390 (65%), Gaps = 7/390 (2%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             LATALALHRKGL+S+V ERS+ LR+EG  I +L NGWRALDQLG+G  LR  A+ +Q G+
Sbjct  22    LATALALHRKGLRSVVYERSESLRAEGSAITILRNGWRALDQLGVGDVLRDKAILVQGGQ  81

Query  1155  DIFLGE-DKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTR  979
              I++ E +++Q I    G+ RC+ R+DLI++LADALP  T+RFG +V +V  D    F  
Sbjct  82    GIWVDEGNQQQPIPIPGGEARCLKRSDLIKALADALPPETVRFGYKVVAVTMDPENMFPT  141

Query  978   LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRH  799
             L L+NGS I A++LIGCDG  S+VA+ LG+KP + F + + RGLT+YPN H    E  R 
Sbjct  142   LTLNNGSSIRAKVLIGCDGSNSVVADFLGIKPTRLFALCSVRGLTSYPNGHVFSPELVRI  201

Query  798   FKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKE  619
              +  V VG +P+ ++LV+WFV+ P   L   KFP D   I+++  +  E     P+   E
Sbjct  202   KRDRVMVGRIPVDNNLVYWFVSVPLSWLD-RKFPDDPELIRKLTTKITEG---FPSDAVE  257

Query  618   VIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVV  439
             +I  S+ +SLS +HL+Y  P E+L+GR R+G +TVAGDAMH MGPFLGQGG ++LEDAVV
Sbjct  258   MIEGSDLDSLSITHLRYHAPWEMLVGRFRRGPITVAGDAMHAMGPFLGQGGSAALEDAVV  317

Query  438   LARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATS  259
             LAR LG   A  +  +   KE  + +I +A ++YV+ERRMR+ +L+   YL G  + +  
Sbjct  318   LARNLGRKIASLSPYER-GKEIMTDKIGQAFDQYVEERRMRMVRLATQAYLTGLILGSPP  376

Query  258   -KLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               + K      MA+ FR+     ++DCG L
Sbjct  377   MSITKFIAVIIMAILFRDRNEHAKFDCGNL  406



>emb|CDY09743.1| BnaC07g33180D [Brassica napus]
Length=398

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 184/394 (47%), Positives = 255/394 (65%), Gaps = 15/394 (4%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+   LR  +  + + 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVSDRLRLTSNLIHKA  74

Query  1158  RDIFLGEDKEQKIEYV---SGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + + ED ++K E+V     + RC+ RNDL+ +LADALP GTIR   ++ S+  D +T 
Sbjct  75    RTMLI-EDGKKKREFVLNIKDEARCIRRNDLVDALADALPDGTIRLNSQIVSIQEDEITS  133

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + LSNG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  134   FPIVHLSNGNTIKAKVLIGCDGANSIVSDYLRLGPIKAFACRAVRGFTNYPNGHGFPHEL  193

Query  807   HRHFKGDVRVGILPISHDLVHWFVT-FPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPA  631
              R   G+V VG LP++ + V WFV      Q  G    +D+ +I  + ++ ++KL +   
Sbjct  194   LRMKTGNVLVGRLPLNDNQVFWFVVHMQDSQHNG----KDQKSIANVTLKWVDKLSE---  246

Query  630   KVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLE  451
               KE++   + ESL+ +HL+YR P E++ G+ R+GTVTVAGDAMHVMGPFLGQGG ++LE
Sbjct  247   DWKEMVKRCDVESLTLTHLRYRSPWEIMFGKFRRGTVTVAGDAMHVMGPFLGQGGSAALE  306

Query  450   DAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASM  271
             DAVVLARCL  A  +  +   + K+     I EA+++YV ERRMR+  LS  TYL G S+
Sbjct  307   DAVVLARCL--ARKLGPDHGDLLKDCSVKSIGEAIDEYVSERRMRLVGLSTQTYLTGRSL  364

Query  270   AATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
                S + ++ F   + L F R+     +YDCG+L
Sbjct  365   QTQSMVVRIMFIVLLVLLFGRDQIHHTKYDCGRL  398



>emb|CAA07574.1| monooxygenase [Arabidopsis thaliana]
 dbj|BAD42916.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD42962.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43057.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43099.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43117.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43175.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43229.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43250.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44098.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44197.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44286.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44364.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44464.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44478.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44505.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44509.1| unnamed protein product [Arabidopsis thaliana]
Length=397

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 254/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  305   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  362

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  397



>ref|XP_006283848.1| hypothetical protein CARUB_v10004954mg [Capsella rubella]
 gb|EOA16746.1| hypothetical protein CARUB_v10004954mg [Capsella rubella]
Length=404

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 250/407 (61%), Gaps = 15/407 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KS+VLERS+ +RS+G   G+  NGW AL+QLG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSVVLERSESVRSQGAAFGIQTNGWLALEQLGVADKL  64

Query  1188  RTVALPLQRGRDIFL--GEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             R  +LP+ + RD+    G  + + +   S G+VR + RNDL+R+LA ALP GT+R GC++
Sbjct  65    RLNSLPIPQIRDVMFEKGIKRRESVGLASYGEVRGVIRNDLVRALAHALPLGTLRLGCQI  124

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              SV  D  T F  + + NG  I+A++LIGCDG  SIV+  LGL P K  G  A RG T Y
Sbjct  125   VSVQLDETTSFPIVHVQNGEPIKAKVLIGCDGSNSIVSRFLGLNPTKALGARAVRGFTNY  184

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             P+ H  P EF R    +V  G LPI+H LV WFV      L       D N +K+   E+
Sbjct  185   PDGHEFPNEFIRIKMDNVVCGRLPITHKLVFWFVV-----LLNCPQELDSNLVKKQ--ED  237

Query  657   IEKLQ-----DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             I +L      +     KE++   + +SL  S L+YR P +++ G+ R+GTVTVAGD+MH+
Sbjct  238   ITRLTLTSIGEFSEDWKEMVKNCDMDSLYISRLRYRAPWDVMSGKFRRGTVTVAGDSMHL  297

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             MGPFLGQG  ++LED VVLARCL       +    +       + EEA+++Y++ERR R+
Sbjct  298   MGPFLGQGTSAALEDGVVLARCLWRKLGQNSVNSNVSYSASRTQFEEAIDEYIRERRGRL  357

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               LS  TYL G  + A+S + K+ F   + + FR+      YDCG+L
Sbjct  358   VGLSTQTYLTGCLIEASSPVRKILFVVLLMILFRDRIGHTRYDCGRL  404



>ref|NP_193311.6| monooxygenase 1 [Arabidopsis thaliana]
 gb|AEE83647.1| monooxygenase 1 [Arabidopsis thaliana]
Length=422

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 254/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  40    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  99

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  100   RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  157

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  158   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  217

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  218   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  269

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  270   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  329

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  330   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  387

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  388   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  422



>dbj|BAD44358.1| unnamed protein product [Arabidopsis thaliana]
Length=397

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 254/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVGALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  305   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  362

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  397



>ref|XP_007131324.1| hypothetical protein PHAVU_011G004100g [Phaseolus vulgaris]
 gb|ESW03318.1| hypothetical protein PHAVU_011G004100g [Phaseolus vulgaris]
Length=404

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/403 (45%), Positives = 247/403 (61%), Gaps = 10/403 (2%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             EIVIVG GICGLATALALHRK +KS+VLERS+ +R+ G  I V  NGW AL QLGI S L
Sbjct  8     EIVIVGAGICGLATALALHRKRIKSVVLERSETVRATGAAIIVQANGWHALHQLGIASTL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             R  A+P+QRGR I L E +  +  + V+ + RC+ R+DL++ +AD LP GTIR  C+V S
Sbjct  68    RQTAIPIQRGRFISLNEAEPMEFPFGVNQEFRCLKRSDLVKVMADNLPKGTIRTNCQVLS  127

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGL--KPAKEFGVVATRGLTTY  838
             +D D VT F  L+LSNG+ I A+++IGCDG  S +  + GL       F     RG T Y
Sbjct  128   IDLDPVTNFPHLMLSNGTVIHAKVVIGCDGVNSAIGSMFGLYRTTLSLFSTCVARGFTNY  187

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             PN H    EF    +G V++G +P++  LV+WFVT   R        +D   I+Q ++E+
Sbjct  188   PNGHQFASEFVMMSRGQVQLGRIPVTDKLVYWFVT-RLRTSRDSTIWKDPVLIRQSLMES  246

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
             ++   + P ++ +  +LS    L  + LKYR P ELL    RKGTVT+AGDAMH  GPF+
Sbjct  247   MKGFPEGPTEMIKNCNLS---FLHLTELKYRAPWELLFNSFRKGTVTIAGDAMHATGPFV  303

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARI-EEALEKYVKERRMRVAQLS  301
              QGG +S+ED +VLARCL  A    NN    E+ E +  + EEA ++YV+ER+MR   LS
Sbjct  304   AQGGSASIEDGIVLARCL--AQKKFNNAKKTEETEINIAVAEEAFDEYVRERKMRNFWLS  361

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              H++L+G  +   S + +      M+  FR+    + Y CG L
Sbjct  362   FHSFLVGKKLDTKSSIIRFIILAIMSTLFRDPDWHSRYHCGNL  404



>dbj|BAD43328.1| unnamed protein product [Arabidopsis thaliana]
Length=397

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 254/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHR+G+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHREGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  305   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  362

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  397



>dbj|BAD43227.1| unnamed protein product [Arabidopsis thaliana]
Length=397

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 253/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  L   +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLHLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
             EDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S
Sbjct  305   EDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRS  362

Query  273   MAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
             +  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   LQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  397



>ref|NP_001190738.1| monooxygenase 1 [Arabidopsis thaliana]
 gb|AEE83648.1| monooxygenase 1 [Arabidopsis thaliana]
Length=409

 Score =   320 bits (820),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 255/407 (63%), Gaps = 30/407 (7%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVA------  1177
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +      
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKI  74

Query  1176  ------LPLQRGRDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGC  1024
                   L + R R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG 
Sbjct  75    LIYGPFLDMNRARTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGS  132

Query  1023  EVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLT  844
              + S++ D  T F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T
Sbjct  133   HIVSIEQDKTTLFPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFT  192

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVI  664
              YPN H  P E  R  +G+V +G LP++ + V WF+              + N   Q  I
Sbjct  193   KYPNGHGFPQEVLRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESI  244

Query  663   ENI--EKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
              N+  +   DL    KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVM
Sbjct  245   ANLCRKWADDLSEDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVM  304

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
             GPFL QGG ++LEDAVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+ 
Sbjct  305   GPFLAQGGSAALEDAVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLL  362

Query  309   QLSMHTYLIGASMAATSKLAKMAF-GGAMALFFRNGAAQNEYDCGQL  172
              LS+ TYL G S+  +SK+ ++ F    + LF R+      YDCG+L
Sbjct  363   GLSVQTYLTGRSLQTSSKVLRLMFIALLLLLFGRDQIRHTRYDCGRL  409



>ref|XP_010440252.1| PREDICTED: uncharacterized protein LOC104723571 [Camelina sativa]
Length=397

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 256/391 (65%), Gaps = 10/391 (3%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT+LALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +L + + 
Sbjct  15    GLATSLALHRKGIKSVVLERAEKVRSEGAGIGTLTNGWRALDQLGVGQRLRLTSLLIHKA  74

Query  1158  RDIFLGE-DKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFT  982
             R + +   +K + +  +  + RC+ RNDL+ +LADALP GTIRFG  + S+  D  T F 
Sbjct  75    RTMLIENGEKREFVLTIKDEARCIKRNDLVEALADALPEGTIRFGSRIVSIKEDQTTSFP  134

Query  981   RLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHR  802
              + L NG+ I+A++LIGCDG  S+V++ L L P K F   A RG TTYPN H  P E  R
Sbjct  135   VVQLFNGTMIKAKVLIGCDGANSVVSDYLNLGPKKAFSSRAVRGFTTYPNGHGFPQELLR  194

Query  801   HFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVK  622
               KG++ +G LP++ + + WF+         ++  +D+ +I  + ++ +++L +     K
Sbjct  195   IKKGNILIGRLPLNENQLFWFL---VHMQDNDQKVKDQESIANLCLKWVDELFE---DWK  248

Query  621   EVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAV  442
             E++   + +SLS +HL+YR P E++ G+ R+GTVTVAG AMHVMGPFLGQGG ++LEDAV
Sbjct  249   EMVKTCDVDSLSLTHLRYRAPSEIMFGKFRRGTVTVAGYAMHVMGPFLGQGGSAALEDAV  308

Query  441   VLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAAT  262
             VLARCL  A  V  +   + ++     IEEA+++YVKERRMR+  LSM TYL G  +   
Sbjct  309   VLARCL--ARNVGPDHGDLLEDCPMRSIEEAIDEYVKERRMRLLGLSMQTYLTGRLLQTP  366

Query  261   SKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             S + ++ F   + L F R+     +YDCG+L
Sbjct  367   SNVVRLIFIVLLVLLFGRDQIRHTQYDCGRL  397



>ref|XP_010449893.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=404

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/403 (44%), Positives = 248/403 (62%), Gaps = 7/403 (2%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KS+VLERS+ +RSEG   G+  NGW AL+QLG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSVVLERSESVRSEGAAFGIQTNGWLALEQLGVADKL  64

Query  1188  RTVALPLQRGRDIFL--GEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             R  +LP+ + RD+ +  G  + + +   S G+VR + RNDL+R+LADALP GT+R GC++
Sbjct  65    RLNSLPIPQIRDVLIEKGIKRRESVGPASYGEVRGVIRNDLVRALADALPRGTLRLGCQI  124

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              SV  D  T F  + + NG  I+A++LIGCDG  SIV+  LGL P K  G  A RG T Y
Sbjct  125   MSVKIDETTSFPIVHVRNGEPIKAKVLIGCDGSNSIVSRFLGLNPTKALGARAVRGFTNY  184

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT-FPTRQLTGEKFPRDENAIKQMVIE  661
             P  H    EF R    +V  G LPI+H +V WFV      Q     F +D+  I ++ + 
Sbjct  185   PEGHGFWQEFIRIKMDNVVSGRLPITHKVVFWFVVLLNCPQELDSNFLKDQEDIARLALA  244

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
             ++ +  +     KE++   +  SL  S L+YR P +++    R+GTVTVAGD+MH+MGPF
Sbjct  245   SVGEFSE---DWKEMVKNCDMVSLYISRLRYRAPWDVMSSNFRRGTVTVAGDSMHLMGPF  301

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             LGQG  ++LED VVLARCL       +  + +       + EEA+++YVKERR R+  LS
Sbjct  302   LGQGTSAALEDGVVLARCLWRKLGQNSVNNNVSSSSSRMKFEEAIDEYVKERRGRLVGLS  361

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               TYL G  + A+S + K+     + + FR+      YDCG+L
Sbjct  362   TQTYLTGCLIEASSPVRKILLVVLLMILFRDQIGHTRYDCGRL  404



>ref|XP_010548939.1| PREDICTED: kynurenine 3-monooxygenase [Tarenaya hassleriana]
Length=389

 Score =   317 bits (811),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/401 (45%), Positives = 246/401 (61%), Gaps = 18/401 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG++S+VLER   +RSEG GIG L NGWRALD LG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIESVVLERGDRVRSEGAGIGTLANGWRALDHLGVSHVL  64

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             R  +L + + R + +   K +++   +S + RC+ R+DL+R+LADA        G ++ S
Sbjct  65    RPTSLRIHKVRTVLVHNGKHRELASPISDEARCLKRDDLVRALADA--------GSQIVS  116

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPN  832
             ++ D  T F  L LS+G  I+A++LIGCDG  S+VA+ L L P K F   A RG   YPN
Sbjct  117   INLDETTSFPVLQLSHGVTIKAKVLIGCDGANSMVADFLKLSPKKAFPSGAVRGFAFYPN  176

Query  831   AHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIE  652
              H  P E  R   G+   G LP++H+LV WF         G    +D+ AI  + +++  
Sbjct  177   GHGFPQELLRMKIGNTMSGRLPVTHNLVFWFAHLQDSSKVG-IVAKDQEAIANLTLDS--  233

Query  651   KLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQ  472
              ++D P   KE++   +  SLS  HLKY+ P  ++ G+ RKGTVTVAGDAMHVMGPF+GQ
Sbjct  234   -MRDFPEDWKEMVKNCDVHSLSLYHLKYKSPLNIMFGKFRKGTVTVAGDAMHVMGPFIGQ  292

Query  471   GGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHT  292
             GG ++LEDAVVLARCL       + V G      + RI EAL++YV ERRMR+  LS  T
Sbjct  293   GGSAALEDAVVLARCLAKKLGWDDGVKG----SSAKRIGEALDEYVNERRMRLVGLSTQT  348

Query  291   YLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             YL G  +  +S + ++     + + F R+      YDCG+L
Sbjct  349   YLTGHLLRTSSVVVRLMLLLFLIVLFGRSQFRHTRYDCGRL  389



>ref|XP_009361911.1| PREDICTED: uncharacterized protein LOC103952109 [Pyrus x bretschneideri]
Length=399

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 250/410 (61%), Gaps = 14/410 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D++  IVIVGGGICGLATALALHRKG++S+VLERS  L + G  I V  NGWRALD
Sbjct  1     MEIGDTRESIVIVGGGICGLATALALHRKGIRSVVLERSNRLPATGVAIIVHLNGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+ S LR  + P+  G+ I LG  + + ++    ++R + R DLI  LAD LP  T+R
Sbjct  61    QLGVASLLRQTSFPILSGQFISLGSGEIEDMDVGKEELRVLKRTDLISVLADNLPPNTVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGCEV SV  +  T    L L +G+ +  +++IGCDG  SIV+ ++G+K    F +   R
Sbjct  121   FGCEVHSVKLNPGTSSPVLQLQDGTILNPKVVIGCDGVNSIVSNVMGVKAPNIFRICVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK--FPRDENAI  679
             G T YP+ H L  EF    K D +VG LP++ DLV+WF+   TR+ + +     +D+  I
Sbjct  181   GFTRYPDGHELGSEFTLTRKDDTQVGRLPMTKDLVYWFM---TRKHSSQDSAASKDQKLI  237

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFS-HLKYrppgelllgrlRKGTVTVAGDA  502
             +++ ++++E     P    E+    E ESL  + +++Y  P ++L    R GTV++AGDA
Sbjct  238   RELGVKSVE---GFPTSTIEMFKNCELESLHLTEYVRYHTPWDILRKPSRAGTVSLAGDA  294

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH MGPFL QGG ++LEDAVVLARCL     V  +  G +       +EEAL++YVKER+
Sbjct  295   MHTMGPFLAQGGSAALEDAVVLARCLAQKTCVDPSGRGTK-----LMVEEALDQYVKERK  349

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              RV +LS+ TYLIG     +S+  K+     +A+ F        YDCG L
Sbjct  350   TRVLRLSLQTYLIGKMFHTSSQFVKLICVVLLAILFSEAHGHTRYDCGSL  399



>ref|XP_010434921.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=402

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/402 (45%), Positives = 249/402 (62%), Gaps = 7/402 (2%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KS+VLERS+ +RSEG   G+  NGW AL+QLG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSVVLERSESVRSEGAAFGIQTNGWLALEQLGVADKL  64

Query  1188  RTVALPLQRGRDIFL--GEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             R  +LPL + RD+ +  G  + + +   S G+VR + RNDL+R+LA ALP GT+R GC++
Sbjct  65    RLNSLPLPQIRDVLIEKGIKRRESVGPASYGEVRGVIRNDLVRALAHALPLGTLRLGCQI  124

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              SV  D  T F  + + NG  I+A++LIGCDG  S V+  LGL P K  G  A RG T Y
Sbjct  125   VSVKLDETTSFPIVHVQNGEPIKAKVLIGCDGSNSTVSRFLGLNPTKALGARAVRGFTNY  184

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             P  H    EF R    +V  G LPI+H LV WFV           F +D+ AI ++ + +
Sbjct  185   PEGHGFRQEFIRIKMDNVVSGRLPITHKLVFWFVVLLNCP-QDSNFLKDQEAIARLALAS  243

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
             + +  +     KE++   +  SL  S L+YR P +++ G+ R+GTVTVAGD+MH+MGPFL
Sbjct  244   VGEFSE---DWKEMVKNCDMASLYISRLRYRAPWDVMSGKFRRGTVTVAGDSMHLMGPFL  300

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSM  298
             GQG  ++LED VVLARCL       +  + +       ++EEA+++YVKERR R+  LS 
Sbjct  301   GQGTSAALEDGVVLARCLWRKLGQNSVNNNVSSSSLRMQLEEAIDEYVKERRGRLVGLST  360

Query  297   HTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              TYL G  + A+S + K+     + + FR+      YDCG+L
Sbjct  361   QTYLTGCLIEASSPVRKILLIVLLMILFRDQIGHTRYDCGRL  402



>ref|XP_006414450.1| hypothetical protein EUTSA_v10025376mg [Eutrema salsugineum]
 gb|ESQ55903.1| hypothetical protein EUTSA_v10025376mg [Eutrema salsugineum]
Length=398

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 250/408 (61%), Gaps = 23/408 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVI+GGGI GLAT+LALHRKG+KSIVLERS+ +RSEG   G+  NGW AL QLG+   L
Sbjct  5     DIVILGGGIAGLATSLALHRKGIKSIVLERSETVRSEGAAFGIQTNGWLALQQLGLADKL  64

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R  +LP+ + RD+ + E  +++ E V     G+VR + RNDL+R+LA  LP GT+R GC+
Sbjct  65    RPNSLPIHQIRDVLIEEGIKRR-ESVGPASYGEVRGVIRNDLVRALAHELPLGTLRLGCQ  123

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             + SV  D    F  + + NG  I++++LIGCDG  S+V+E LGLKP K     A RG T 
Sbjct  124   IVSVKLDETLSFPIVHVKNGQDIKSKVLIGCDGSNSVVSEFLGLKPTKSLSSRAVRGFTN  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             YP+ H    EF R    +V  G LPI+  LV WFV          K P+D N ++    E
Sbjct  184   YPDGHGFRQEFIRIKMDNVVSGRLPITPKLVFWFVVLL-------KCPQDSNFLRNQ--E  234

Query  660   NIEK-----LQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             +I +     + D   + KE++   +  SL  + L+YR P +++ G+ R+GTVTVAGD+MH
Sbjct  235   DIARFTLSSVNDFSQEWKEMVKNCDINSLYINRLRYRAPWDVMSGKFRRGTVTVAGDSMH  294

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
             +MGPFLGQG  ++LED VVLARCL      K   DG+       RIEEA++ YV+ERR R
Sbjct  295   LMGPFLGQGCSAALEDGVVLARCLWR----KLGQDGMNNVFSRKRIEEAIDDYVRERRGR  350

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + +LS  TYL    + A+S + K+     + + FR+      YDCG+L
Sbjct  351   LVRLSTQTYLTSRLIEASSPVTKLLVVVLLMIMFRDQIGHTRYDCGRL  398



>ref|XP_008375335.1| PREDICTED: uncharacterized protein LOC103438584 [Malus domestica]
Length=399

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 249/410 (61%), Gaps = 14/410 (3%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D++  IVIVGGGICGLATALALHRKG++S+VLERS  L + G  I V  NGWRALD
Sbjct  1     MEIGDTRESIVIVGGGICGLATALALHRKGIRSVVLERSNRLPATGVAIIVHLNGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+ S LR  + P+  G+ I LG  + + ++    ++R + R DL+  LAD LP  T+R
Sbjct  61    QLGVASLLRQTSFPILSGQLISLGSGEIEBMDVGKEELRVLKRTDLVSVLADNLPPNTVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGCEV SV  +  T    L L +G+ +  +++IGCDG  SIV+ ++G K +  F +   R
Sbjct  121   FGCEVHSVKLNPGTSSPVLQLQDGTILNPKVVIGCDGVNSIVSNVMGXKASNIFRICVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK--FPRDENAI  679
             G T YP+ H    EF    K D +VG LP++  LV+WF+   TR+ + +     +D+  I
Sbjct  181   GFTRYPDGHEFGSEFTLTRKDDTQVGRLPMTESLVYWFM---TRKHSSQDSAASKDQKLI  237

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFS-HLKYrppgelllgrlRKGTVTVAGDA  502
             +++ ++++E     P  + E+    E +S+  + +++Y  P ++     R GTV++AGDA
Sbjct  238   RELGVKSVE---GFPTSIIEMFKNCELDSIHLTEYVRYHAPWDIXRXPSRAGTVSLAGDA  294

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH MGPFL QGG ++LEDAVVLARCL    A K  VD +        +EEAL++YVKER+
Sbjct  295   MHTMGPFLAQGGSAALEDAVVLARCL----AQKTRVD-LRGRGTKLMVEEALDQYVKERK  349

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              RV +LS+ TYLIG     +S+  K+     +A+ F        YDCG L
Sbjct  350   TRVLRLSLQTYLIGKMFHTSSQFVKLICIVLLAVLFSESHGHTRYDCGSL  399



>ref|XP_002868182.1| hypothetical protein ARALYDRAFT_355191 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44441.1| hypothetical protein ARALYDRAFT_355191 [Arabidopsis lyrata subsp. 
lyrata]
Length=408

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 175/409 (43%), Positives = 254/409 (62%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KSIVLER++ +RSEG   G+  NGW AL QLG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSIVLERAESVRSEGAAFGIQTNGWLALQQLGVADKL  64

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R  +LP+ + RD+ + +  +Q+ E V     G+VR + RNDL+R+LA ALP GT+R GC 
Sbjct  65    RLNSLPIHQIRDVLIEKGIKQR-ESVGPASYGEVRGVLRNDLVRALAHALPLGTLRLGCH  123

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAE-----ILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             + SV  D  T F  + + NG  I+A+     +LIGCDG  S+V+  LGL P K+ G  A 
Sbjct  124   ILSVKLDETTSFPIVHVKNGEAIKAKARLATVLIGCDGSNSVVSRFLGLNPTKDLGSRAV  183

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK  676
             RG T YP+ H    EF R    +V  G +PI+H LV WFV           F R++  I 
Sbjct  184   RGFTNYPDDHGFRQEFIRIKMDNVVSGRIPITHKLVFWFVVLLNCP-QDSSFLRNQADIA  242

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             ++ + ++ +  +   + KE++   + +SL  + L+YR P ++L G+ R GTVTVAGD+MH
Sbjct  243   RLTLASVHEFSE---EWKEMVKNCDMDSLYINRLRYRAPWDVLSGKFRCGTVTVAGDSMH  299

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAV-KNNVDGIEKEERSARIEEALEKYVKERRM  319
             +MGPF+GQG  ++LED VVLARCL    ++ ++ ++ +       +IEEA+++Y++ERR 
Sbjct  300   LMGPFIGQGCSAALEDGVVLARCLWRKLSLGQDGMNNVSYSSSRMQIEEAIDEYIRERRG  359

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             R+  LS  TYL G  + A+S + K      + + FR+      YDCG+L
Sbjct  360   RLVGLSTQTYLTGNLIKASSPVTKFLLVVLLMILFRDQIGHTRYDCGRL  408



>ref|XP_010440251.1| PREDICTED: uncharacterized protein LOC104723568 [Camelina sativa]
Length=404

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 247/403 (61%), Gaps = 7/403 (2%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGI GLAT+LALHRKG+KS+VLERS+ +RSEG   G+  NGW AL+QLG+   L
Sbjct  5     DIVIVGGGIAGLATSLALHRKGIKSVVLERSESVRSEGAAFGIQTNGWLALEQLGVADKL  64

Query  1188  RTVALPLQRGRDIFL--GEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             R  +LP+ + RD+ +  G  + + +   S G+VR + RNDL+R+LADALP  T+R GC++
Sbjct  65    RLNSLPIPQIRDVLIEKGIKRRESVGPASYGEVRGVIRNDLVRALADALPRRTLRLGCQI  124

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              SV  D  T F  + + NG  I+A++LIGCDG  SIV+  LGL P K  G  A RG T Y
Sbjct  125   MSVKLDETTSFPIVHVRNGDPIKAKVLIGCDGSNSIVSRFLGLNPTKPLGARAVRGFTNY  184

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT-FPTRQLTGEKFPRDENAIKQMVIE  661
             P  H    EF R    +V  G LPI+H LV WFV      Q     F  ++  I  + + 
Sbjct  185   PEGHGFRQEFIRIKMDNVVSGRLPITHKLVFWFVVLLNCPQELESNFLTNQEDIAILALA  244

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
             ++ +  +     KE++   +  SL  S L+YR P +++ G+ R+GTV VAGD+MH+MGPF
Sbjct  245   SVGEFSE---DWKEMVKNCDMVSLYISRLRYRAPWDVMSGKFRRGTVIVAGDSMHLMGPF  301

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             LGQG  ++LED VVLARCL       +  + +       ++EEA+++YVKERR R+  LS
Sbjct  302   LGQGTSAALEDGVVLARCLWRKLGQNSVNNNVSSSSSRMQLEEAIDEYVKERRGRLVGLS  361

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               TYL G  + A+S + K+     + + FR+      YDCG+L
Sbjct  362   TQTYLTGCLIEASSPVRKILLVVLLMILFRDQIGHTRYDCGRL  404



>ref|XP_010065076.1| PREDICTED: LOW QUALITY PROTEIN: kynurenine 3-monooxygenase-like 
[Eucalyptus grandis]
Length=399

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/409 (42%), Positives = 241/409 (59%), Gaps = 21/409 (5%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + +IV+VGGGICGLAT LALHRKG++S+VLERS+ LR+ G  I + PNGWRALDQLG+G 
Sbjct  4     ERDIVVVGGGICGLATGLALHRKGIQSLVLERSETLRATGSAIIMQPNGWRALDQLGVGP  63

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
              LR  A+ ++ GR + + + K+  I  + G+VRC+ R DLI  LA+ LP+ T+RFGC V 
Sbjct  64    KLRKTAIAMEGGRIVSIPDGKQGPI-LLGGEVRCLRRMDLINVLAEGLPSNTVRFGCRVV  122

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             SV+ D  T    L L +G  I+A+++IGCDG  S+VA ++GL     +    TRG T Y 
Sbjct  123   SVELDPTTSRPLLHLDDGGTIKAKVVIGCDGVHSVVANIVGLNKTGLYPTYVTRGFTRYE  182

Query  834   NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK----FPRDENAIKQMV  667
             N H L  EF    K ++++G LPI   LV+WFV   TR  T  +      +D   ++  +
Sbjct  183   NGHGLANEFVVMRKDELQLGWLPIDDRLVYWFV---TRNWTSPESRATLSKDPMLLRSSI  239

Query  666   IENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMG  487
                ++ + D P +  +++  S+  ++ ++ L+Y           RKG + VAGDAMH M 
Sbjct  240   ---VKAMNDFPTEAIQMVSGSDLATVQYTELRY------RPPWXRKGVIVVAGDAMHAMA  290

Query  486   PFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER----SARIEEALEKYVKERRM  319
             PFL QGG +SLEDAVVLARCL     + N+     +E R       +EEA EKY KERR 
Sbjct  291   PFLAQGGAASLEDAVVLARCLAEKIKLANSDGHGPRETRLSFEKPAVEEAFEKYSKERRA  350

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             R   L++ TY I   +   S + K+     MA+ F +      YDCG+L
Sbjct  351   RAFWLTLQTYFIAMLLGNYSGIIKLMTVLLMAVLFSDKIGHTRYDCGRL  399



>ref|XP_002454010.1| hypothetical protein SORBIDRAFT_04g023020 [Sorghum bicolor]
 gb|EES06986.1| hypothetical protein SORBIDRAFT_04g023020 [Sorghum bicolor]
Length=409

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 186/420 (44%), Positives = 265/420 (63%), Gaps = 24/420 (6%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M      H IVI GGGICGLATALALHRKG+ S+VLE+S+ LR++G GIGV  NGWR L+
Sbjct  1     MAEAAEAHSIVIAGGGICGLATALALHRKGIASLVLEKSRSLRADGAGIGVHANGWRVLE  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDK--EQKIEYVSGDVRCMARNDLIRSLADALPAGT  1039
             QLG+ + LR  A  +    D++   DK   +K+  V  ++RC+ R DLI +LA  +PAGT
Sbjct  61    QLGVAADLRDTAHLITVYHDVWKQGDKISREKVP-VRTELRCLNRKDLIEALAKDIPAGT  119

Query  1038  IRFGCEVSSVDYDSVTKFTRLL-LSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             IRFGC +++VD D       +L +++G+ I+A++LIGC+G  S+VA+ LGL P +     
Sbjct  120   IRFGCRIAAVDADPAGGHGAVLTMADGTTIKAKVLIGCEGTYSVVAKYLGLSPVRTIPRP  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
               RG T YP+ HS   EF R   GD  +G L I+ +LVH+F+T P       K P D + 
Sbjct  180   VLRGFTWYPHGHSFDNEFLRLRVGDFFIGRLTITDNLVHFFITMP-------KPPTDVST  232

Query  681   --IKQMVIENIEKLQDL--PAKVKEVIHLSEPESLSF-SHLKYrppgelllgrlRKGTVT  517
               +KQ+    +++++D+  PA++ +++  S+PESL+F +   YRPP E++LG  +KGTVT
Sbjct  233   KDLKQVRDHALKEMRDVQCPAEIIDIVRDSDPESLNFVTEFWYRPPWEVVLGSFQKGTVT  292

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIE----EA  349
             VAGDAMH MGPF+GQGG + LEDAVVLAR L  A     + DG+ K    AR E    EA
Sbjct  293   VAGDAMHAMGPFIGQGGSAGLEDAVVLARSLARAV---GDADGVGKGAAPARREKMVGEA  349

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMA-ATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + +Y++ERR RVA LS+ ++++G  +  + S + K+A    + L          YDCG+L
Sbjct  350   IGEYIRERRPRVALLSLESFIMGTLLVRSPSPVTKLACVAVLVLLGSKSLRHAYYDCGRL  409



>ref|XP_010930395.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=405

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 256/409 (63%), Gaps = 6/409 (1%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H++V+VGGGICGLATALALHRKG+KS+VLERS+ +R+ G  IG+  NGW ALD
Sbjct  1     MRSREEHHDVVVVGGGICGLATALALHRKGVKSLVLERSERIRATGAAIGIFMNGWCALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             +LG+G+ LR   +P+    ++   +   Q       ++RC+ R+DLI+ L D LP  ++R
Sbjct  61    RLGVGAVLRDKTIPIPEIHEVLYHKSTMQVKSTRMEELRCLKRSDLIQVLFDNLPVDSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              GC++ +V+ D  T F  L + +GS I+A+++IGCDG  S++++ LG            R
Sbjct  121   LGCQIVAVERDPSTSFPILYVHDGSIIKAKVVIGCDGSNSVISKSLGPGALNVLPNCVIR  180

Query  852   GLTTYPNAHSLPIEFHRHFK-GDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK  676
             GLT YPN H+L   F RH   G +  G +PI  +LVHWFV +P      +  P+D   + 
Sbjct  181   GLTNYPNGHNLETRFFRHLDVGYMSYGRIPIDDNLVHWFVDWPYPDRDTDA-PKDPKFLM  239

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             ++ ++ I   +D PA++ E++  S+P SL  + ++YR P  L+ G LR+GT+TVAGDAMH
Sbjct  240   ELAMQQI---KDNPAEMIEMVEGSDPSSLHLTRIRYRSPWHLVFGNLRRGTMTVAGDAMH  296

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
             +MGPFLGQGGC +LEDAVVLAR L  A  +      +   E   RIE ALE YV+ER+ R
Sbjct  297   MMGPFLGQGGCLALEDAVVLARNLARAMPMGLEGSRVGDGELKKRIETALENYVRERKPR  356

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             V +L+M + L+  S+++ SK+ ++     + +FF   +     +DCG L
Sbjct  357   VLRLAMQSMLLAISISSPSKIKRLLSLALLVVFFGGASLGYTRFDCGPL  405



>ref|XP_010524529.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/389 (44%), Positives = 240/389 (62%), Gaps = 11/389 (3%)
 Frame = -2

Query  1329  TALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR-TVALPLQRGRD  1153
             T+LALHRKG+KS+VLER++ +RSEG  +GV PNGWRAL++LG+   LR + ++PL R R 
Sbjct  18    TSLALHRKGIKSVVLERAERVRSEGAALGVHPNGWRALEELGVADKLRRSNSVPLHRFRS  77

Query  1152  IFL--GEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTR  979
             +F   G+  E       G V C+ RN+L+++LA+ALP GTIRFG  + S + D  + F  
Sbjct  78    VFYENGKRHETVGPAAYGAVNCLKRNELVKALAEALPEGTIRFGYGLVSANIDETSSFPI  137

Query  978   LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRH  799
             L   +G  I A+++IGCDG  S++A+ L + P + FG  A RG T+YP+ H    E    
Sbjct  138   LRFKDGRSIRAKVVIGCDGSNSVIADFLRMNPTRAFGSRAVRGFTSYPDGHGFQPEVVTM  197

Query  798   FKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKE  619
                +V  G LP++  LV WF  FP       +  RD  AI ++   +    +DLP + +E
Sbjct  198   KMENVLCGRLPVTDRLVFWFTYFPHYSQQESEISRDREAIAELTKGST---KDLPEEWRE  254

Query  618   VIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVV  439
             ++   +  SL  S ++YRPP E+L+G+ R+GTVTVAGDAMH+MGPFLGQGGC++LEDAVV
Sbjct  255   MVKNCDVSSLYMSSIRYRPPWEILVGKFRRGTVTVAGDAMHLMGPFLGQGGCAALEDAVV  314

Query  438   LARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATS  259
             L RCLG     K    G     R   +EEA+++YV+ERR RV  LS   YL G  + A+S
Sbjct  315   LGRCLG-----KKLGQGHVFPPRKGMVEEAIDEYVRERRKRVFALSTQVYLTGKLVGASS  369

Query  258   KLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              +AK+     + + F +      YDCG+L
Sbjct  370   GVAKVMLLVLLMVLFYDQIRHTRYDCGKL  398



>ref|XP_010688732.1| PREDICTED: uncharacterized protein LOC104902601 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=393

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 233/383 (61%), Gaps = 14/383 (4%)
 Frame = -2

Query  1308  KGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGRDIFLGEDK-  1132
             KG+KS+VLERS  LR+ G  IGV PNGWRAL QLG+ S L++ A+P QR  D+    DK 
Sbjct  21    KGIKSVVLERSDTLRATGAAIGVFPNGWRALHQLGLDSTLQSTAIPFQRAVDVL--ADKG  78

Query  1131  --EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGS  958
                + +    G+ RC+ R+DL+ +LA+ALP+ TIRFGC++ SV+ +  + +  L L +GS
Sbjct  79    IVRETLLSEGGEARCLRRSDLVDALANALPSETIRFGCQLVSVNIEGSSSYAALQLHDGS  138

Query  957   YIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRV  778
              I+A++LIGCDG  S++A  +GLKP + F   A RGLTTYPN H    EF R  K    V
Sbjct  139   LIKAKVLIGCDGANSVIASYIGLKPTRPFSTCAVRGLTTYPNGHGFAPEFLRMRKDKHLV  198

Query  777   GILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEP  598
             G +PI    V+WFV     Q  GE  P+D  +I+QM    ++     P  + ++I  S+ 
Sbjct  199   GRIPIDEKTVYWFVVLQWIQRDGE-MPKDSTSIRQM---TLDITAGFPNDIVDMIENSDL  254

Query  597   ESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGS  418
              SLS + L+YR P  LL G  R+ TVTVAGDA HVMGPFLGQGG ++LEDAVVLARCL  
Sbjct  255   SSLSLTRLRYRAPWNLLSGNFRRETVTVAGDAWHVMGPFLGQGGSAALEDAVVLARCLAK  314

Query  417   AAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAA-TSKLAKMA  241
               +  ++   +  +      +EAL++Y+KERR RV  LS  TYL G  +    S L +  
Sbjct  315   KISNADHSGHLSTQ----LAKEALDEYLKERRRRVVLLSTLTYLRGLLLVEDPSLLLRFL  370

Query  240   FGGAMALFFRNGAAQNEYDCGQL  172
                 + + FR+      YDCG+L
Sbjct  371   CIIIITVLFRDPLNHIRYDCGEL  393



>ref|XP_010688730.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=399

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 233/404 (58%), Gaps = 17/404 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGICGLATAL LHRKG++S+VLERS  LR+ G  I V PNGWRAL QLG+ S L
Sbjct  8     DIVIVGGGICGLATALGLHRKGIQSVVLERSDTLRATGAAITVFPNGWRALHQLGLDSTL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
              + A+P QR  DI   E    +I     D RC+ R DL+ +LA+ALP  TIRFGC+V SV
Sbjct  68    LSTAIPWQRAVDIS-PEGVAHEIRLSEEDTRCLRRGDLVEALANALPLQTIRFGCQVVSV  126

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             + +  +    L L +GS I+A++LIGCDG  S++A  +GLKP +     + RGLT YPN 
Sbjct  127   NVEKSSSCAVLQLHDGSLIKAKVLIGCDGLNSVIANYIGLKPTRFLSTCSVRGLTLYPNG  186

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEK  649
             H    +  R  K    VG +PI    V+WFV     +    K P+D  +I+Q+    I++
Sbjct  187   HGYAPKSLRVRKDKHYVGRIPIDEKTVYWFVAL---EWKDAKMPKDPASIRQLA---IDR  240

Query  648   LQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQG  469
                    + E+I  S+  SLS + L+YR P  LL   LR+ T+TVAGDA H MGPFLGQG
Sbjct  241   TAGFSKDIVEMIENSDLSSLSLTRLRYRAPWNLLSRSLRRETITVAGDAWHAMGPFLGQG  300

Query  468   GCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA-----QL  304
             G  +LEDAVVLARCL S      N++       +   +EAL++Y+KERR RV        
Sbjct  301   GSVALEDAVVLARCL-SKKICNANMNRSRMHLSTQMAKEALDEYLKERRRRVVLLSTLTY  359

Query  303   SMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                   I         L  + F    A+ FR+      YDCG+L
Sbjct  360   LTGLLTIEDLSLLLRLLCIIIF----AVVFRDRLNHTRYDCGEL  399



>ref|XP_010688727.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010688728.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010688729.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=400

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 233/404 (58%), Gaps = 16/404 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVGGGICGLATAL LHRKG++S+VLERS  LR+ G  I V PNGWRAL QLG+ S L
Sbjct  8     DIVIVGGGICGLATALGLHRKGIQSVVLERSDTLRATGAAITVFPNGWRALHQLGLDSTL  67

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
              + A+P QR  DI   E    +I     D RC+ R DL+ +LA+ALP  TIRFGC+V SV
Sbjct  68    LSTAIPWQRAVDIS-PEGVAHEIRLSEEDTRCLRRGDLVEALANALPLQTIRFGCQVVSV  126

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             + +  +    L L +GS I+A++LIGCDG  S++A  +GLKP +     + RGLT YPN 
Sbjct  127   NVEKSSSCAVLQLHDGSLIKAKVLIGCDGLNSVIANYIGLKPTRFLSTCSVRGLTLYPNG  186

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEK  649
             H    +  R  K    VG +PI    V+WFV    +     K P+D  +I+Q+    I++
Sbjct  187   HGYAPKSLRVRKDKHYVGRIPIDEKTVYWFVALEWK--VDAKMPKDPASIRQLA---IDR  241

Query  648   LQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQG  469
                    + E+I  S+  SLS + L+YR P  LL   LR+ T+TVAGDA H MGPFLGQG
Sbjct  242   TAGFSKDIVEMIENSDLSSLSLTRLRYRAPWNLLSRSLRRETITVAGDAWHAMGPFLGQG  301

Query  468   GCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA-----QL  304
             G  +LEDAVVLARCL S      N++       +   +EAL++Y+KERR RV        
Sbjct  302   GSVALEDAVVLARCL-SKKICNANMNRSRMHLSTQMAKEALDEYLKERRRRVVLLSTLTY  360

Query  303   SMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                   I         L  + F    A+ FR+      YDCG+L
Sbjct  361   LTGLLTIEDLSLLLRLLCIIIF----AVVFRDRLNHTRYDCGEL  400



>ref|NP_001046834.1| Os02g0471300 [Oryza sativa Japonica Group]
 dbj|BAD19484.1| putative monooxygenase [Oryza sativa Japonica Group]
 dbj|BAF08748.1| Os02g0471300 [Oryza sativa Japonica Group]
 gb|EAZ23001.1| hypothetical protein OsJ_06696 [Oryza sativa Japonica Group]
Length=419

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 174/425 (41%), Positives = 250/425 (59%), Gaps = 24/425 (6%)
 Frame = -2

Query  1395  EMEST--DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWR  1222
             EME    D+ H IVIVGGGICGLATALALHRKG+ S+VLERS+ LR++G  IG+  NGWR
Sbjct  2     EMEEVVEDAAHGIVIVGGGICGLATALALHRKGISSLVLERSEALRADGVAIGIHANGWR  61

Query  1221  ALDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             AL+ LG+ + LR     +   R ++  ++K   +     ++RC+ R DL+ +LA  LPAG
Sbjct  62    ALEHLGVAAVLREATNAITAYRSVWQLQNKTTLLP-ARKELRCLTRKDLVETLAKNLPAG  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRFGC V++VD DS ++   L   +G  I+A++LIGCDG  S+VA+ LGL    E   +
Sbjct  121   TIRFGCRVAAVDEDSGSRCPVLTTEDGHTIKAKVLIGCDGANSVVAKYLGLGNPSELPRL  180

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A  GL +YP+ H    EF      D+ VG LPI+  LVH+F+   +R+       RD +A
Sbjct  181   AILGLASYPDGHPFGTEFLTIAGDDLAVGRLPINDHLVHFFL---SRRRHSTDMARDASA  237

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLK------YrppgelllgrlRKGTV  520
              ++ V   +EKLQ+ PA V +++   +  S  ++  K      ++          R+  V
Sbjct  238   AREYV---LEKLQECPADVVDMVRRCDHASSLWTTTKVWYRPPWQVALAAFFQLRRRAAV  294

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA-AAVKNNVDGI--------EKEERS  367
             TVAGDAMHVMGPF+GQGG S+LEDAVVLAR L S+ A V+   D +        ++ +  
Sbjct  295   TVAGDAMHVMGPFIGQGGSSALEDAVVLARSLSSSRATVEGGADDLAGDRGRRHDQPQVD  354

Query  366   ARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEY  187
               +  A+ +YV+ERR RV +LS+ ++ +G  +   S + ++     MAL         +Y
Sbjct  355   GEMGAAIGRYVRERRARVIRLSLESFTVGTLLRTKSAVVRLVCAVVMALLGTRSRRHADY  414

Query  186   DCGQL  172
             DCG L
Sbjct  415   DCGSL  419



>ref|XP_007032109.1| Monooxygenase, putative isoform 1 [Theobroma cacao]
 gb|EOY03035.1| Monooxygenase, putative isoform 1 [Theobroma cacao]
Length=413

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 239/383 (62%), Gaps = 14/383 (4%)
 Frame = -2

Query  1308  KGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGRDIFLGEDKE  1129
             KG+++IVLERS+ LR+ G  I V PNGWRALDQLGI S LR  A+ +Q GR I + + K+
Sbjct  41    KGIETIVLERSENLRATGAAIIVQPNGWRALDQLGIASKLRQTAVSIQSGRYITVKDGKQ  100

Query  1128  QKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYI  952
             + +     G++RC+ R DL+ +LA+ LPA T+R GC+V S+  D  T +  L L +GS +
Sbjct  101   KDLPVGDVGELRCLKRTDLLNALAENLPADTVRLGCKVVSITLDPSTSYPILQLQDGSVL  160

Query  951   EAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGI  772
              A+++IGCDG  S +A +LGL   + F     RG T Y   H     F    K DV++G+
Sbjct  161   MAKVVIGCDGVNSTIANILGLNSTRLFSTSVIRGFTNYETGHEFGSAFLVFSKDDVQLGL  220

Query  771   LPISHDLVHWFVTFPTRQLTGE--KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEP  598
             LP++  LV+WFV   TR+ T +  K  + +  IK+     +E ++  P  + E++  S+ 
Sbjct  221   LPVTEKLVYWFV---TRKQTSQDSKVSKSQTLIKE---STVEAMKGFPIHIMEMVKDSDL  274

Query  597   ESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGS  418
             +SL  + L++  P +LL   LR+GTVTVAGDAMH M PFL QGG +SLEDAVVLARCL  
Sbjct  275   DSLHLTDLRFLAPWDLLGTNLRRGTVTVAGDAMHAMAPFLAQGGSASLEDAVVLARCLSQ  334

Query  417   AAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMA  241
                ++  VD  EK+ ++   +E AL++YVKER+MRV  LS+ T+LIG  +  ++ L K  
Sbjct  335   NQTMR--VD--EKQAKTMMDMEAALDQYVKERKMRVFWLSLETFLIGTMLDTSTLLVKCL  390

Query  240   FGGAMALFFRNGAAQNEYDCGQL  172
                ++ + FR+  A   YDCG+L
Sbjct  391   CIISLMVLFRDKIAHTRYDCGRL  413



>gb|EAY85810.1| hypothetical protein OsI_07170 [Oryza sativa Indica Group]
Length=420

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 174/426 (41%), Positives = 251/426 (59%), Gaps = 25/426 (6%)
 Frame = -2

Query  1395  EMEST--DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWR  1222
             EME    D+ H IVIVGGGICGLATALALHRKG+ S+VLERS+ LR++G  IG+  NGWR
Sbjct  2     EMEEVVEDAAHGIVIVGGGICGLATALALHRKGISSLVLERSEALRADGVAIGIHANGWR  61

Query  1221  ALDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLA-DALPA  1045
             AL+ LG+ + LR     +   R ++  ++K   +     ++RC+ R DL+ +LA + LPA
Sbjct  62    ALEHLGVAAVLREATNAITAYRSVWQLQNKTTLLP-ARKELRCLTRKDLVETLAKNLLPA  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIRFGC V++VD DS ++   L   +G  I+A++LIGCDG  S+VA+ LGL    E   
Sbjct  121   GTIRFGCRVAAVDEDSGSRCPVLTTEDGHTIKAKVLIGCDGANSVVAKYLGLGNPSELPR  180

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
             +A  GL +YP+ H    EF      D+ VG LPI+  LVH+F+   +R+       RD +
Sbjct  181   LAILGLASYPDGHPFGTEFLTIAGDDLAVGRLPINDHLVHFFL---SRRRPSTDMARDAS  237

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLK------YrppgelllgrlRKGT  523
             A ++ V   +EKLQ+ PA V +++   +  S  ++  K      ++          R+  
Sbjct  238   AAREYV---LEKLQECPADVVDMVRRCDHASSLWTTTKVWYRPPWQVALAAFFQLRRRAA  294

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA-AAVKNNVDGI--------EKEER  370
             VTVAGDAMHVMGPF+GQGG S+LEDAVVLAR L S+ A V+   D +        ++ + 
Sbjct  295   VTVAGDAMHVMGPFIGQGGSSALEDAVVLARSLSSSRATVEGGADDLAGDRGRRHDQPQV  354

Query  369   SARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE  190
                +  A+ +YV+ERR RV +LS+ ++ +G  +   S + ++     MAL         +
Sbjct  355   DGEMGAAIGRYVRERRARVIRLSLESFTVGTLLRTKSAVVRLVCAVVMALLGTRSRRHAD  414

Query  189   YDCGQL  172
             YDCG L
Sbjct  415   YDCGSL  420



>ref|NP_001137114.1| hypothetical protein [Zea mays]
 ref|XP_008681332.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF83290.1| unknown [Zea mays]
 gb|AFW71837.1| hypothetical protein ZEAMMB73_473575 [Zea mays]
Length=402

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 254/404 (63%), Gaps = 12/404 (3%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR++G GIGV  NGWRAL+QLG+ + 
Sbjct  7     HGIVIVGGGICGLATALALHRKGIPSLVLEKSRSLRADGAGIGVHANGWRALEQLGVAAE  66

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
             LR  A  +    D++   DK  + +  V  ++RC+ R DLI +LA  +PAG IRFGC V+
Sbjct  67    LRETAQLITVYHDVWQQGDKTSREKVPVRMELRCLNRKDLIEALAKDIPAGAIRFGCRVA  126

Query  1014  SVDYDSVTKFTRLL-LSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
             +V  D       +L +++G+ ++A++LIGC+G  S VA  LGL P +       RG T Y
Sbjct  127   AVAADPGGGHGAVLTMADGTAMKAKVLIGCEGTYSAVARYLGLSPVRTIPRPVLRGFTWY  186

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             P+ HS   EF R   G   +G L I+ +LVH+FVT P +Q T +   +D   ++   +++
Sbjct  187   PHGHSFDTEFLRLRVGGFFIGRLTITDNLVHFFVTMP-KQPTADVI-KDLKRVRDHALKD  244

Query  657   IEKLQDLPAKVKEVIHLSEPESLSF-SHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
             ++ ++  P ++ E++  S+PESL+  +   YRPP E++LG  ++G VTVAGDAMH MGPF
Sbjct  245   LQDVE-CPGEIIEIVRGSDPESLNLVTEFWYRPPWEVVLGSFQRGAVTVAGDAMHAMGPF  303

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             +GQGG + LEDAVVLAR L  AA     VD  +       + EA+ +YV+ERR R+A LS
Sbjct  304   IGQGGSAGLEDAVVLARSLARAA-----VDDSDNAREKKVVGEAIGEYVRERRPRLALLS  358

Query  300   MHTYLIGASMA-ATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + ++++GA +  + S + K+     + L          YDCG+L
Sbjct  359   LESFVMGALLVRSPSPVTKLVCVAVLILLGSKSLRHANYDCGRL  402



>ref|XP_006340107.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=315

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 209/330 (63%), Gaps = 17/330 (5%)
 Frame = -2

Query  1158  RDIFLGEDKEQKIEYVS-GDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFT  982
             R  ++ +  E+   Y + G+VRC+ R+D++ + ADALP   IRFGC++ SV+ D +T   
Sbjct  2     RITWMDKGNEKFTPYKNIGEVRCLKRSDIVETFADALPPMAIRFGCDIVSVEMDPITSLP  61

Query  981   RLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHR  802
              LLLSNG  I A++LIGCDG RSIVA  LGLKPAK F   A RGLT+YPN HS P+EF R
Sbjct  62    SLLLSNGKRIGAKVLIGCDGWRSIVASFLGLKPAKTFRTCAIRGLTSYPNGHSFPLEFVR  121

Query  801   HFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVK  622
                G   VG LPI+  LVHWFV+   +Q    KFP++   IKQ  +E +      PA V+
Sbjct  122   LIIGQTAVGRLPITDKLVHWFVS--VQQGIDAKFPQNTQFIKQRAMEAVS---GHPADVQ  176

Query  621   EVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAV  442
             E+I   + +SLSF+HLKYR P +L+ G  R+ TVTVAGDAMHVMGPFLGQGG S +EDAV
Sbjct  177   EMIEKCDLDSLSFAHLKYRAPWDLMFGNFREKTVTVAGDAMHVMGPFLGQGGSSGIEDAV  236

Query  441   VLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAAT  262
             VL R L  A  +  N             EEAL++Y+KER+MRV +L+  +YL    +   
Sbjct  237   VLGRNL--AKTINGN---------CFDHEEALDQYIKERKMRVVKLATQSYLTALLIENR  285

Query  261   SKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               L K+     MA+FFRN +A  +YDCG L
Sbjct  286   PMLTKIVVVAVMAIFFRNQSAHTQYDCGLL  315



>ref|XP_002532447.1| monoxygenase, putative [Ricinus communis]
 gb|EEF29933.1| monoxygenase, putative [Ricinus communis]
Length=400

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 232/391 (59%), Gaps = 15/391 (4%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             LATALALHR+G++S VLE+S+ LR+ G GI V PNGWRALDQLG+ + LR  + P+Q G+
Sbjct  19    LATALALHRQGVRSKVLEKSETLRTTGVGIIVRPNGWRALDQLGVAAILRQTSAPIQGGQ  78

Query  1155  DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRL  976
              I + + K + +    G+ RC+ RNDLI++LAD LP  T+++GC V S+  D +T +  L
Sbjct  79    HISVHDGKRKNLPG-DGETRCLRRNDLIKALADNLPVNTVQYGCRVESIQVDPITTYPIL  137

Query  975   LLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHF  796
              L  G  ++ +I+IGCDG  S     LGL   K       RG T Y +AH    EFH   
Sbjct  138   HLHGGRVLKPKIVIGCDGVHSTTGTFLGLNSPKFSPTCVIRGFTYYQSAHEFGNEFHLVS  197

Query  795   KGDVRVGILPISHDLVHWFVTFPTRQLTGE--KFPRDENAIKQMVIENIEKLQDLPAKVK  622
                V++GI+P++  L++WFV   TR+   E  K  RD+  IK      +E L+  P    
Sbjct  198   SKCVQLGIVPVNEKLIYWFV---TREWGSEDPKISRDQKRIKD---STLELLKGYPENTV  251

Query  621   EVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAV  442
              ++  S  +SL  + L YR P +LL    RKGTV +AGDAMH MGPFL QGG  SLEDAV
Sbjct  252   HLVKNSHLDSLYLTGLTYRAPWDLLTSNFRKGTVALAGDAMHAMGPFLAQGGSVSLEDAV  311

Query  441   VL--ARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMA  268
             V+  ARCL    A K N   ++       IEE L+ Y+K+RRMRV  + +HTYLIG++  
Sbjct  312   VMPXARCL----AQKLNTRTMKDTRIKVLIEEGLDDYMKQRRMRVFWMCLHTYLIGSAFH  367

Query  267   ATSKLAKMAFGGAMALFFRNGAAQNEYDCGQ  175
             +++ + ++     + + FR+      YDC Q
Sbjct  368   SSASVKQLLSIVLLIILFRDSNKHTRYDCSQ  398



>ref|XP_004952758.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=411

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 250/406 (62%), Gaps = 7/406 (2%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATAL LHRKG+ S+VLE+S++LR+EG GIGV  NGWRAL+QLG+ + 
Sbjct  7     HGIVIVGGGICGLATALGLHRKGIASLVLEKSEVLRAEGAGIGVQANGWRALEQLGVAAE  66

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
             LR  A  +    D++L   K  +  Y V  ++RC+ R DLI +LA  LPAG IRFGC ++
Sbjct  67    LRKTAGLITAYHDVWLQGGKSTRDRYPVRTELRCLNRKDLIEALAKDLPAGAIRFGCRIA  126

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGG-RSIVAELLGLKPAKEFGVVATRGLTTY  838
             +V  D       L +++G+ ++A++LIGCDGG  S+VA+ LGL P +       RG T+Y
Sbjct  127   AVHADPGGHGAVLTMADGATMKAKVLIGCDGGTNSVVAKYLGLPPVRTIPRPVLRGFTSY  186

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             P+ H    EF R   GD  +G LPI+ +LVH+FVT             D   ++ +V+ +
Sbjct  187   PHGHPFENEFLRLRVGDFFIGRLPITDNLVHFFVTMAKPAADEGLTGGDLRGVRDLVLRD  246

Query  657   IEKLQDLPAKVKEVIHLSEPESLSF-SHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
             +E+LQ  P ++ EV+  S+PESL+  ++  YRPP E+ L   R+G VTVAGDAMH MGPF
Sbjct  247   LEELQ-CPTEITEVVRRSDPESLNLVTNFWYRPPWEVALRGFRRGVVTVAGDAMHAMGPF  305

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNV--DGIEKEERSARIEEALEKYVKERRMRVAQ  307
             +GQGG + LEDAVVLAR L  A         D     E  A + EAL  YV+ERR+R+  
Sbjct  306   IGQGGSAGLEDAVVLARSLARAVGAAAAAGDDSKPPREEDAVVGEALGAYVRERRLRLTL  365

Query  306   LSMHTYLIGASMA-ATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             LS+ ++++G  +  + S   K+A    + L          +DCG+L
Sbjct  366   LSLESFIMGVLLVRSPSPAVKLACVAVLVLLGSKSLRHANFDCGRL  411



>dbj|BAK04829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 168/412 (41%), Positives = 247/412 (60%), Gaps = 17/412 (4%)
 Frame = -2

Query  1401  KREMESTDSK-HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGW  1225
             ++EM + + + H ++IVGGGICGLATALALH KG+ S+VLE+++ LR+ G GI +  NGW
Sbjct  4     RKEMATGEEELHGVLIVGGGICGLATALALHIKGIDSLVLEKAESLRATGAGISIKVNGW  63

Query  1224  RALDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             RAL+QL +   LR +A+ L       + +D+ +K+ Y S + RC+ R+DL+ +LA  LP 
Sbjct  64    RALEQLKVSEELRKLAVNLTGMDRKDIHDDRVKKVSYRS-ECRCLKRSDLVETLARHLPG  122

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             G IRFGC+V ++  D+VT+   +  S+GS I A+++IGCDG  S+VA+ LGLKP +   +
Sbjct  123   GCIRFGCQVEAISLDAVTRCPIVSTSDGSTIRAKVVIGCDGANSVVAKFLGLKPTRSLPM  182

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
              A R +TT P  HS    F       +   ++P+    V +F     R        RD  
Sbjct  183   WAARAMTTIPEGHSFRNRFLNLVSEGISFRLVPMDDKTV-YFAAIQRRPPKERTNIRDPA  241

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I+      ++ +Q  P  V +V+   +  ++S + + YRPP  L+    ++GTVTVAGD
Sbjct  242   LIRHAA---LQAMQGYPEDVLDVVRSCDLSTMSLAQICYRPPWHLVFQPFQEGTVTVAGD  298

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH MGPF+GQGG SSLEDA+V+AR L    +  +   GIEK         AL  YVKER
Sbjct  299   AMHAMGPFIGQGGSSSLEDAIVIARRLAQTKS-DDGAKGIEK---------ALVSYVKER  348

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFR-NGAAQNEYDCGQL  172
             R+R+ +LS+  +L G  + ATSKL K+    A+A+ F  N    +++DCG L
Sbjct  349   RVRILRLSVQAFLNGQLIVATSKLMKVLIRAALAVLFAGNSDRHSDFDCGSL  400



>ref|XP_010694352.1| PREDICTED: kynurenine 3-monooxygenase-like [Beta vulgaris subsp. 
vulgaris]
Length=402

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 169/400 (42%), Positives = 243/400 (61%), Gaps = 25/400 (6%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             LATALALHRKGLKS+VLE+S+ LR  G  I +L NGWRALDQLG+ S LR V+ P+    
Sbjct  16    LATALALHRKGLKSVVLEKSETLRECGVVISILTNGWRALDQLGVASKLRPVSFPVFGFH  75

Query  1155  DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRL  976
             DI L    E++      ++R   R  LI +LA  LP  TIRFGC+VS++  D  + +  +
Sbjct  76    DIVLDNGSERRTPASKEEIRSFRRIHLIETLAKELPEDTIRFGCQVSAITMDRDSSYPVI  135

Query  975   LLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIE-FHRH  799
              L +G+ I++++LIGCDG  S VAE +GLKP K + +   RGLT YP  H++  + F R 
Sbjct  136   HLDDGTIIKSKVLIGCDGAFSRVAEYVGLKPVKHYSMAVVRGLTNYPTGHNISEKMFTRT  195

Query  798   FKGDVRVGILPISHDLVHWFVTF--PTRQLTGEKFPRDENAIKQMVIENI--EKLQDLPA  631
              KG+V VG +P+  +LV+WFV+   PT         +D   +K + ++N+  E ++D P+
Sbjct  196   RKGNVMVGRIPMGENLVYWFVSMRSPT---------KDSTVLKDLDMKNLAKEAVKDYPS  246

Query  630   KVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLE  451
             +   +I   +  SL F++L YRPP  L +    KG V VAGDA HVM P LGQGG ++LE
Sbjct  247   ETVNMIEQCDINSLHFNNLHYRPPWNLFVENFSKGNVIVAGDAKHVMAPALGQGGSAALE  306

Query  450   DAVVLARCLGSAAAVKNNVDGIEKEERSARI------EEALEKYVKERRMRVAQLSMHTY  289
             D+VVLARC+    A K  V+G+E E++  +       E A ++++KERR RV  LS++T+
Sbjct  307   DSVVLARCM----AQKMIVEGLEGEQQHQKTINWGKAELAFDQFLKERRSRVWWLSLNTH  362

Query  288   LI-GASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +I   S  A+SK  +      +   FR      +Y+CG+L
Sbjct  363   IIVSLSQHASSKAIRFLCIFFLIALFRKPLWDVQYNCGRL  402



>ref|XP_002452285.1| hypothetical protein SORBIDRAFT_04g023000 [Sorghum bicolor]
 gb|EES05261.1| hypothetical protein SORBIDRAFT_04g023000 [Sorghum bicolor]
Length=390

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/405 (41%), Positives = 247/405 (61%), Gaps = 19/405 (5%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +  H IVIVG GICGLATALALHRKG+ S+VLE+S+ LRS+G  IG+  NGWR L+QLG+
Sbjct  3     EEAHGIVIVGSGICGLATALALHRKGIASLVLEKSETLRSDGAAIGIHANGWRVLEQLGV  62

Query  1200  GSHLRTVALPLQRGRDIFLGEDKE-QKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGC  1024
              + LR  A  +    +++  ++K+  ++  +  ++RC+ R DLI ++A  LP+G IR+GC
Sbjct  63    AAELRKTANLVTAYHNVWQQKNKKTSRLLPIRNELRCLKRKDLIETMAKNLPSGAIRYGC  122

Query  1023  EVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLT  844
              V ++  D+ T    L   +G  I+A++LIGCDG  S+VA+ LGL           RG T
Sbjct  123   HVVAIHQDTGTHGAILTTVDGCIIKAKVLIGCDGANSVVAKYLGLSAPITNHHTVFRGFT  182

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVI  664
              YP+ H    EF R    +  VG +P++ +LVH+ +  P    TG +   D  A K  VI
Sbjct  183   RYPHGHPFSTEFLRIRGEEFFVGRIPVTDNLVHFLIVTPIPP-TG-RITYDVIAAKDSVI  240

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTVAGDAMHVMG  487
             E ++  QD P+ + E++  S+PE+L+  +++ YRPP ++  G   KG VTVAGDAMHV+G
Sbjct  241   EKLQA-QDCPSDIIEMLRNSDPETLNVVNNIWYRPPWQVAFGTFHKGIVTVAGDAMHVVG  299

Query  486   PFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQ  307
             PF+GQGG S LEDA+VLAR L  AAA   +V              A+++YV+ERR+RV+ 
Sbjct  300   PFIGQGGASGLEDAIVLARSLSRAAAGDYSV--------------AIKEYVRERRLRVSL  345

Query  306   LSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +S+ +++ G   +A S++  +     +AL         ++DCG+L
Sbjct  346   VSLESFVFGMLGSAKSRVTMLVCIVVLALLGNRSLRHADFDCGRL  390



>dbj|BAD44160.1| unnamed protein product [Arabidopsis thaliana]
Length=325

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 15/310 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCL  424
             EDAVVLARCL
Sbjct  305   EDAVVLARCL  314



>dbj|BAD44136.1| unnamed protein product [Arabidopsis thaliana]
Length=325

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 206/311 (66%), Gaps = 15/311 (5%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALDQLG+G  LR  +  + + 
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDQLGVGDRLRLNSSLIHKA  74

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  75    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  132

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  133   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  192

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENI--EKLQDLP  634
              R  +G+V +G LP++ + V WF+              + N   Q  I N+  +   DL 
Sbjct  193   LRIKQGNVLIGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLS  244

Query  633   AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
                KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDA+HVMGPFL QGG ++L
Sbjct  245   EDWKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAVHVMGPFLAQGGSAAL  304

Query  453   EDAVVLARCLG  421
             EDAVVLARCL 
Sbjct  305   EDAVVLARCLA  315



>ref|XP_008681331.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=429

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 176/431 (41%), Positives = 253/431 (59%), Gaps = 39/431 (9%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR++G GIGV  NGWRAL+QLG+ + 
Sbjct  7     HGIVIVGGGICGLATALALHRKGIPSLVLEKSRSLRADGAGIGVHANGWRALEQLGVAAE  66

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
             LR  A  +    D++   DK  + +  V  ++RC+ R DLI +LA  +PAG IRFGC V+
Sbjct  67    LRETAQLITVYHDVWQQGDKTSREKVPVRMELRCLNRKDLIEALAKDIPAGAIRFGCRVA  126

Query  1014  SVDYD---------------SVTKFTRLLLSNGSYIEA-------------EILIGCDGG  919
             +V  D               ++    +L  +  SYI+              ++LIGC+G 
Sbjct  127   AVAADPGGGHGAVLTMADGTAMKAKVKLACNRWSYIQYHIYIYPLPEIELFQVLIGCEGT  186

Query  918   RSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWF  739
              S VA  LGL P +       RG T YP+ HS   EF R   G   +G L I+ +LVH+F
Sbjct  187   YSAVARYLGLSPVRTIPRPVLRGFTWYPHGHSFDTEFLRLRVGGFFIGRLTITDNLVHFF  246

Query  738   VTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSF-SHLKYrp  562
             VT P +Q T +   +D   ++   +++++ ++  P ++ E++  S+PESL+  +   YRP
Sbjct  247   VTMP-KQPTADVI-KDLKRVRDHALKDLQDVE-CPGEIIEIVRGSDPESLNLVTEFWYRP  303

Query  561   pgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIE  382
             P E++LG  ++G VTVAGDAMH MGPF+GQGG + LEDAVVLAR L  AA     VD  +
Sbjct  304   PWEVVLGSFQRGAVTVAGDAMHAMGPFIGQGGSAGLEDAVVLARSLARAA-----VDDSD  358

Query  381   KEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMA-ATSKLAKMAFGGAMALFFRNG  205
                    + EA+ +YV+ERR R+A LS+ ++++GA +  + S + K+     + L     
Sbjct  359   NAREKKVVGEAIGEYVRERRPRLALLSLESFVMGALLVRSPSPVTKLVCVAVLILLGSKS  418

Query  204   AAQNEYDCGQL  172
                  YDCG+L
Sbjct  419   LRHANYDCGRL  429



>emb|CAB10354.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78618.1| hypothetical protein [Arabidopsis thaliana]
Length=657

 Score =   282 bits (722),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/365 (45%), Positives = 225/365 (62%), Gaps = 45/365 (12%)
 Frame = -2

Query  1338  GLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRG  1159
             GLAT++ALHRKG+KS+VLER++ +RSEG GIG L NGWRALD               +  
Sbjct  15    GLATSIALHRKGIKSVVLERAEKVRSEGAGIGTLSNGWRALDT------------AWRWA  62

Query  1158  RDIFLGEDKEQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTK  988
             R + +   K++  E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T 
Sbjct  63    RTMLIENGKKR--EFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTL  120

Query  987   FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEF  808
             F  + L+NG+ I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E 
Sbjct  121   FPVVHLANGNSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEV  180

Query  807   HRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAK  628
              R  +G+V +G LP++ + V WF+             +D N                   
Sbjct  181   LRIKQGNVLIGRLPLTDNQVFWFLV----------HMQDNNH----------------ND  214

Query  627   VKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLED  448
              KE++ +   ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++LED
Sbjct  215   WKEMVKICNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAALED  274

Query  447   AVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMA  268
             AVVLARCL  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S+ 
Sbjct  275   AVVLARCL--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRSLQ  332

Query  267   ATSKL  253
              +SKL
Sbjct  333   TSSKL  337



>ref|XP_004952767.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Setaria italica]
 ref|XP_004952768.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Setaria italica]
 ref|XP_004952769.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Setaria italica]
Length=418

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 167/403 (41%), Positives = 245/403 (61%), Gaps = 10/403 (2%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+SK LR+EGG IGV  NGWR L+QLG+   
Sbjct  23    HGIVIVGGGICGLATALALHRKGIPSLVLEKSKTLRTEGGSIGVHVNGWRVLEQLGVAPE  82

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
             LR  A  +    D++  +   + +   V G++R + R DLI ++A  +P+G IRF C ++
Sbjct  83    LRKTADVVTEFHDVWQQKQGNKSVVVPVRGELRWLKRRDLIETMAKNVPSGAIRFSCHIA  142

Query  1014  SV-DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
             ++   +  +    L   +GS I A+ LIGCDG  S+VA+ LGL PAK    +  RG T Y
Sbjct  143   AIRPVNPGSHGVVLTTLDGSIIRAKALIGCDGSNSVVAKYLGLSPAKSTSRMLLRGYTRY  202

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
             P+ H     F R       VG  P++ +LV++FV        G    +D +A+K++V+E 
Sbjct  203   PHGHPFGPHFLRLRGNGFFVGRSPMTDNLVNFFVAL---WHPGADATKDASAMKELVLEK  259

Query  657   IEKLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
             ++       ++ E++   EP+SL   + + YRPP ++L    ++GT TVAGDAMHVMG +
Sbjct  260   LKG--QCSDEIIEMVRAPEPDSLILLTKIWYRPPWQVLFSSFQRGTATVAGDAMHVMGTY  317

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             +GQGG +S+EDA+VLAR L  AAA      G E  E+  +I  A+ +YV+ERR+R+ +LS
Sbjct  318   IGQGGSASMEDALVLARSLSRAAAGGGGSGGDELCEK--KISAAMGEYVRERRLRIVRLS  375

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + ++ +G  +A  S L K+A    ++L         +YDCG+L
Sbjct  376   LESFTMGTLLATKSLLTKLACFAILSLLGTASLGHTKYDCGRL  418



>ref|XP_004952763.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=401

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 166/407 (41%), Positives = 250/407 (61%), Gaps = 12/407 (3%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++ H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR+EGG IGV  NGWR L+QLG+
Sbjct  3     EAVHGIVIVGGGICGLATALALHRKGIPSLVLEKSETLRTEGGSIGVHVNGWRVLEQLGV  62

Query  1200  GSHLRTVALPLQRGRDIFLGEDKEQKIEY-VSGDVRCMARNDLIRSLADALPAGTIRFGC  1024
                LR  A  +    D++  +   + +   V G++R + R DL+ ++A  +P+G IRF C
Sbjct  63    APELRKTADVVTEFHDVWQQKQGNKSVVVPVRGELRWLKRRDLVETMAKNIPSGAIRFSC  122

Query  1023  EVSSVDYDSVTKFTRLLLS-NGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
              ++++   +      +L + +GS I A+ LIGCDG  S+VA+ LGL PAK    +  RG 
Sbjct  123   HIAAIRPANPGSHGVVLTTLDGSIIRAKALIGCDGSNSVVAKYLGLSPAKSTSRMLLRGY  182

Query  846   TTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMV  667
             T YP+ H     F R       VG  P++ +LV++FV        G    +D +A+K++V
Sbjct  183   TRYPHGHPFGPHFLRLRGNGFFVGRSPMTDNLVNFFVAL---WHPGADATKDASAMKELV  239

Query  666   IENIE-KLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             +E ++ +  D   ++ E++   EP+SL   + + YRPP +++    R+GT TVAGDAMHV
Sbjct  240   LEKLKGQCSD---EIIEMVRDPEPDSLILLTKIWYRPPWQVMFSSFRRGTATVAGDAMHV  296

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             MG ++GQGG +S+EDA+VLAR L  AAA      G E  E+  +I  A+ +YV+ERR+R+
Sbjct  297   MGSYIGQGGSASMEDALVLARSLSRAAAAAGGSGGDELCEK--KISAAMGEYVRERRLRI  354

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              +LS+ ++ +G  +A  S L K+A    ++L         +YDCG+L
Sbjct  355   VRLSLESFTMGTLLATKSLLTKLACFAILSLLGTASLGHTKYDCGRL  401



>gb|ABK24681.1| unknown [Picea sitchensis]
Length=416

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 167/417 (40%), Positives = 233/417 (56%), Gaps = 40/417 (10%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
              VIVGGGI GLATA+AL R GLKS+VLER+  LR+ G  + ++ N WRALD LG+   LR
Sbjct  15    FVIVGGGIAGLATAVALQRVGLKSLVLERADSLRTTGAALTLMTNAWRALDVLGVAQSLR  74

Query  1185  TVALPLQRGRDIFLGEDKEQKIEYV----SGD--VRCMARNDLIRSLADALPAGTIRFGC  1024
                  LQ  +         ++I Y      GD  VRC+ R+ L+ +LA  L  GTIRF  
Sbjct  75    LKHPQLQGAQVTSFPSAFTKQISYTGSGKCGDHEVRCVQRSFLLETLAKELAPGTIRFNT  134

Query  1023  EVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLT  844
             +V S+   + +  T + L +G+ I+A++LIGCDGG S+VA+ LGL+     G    RGL 
Sbjct  135   KVVSIQQSTNSSLTIVKLGDGALIKAKVLIGCDGGNSVVADWLGLQAPSLSGRSGIRGLA  194

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT---FPTRQLTGEKFPRDENAIKQ  673
             TYP  H    +   ++   +R G +P +   V+WF T    P+    G    RD  +I +
Sbjct  195   TYPEGHKFGPKVKLYWGEHLRAGFVPCNDKDVYWFTTQSSLPSDSDIG----RDPKSILE  250

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
                + +E L D P ++ +++  ++ ++L+ + L  R P  +L G+L KG V VAGDAMH 
Sbjct  251   ---KAMEILGDYPEEILDIVKKTQIDTLTLTPLSLRWPWAVLFGKLCKGNVCVAGDAMHP  307

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGCS+LEDAVVL RCLG A  V N   G+E+E+   +IEEAL+KYV+ERR R 
Sbjct  308   MTPDLGQGGCSTLEDAVVLGRCLGEATTVMN---GLEEEK---KIEEALKKYVEERRWRS  361

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFR----------NGAAQNEYDCGQL  172
               L    Y+ G        + +   GG +  F R          N   Q ++DCG L
Sbjct  362   FGLISGAYITG--------VVQQGSGGVITRFLRDKFLSRKLSENLMNQADFDCGTL  410



>ref|XP_010551061.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=321

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 196/313 (63%), Gaps = 14/313 (4%)
 Frame = -2

Query  1107  GDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGC  928
             G+ RC+ RNDL++ LADALP GTIRFGC V+SV  D  T F  + + +G+ I+A++LIGC
Sbjct  22    GEARCIKRNDLVKVLADALPQGTIRFGCRVASVKLDETTSFPIIRVQDGTNIKAKVLIGC  81

Query  927   DGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLV  748
             DG  S+VAE L L   K     A RGLT+YPN H    EF R    DV  G LPI+   V
Sbjct  82    DGANSVVAEFLRLNRTKVCASRAVRGLTSYPNGHGFRHEFVRIKTDDVLCGRLPITAHSV  141

Query  747   HWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKY  568
              WF   P      + F +D+ A++++ + +I++L +   + KE++   +  SL  S L+Y
Sbjct  142   FWFALVPNCSADSKNF-KDQEAVQKLTLRSIKELSE---EWKEMVKKCDKSSLYMSSLRY  197

Query  567   rppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDG  388
             R P E+L G+ R GTVTVAGDAMH+MGPFLGQGG S+LEDAVV+ARCL          + 
Sbjct  198   RTPWEILFGKFRTGTVTVAGDAMHMMGPFLGQGGSSALEDAVVMARCLA---------EK  248

Query  387   IEK-EERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFR  211
             IEK  +   RIEE +++YV+ERRMR+  LS  TYL G  + ++S++ K+ F   + + F 
Sbjct  249   IEKCGDSRKRIEEGIDEYVRERRMRLFSLSTQTYLTGLCIESSSRVVKLMFMVFVMVLFF  308

Query  210   NGAAQNEYDCGQL  172
             +      YDCG+L
Sbjct  309   DPIHHTRYDCGRL  321



>dbj|BAD43234.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43237.1| unnamed protein product [Arabidopsis thaliana]
Length=317

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 203/326 (62%), Gaps = 16/326 (5%)
 Frame = -2

Query  1131  EQKIEYVSG---DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNG  961
             E+K E+VS    + RC+ RNDL+ +L+DALP GTIRFG  + S++ D  T F  + L+NG
Sbjct  2     EKKREFVSNIVDEARCIKRNDLVEALSDALPKGTIRFGSHIVSIEQDKTTLFPVVHLANG  61

Query  960   SYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVR  781
             + I+A++LIGCDG  SIV++ L L P K F   A RG T YPN H  P E  R  +G+V 
Sbjct  62    NSIKAKVLIGCDGANSIVSDYLQLNPKKAFACRAVRGFTKYPNGHGFPQEVLRIKQGNVL  121

Query  780   VGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEK--LQDLPAKVKEVIHL  607
             +G LP++ + V WF+              + N   Q  I N+ +    DL    KE++ +
Sbjct  122   IGRLPLTDNQVFWFLVHMQ--------DNNHNGKDQESIANLCRKWADDLSEDWKEMVKI  173

Query  606   SEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARC  427
                ESL+ +HL+YR P E++LG+ R+GTVTVAGDAMHVMGPFL QGG ++LEDAVVLARC
Sbjct  174   CNVESLTLTHLRYRAPSEIMLGKFRRGTVTVAGDAMHVMGPFLAQGGSAALEDAVVLARC  233

Query  426   LGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAK  247
             L  A  V  +   + K+     IEEA+++YV ERRMR+  LS+ TYL G S+  +SK+ +
Sbjct  234   L--ARKVGPDHGDLLKDCSMKNIEEAIDEYVDERRMRLLGLSVQTYLTGRSLQTSSKVLR  291

Query  246   MAF-GGAMALFFRNGAAQNEYDCGQL  172
             + F    + LF R+      YDCG+L
Sbjct  292   LMFIALLLLLFGRDQIRHTRYDCGRL  317



>ref|XP_011074709.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
 ref|XP_011069403.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=412

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 231/421 (55%), Gaps = 26/421 (6%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             MES +   +IVIVG GI GL+TAL LHR G++S+VLE S  LR  G  + +  N WRALD
Sbjct  1     MES-EIHEDIVIVGAGIAGLSTALGLHRLGIRSLVLESSDGLRITGFALTMWTNAWRALD  59

Query  1212  QLGIGSHLRTVALPLQ---------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLA  1060
              LGIG  LR  +L +Q           R    G D + K +    + RC+ R DL+ +L 
Sbjct  60    ALGIGDSLRARSLRMQGIEACSRNPSLRSQQQGGDADLKFDMF--ESRCVKRKDLLENLE  117

Query  1059  DALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPA  880
               LP GTIR+   + S+      K   L L++G+ + A++LIGCDG  S+VA+ LGL+  
Sbjct  118   RELPQGTIRYSSRIISIVESGRLKL--LHLADGTDVRAKVLIGCDGVNSVVAKWLGLQNP  175

Query  879   KEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKF  700
                G  A RG   Y + H    +FH +F G VR G +P     ++WF TF     T ++ 
Sbjct  176   VNAGRSAIRGFVEYMDGHGFEPKFHAYFGGGVRYGFIPCDQKSIYWFCTFTPSLFTYDEN  235

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              +D   +KQ V+ NI    D P  V +++  +  + +S + LK+R P  +L G + K  V
Sbjct  236   EQDPLKMKQFVMSNI---WDAPKHVSDIVERTGLDCISCAPLKFRQPWNILQGNIVKNNV  292

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              VAGDA+H M   +GQGGCS+LED+++LARCL  A   K   +  EK+E   R+E+ LEK
Sbjct  293   CVAGDALHPMTLDIGQGGCSALEDSIILARCLAEALLRKQTCNDKEKDEDYVRMEKGLEK  352

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAK-----MAFGGAMALFFRNGAAQNEYDCGQ  175
             Y KERR R   L    Y++G    + SK+ +     + F   + +F R      ++DCG+
Sbjct  353   YSKERRWRSFSLISTAYVVGLIQESDSKVIRFLRKNLLFQFLVGIFER----MADFDCGE  408

Query  174   L  172
             L
Sbjct  409   L  409



>dbj|BAD16528.1| putative monooxygenase 1 [Oryza sativa Japonica Group]
Length=418

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 230/400 (58%), Gaps = 16/400 (4%)
 Frame = -2

Query  1344  ICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQ  1165
             +CGLATALALHRKG+ S+V+ERS+ LR  G  + V  NGWRAL++LG+   LR  A  + 
Sbjct  26    LCGLATALALHRKGMGSLVVERSEALRVGGVALNVHANGWRALEELGLADGLRKTANLIT  85

Query  1164  RGRDIFLGEDKEQKI--------EYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
               R +   + K Q               ++RC+ R D++ +LA ++PA TIR+GC + +V
Sbjct  86    SVRMVRQIQGKNQTTVSSPSYSYARCRKEIRCLRRKDVMEALAKSVPAHTIRYGCRIVAV  145

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             D D  T  T L +++ S I+A+++IGCDG  S+VA  +GL    +       G  +YP  
Sbjct  146   DEDPGTDCTVLTMADDSTIKAKVVIGCDGWNSVVARYVGLGAPSQLPRFIVLGFASYPEG  205

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEK  649
             H    EF +    D  VG +PI+ +L+H+FV   +R  +  +   DE+A ++ V   +EK
Sbjct  206   HPFGTEFSQIIADDFAVGRVPINENLLHFFV---SRSPSPGRTDVDEDAARKYV---LEK  259

Query  648   LQDLPAKVKEVIHLSE-PESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQ  472
             + +LP +V +++   +   S + + + YRPP ++ L   R+G VTVAGDAMH MGPF+GQ
Sbjct  260   VDELPGEVADMVRRCDAASSWTLTKVWYRPPWQVALAGFRRGAVTVAGDAMHAMGPFIGQ  319

Query  471   GGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHT  292
             GG + LEDAVVLAR L SAAA         ++ R   +  A+++YV ERR R   L +H+
Sbjct  320   GGSAGLEDAVVLARSLSSAAAGDGRAPP-RQQLRDDAVGAAIDEYVAERRRRATTLCLHS  378

Query  291   YLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + IG  +       K+A    +AL   +     +YDCG+L
Sbjct  379   FAIGTLLTTRWLAVKLACVAVLALLGGDSRRDADYDCGRL  418



>ref|XP_008791371.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Phoenix dactylifera]
Length=354

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 156/411 (38%), Positives = 220/411 (54%), Gaps = 61/411 (15%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATA                                     
Sbjct  1     MGSKEEHHDIVIVGGGICGLATA-------------------------------------  23

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
                         L L R RD++L ++K Q       ++RC+ R+DLI +LA  LP  ++R
Sbjct  24    ------------LALHRIRDMWLHKNKMQVTSCRKEELRCLKRSDLIETLAKNLPTQSVR  71

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D +T F  L  ++G+ I+A++LI CDG  S+VA+ LGL+  K F + A R
Sbjct  72    FGCQIVAVESDPITSFPVLYTNDGATIKAKVLIXCDGSNSVVAKSLGLQAPKVFPISAVR  131

Query  852   GLTTYPNAHSLPIEFHRHFKGD-VRVGILPISHDLVHWFV--TFPTRQLTGEKFPRDENA  682
             G T+Y + HS    F R  +GD V +G LP+   LV+WFV    P++     K P     
Sbjct  132   GFTSYSDGHSFDSHFIR-LRGDGVLLGRLPVDEKLVYWFVGRLSPSQDSDVRKVP---EL  187

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             IK+  +E I   ++ P ++ E++   +  SLS +H+ YR P  LL     +GT+TVAGDA
Sbjct  188   IKEFTLETI---REFPPEIIEMVKHCDSSSLSLTHIWYRAPWHLLFANFWQGTMTVAGDA  244

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MHVMGPFLGQGG + LEDA+VLARCL     +      I   E   RI  A+ KYV ERR
Sbjct  245   MHVMGPFLGQGGSAGLEDAIVLARCLSQEMPMGPE-GAISDRELCRRIGRAMSKYVNERR  303

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG-AAQNEYDCGQL  172
             +RV +LS  +YL G+ + A+S + K+     + +F   G  +   YDCG L
Sbjct  304   LRVMRLSAQSYLTGSVVVASSWVKKLVCLAILVVFLGGGLLSHTNYDCGSL  354



>ref|XP_010930387.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=352

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 217/408 (53%), Gaps = 57/408 (14%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATA                                     
Sbjct  1     MGSKEEHHDIVIVGGGICGLATA-------------------------------------  23

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
                         L L R RD++L ++K Q        +RC+ R+DLI SLA  LP G+IR
Sbjct  24    ------------LALHRIRDMWLHKNKMQVTSCRKEALRCLKRSDLIESLAKNLPVGSIR  71

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC++ +V+ D ++ F  L  ++G+ I+A++LIGCDG  S+VA+ LGL+  K   + A R
Sbjct  72    FGCQIVAVELDPLSSFPILYANDGATIKAKVLIGCDGSNSVVAKSLGLQAPKVCPISAVR  131

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
               T+Y + HS    F R     V +G +P+   LV+WFV+        +   +D   IK+
Sbjct  132   AFTSYSDGHSFDSHFIRLSGDGVLLGRVPVDEKLVYWFVSV---LCPSQDVQKDHELIKK  188

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             + +E    L++ P +V E++   +  SLS +H+ YR P  L      + T+TVAGDAMHV
Sbjct  189   VTLET---LKEFPTEVIEMVKHCDSSSLSLTHIWYRAPWHLFFANFWQRTMTVAGDAMHV  245

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             MGPFLGQGG + LEDA+VLARC+     +          E   RI  AL KYV ERR+R+
Sbjct  246   MGPFLGQGGSAGLEDAIVLARCIVQEMPMGPE-GATSDREMVKRIGRALSKYVNERRLRI  304

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
              +LS  +YL G+ + A+S + K+     + +F R+G+ + + YDCG L
Sbjct  305   MRLSTQSYLTGSVIMASSWVKKLVCLAILIVFLRSGSLSHSNYDCGSL  352



>ref|XP_010260971.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nelumbo 
nucifera]
Length=415

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/412 (38%), Positives = 230/412 (56%), Gaps = 21/412 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATALAL + G++S+VLERS+ LR+ G  + + PN WRAL  LG+   L
Sbjct  6     DVVIVGAGIAGLATALALKKVGIRSLVLERSQELRTTGAALTLFPNAWRALQVLGVDHKL  65

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPAGTIRFG  1027
              ++   LQRG    +     Q++ Y +G      + R + R +L+ +LA+ LP GTIRF 
Sbjct  66    TSIYPSLQRGYITNIASGATQEV-YFTGSERKKFEPRAVHRKNLLETLAEELPPGTIRFS  124

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++SS++  +   +    L L +G+ I+A++LIGCDG  S+VA  LGL      G  A R
Sbjct  125   SKLSSIETQTFEGSSIAILHLDDGTQIKAKVLIGCDGVHSVVARWLGLMDPVHSGRSAVR  184

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  YP  H +  + H++    VR G  P++   ++WF+   ++  +G     D   I+Q
Sbjct  185   GLAVYPQGHKVK-DIHQYINNGVRGGFAPLTDKEIYWFIAHNSKPTSG-GMEADPRQIQQ  242

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  D P++  EV+  +E  +LS + L +R P +L+ G++ KG +TVAGDAMH 
Sbjct  243   DVIENSAK--DFPSEYLEVVRHAELSTLSLAPLMFRFPWDLIFGKVFKGNITVAGDAMHP  300

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC++LEDAVVL R LG+       +           +  ALE+Y KERR R 
Sbjct  301   MTPDLGQGGCAALEDAVVLGRHLGNLLLQHGRI-------APGEVAGALERYTKERRWRA  353

Query  312   AQLSMHTYLIG-ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL*PVP  160
             A L M +Y+ G      +  L K         F  +     +YDCG+L   P
Sbjct  354   AGLIMGSYISGWVQQLGSGWLMKFLRDTVFYGFLFSKIVDIDYDCGELPHFP  405



>emb|CDX72750.1| BnaC07g47720D [Brassica napus]
Length=404

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 154/410 (38%), Positives = 227/410 (55%), Gaps = 21/410 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G++S+VLE S  LR+ G       N W+A++ LG+  H+
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIRSMVLESSDKLRATGFAFTTWFNAWKAMEALGVSQHV  67

Query  1188  RTVALPLQRGR--DIFLGEDKEQKI-----EYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R +   LQ      I  G   ++ +     EY S   RC+ R  L+ +LAD LP GTIRF
Sbjct  68    RDLHDLLQGWVVGHISPGNPSKEMLFPKSEEYES---RCVQRKVLLEALADELPQGTIRF  124

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V  ++     K   L  S+G+ ++ ++L+GCDG +S+V + LG K       +A RG
Sbjct  125   SSKVVHIELSGYYKMVHL--SDGTILKTKVLVGCDGVKSVVGKWLGFKNPATTSRLAIRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             LT +P  H    +F + +   VR G +P  H+ V+WF+T    +L  E  P +   IK+ 
Sbjct  183   LTHFPQGHGFGKKFFQFYGNGVRSGFIPCDHNTVYWFLTHTGIELDEETSPEN---IKEF  239

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA+H M
Sbjct  240   VLN---KIKDLPENIKSVVETTDLDSMVMSRLKYRPPWELLWANIAKDNVCVAGDALHPM  296

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P +GQGGCS++ED V+LARCLG A   K   +  ++ ER  RIE+ L+KY  ER+ R  
Sbjct  297   TPDIGQGGCSAMEDGVILARCLGEAIKAKGETE--DEGERYKRIEQGLKKYAGERKWRSI  354

Query  309   QLSMHTYLIGASMAATSKLAKMAFG-GAMALFFRNGAAQNEYDCGQL*PV  163
              L   +Y +G    +T K   +       +        ++ +DCG L P 
Sbjct  355   DLITTSYTVGFIQQSTGKWMNLLRDKFLSSFLSWLLLKKSHFDCGSLVPT  404



>gb|KDO68112.1| hypothetical protein CISIN_1g015061mg [Citrus sinensis]
Length=409

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 157/415 (38%), Positives = 236/415 (57%), Gaps = 22/415 (5%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +IVIVG GI GL T+L L+R G++S+VLE S+ LR  G    V  N W+ALD +GI
Sbjct  2     ESVEDIVIVGAGIAGLTTSLGLYRLGIRSMVLESSESLRVTGFAFTVWTNAWKALDAVGI  61

Query  1200  GSHLRT--------VALPLQRGRDIFLGEDKEQKIE--YVSGDVRCMARNDLIRSLADAL  1051
             G+ LR         VA P   G+      ++  K++  Y   ++RC+ R  L+ +LA  L
Sbjct  62    GNSLRQQHQQLRSIVATPTISGKP---SSERSLKVQGKYGEHEMRCVRRKLLLETLAKEL  118

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTIR+  +V S++      F  L L++G+ ++ ++LIGCDG  SIVA+ LG K     
Sbjct  119   PSGTIRYSSQVVSIEESG--HFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFKNPAFV  176

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G  A RG + +  +H     F + F   +R G +P     ++WF T+ +   + +K   D
Sbjct  177   GRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSS--SQDKELED  234

Query  690   ENA-IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
              +A +KQ V+    KL DLPA+VK VI  +  +S+  S L+YR P E+L G + +G+V V
Sbjct  235   HSAELKQFVLG---KLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISRGSVCV  291

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P +GQGGC++LED +VLARC+  A   K  V   ++EE + R+E  L++Y 
Sbjct  292   AGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEEFNKRVEMGLKRYA  351

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             KERR R  +L    YL+G+   +  K+        +A F      +  ++DCG L
Sbjct  352   KERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLLKKADFDCGNL  406



>ref|XP_006486714.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Citrus sinensis]
Length=409

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 157/415 (38%), Positives = 236/415 (57%), Gaps = 22/415 (5%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +IVIVG GI GL T+L L+R G++S+VLE S+ LR  G    V  N W+ALD +GI
Sbjct  2     ESIEDIVIVGAGIAGLTTSLGLYRLGIRSMVLESSESLRVTGFAFTVWTNAWKALDAVGI  61

Query  1200  GSHLRT--------VALPLQRGRDIFLGEDKEQKIE--YVSGDVRCMARNDLIRSLADAL  1051
             G+ LR         VA P   G+      ++  K++  Y   ++RC+ R  L+ +LA  L
Sbjct  62    GNSLRQQHQQLRSIVATPTISGKP---SSERSLKVQGKYGEHEMRCVRRKLLLETLAKEL  118

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTIR+  +V S++      F  L L++G+ ++ ++LIGCDG  SIVA+ LG K     
Sbjct  119   PSGTIRYSSQVVSIEESG--HFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFKNPAFV  176

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G  A RG + +  +H     F + F   +R G +P     ++WF T+ +   + +K   D
Sbjct  177   GRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSS--SQDKELED  234

Query  690   ENA-IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
              +A +KQ V+    KL DLPA+VK VI  +  +S+  S L+YR P E+L G + +G+V V
Sbjct  235   HSAELKQFVLG---KLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISRGSVCV  291

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P +GQGGC++LED +VLARC+  A   K  V   ++EE + R+E  L++Y 
Sbjct  292   AGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEEFNKRVEMGLKRYA  351

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             KERR R  +L    YL+G+   +  K+        +A F      +  ++DCG L
Sbjct  352   KERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLLKKADFDCGNL  406



>ref|XP_008645820.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Zea mays]
 gb|AFW71844.1| hypothetical protein ZEAMMB73_589629 [Zea mays]
Length=425

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 163/408 (40%), Positives = 234/408 (57%), Gaps = 10/408 (2%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR +GG IGV  NGWR L+QLG+ + 
Sbjct  20    HGIVIVGGGICGLATALALHRKGIASLVLEKSEALRVDGGSIGVHVNGWRVLEQLGVAAE  79

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             LR  A  +    D++  ++K+  +  V  ++R + R DL+ ++A  +PAG IR GC V++
Sbjct  80    LRETANLVTAFHDVW-QDEKKSTLTPVRKELRWLKRKDLLETMAKDIPAGAIRLGCHVTA  138

Query  1011  V---DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV-VATRGLT  844
             +   D   V   T      G  I A++LIGCDG  S+VA+ LG+ P+K        RG T
Sbjct  139   IHPSDPGVVLTTTPAGGGGGGVIRAKVLIGCDGSNSVVAKYLGMSPSKPTPPRTYLRGFT  198

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDENAIKQM  670
             TY + H     F R       VG  P++   V +FV    P+   +      D    +  
Sbjct  199   TYRHGHPFGDRFLRLRGRRFFVGRSPMTDTRVSFFVACHVPSAATSSSSRVVDARDTRHA  258

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             V++ +   Q  PA+V E++  ++P+SL+  + + YRPP ++ L   RKG VTVAGDAMH 
Sbjct  259   VLQKLRD-QRCPAEVVEMVRDADPDSLNVVTRVWYRPPWQVALAAFRKGAVTVAGDAMHA  317

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMR  316
             MG ++GQGG ++LEDA+VLAR L  A A          +E        A+ +YV+ERR+R
Sbjct  318   MGSYIGQGGSAALEDALVLARSLARARAAAAGGRDDGDDEPFLLGAATAIREYVRERRLR  377

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             VA+LS+  +++G  + A S   K+A    +AL          YDCG+L
Sbjct  378   VARLSLEAFVMGELLRAKSMATKLACMAILALLGTKALGHTNYDCGRL  425



>ref|XP_010526550.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Tarenaya 
hassleriana]
Length=433

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 158/412 (38%), Positives = 218/412 (53%), Gaps = 29/412 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TAL LHR+G++S VLE  + LR  G  +    N W+ALD LG+   L
Sbjct  33    DIVIVGAGIAGLSTALGLHRQGIRSKVLESYEDLRVTGSALTTWFNAWKALDALGLSPAL  92

Query  1188  R------------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R            +V       R +  G+ +E        + RC+ R  L+  LA  LP 
Sbjct  93    RPSHHRLHGIAVGSVVAGNHPSRQLLFGQSQEH-------EARCLQRKLLLECLARELPP  145

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIRF  +V S+    + K   L  ++G+ ++  +L+GC+G  SIVA  LG K       
Sbjct  146   GTIRFSSKVVSIQLSGLFKLVHL--ADGTVLKTRVLVGCEGVNSIVARWLGFKNPVTTAR  203

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
              A RGLT +PNAH      H+     VR G +P +   V+WF+T    Q   E  P    
Sbjct  204   SAIRGLTHFPNAHGFGNTIHQFLGNGVRSGFIPCNDHTVYWFLTHTPTQPDEETNP---T  260

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +KQ V++   KL+DLP  VK ++  ++  S+  S LKYRPP E+L   + K  V VAGD
Sbjct  261   KLKQFVLD---KLKDLPDNVKGIVEDTDLSSIVMSRLKYRPPWEILWANITKDNVCVAGD  317

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             A+H M P +GQGGCS+LED VVLARCLG A    NN+ G  +EER   IE  L KY  ER
Sbjct  318   ALHPMTPDIGQGGCSALEDGVVLARCLGEALRA-NNLKGDTEEERYRGIENGLRKYASER  376

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             + R   L    Y++G    +  K   +     ++ F  R    ++ +DCG+L
Sbjct  377   KWRSIDLITTAYMVGFIQESRGKWTNLIRDKLLSSFLSRMLLKKSHFDCGKL  428



>ref|XP_010466864.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=406

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 154/420 (37%), Positives = 234/420 (56%), Gaps = 29/420 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME+ +S  +I+IVG GI GLATAL LHR G++SIVLE S+ LR+ G  I +  N W+A++
Sbjct  1     MEAEESTQDIIIVGAGISGLATALGLHRLGIRSIVLESSENLRATGFAISLYFNAWKAME  60

Query  1212  QLGIGSHLRT--------VALPLQRG---RDIFLGEDKEQKIEYVSGDVRCMARNDLIRS  1066
              LGI  ++R+        V  P+  G   +++F  E +E        +VRC+ R  L+ +
Sbjct  61    ALGISENVRSLGDRFQGWVVTPISSGNPPKEMFFPESEEY-------EVRCVQRKSLLEA  113

Query  1065  LADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
             LA  LP GTIRF  ++  V  +    +  + LS+G+ ++ ++L+GCDG  S+V + LG K
Sbjct  114   LAGELPDGTIRFSSKL--VHIELFGHYKMVHLSDGTILKTKVLVGCDGVNSVVGKWLGFK  171

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
                +    A  GLT +P  H L   F + F   +R G +    + V+WF+T  + ++   
Sbjct  172   NPVKSPRFAILGLTHFPTGHGLGRRFFQFFGNGIRYGFISCDKNTVYWFLTHTSTEID--  229

Query  705   KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKG  526
                ++   IKQ V+    K++DLP  +K +   ++ +SL  S LKYRPP ELL   + K 
Sbjct  230   --KKNREKIKQFVVT---KIKDLPDNIKSIAETADLDSLVMSRLKYRPPWELLWANIAKD  284

Query  525   TVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEA  349
              V VAGDA+H M P +GQGG S++ED V+LARCLG A   KN     E EE S  RIE+ 
Sbjct  285   NVCVAGDALHPMTPDIGQGGSSAMEDGVILARCLGEAMKAKNPKGETEDEEESYKRIEDG  344

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
             L+KYV++R+ R   L   +Y +G    +  K   +     ++ F       ++ ++CG L
Sbjct  345   LKKYVRDRKWRSIDLIATSYTVGFIQQSGWKWLTLFRDKFLSSFLSWLLMKKSHFNCGSL  404



>ref|XP_007032110.1| Monooxygenase, putative isoform 2 [Theobroma cacao]
 gb|EOY03036.1| Monooxygenase, putative isoform 2 [Theobroma cacao]
Length=358

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 222/386 (58%), Gaps = 41/386 (11%)
 Frame = -2

Query  1311  RKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGRDIFL--GE  1138
             RKG+++IVLERS+ LR+ G  I V PNGWRALDQLGI S LR  A+ +Q GR I +  G+
Sbjct  8     RKGIETIVLERSENLRATGAAIIVQPNGWRALDQLGIASKLRQTAVSIQSGRYITVKDGK  67

Query  1137  DKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR-FGCEVSSVDYDSVTKFTRLLLSNG  961
              K+  + Y    ++    N  IRSL + LP  +I  + C                  +NG
Sbjct  68    QKDLPVGYCPPRMQGGVHN--IRSL-NVLPDSSIAGWKC------------------ANG  106

Query  960   SYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVR  781
                  E++IGCDG  S +A +LGL   + F     RG T Y   H     F    K DV+
Sbjct  107   Q----EVVIGCDGVNSTIANILGLNSTRLFSTSVIRGFTNYETGHEFGSAFLVFSKDDVQ  162

Query  780   VGILPISHDLVHWFVTFPTRQLTGE--KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHL  607
             +G+LP++  LV+WFVT   R+ T +  K  + +  IK+     +E ++  P  + E++  
Sbjct  163   LGLLPVTEKLVYWFVT---RKQTSQDSKVSKSQTLIKE---STVEAMKGFPIHIMEMVKD  216

Query  606   SEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARC  427
             S+ +SL  + L++  P +LL   LR+GTVTVAGDAMH M PFL QGG +SLEDAVVLARC
Sbjct  217   SDLDSLHLTDLRFLAPWDLLGTNLRRGTVTVAGDAMHAMAPFLAQGGSASLEDAVVLARC  276

Query  426   LGSAAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLA  250
             L     ++  VD  EK+ ++   +E AL++YVKER+MRV  LS+ T+LIG  +  ++ L 
Sbjct  277   LSQNQTMR--VD--EKQAKTMMDMEAALDQYVKERKMRVFWLSLETFLIGTMLDTSTLLV  332

Query  249   KMAFGGAMALFFRNGAAQNEYDCGQL  172
             K     ++ + FR+  A   YDCG+L
Sbjct  333   KCLCIISLMVLFRDKIAHTRYDCGRL  358



>ref|XP_010930388.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Elaeis guineensis]
Length=336

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/341 (40%), Positives = 201/341 (59%), Gaps = 8/341 (2%)
 Frame = -2

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             LR  A+PL   RD++L ++K Q        +RC+ R+DLI SLA  LP G+IRFGC++ +
Sbjct  3     LRRKAIPLTEIRDMWLHKNKMQVTSCRKEALRCLKRSDLIESLAKNLPVGSIRFGCQIVA  62

Query  1011  VDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPN  832
             V+ D ++ F  L  ++G+ I+A++LIGCDG  S+VA+ LGL+  K   + A R  T+Y +
Sbjct  63    VELDPLSSFPILYANDGATIKAKVLIGCDGSNSVVAKSLGLQAPKVCPISAVRAFTSYSD  122

Query  831   AHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIE  652
              HS    F R     V +G +P+   LV+WFV+        +   +D   IK++ +E   
Sbjct  123   GHSFDSHFIRLSGDGVLLGRVPVDEKLVYWFVSV---LCPSQDVQKDHELIKKVTLET--  177

Query  651   KLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQ  472
              L++ P +V E++   +  SLS +H+ YR P  L      + T+TVAGDAMHVMGPFLGQ
Sbjct  178   -LKEFPTEVIEMVKHCDSSSLSLTHIWYRAPWHLFFANFWQRTMTVAGDAMHVMGPFLGQ  236

Query  471   GGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHT  292
             GG + LEDA+VLARC+     +          E   RI  AL KYV ERR+R+ +LS  +
Sbjct  237   GGSAGLEDAIVLARCIVQEMPMGPE-GATSDREMVKRIGRALSKYVNERRLRIMRLSTQS  295

Query  291   YLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
             YL G+ + A+S + K+     + +F R+G+ + + YDCG L
Sbjct  296   YLTGSVIMASSWVKKLVCLAILIVFLRSGSLSHSNYDCGSL  336



>ref|XP_006422567.1| hypothetical protein CICLE_v10028550mg [Citrus clementina]
 gb|ESR35807.1| hypothetical protein CICLE_v10028550mg [Citrus clementina]
Length=409

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 156/415 (38%), Positives = 235/415 (57%), Gaps = 22/415 (5%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +IVIVG GI GL T+L L+R G++S+VLE S+ LR  G    V  N W+ALD +GI
Sbjct  2     ESVEDIVIVGAGIAGLTTSLGLYRLGIRSMVLESSESLRVTGFAFTVWTNAWKALDAVGI  61

Query  1200  GSHLRT--------VALPLQRGRDIFLGEDKEQKIE--YVSGDVRCMARNDLIRSLADAL  1051
             G+ LR         VA P   G+      ++  K++  Y   ++RC+ R  L+ +LA  L
Sbjct  62    GNSLRQQHQQLRSIVATPTISGKP---SSERSLKVQGKYGEHEMRCVRRKLLLETLAKEL  118

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTIR+  +V S++      F  L L++G+ ++ ++LIGCDG  SIVA+ LG K     
Sbjct  119   PSGTIRYSSQVVSIEESG--HFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFKNPAFV  176

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G  A RG + +  +H     F + F   +R G +P     ++WF T+ +   + +K   D
Sbjct  177   GRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSS--SQDKELED  234

Query  690   ENA-IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
              +A +KQ V+    KL DLPA+VK VI  +  +S+  S L+YR P E+L G + +G+V V
Sbjct  235   HSAELKQFVLG---KLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISRGSVCV  291

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P +GQGGC++LED +VLARC+  A   K  V   ++E  + R+E  L++Y 
Sbjct  292   AGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEGFNKRVEMGLKRYA  351

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             KERR R  +L    YL+G+   +  K+        +A F      +  ++DCG L
Sbjct  352   KERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLLKKADFDCGNL  406



>ref|XP_008807125.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Phoenix dactylifera]
Length=405

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 149/376 (40%), Positives = 215/376 (57%), Gaps = 26/376 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VI+G GI GLATAL LHRKG++S+VLE S+ LR+ G GI    N WRALD LG+G  L
Sbjct  6     DVVIIGAGIAGLATALGLHRKGVRSLVLESSESLRAAGFGITTWTNAWRALDALGVGDSL  65

Query  1188  R------------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R            + A   +     F+   K  + E     VRC+ RN L+ +L + LP 
Sbjct  66    RQSHDRIQGVTATSAASGARTSNSAFMARGKIGERE-----VRCLRRNILLETLENELPL  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+R+  +V++++ D    F  L L++GS ++ ++LIGCDG  S+VA  LGLK     G 
Sbjct  121   GTVRYSSKVAAIEEDGY--FKLLHLADGSTLKTKVLIGCDGVNSVVARWLGLKKPAFTGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
              A+RG   +PN H    E  ++F    R G+LP +  +V+WF T+ P+ Q   ++     
Sbjct  179   SASRGFAEFPNGHGFKPEAMQYFGEGFRTGLLPCNERMVYWFFTWTPSEQ--EKEVEESA  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               +KQ ++  + K   +P +   VI +SE  +   + L+YR    LL G + KG V VAG
Sbjct  237   TKMKQYMLSKL-KHSKVPEEFIHVIEISELSNPVSAQLRYRWQFSLLWGNISKGNVCVAG  295

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKE  328
             DA H M P LGQGGCS+LED++VLARCL  A   ++N      E    +I++ LEKY +E
Sbjct  296   DAFHPMTPDLGQGGCSALEDSIVLARCLSEALLAEHNGGA---EGGYDKIKKGLEKYARE  352

Query  327   RRMRVAQLSMHTYLIG  280
             RR R  QL   +Y++G
Sbjct  353   RRWRSFQLIATSYVVG  368



>ref|XP_010466863.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=412

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 156/415 (38%), Positives = 222/415 (53%), Gaps = 30/415 (7%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              +IVIVG GI GLATAL LHR G++S VLE S+ LR+ G  +    N W+AL+ LGI  H
Sbjct  6     QDIVIVGAGISGLATALGLHRLGIRSTVLESSEKLRATGFALSFYFNAWKALEALGISQH  65

Query  1191  LRTVALPLQRG-----------RDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             LR     LQ             +++ L E +E        +VRC+ R  L+ +LA  LP 
Sbjct  66    LRNHHDRLQGWMVGSISAENPPKEMLLPESEEY-------EVRCVHRKMLLEALAGELPE  118

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIRF  +V  ++     K   L  S+G+ ++ ++L+GCDG  S+V + LG K       
Sbjct  119   GTIRFLSKVVHIELSGHYKIVHL--SDGTTLKTKVLVGCDGVNSVVGKWLGFKSPASTAR  176

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
             +  RGL  +P  H     F + +   VR G +P   + V+WF+T  +  L  E  P +  
Sbjct  177   LGIRGLAHFPTGHGFEKRFFQFYGNGVRSGFVPCDQNSVYWFLTHTSTSLAEETNPEN--  234

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              IKQ V+  I   +DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGD
Sbjct  235   -IKQFVLNMI---KDLPKYIKSVVETTDLDSMVMSRLKYRPPWELLWANIAKDNVCVAGD  290

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDG---IEKEERSARIEEALEKYV  334
             A+H M P +GQGGCS++ED V+LARCLG A   KN++ G    ++ E   RIE  L+KY 
Sbjct  291   ALHPMTPDIGQGGCSAMEDGVILARCLGEAIKFKNDLMGETEDDQNESYKRIEVGLKKYA  350

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             +ER+ R   L +  Y +G    +  K   +     +  F  R     + +DCG L
Sbjct  351   RERKWRSIDLIIAAYTVGFIQQSRGKWMNLFTDRFLRSFLSRLRLKMSHFDCGSL  405



>ref|XP_006851406.1| hypothetical protein AMTR_s00040p00065120 [Amborella trichopoda]
 gb|ERN12987.1| hypothetical protein AMTR_s00040p00065120 [Amborella trichopoda]
Length=409

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 232/412 (56%), Gaps = 23/412 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSI-VLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             ++VIVGGGI GLATALAL R G+  + VLE++  LR+ G  + + PN WRAL+ LG+   
Sbjct  7     DVVIVGGGIAGLATALALKRVGINGVLVLEKADELRATGSALTLFPNAWRALNALGVAHK  66

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVSGD-------VRCMARNDLIRSLADALPAGTIR  1033
             L  +  P+QRG    +       +  V GD       VRC+ R  L+++LAD LP+ TIR
Sbjct  67    LAPLYPPIQRGSVTLISSGVTLPLS-VPGDNDGNGMGVRCVHRKALLQALADELPSRTIR  125

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             FGC V+S++  S + F  + L +GS I+ ++LIGCDG  S+VA+ LGL      G +A R
Sbjct  126   FGCHVASIETLSDSSFALIRLGDGSSIKTKVLIGCDGVNSVVAQWLGLSAPVLAGRLAVR  185

Query  852   GLTTY-PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK  676
             GL +Y  + H L  E  +     ++ GI+P++   ++WF+T+ +     E   + E   K
Sbjct  186   GLASYGGHGHKLGHEALQFVGDGLKGGIVPVNDHELYWFLTYKSTPQEVELVGQPELIRK  245

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
              +  +  EK    P K  E+I  ++  +L+ + LK R P +L+   L +G V VAGD MH
Sbjct  246   SVAEKTAEK---FPTKFSEIIRNTDLSTLTLAQLKLRCPWDLIFRDLTRGNVAVAGDGMH  302

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
              M P LGQGGCS+LEDA+ L R LG A   +NN DG       + +EE+L+KY +ER+ R
Sbjct  303   PMTPDLGQGGCSALEDAIFLGRNLGEAFQ-RNNFDG-------SSVEESLKKYARERKWR  354

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL*PV  163
              A L   +Y  G          ++     ++ +F+  G    +YDCG+L PV
Sbjct  355   AAGLISASYFSGWIQGHNGWFVQLVRDKLLSKIFYSRGVRSLDYDCGEL-PV  405



>ref|XP_009101939.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brassica rapa]
 emb|CDY65009.1| BnaA06g40840D [Brassica napus]
Length=401

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 155/410 (38%), Positives = 223/410 (54%), Gaps = 24/410 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G++S+VLE S  LR+ G       N W+A++ LG+  H+
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIRSMVLESSDKLRATGFAFTTWFNAWKAMEALGVSQHV  67

Query  1188  RTVALPLQRGR--DIFLGEDKEQKI-----EYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R +   LQ      I  G   ++ +     EY S   RC+ R  L+ +LAD LP GTIRF
Sbjct  68    RDLHDLLQGWVVGHISPGNPSKEMLFPKSEEYES---RCVQRKVLLEALADELPQGTIRF  124

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V  ++     K   L  S+G+ ++ ++L+GCDG  S+V + LG K       +A RG
Sbjct  125   SSKVVHIELSGYYKMVHL--SDGTILKTKVLVGCDGVNSVVGKWLGFKNPATTSRLAIRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             LT +P  H    +F + +   VR G +P  H+ V+WF+T    +L  E  P     IK+ 
Sbjct  183   LTHFPQGHGFGKKFFQFYGNGVRSGFIPCDHNTVYWFLTHTCTELDEETSPE---TIKEF  239

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA+H M
Sbjct  240   VLN---KIKDLPDNIKSVVETTDLDSMVMSRLKYRPPWELLWANIAKDNVCVAGDALHPM  296

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P +GQGGCS++ED V+LARCLG A   K      E  E   RIE+ L+KY  ER+ R  
Sbjct  297   TPDIGQGGCSAMEDGVILARCLGEAIKAKG-----ETGECYKRIEQGLKKYAGERKWRSI  351

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAA-QNEYDCGQL*PV  163
              L    Y +G    +T K   +     ++ F       ++ +DCG L P 
Sbjct  352   DLITTAYTVGFIQQSTGKWMNLLRDKFLSSFLSRLLLKKSHFDCGSLVPT  401



>ref|XP_008786383.1| PREDICTED: uncharacterized protein LOC103704750 [Phoenix dactylifera]
Length=343

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 210/360 (58%), Gaps = 24/360 (7%)
 Frame = -2

Query  1233  NGWRALDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
             NGW ALD+LG+G  LR  ++P+   ++ +  +   Q       D RC+ R DLI+ L D 
Sbjct  2     NGWCALDRLGVGGVLRDKSIPIPVIQEAWHHKSTVQVKSSRVEDFRCLKRTDLIQVLFDN  61

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LPAG++R GC++ +V+ DS T F  L           +LIGCDG  SI+++ LGL     
Sbjct  62    LPAGSVRLGCQIVAVEGDSSTSFPILY----------VLIGCDGSNSIISKSLGLGALNS  111

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHF-KGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
                   RGLT YPN H L   F R+   G +  G +PI   LVHWFV +P        +P
Sbjct  112   LPNCVIRGLTNYPNGHDLERCFLRNLDNGYMAFGRIPIDDKLVHWFVDWP--------YP  163

Query  696   -RDENAIK--QMVIE-NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRK  529
              RD +A K  + ++E  +++++D PA++ E++  S P SL+ + ++YR P  L+ G  R+
Sbjct  164   DRDTDASKDPKFIMELAMQQIKDYPAEMIEMVESSNPSSLNLTRIRYRSPWHLVFGNFRR  223

Query  528   GTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEA  349
             GT+TVAGDAMH+MGPFLGQGGC +LEDAVVLAR L  A  +      +   E   RIE A
Sbjct  224   GTMTVAGDAMHMMGPFLGQGGCVALEDAVVLARNLAEAMPMGLEGGRVGDGELKKRIEAA  283

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA-AQNEYDCGQL  172
              E YVKER+ RV +L+M + L+G  +++ SK+ ++     + +FF   + +   YDCG L
Sbjct  284   FENYVKERKPRVLRLAMQSMLVGMLISSPSKIKRLLSLALLVVFFGGASLSYTRYDCGPL  343



>ref|XP_010920086.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
 ref|XP_010920087.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=405

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 217/375 (58%), Gaps = 16/375 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  ++VI+G GI GLATAL LHR G++S+VLE S  LR+ G G+    N WRALD LG+
Sbjct  2     ETVEDVVIIGAGIAGLATALGLHRMGVRSLVLESSDSLRAAGFGLATWNNAWRALDALGV  61

Query  1200  GSHLRTVALPLQRGR--DIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADALPAG  1042
             G  LR   + LQ         G    Q      G     +VRC+ RN L+ +L   LP G
Sbjct  62    GDSLRQSHVRLQGATVASATSGATTSQLTFTTQGKSGEHEVRCLRRNILLETLEKELPLG  121

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             T+R+  +V++++ D    F  L L++GS ++ ++LIGCDG  S+VA+ LGLK        
Sbjct  122   TVRYSSKVAAIEEDGY--FKLLHLADGSTLKTKVLIGCDGVNSVVAKWLGLKKPAFTERS  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDEN  685
             A+RG T +PN H L +EF ++F    R G+LP     ++WF T+ P+ Q   ++  +   
Sbjct  180   ASRGFTEFPNGHGLKLEFVQYFGEGFRTGLLPCDEKTIYWFFTWIPSEQ--EKEVEQSAT  237

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +KQ ++  + K   +P +   +I +S+  +   + L+YR P  LL G + K  V VAGD
Sbjct  238   KMKQYILSKL-KHSSVPEEFIHIIEISDLSNPVSAQLRYRWPFSLLWGDISKENVCVAGD  296

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             A H M P LGQGGCS+LED++VLARCL  A   ++N  G E E    +IE+ LEKY KER
Sbjct  297   AFHPMTPDLGQGGCSALEDSIVLARCLSEALLGEHN-GGAEVE--YDKIEKGLEKYSKER  353

Query  324   RMRVAQLSMHTYLIG  280
             R R  +L    Y++G
Sbjct  354   RWRSFKLIATAYVVG  368



>ref|XP_006411647.1| hypothetical protein EUTSA_v10025344mg [Eutrema salsugineum]
 gb|ESQ53100.1| hypothetical protein EUTSA_v10025344mg [Eutrema salsugineum]
Length=407

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 162/431 (38%), Positives = 236/431 (55%), Gaps = 46/431 (11%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME  D++ +IVIVG GI GL+TA+ LHR G+ S+VLE S +LR+ G       N W+A++
Sbjct  1     MEEEDTR-DIVIVGAGISGLSTAVGLHRLGISSMVLESSDMLRATGFAFTTWFNAWKAME  59

Query  1212  QLGIGSHLRT--------VALPLQRG---RDIFLGEDKEQKIEYVSGDVRCMARNDLIRS  1066
              LGI  H+R+        V  P+  G   R++   E +E        + RC+ R  L+ +
Sbjct  60    ALGISEHIRSLHDRLQGWVVGPISAGNPSREMLFPESEEY-------ESRCVQRKLLLEA  112

Query  1065  LADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
             LAD LP GTIRF  +V  ++     K   L  S+G+ ++ ++L+GCDG  S+V + LG K
Sbjct  113   LADELPQGTIRFSSKVVHIELSGHYKMVHL--SDGTILKTKVLVGCDGVNSVVGKWLGFK  170

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
                    +A RGLT +P  H    +F + +   VR G +P  H+ V+WF+T  + +L  +
Sbjct  171   NPATTARLAIRGLTHFPAGHGFGSKFFQFYGNGVRSGFIPCDHNTVYWFLTHTSAELDED  230

Query  705   KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKG  526
               P +   IK+ V++   K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K 
Sbjct  231   TNPEN---IKEFVLK---KIKDLPENIKSVVETTDLDSVVMSRLKYRPPWELLWANIAKY  284

Query  525   TVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSA--RIEE  352
              V VAGDA+H M P +GQGGCS++ED V+LARCLG A   KN     E +E  +  RIEE
Sbjct  285   NVCVAGDALHPMTPDIGQGGCSAMEDGVILARCLGEAIKAKNVKGETEDDEDESYKRIEE  344

Query  351   ALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF---------FRNGAA  199
              L+KY  ER+ R   L    Y +G    +T K         M+LF          R    
Sbjct  345   GLKKYAGERKWRSIDLITTAYTVGFIQQSTGKW--------MSLFRDKFLSSFLSRLLLK  396

Query  198   QNEYDCGQL*P  166
             ++ +DCG L P
Sbjct  397   KSHFDCGSLVP  407



>ref|XP_008807123.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Phoenix dactylifera]
Length=406

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 214/376 (57%), Gaps = 26/376 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VI+G GI GLATAL LHRKG++ +VLE S+ LR+ G G+    N WRALD LG+G  L
Sbjct  7     DVVIIGAGIAGLATALGLHRKGVRILVLESSESLRAAGFGLVAWTNAWRALDTLGVGDSL  66

Query  1188  RTVALPLQ------------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R   + LQ                 F+   K  + E     VRC+ RN L+ +L + LP 
Sbjct  67    RQSHVRLQGVTATSAASGARTSNSAFMARGKIGERE-----VRCLRRNILLETLENELPL  121

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+R+  +V++++ D    F  L L++GS ++ ++LIGCDG  S+VA  LGLK     G 
Sbjct  122   GTVRYSSKVAAIEEDGY--FKLLHLADGSTLKTKVLIGCDGVNSVVARWLGLKKPAFTGR  179

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
              A+RG   +PN H    E  ++F    R G+LP +  +V+WF T+ P+ Q   ++     
Sbjct  180   SASRGFAEFPNGHGFKPEAMQYFGEGFRTGLLPCNERMVYWFFTWTPSEQ--EKEVEESA  237

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               +KQ ++  + K   +P +   VI +SE  +   + L+YR    LL G + KG V VAG
Sbjct  238   TKMKQYMLSKL-KHSKVPEEFIHVIEISELSNPVSAQLRYRWQFSLLWGNISKGNVCVAG  296

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKE  328
             DA H M P LGQGGCS+LED++VLARCL  A   ++N      E    +I++ LEKY +E
Sbjct  297   DAFHPMTPDLGQGGCSALEDSIVLARCLSEALLAEHNGGA---EGGYDKIKKGLEKYARE  353

Query  327   RRMRVAQLSMHTYLIG  280
             RR R  QL   +Y++G
Sbjct  354   RRWRSFQLIATSYVVG  369



>ref|XP_010028757.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Eucalyptus grandis]
Length=406

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 159/411 (39%), Positives = 221/411 (54%), Gaps = 17/411 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  +IVIVG GI GL TAL LHR G++S+VLE S  LR+ G       N WRALD LGI
Sbjct  2     EAVEDIVIVGAGIAGLTTALGLHRLGIRSLVLESSDGLRTTGFAFTTWTNAWRALDALGI  61

Query  1200  GSHLR---TVALPLQRGRDIFLGEDKEQKIEYVSG----DVRCMARNDLIRSLADALPAG  1042
             G  LR        LQ    IF     E++ +        +VR + R  L+ +LA+ LP+G
Sbjct  62    GEPLRQQHNQLFGLQLTSTIFGISTAERQFDATGTRRGHEVRGVQRRTLLETLANELPSG  121

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIR+  +V S++     K   L  S+GS ++A+ LIGCDG  S VA+ LG K     G  
Sbjct  122   TIRYSSKVVSIEESGFLKLVHL--SDGSILKAKALIGCDGVNSAVAKWLGFKKPAFVGRS  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RG   Y ++HS   +F + F   VR G +P     ++WF TF +     E+       
Sbjct  180   AIRGCVYYDHSHSFEPKFSQFFGEGVRFGFMPCDDKTIYWFFTFYSSS-KDEEMEESPAK  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +KQ +++   KL  +P  V+ V   +E +++  S LK+RPP E+L G + K  V V GDA
Sbjct  239   MKQFMLQ---KLGKIPDNVRAVFEKTELDNIILSPLKFRPPWEILWGNISKTNVCVTGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
              H M P +GQGGCS+LED VVLARCLG   A+++N   +  EE   RIE  L +Y KERR
Sbjct  296   FHPMTPDIGQGGCSALEDGVVLARCLGE--ALRDN-QSMSSEEEYKRIEMGLRRYAKERR  352

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
              R  +L    Y++G     + K+        +A F  R       +DCG+L
Sbjct  353   WRAFELISTAYMVGYIQQGSGKVLNFLRDRVLATFLARQLLKMASFDCGKL  403



>gb|KDO68113.1| hypothetical protein CISIN_1g015061mg [Citrus sinensis]
Length=414

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/420 (37%), Positives = 236/420 (56%), Gaps = 27/420 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHR-----KGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             +S  +IVIVG GI GL T+L L+R      G++S+VLE S+ LR  G    V  N W+AL
Sbjct  2     ESVEDIVIVGAGIAGLTTSLGLYRFKTKKLGIRSMVLESSESLRVTGFAFTVWTNAWKAL  61

Query  1215  DQLGIGSHLRT--------VALPLQRGRDIFLGEDKEQKIE--YVSGDVRCMARNDLIRS  1066
             D +GIG+ LR         VA P   G+      ++  K++  Y   ++RC+ R  L+ +
Sbjct  62    DAVGIGNSLRQQHQQLRSIVATPTISGKP---SSERSLKVQGKYGEHEMRCVRRKLLLET  118

Query  1065  LADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
             LA  LP+GTIR+  +V S++      F  L L++G+ ++ ++LIGCDG  SIVA+ LG K
Sbjct  119   LAKELPSGTIRYSSQVVSIEESG--HFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFK  176

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
                  G  A RG + +  +H     F + F   +R G +P     ++WF T+ +   + +
Sbjct  177   NPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSS--SQD  234

Query  705   KFPRDENA-IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRK  529
             K   D +A +KQ V+    KL DLPA+VK VI  +  +S+  S L+YR P E+L G + +
Sbjct  235   KELEDHSAELKQFVLG---KLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISR  291

Query  528   GTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEA  349
             G+V VAGDA+H M P +GQGGC++LED +VLARC+  A   K  V   ++EE + R+E  
Sbjct  292   GSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEEFNKRVEMG  351

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             L++Y KERR R  +L    YL+G+   +  K+        +A F      +  ++DCG L
Sbjct  352   LKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLLKKADFDCGNL  411



>ref|XP_009408212.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 224/408 (55%), Gaps = 15/408 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IV+VG GI GLA AL LHR GL+S+VLE S  LR+ G  I    N WRALD LG+G  L
Sbjct  6     DIVVVGAGIAGLAVALGLHRSGLRSLVLESSDSLRASGFAITTWTNAWRALDALGVGDAL  65

Query  1188  RT--------VALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             R         VA     G        + +       +VRC+ RN L+ +LA  LP GTIR
Sbjct  66    RQQHVRLEQLVAFSASSGSVTTRLSLRARGKHIGKHEVRCLKRNLLVEALAQELPHGTIR  125

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             +  +V SV+     K   L L++GS + A++LIGCDG  S+VA+ LGLK     G  A R
Sbjct  126   YSSKVVSVEEAGTVKL--LHLADGSTLRAKVLIGCDGVNSVVAKWLGLKVPAFAGRYAAR  183

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G+ T+P+ H++  EF +HF    R G+LP     V+WF T+ T     ++  +D   +++
Sbjct  184   GIATFPDGHAINPEFAQHFGTGYRSGMLPCDKKSVYWFFTW-TSDGEDKEMRKDAARVRE  242

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V+  + K   +P +V  VI  SE   ++ S L+YR P  LL G + KG V V GDA H 
Sbjct  243   FVLSKM-KTAKVPEEVLHVIERSELSGVASSPLRYRSPLNLLWGDISKGNVCVTGDAFHP  301

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LG+GGC++LED VVLA+CL  A A+        +E+ S RIE AL KY   RR R 
Sbjct  302   MTPDLGEGGCAALEDGVVLAKCL--AQALIGAGQERSEEDESRRIEAALRKYANARRWRN  359

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
               L + ++++G      + +  M     ++ L  +   ++ +++CG L
Sbjct  360   LDLVVTSFVVGFIQEGGNWVMNMMRDEVLSGLLAKKLLSEADFECGNL  407



>ref|XP_010910536.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=405

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 226/415 (54%), Gaps = 31/415 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VI+G GI GLATAL LHRKG++S+VLE S+ LR+ G G+ +  N WRALD LG+G  L
Sbjct  6     DVVIIGAGIAGLATALGLHRKGVRSLVLESSETLRAAGFGLSIWTNAWRALDALGVGDSL  65

Query  1188  RTVALPL------------QRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R   + L            +     F+ + K  + E     VRC+ RN L+ +L   LP 
Sbjct  66    RQSHVRLRGVTAISATSGARASNSAFMAQGKSGEHE-----VRCLRRNMLLETLEKELPR  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+RF  +V +++ D    F  L L++GS ++ ++LIGCDG  S+VA+ LGL      G 
Sbjct  121   GTVRFSSKVVAIEEDGY--FKLLHLADGSTVKTKVLIGCDGVNSVVAKWLGLNKPIFTGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
              A+RG   +PN H    E  + F    R G+LP +  +V+WF T+ T     ++      
Sbjct  179   SASRGFAEFPNGHGFKPEAMQCFGEGFRTGVLPCNERIVYWFFTW-TPSEKEKEVEESPT  237

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +KQ ++  + K   +P ++   I +SE      + L+YR P  LL G + KG V VAGD
Sbjct  238   KMKQYMLSKL-KHSKVPEELIHGIEISELSDPVSAPLRYRWPFSLLWGDISKGNVCVAGD  296

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             A H M P LGQGGCS+LED++VLARCLG   A+    DG  K E   +I+E LEKY KER
Sbjct  297   AFHPMTPDLGQGGCSALEDSIVLARCLGE--ALLGEHDGGAKGEYD-KIKEGLEKYAKER  353

Query  324   RMRVAQLSMHTYLIGASMAATSK----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             R R  QL    Y++G    + S     L      G M+      A   ++DCG L
Sbjct  354   RWRSFQLITIAYVLGRIQQSESTIVGYLRDKWLSGTMSRLLLERA---DFDCGML  405



>ref|XP_006486713.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=414

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/420 (37%), Positives = 236/420 (56%), Gaps = 27/420 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHR-----KGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             +S  +IVIVG GI GL T+L L+R      G++S+VLE S+ LR  G    V  N W+AL
Sbjct  2     ESIEDIVIVGAGIAGLTTSLGLYRFKTKKLGIRSMVLESSESLRVTGFAFTVWTNAWKAL  61

Query  1215  DQLGIGSHLRT--------VALPLQRGRDIFLGEDKEQKIE--YVSGDVRCMARNDLIRS  1066
             D +GIG+ LR         VA P   G+      ++  K++  Y   ++RC+ R  L+ +
Sbjct  62    DAVGIGNSLRQQHQQLRSIVATPTISGKP---SSERSLKVQGKYGEHEMRCVRRKLLLET  118

Query  1065  LADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
             LA  LP+GTIR+  +V S++      F  L L++G+ ++ ++LIGCDG  SIVA+ LG K
Sbjct  119   LAKELPSGTIRYSSQVVSIEESG--HFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFK  176

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
                  G  A RG + +  +H     F + F   +R G +P     ++WF T+ +   + +
Sbjct  177   NPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSS--SQD  234

Query  705   KFPRDENA-IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRK  529
             K   D +A +KQ V+    KL DLPA+VK VI  +  +S+  S L+YR P E+L G + +
Sbjct  235   KELEDHSAELKQFVLG---KLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISR  291

Query  528   GTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEA  349
             G+V VAGDA+H M P +GQGGC++LED +VLARC+  A   K  V   ++EE + R+E  
Sbjct  292   GSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEEFNKRVEMG  351

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             L++Y KERR R  +L    YL+G+   +  K+        +A F      +  ++DCG L
Sbjct  352   LKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLLKKADFDCGNL  411



>gb|EYU36808.1| hypothetical protein MIMGU_mgv1a007451mg [Erythranthe guttata]
Length=407

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 152/408 (37%), Positives = 218/408 (53%), Gaps = 17/408 (4%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              +IVIVG GI GLATAL LHR G++S+VLE S+ LR  G  + +  N WRALD LGIG  
Sbjct  5     EDIVIVGAGIAGLATALGLHRFGIRSLVLESSESLRLTGFALAMWTNAWRALDALGIGDV  64

Query  1191  LRTVALPLQ-----RGRDIFLGEDKEQKIEYVSG--DVRCMARNDLIRSLADALPAGTIR  1033
             LR  AL +Q             ++        SG  ++RC+ R DL+ +L   LP GT+R
Sbjct  65    LRATALQIQAFEISSFNSNLPSQEPSPNSNLNSGKTELRCVRRKDLLETLERELPQGTVR  124

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             +  ++ S++      F  L L++GS    ++LIGCDG  S+VA+ LGLK     G  A R
Sbjct  125   YSSKIVSIEESG--NFKLLHLADGSVFRTKVLIGCDGVNSMVAKWLGLKDPINTGRSAIR  182

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G   YP  H    +FH +F G VR G +P     ++WF TF       ++   +   +KQ
Sbjct  183   GYVVYPTNHGYEPKFHAYFGGGVRYGFVPCDDKSLYWFCTFSPSLFKYDENENNPLKMKQ  242

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V+ +I   +D P  V +V+  +  + +S++HL+ R P  LL G + K  V V GDA+H 
Sbjct  243   FVLSSI---KDAPEDVFDVVERTTLDCISYAHLRQRSPWNLLTGDIVKNNVCVIGDALHP  299

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGCS+LED+VVLARCL  A   KN  D    +E   + +   +K+  +RR R 
Sbjct  300   MTPDLGQGGCSALEDSVVLARCLAEALLTKNERD----DEECEKPKMGRQKFSNQRRWRS  355

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ-NEYDCGQL  172
               L    YL+G    +   +        M+ F      + +++DCG+L
Sbjct  356   FSLISAAYLVGLVQESDGVVIDFLKKKFMSRFSVGIVMRMSDFDCGKL  403



>ref|XP_010028758.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Eucalyptus grandis]
Length=383

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/404 (39%), Positives = 217/404 (54%), Gaps = 26/404 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  +IVIVG GI GL TAL LHR G++S+VLE S  LR+ G       N WRALD LGI
Sbjct  2     EAVEDIVIVGAGIAGLTTALGLHRLGIRSLVLESSDGLRTTGFAFTTWTNAWRALDALGI  61

Query  1200  GSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             G        PL++  +   G   E         VR + R  L+ +LA+ LP+GTIR+  +
Sbjct  62    GE-------PLRQQHNQLFGRGHE---------VRGVQRRTLLETLANELPSGTIRYSSK  105

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             V S++     K   L  S+GS ++A+ LIGCDG  S VA+ LG K     G  A RG   
Sbjct  106   VVSIEESGFLKLVHL--SDGSILKAKALIGCDGVNSAVAKWLGFKKPAFVGRSAIRGCVY  163

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             Y ++HS   +F + F   VR G +P     ++WF TF +     E+       +KQ +++
Sbjct  164   YDHSHSFEPKFSQFFGEGVRFGFMPCDDKTIYWFFTFYSSS-KDEEMEESPAKMKQFMLQ  222

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
                KL  +P  V+ V   +E +++  S LK+RPP E+L G + K  V V GDA H M P 
Sbjct  223   ---KLGKIPDNVRAVFEKTELDNIILSPLKFRPPWEILWGNISKTNVCVTGDAFHPMTPD  279

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             +GQGGCS+LED VVLARCLG   A+++N   +  EE   RIE  L +Y KERR R  +L 
Sbjct  280   IGQGGCSALEDGVVLARCLGE--ALRDN-QSMSSEEEYKRIEMGLRRYAKERRWRAFELI  336

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
                Y++G     + K+        +A F  R       +DCG+L
Sbjct  337   STAYMVGYIQQGSGKVLNFLRDRVLATFLARQLLKMASFDCGKL  380



>ref|XP_008807124.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Phoenix dactylifera]
Length=406

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/376 (40%), Positives = 217/376 (58%), Gaps = 26/376 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VI+G GI GLATAL LHRKG++ +VLE S+ LR+ G G+    N WRALD LG+G  L
Sbjct  7     DVVIIGAGIAGLATALGLHRKGVRILVLESSESLRAAGFGLVAWTNAWRALDTLGVGDSL  66

Query  1188  RTVALPLQ-----------RGRDI-FLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R   + LQ           R  ++ F+   K  + E     VRC+ RN L+ +L + LP 
Sbjct  67    RQSHVRLQGLTATSSTSGARTSNLAFVARGKIGERE-----VRCLRRNILLETLENELPL  121

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+R+  +V++++ D    F  L L++GS ++ ++LIGCDG  S+VA  LGLK     G 
Sbjct  122   GTVRYSSKVAAIEEDGY--FKLLHLADGSTLKTKVLIGCDGVNSVVARWLGLKKPAFTGR  179

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
              A+RG   +PN H    E  ++F    R G+LP +  +V+WF T+ P+ Q   ++     
Sbjct  180   SASRGFAEFPNGHGFKPEAMQYFGEGFRTGLLPCNERMVYWFFTWTPSEQ--EKEVEESA  237

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               +KQ ++  + K   +P +   VI +SE  +   + L+YR    LL G + KG V VAG
Sbjct  238   TKMKQYMLSKL-KHSKVPEEFIHVIEISELSNPVSAQLRYRWQFSLLWGNISKGNVCVAG  296

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKE  328
             DA H M P LGQGGCS+LED++VLARCL  A   ++N      E    +I++ LEKY +E
Sbjct  297   DAFHPMTPDLGQGGCSALEDSIVLARCLSEALLAEHNGGA---EGGYDKIKKGLEKYARE  353

Query  327   RRMRVAQLSMHTYLIG  280
             RR R  QL   +Y++G
Sbjct  354   RRWRSFQLIATSYVVG  369



>ref|XP_006858560.1| hypothetical protein AMTR_s00071p00172540 [Amborella trichopoda]
 gb|ERN20027.1| hypothetical protein AMTR_s00071p00172540 [Amborella trichopoda]
Length=422

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 151/410 (37%), Positives = 225/410 (55%), Gaps = 20/410 (5%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + +IVIVG GI GLATAL LHR GLK  +LE    LR+ G G+    N W+AL+ LG+  
Sbjct  6     QEDIVIVGAGIAGLATALGLHRMGLKCFILESHDALRTTGFGLTTWTNAWKALEALGVAD  65

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPAGTIR  1033
              LR   + LQR     L                   + RC+ R+ L+ +LA  LP G I+
Sbjct  66    SLRHQHVQLQRVSVTTLATGATTHTPLTGQGKCGQFETRCLRRDLLVEALARELPKGCIK  125

Query  1032  FGCEVSSVDYDSVTKFTRLL-LSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             FG +V++++         LL L++G+ I+A+++IGCDG  S+V+  LGL+     G    
Sbjct  126   FGAKVANMEVKDYKSPPYLLHLADGTIIKAKVVIGCDGVNSVVSTWLGLQKPAYVGRSEI  185

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAI  679
             RG   + + H    +F ++   D +VG++P ++  ++WF T+ PT Q    +   D + +
Sbjct  186   RGFANFQDGHGFEPDFLQYINDDFQVGLIPCNNQTIYWFFTWSPTHQ--EREIEDDPDKM  243

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             KQ+V+E   K +D+   V++VI  +  E L+ S L+ R P  L+ G + KG V VAGDA 
Sbjct  244   KQLVLE---KTRDILKNVQDVIERTRVECLNTSRLRCRWPWCLIHGNICKGNVCVAGDAF  300

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H M P +GQGGCS+LED VVLARCLG   A+ +   GIE++    RI  ALEKYVKER+ 
Sbjct  301   HCMTPDIGQGGCSALEDGVVLARCLGE--AILDGEKGIEEK----RISMALEKYVKERKW  354

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
             R   ++   Y  G       K+    +   ++ +  R   A  +++CG L
Sbjct  355   RAIMITTVAYFFGFLQQGHGKVKTFLWDKLLSRIMQRRRMAITDFNCGSL  404



>ref|XP_004245095.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
lycopersicum]
Length=410

 Score =   239 bits (611),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 220/418 (53%), Gaps = 30/418 (7%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
               +IVIVG GI GLAT+L LHR G++SIVLE S  LR+ G  + +  N WRALD LG+G 
Sbjct  4     NEDIVIVGAGIGGLATSLGLHRLGVRSIVLESSDSLRTSGFALALWTNAWRALDALGVGD  63

Query  1194  HLRTVALPLQRGR-----------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALP  1048
              LR  +L   R +           +I L  D  + I+Y   D RC+ R +++ +L   LP
Sbjct  64    SLRQRSLHFTRFQAFSANSGLPTAEISLEAD-NKPIDY---DSRCIKRQEIVETLEKELP  119

Query  1047  AGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
              GTI++ C V S+    + K     L+N + I  ++LIGCDG  S+VA+ +GL    +  
Sbjct  120   QGTIKYSCRVISIQQSGLYKLVH--LANKTIIRTKVLIGCDGVNSMVAKWMGLPKPIDAN  177

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRD  691
               A RG   YP AH    +F  +F G VR+G LP  H  ++WF TF P+     EK    
Sbjct  178   RSAIRGYLEYPKAHGFEPKFCAYFGGGVRIGFLPCDHKSLYWFCTFTPSDVDYDEKIEGS  237

Query  690   ENAIKQMVI---ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllgrlRKGT  523
                +KQ V+    N+ K      +   ++  +  +SL  + LK R     L+   + K  
Sbjct  238   PTKMKQFVLSLANNVSK------EAYNILERTSLDSLYCAKLKLRTPWNILIKENIVKNN  291

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
               + GDA+H M P +GQGGCS+LED+VVLARC+ S A    N++  +  +   RIE  LE
Sbjct  292   TCLVGDALHPMTPDIGQGGCSTLEDSVVLARCI-SMAIFAKNLENDDDVQLCKRIEVGLE  350

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
             KY KER+ R+  L   +YL+G +  +  K+        +A F         ++DCG+L
Sbjct  351   KYAKERKWRIFNLITTSYLVGLAQESNGKVISYLREKFLAQFTIETMLKMGDFDCGKL  408



>ref|XP_004288321.1| PREDICTED: FAD-dependent urate hydroxylase-like [Fragaria vesca 
subsp. vesca]
Length=406

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 234/418 (56%), Gaps = 39/418 (9%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVGGGI GLATA+AL R G++++VLERS+ LR+ G  + + PN W ALD LG+   L
Sbjct  7     DVVIVGGGIAGLATAVALKRAGIEALVLERSEGLRATGAALTLFPNAWFALDALGVSQKL  66

Query  1188  RTVALPLQRGRDIFL-----GEDKEQKIEYVSGDV---RCMARNDLIRSLADALPAGTIR  1033
              + A      R +++     GE +E      +GD    R + R  L+ +LAD LP  +IR
Sbjct  67    ASYA----HSRKLYITDLDTGEVQEVPFIKPNGDAVGPRSVHRKALLEALADELPVHSIR  122

Query  1032  FGCEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             F  ++S++D      +    + + NG+ I+A++LIGCDG  S+V+  LGL+     G  A
Sbjct  123   FSSKISAIDTQQHEGSSIAIVHMENGTVIKAKVLIGCDGVHSVVSRWLGLRDPVLSGRSA  182

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF--PTRQLTGEKFPRDEN  685
              RGL  YP  H L     ++     R GI+P++   ++WF+++  P ++ + E FP D  
Sbjct  183   VRGLAVYPQGHGLEHNVRQYVGTGKRAGIVPLTDKEIYWFISYTSPAKETSLEDFPED--  240

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I++ V+EN  K  D+P    +V+  S+  +L+ + LKYR P  ++ G L K  +TVAGD
Sbjct  241   -IQKEVLENYGK--DIPTIFSDVVKQSDLSTLTRAPLKYRYPLNVVFGTLSKQNITVAGD  297

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P L QGGCSSLEDAV+L R +G    V+N    + KE     I E L KYV+ER
Sbjct  298   AMHPMTPDLAQGGCSSLEDAVILGRHIGR-YFVQNGQVLVAKE-----ISEVLGKYVEER  351

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAM---ALFFR----NGAAQNEYDCGQL  172
             R RVA L   +Y+ G    A S      +GG      +F++           YDCG+L
Sbjct  352   RWRVALLITGSYISGWVQQAGS-----GWGGKFLRDVIFYKFLYLKMVRYVNYDCGKL  404



>ref|NP_196151.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis 
thaliana]
 dbj|BAB09975.1| monooxygenase [Arabidopsis thaliana]
 gb|AAO24580.1| At5g05320 [Arabidopsis thaliana]
 dbj|BAE99644.1| monooxygenase [Arabidopsis thaliana]
 gb|AED90857.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis 
thaliana]
Length=406

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/409 (36%), Positives = 227/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +I+IVG GI GLATAL LHR G++SIVLE S+ LR+ G  + +  N W+A++ LGI
Sbjct  4     ESTQDIIIVGAGISGLATALGLHRLGIRSIVLESSEQLRATGFALSLYFNAWKAMEALGI  63

Query  1200  GSHLRTVALPLQRG--RDIFLGEDKEQKI--EYVSGDVRCMARNDLIRSLADALPAGTIR  1033
               H+R++    Q    R I  G+  ++ +  E    +VRC+ R  L+ +LA  LP GTIR
Sbjct  64    SQHIRSLGDRFQGWVVRPISAGDPPKEMLFPESEEYEVRCVQRKLLLDALAGELPQGTIR  123

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             F  ++  ++     K   L  S+G+ ++ ++L+GCDG +S+V + LG K   +   VA R
Sbjct  124   FSSKLVHIELSGHYKMVHL--SDGTILKTKVLVGCDGVKSVVGKWLGFKNPVKTSRVAIR  181

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G+  +   H L   F + +   VR G +    + V+WF+T  +  L      ++   IKQ
Sbjct  182   GIAHFQTGHELGRRFFQFYGNGVRSGFISCDQNTVYWFLTHTSTDLD----KKNHQKIKQ  237

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V+    K++DLP  +K ++  ++ +SL  + L YRPP ELL   + K  V VAGDA+H 
Sbjct  238   FVLT---KIKDLPDNIKSILETTDLDSLVMNPLMYRPPWELLWANIAKDNVCVAGDALHP  294

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSA-RIEEALEKYVKERRMR  316
             M P +GQGGCS++ED V+LARCLG A   KN     E E  S  RIE+ L+KY   R+ R
Sbjct  295   MTPDIGQGGCSAMEDGVILARCLGEAMKAKNMKGETEDENESYRRIEDGLKKYAGSRKWR  354

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
                L   +Y +G    +  K   +     M+ F       ++ ++CG+L
Sbjct  355   SIDLITTSYTVGFIQQSRGKWMTLFRDKFMSSFLSWLRVKKSHFNCGRL  403



>ref|XP_008447940.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
melo]
Length=408

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/422 (36%), Positives = 233/422 (55%), Gaps = 30/422 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME      EIVIVG GI GLATAL LHR G++S+VLE S  LR+ G  +    N W+ALD
Sbjct  1     MEEKGDVEEIVIVGAGISGLATALGLHRLGIRSLVLETSDSLRAAGYALTTWNNAWKALD  60

Query  1212  QLGIGSHLR--------TVALPLQRGRD----IFLGEDKEQKIEYVSGDVRCMARNDLIR  1069
              LG+   LR         V      G+     +F G   ++         R + R  L+ 
Sbjct  61    ALGVADSLRLRHDRLAGNVTFSAVSGKPTSNLLFTGHRDQE--------ARTLMRKSLLE  112

Query  1068  SLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGL  889
             +LA  LP  TI++  ++ S++ ++      L L++G+ ++ ++LIGCDG  S+VA+ LGL
Sbjct  113   ALAVDLPKDTIKYSSKLVSIEEEAAGFLKLLHLADGTILKTKVLIGCDGVNSVVAKWLGL  172

Query  888   KPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLT  712
             K     G  ATRG+ TY + H    +F   F   +R G++P + + V+WF T+ P++Q  
Sbjct  173   KKPSLSGRNATRGIVTYNDGHGFDNKFMWFFSKGLRFGVMPCNSNTVYWFATWCPSKQ--  230

Query  711   GEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlR  532
              E+   +   +K+ +   + KL  +P + + V+  ++ ++     L+YR P EL+     
Sbjct  231   EEEIEENPTKLKEHI---LSKLGKVPDQARAVVEDTQVDAFVSLPLRYRRPWELVCNNFS  287

Query  531   KGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDG-IEKEERSARIE  355
             +G V++AGDA+H M P LGQGGCS+LED V+LARCL  A A+  N +G +E +E   RIE
Sbjct  288   RGNVSIAGDALHSMTPDLGQGGCSALEDGVILARCL--AEAMSRNPNGEVEDKEEYKRIE  345

Query  354   EALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ-NEYDCG  178
             + LEKY KERR R  +L + +Y++G+   +  K+        +A        + +++DCG
Sbjct  346   KGLEKYAKERRWRSIKLIIASYVVGSIQESKGKVMNYLRDNILADSLVGVLMKISDFDCG  405

Query  177   QL  172
              L
Sbjct  406   TL  407



>ref|XP_008645819.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Zea mays]
Length=430

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 164/415 (40%), Positives = 233/415 (56%), Gaps = 19/415 (5%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR +GG IGV  NGWR L+QLG+ + 
Sbjct  20    HGIVIVGGGICGLATALALHRKGIASLVLEKSEALRVDGGSIGVHVNGWRVLEQLGVAAE  79

Query  1191  LR-----TVALP--LQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             LR       ALP   Q  R +     ++++      ++R + R DL+ ++A  +PAG IR
Sbjct  80    LRETANLVTALPNCFQVPRRV---AGRKEEHPDTRQELRWLKRKDLLETMAKDIPAGAIR  136

Query  1032  FGCEVSSV---DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV-  865
              GC V+++   D   V   T      G  I A++LIGCDG  S+VA+ LG+ P+K     
Sbjct  137   LGCHVTAIHPSDPGVVLTTTPAGGGGGGVIRAKVLIGCDGSNSVVAKYLGMSPSKPTPPR  196

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRD  691
                RG TTY + H     F R       VG  P++   V +FV    P+   +      D
Sbjct  197   TYLRGFTTYRHGHPFGDRFLRLRGRRFFVGRSPMTDTRVSFFVACHVPSAATSSSSRVVD  256

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTV  514
                 +  V++ +   Q  PA+V E++  ++P+SL+  + + YRPP ++ L   RKG VTV
Sbjct  257   ARDTRHAVLQKLRD-QRCPAEVVEMVRDADPDSLNVVTRVWYRPPWQVALAAFRKGAVTV  315

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR-IEEALEKY  337
             AGDAMH MG ++GQGG ++LEDA+VLAR L  A A          +E        A+ +Y
Sbjct  316   AGDAMHAMGSYIGQGGSAALEDALVLARSLARARAAAAGGRDDGDDEPFLLGAATAIREY  375

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             V+ERR+RVA+LS+  +++G  + A S   K+A    +AL          YDCG+L
Sbjct  376   VRERRLRVARLSLEAFVMGELLRAKSMATKLACMAILALLGTKALGHTNYDCGRL  430



>ref|XP_010260765.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010260766.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Nelumbo nucifera]
Length=411

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 18/414 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  ++VIVG GI GL T+L LHR GL+S+VLE S  LR+ G  +    N W+AL  +GI
Sbjct  2     ETVEDVVIVGAGIAGLTTSLGLHRMGLRSLVLESSDSLRTTGFALTTWANAWKALHVIGI  61

Query  1200  GSHLRTVALPLQ--RGRDIFLGEDKEQKI-----EYVSGDVRCMARNDLIRSLADALPAG  1042
                LR   + LQ  +G     G    + +     ++   +VRC+ RN LI +L   LP G
Sbjct  62    ADSLRQEHVLLQGVKGTSTISGLTTSEILFKDIKKFGDVEVRCVRRNLLIEALEKELPPG  121

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRF  +V +++     K   L L++GS ++ ++LIGCDG  S+VA+ LGL+     G  
Sbjct  122   TIRFSSKVVAIEEAGYLKV--LHLADGSVLKTKVLIGCDGVNSVVAKWLGLQKPAFTGRF  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDEN  685
             +TRG  T+ + H L  +F   F   VR G +P      +WF+T+ P+ +  G     +  
Sbjct  180   STRGYATFSSGHGLEPKFLMFFGHGVRSGFIPCDEKTAYWFITWTPSTEQNG--MEENPA  237

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +KQ ++    KL + P +V  V+  +E ES+  S L+ R P  +L G + +G V VAGD
Sbjct  238   KLKQFILS---KLDNAPKEVVSVVENTELESIITSPLRLRWPWNVLWGDIFRGNVCVAGD  294

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAV--KNNVDGIEKEERSARIEEALEKYVK  331
             A+H M P +GQGGCS+LED +VLA+CL  A  +  K    GI+++E   RI+ ALEK+ K
Sbjct  295   ALHPMTPDIGQGGCSALEDGIVLAKCLAQALLMEPKREAKGIDEKEEYNRIKNALEKFAK  354

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             ERR R  QL    +++G    +  KL        ++ F  R    +  YDCG L
Sbjct  355   ERRWRSFQLISTAFVVGLIQQSNGKLMGFLRDKLLSSFMTRLMLERANYDCGGL  408



>ref|XP_010028760.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=413

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/420 (36%), Positives = 224/420 (53%), Gaps = 28/420 (7%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  EIVIVG GI GL TAL LHR G++S+VLE    LR+ G  +G+  NGW+ALD +G+
Sbjct  2     EAVEEIVIVGAGIAGLTTALGLHRLGIRSLVLESHDHLRTTGFALGIWTNGWKALDAVGV  61

Query  1200  GSHLR-----------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
             G  LR           + A+   R  +I L     Q+      + RC+ R  L+ +L   
Sbjct  62    GESLRQQHNRLLRVMTSSAISGLRTAEIALNAMGPQR----DNEFRCVQRKILLETLEKE  117

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP+GTI+F  +V S++     K     LS+GS+++A++LIGCDG  S +A+ LG K    
Sbjct  118   LPSGTIKFSSKVVSIEESGCLKLIH--LSDGSFLKAKLLIGCDGVNSALAKWLGFKKPAS  175

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFP  697
              G    R    Y N H L  +        VR G+LP     ++WF +F P+ Q   E+  
Sbjct  176   VGRFGIRACVYYENGHDLEPKISLFMGKGVRYGVLPCDDKTIYWFFSFSPSSQ--DEEII  233

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
              +   IKQ+V+  + K+ D    +K VI  +E +++  S L++R P E++ G + K  V 
Sbjct  234   DNPAEIKQLVLGKLGKVAD---NIKAVIDDTELDNMMLSPLRFRHPWEIIWGNISKSNVC  290

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA----AAVKNNVDGIEKEERSARIEEA  349
             VAGDA H + P + QGGC++LED +VLARCLG A      +++   GIE+E+   RIE  
Sbjct  291   VAGDAFHPLTPDIAQGGCAALEDGIVLARCLGEALRDRQVMRSEGKGIEEEDEHKRIERG  350

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ-NEYDCGQL  172
             L+ Y KERR R  QL    Y++G    +  K+        +A F      +   Y+CG L
Sbjct  351   LQNYAKERRWRAFQLITTAYMVGYMAQSDGKILNFLSNTVLAGFLAGRLPRIASYNCGML  410



>ref|XP_009794919.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like, partial 
[Nicotiana sylvestris]
Length=260

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 171/274 (62%), Gaps = 14/274 (5%)
 Frame = -2

Query  993  TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPI  814
            T    +LLSNG  I A+ILIGCDG RS+V+  LG+KP + F + A RGLT+YPN HS P+
Sbjct  1    TSLPCILLSNGKRIGAKILIGCDGSRSVVSSFLGVKPTRTFRISAIRGLTSYPNGHSFPL  60

Query  813  EFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLP  634
            EF R       VG LPI+  LVHWF+    +Q T   FP D   IKQ     +E     P
Sbjct  61   EFVRLISDKTAVGRLPITDMLVHWFIG--VQQGTDTIFPHDPELIKQ---RALEATSGRP  115

Query  633  AKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSL  454
            A V+E+I   + +SLSF+HL+YR P +L+LG  R+ TVTVAGDAMHVMGPFLGQGG + +
Sbjct  116  ADVQEMIEGCDLDSLSFTHLRYRAPWDLMLGNFREKTVTVAGDAMHVMGPFLGQGGSAGI  175

Query  453  EDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGAS  274
            EDAVVLAR L  A  +K   D         ++ EAL++YVKERRMRV +L+  +YL    
Sbjct  176  EDAVVLARNL--AKTLKGGFD-------HEKVGEALDQYVKERRMRVVKLATQSYLTALL  226

Query  273  MAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
            +  T  L K      MALFFRN +A   YDCG L
Sbjct  227  VENTPLLIKFVVIAVMALFFRNPSAHVLYDCGHL  260



>ref|NP_001137002.1| uncharacterized protein LOC100217165 [Zea mays]
 gb|ACF83050.1| unknown [Zea mays]
Length=408

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 232/415 (56%), Gaps = 21/415 (5%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             D+  +IVI G G+ GLATAL LHRKG++ +VLE S  LR+ G       N +RALD LG+
Sbjct  3     DAVEDIVIAGAGLAGLATALGLHRKGVRCLVLESSPALRASGFAFTTWTNAFRALDALGV  62

Query  1200  GSHLRTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAG  1042
             G  +R   L  +R        GE   +   KI+  SG  ++RC+ R+ L+R+LAD LP G
Sbjct  63    GDKIREHHLLYERMIAFSAATGEAAAEVSLKIQSKSGPHEIRCVKRDFLLRTLADELPEG  122

Query  1041  TIRFGCEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
             TIR+  +V +++ D V   K  +L L++GS I+A+++IGCDG  S+VA+ LGL      G
Sbjct  123   TIRYSAKVVAMEEDGVGGAKTLQLHLADGSTIKAKVVIGCDGVNSVVAQWLGLPKPILSG  182

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDE  688
               ATRGL  YP  H    E  +      R G+LP S   V+W  T+      G+     E
Sbjct  183   RSATRGLAEYPGGHGFGPEILQFIGHGFRSGVLPCSDTSVYWNYTWYPSPADGDA----E  238

Query  687   NAIKQMVIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
              ++ +M    + KL+   +PA+  EV+  SE   ++ S L++R P  L+ G + +G V V
Sbjct  239   ESVAKMRSHVVAKLRGAKVPAEALEVVERSEMSDVASSPLRFRSPLALVRGSISRGGVCV  298

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P LGQGGC++LED VVLARCLG A A+     G E++E    +  ALE+Y 
Sbjct  299   AGDALHPMTPELGQGGCAALEDGVVLARCLGKAFALL----GQERDEGRV-VTAALEEYA  353

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
               RR R  QL    Y++G    + + + +      ++ L  +   A  +YDCG L
Sbjct  354   AARRWRSIQLITAAYVVGFIQQSNNAVVRFVRDRFLSRLLSKTLVAMADYDCGAL  408



>ref|XP_010028754.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=406

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 217/418 (52%), Gaps = 31/418 (7%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  +IVIVG GI GL TAL LHR G++S+VLE S  LR+ G  +    N WRALD +GI
Sbjct  2     EAVEDIVIVGAGIAGLTTALGLHRLGIRSLVLESSDGLRTMGFALTTWTNAWRALDAVGI  61

Query  1200  GSHLRTVALPLQRGRDIFLGEDKEQKIEYVSG--------------DVRCMARNDLIRSL  1063
             G        PL+R      G         +S               ++RC+ R  L+ +L
Sbjct  62    GE-------PLRRQHSQLFGTQTASTESGLSTVERQFDAPGTQRGHEIRCVQRRTLLETL  114

Query  1062  ADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKP  883
             A+ LP+ TIR+   V S++     K   L  S+GS ++A++LIGCDG  S VA+ LG K 
Sbjct  115   ANELPSSTIRYSSRVVSIEESGYLKLVHL--SDGSILKAKVLIGCDGVHSAVAKWLGFKK  172

Query  882   AKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK  703
                 G  A RG   Y   H+   +  R+F   VR G++P +   ++WF TF +     E+
Sbjct  173   PSFAGRSAIRGCVYYEQGHNFEPKPFRYFGEGVRSGVIPCNDKSIYWFFTFSSSS-QNEE  231

Query  702   FPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
                    +KQ V+    KL  +P  ++  I  +EP+    S L++RPP E+LLG + K  
Sbjct  232   MEESPAKMKQFVLG---KLGKIPDNMRAAIEKTEPDDFILSPLRFRPPWEILLGNISKNN  288

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
             V VAGDA H M P +GQGGC++LED +VLARCLG A   K    G+  EE   RIE  L+
Sbjct  289   VCVAGDAFHPMTPDIGQGGCAALEDGIVLARCLGEALRDKQ---GMSSEEEYKRIEMGLK  345

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
              Y KERR R  +L    Y++G    +  K+        +A F  R       YDCG+L
Sbjct  346   SYAKERRWRAFELISTAYMVGYIQQSNGKVLNFLRERVLASFLARLRLKMASYDCGKL  403



>ref|XP_007199879.1| hypothetical protein PRUPE_ppa006387mg [Prunus persica]
 gb|EMJ01078.1| hypothetical protein PRUPE_ppa006387mg [Prunus persica]
Length=414

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 159/431 (37%), Positives = 230/431 (53%), Gaps = 49/431 (11%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++ ++VIVG GI GLAT+L LHR G++S+VLE S  LR+ G  +    N W+ALD LG+
Sbjct  2     EAEADVVIVGAGISGLATSLGLHRLGIRSLVLESSDSLRTTGFALTTWTNAWKALDALGL  61

Query  1200  GSHLRT--VALP----------LQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
                LR   V L           LQ     F  + K +  E     VRC+ R  L+  LA+
Sbjct  62    ADSLRQQHVTLDGNVTSSRITGLQTSEMPFKAKGKHRDHE-----VRCVKRKLLLDGLAN  116

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP+GTIR   +V SVD     K   L  ++G+ ++A++L+GCDG  S+VA+ LG KP  
Sbjct  117   ELPSGTIRLSSKVVSVDESGYFKLVHL--ADGTILKAKVLVGCDGVNSVVAKWLGFKPPA  174

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RG  T+ + H     F ++F   +R G +P     V+W++T+ P+ Q   ++ 
Sbjct  175   FTGRSAIRGCATFKSCHGFDPMFMQYFGNGIRSGAVPCDDANVYWYITWTPSSQ--EKEL  232

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
               +   +KQ ++    KL  +P KVK V+  +E ++   S L+YR P ELL G + KG  
Sbjct  233   EENPAQLKQYMLS---KLGKIPDKVKAVVENTELDAFISSPLRYRHPWELLWGNISKGNA  289

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA-----AAVKNNVDGIEKEERSARIE  355
              VAGDA+H M P LGQGGC +LED+VVLARCLG A        + + +G+E +E   RIE
Sbjct  290   CVAGDALHPMTPDLGQGGCCALEDSVVLARCLGEALLKNSGGERKDKEGVEGKEEYERIE  349

Query  354   EALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGA---------  202
               L KY  ERR R   L   +Y++G    +  K            FFR+           
Sbjct  350   MGLNKYANERRWRSFDLISTSYVVGFLQESNGKFMN---------FFRDKCLSPILAGLR  400

Query  201   -AQNEYDCGQL  172
               + ++DCG+L
Sbjct  401   LKKADFDCGKL  411



>ref|XP_003535754.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
 gb|KHN37395.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=418

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 152/416 (37%), Positives = 232/416 (56%), Gaps = 23/416 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLAT+LALHR G+ S+VLE S  LR  G  +    N W+ALD LG+G+ L
Sbjct  8     DIVIVGAGIAGLATSLALHRLGVPSLVLEYSDTLRVTGFALTTWTNAWKALDALGVGTIL  67

Query  1188  RTVALPLQRG--RDIFLGEDK-----EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R   + L+      + LG+       E   ++   +VRC+ R  ++ ++A+ LP+GTIRF
Sbjct  68    RHQHVQLKENVTTSLILGQQTSSLSFEGTGKHGDCEVRCVRRQLMLEAIANELPSGTIRF  127

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V +++    +K   + L +G+ I+ ++LIGCDG  S+VA+ LG K A   G    RG
Sbjct  128   LSKVVAIEESGFSKIKIVRLDDGTTIKTKVLIGCDGINSVVAKWLGFKEASFTGRYVIRG  187

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQ  673
                  N H L  +F  +F    R G++P   + V+WF+T+ PT +   ++  ++ + +KQ
Sbjct  188   YKKLMNNHGLEPKFMHYFGKGFRSGVMPCDDNTVYWFLTWTPTSE--EKELAKNPSKMKQ  245

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             +V+  +EK   +P+ +K  I  +E + +  S LKYR   EL+LG++ KG V V GDA H 
Sbjct  246   LVLRKVEK---MPSDIKTFIEKTETKDILTSPLKYRHEWELMLGKISKGNVCVVGDAFHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKE--------ERSARIEEALEKY  337
             M P LGQGGC +LED ++LAR L  A   K     + KE        E+  +IE +L KY
Sbjct  303   MAPDLGQGGCCALEDGIILARHLAEAFTKKTG-KHVAKEMGEEGKSKEQYKKIEASLRKY  361

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
              KERR R   +S+ +Y++G  +    KL           F       ++++DCG+L
Sbjct  362   AKERRWRNIDISVTSYVLGFVLQGDLKLVSHFRDKLFPAFLAELLLKKSDFDCGKL  417



>ref|XP_010028756.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW55573.1| hypothetical protein EUGRSUZ_I01443 [Eucalyptus grandis]
Length=406

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 217/411 (53%), Gaps = 17/411 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             ++  +IVIVG GI GL TAL LHR G++S+VLE S  LR+ G       N WRALD LGI
Sbjct  2     EAVEDIVIVGAGIAGLTTALGLHRLGIRSLVLESSDGLRTTGFAFTTWTNAWRALDALGI  61

Query  1200  GSHLR---TVALPLQRGRDIFLGEDKEQKIEYVSG----DVRCMARNDLIRSLADALPAG  1042
             G  LR        LQ    I      E++ +        ++R + R  L+ +LA+ LP+G
Sbjct  62    GEPLRQQHNQLFGLQLTSTISGISTAERQFDATGARRGHEIRGVQRRTLLETLANELPSG  121

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
              IR+  +V S++     K   L  S+GS ++A++LIGCDG  S VA+ LG K     G  
Sbjct  122   AIRYSSKVVSIEESGFLKLVHL--SDGSILKAKVLIGCDGVNSAVAKWLGFKKPAFAGRS  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RG   Y ++HS   +F + F   VR G +P     V+WF TF +     E+       
Sbjct  180   AIRGCVYYDHSHSFEPKFFQFFGEGVRFGFIPCDDKTVYWFFTFYSSS-KNEEMEESPAK  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +KQ +++   KL  +P  V+ V   +E +++  S LK+RPP E+L G + K  V V GDA
Sbjct  239   MKQFMLQ---KLGKIPDNVRAVFEKTELDNIILSPLKFRPPWEILWGNISKTNVCVTGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
              H M P +GQGGCS+LED VVLARCLG A   K +   +  EE   RIE  L +Y KERR
Sbjct  296   FHPMTPDIGQGGCSALEDGVVLARCLGEALRDKQS---MSSEEEYKRIEMGLRRYAKERR  352

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
              R  +L    Y++G       K+        +A F  R       +DCG+L
Sbjct  353   WRAFELISTAYIVGYIQQGNGKVLNFLRDRVLATFLARQLLKMGSFDCGKL  403



>ref|XP_010446363.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=412

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 226/420 (54%), Gaps = 44/420 (10%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G++S+VLE S+ILR+ G       N W+A++ LG+  HL
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIRSMVLESSEILRATGFAFTTWFNAWKAMEALGVSQHL  67

Query  1188  RTVALPLQ-----------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             R++   LQ             +++   E +E        + RC+ R  L+ +LA  LP  
Sbjct  68    RSLHDRLQGWVVGSISAANPSKEMLFPESEEY-------ESRCVQRKLLLEALAGELPEE  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRF  +V  ++     K   L  S+G+ ++ ++LIGCDG  S+V++ LG K       +
Sbjct  121   TIRFSSKVVHIELSGHHKMVHL--SDGTILKTKVLIGCDGLYSVVSKWLGFKNPATTSRL  178

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT +P  H     F + +   VR G +P  H+ V+WF+T  +  +  E    D   
Sbjct  179   AIRGLTHFPAGHGFGKRFFQFYGNGVRTGFIPCDHNTVYWFLTHSSTDIDEET---DPEI  235

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +K+ V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA
Sbjct  236   LKEFVLN---KIKDLPENIKSVVETTDLDSMVMSRLKYRPPWELLWSNITKDNVCVAGDA  292

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEALEKYVKER  325
             +H M P +GQGGCS++ED V+LARCLG A   KN     E EE S  RIE+ L+KY  ER
Sbjct  293   LHPMTPDIGQGGCSAMEDGVILARCLGEAIRAKNLKSETEDEEESHKRIEQGLKKYAAER  352

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF---------FRNGAAQNEYDCGQL  172
             + R   L    Y +G        L + + G  M LF          R    ++ +DCG L
Sbjct  353   KWRSIDLITTAYTVG--------LIQQSRGKWMNLFRDRFLSSFLSRLLLKKSHFDCGSL  404



>ref|XP_009355644.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=414

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/413 (38%), Positives = 227/413 (55%), Gaps = 21/413 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLAT+L LHR G++S+VLE S  LR+ G  +    N W+ALD LGIG  L
Sbjct  6     DVVIVGAGISGLATSLGLHRLGIRSLVLESSDSLRTTGFALTTWTNAWKALDALGIGDSL  65

Query  1188  RTVALPLQ----RGRDIFLGEDK---EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R   + L       R   L   +   E K ++   +VRC+ RN L+ +LA+ LP GTIRF
Sbjct  66    RQQHVTLDGNVTSSRITGLQTSQMSFEAKGKHGDHEVRCVKRNLLLEALANDLPNGTIRF  125

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V S+D   + K   L  ++G+ ++A++L+GCDG  S+VA+ LG K     G  A RG
Sbjct  126   SSKVVSIDESGLFKLVHL--ADGTVLKAKVLVGCDGVNSVVAKWLGFKQPAFTGRSAIRG  183

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQ  673
                +  +H     F ++F   +R G +P     V+WF+T+ P+ Q   ++   +   +KQ
Sbjct  184   CANFKGSHGFDPLFMQYFGNGIRSGSIPCDDKTVYWFITWSPSSQ--EKELEENPGQLKQ  241

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              ++    KL  +P KVK V+  +E ++   S L+YR P E+L G + KG V VAGDA+H 
Sbjct  242   YMLS---KLGKIPDKVKAVVENTELDAFVSSPLRYRHPWEILWGNISKGNVCVAGDALHP  298

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVD-----GIEKEERSARIEEALEKYVKE  328
             M P +GQGGC++LED VVLARCLG A    +  +     G E +E   RIE  L+KY  E
Sbjct  299   MTPDIGQGGCAALEDGVVLARCLGEALLKSSRHETKDKAGEEGKEEHERIETGLKKYASE  358

Query  327   RRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
             RR R   L     ++G       K+        +A         ++++DCG+L
Sbjct  359   RRWRSFDLISTALMVGFFQEGNGKIMNFLRDKCLAPILAGLLLKKSDFDCGKL  411



>ref|XP_004251850.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
lycopersicum]
Length=407

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 161/419 (38%), Positives = 226/419 (54%), Gaps = 32/419 (8%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++  IVIVG GI GLAT+LALHR GL+SIVLE +  LR+ G  + +  N WRALD L I
Sbjct  2     ETEENIVIVGAGIAGLATSLALHRLGLRSIVLESADSLRATGFALALWTNAWRALDALDI  61

Query  1200  GSHLRTVALPL--------QRGRDI----FLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             G  LR  +L +        + G  I    F+G +    +EY S   RC+ R DL+ +LA+
Sbjct  62    GDSLRQRSLSITGFKSFSAESGAPITEVSFVGNN---SVEYES---RCVRRKDLLETLAN  115

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP G IR+  +V SV+     K     L++G  I  + LIGCDG  S+VA  LGL+   
Sbjct  116   ELPQGAIRYSSKVDSVEVSGPLKLVH--LADGCTIRTKALIGCDGVNSVVANWLGLQKPV  173

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RG   YP  H    +FH +F G VR G LP     ++WF TF P+        
Sbjct  174   YSGRSAIRGFVEYPEKHGYQPKFHAYFGGGVRFGFLPSDEKSLYWFCTFTPSVVHFDGNA  233

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              +D   +KQ V   + K  ++  ++  VI  +  +S+S + LK R P  +L G + K  V
Sbjct  234   EQDPIKLKQFV---LNKASNVSKELSTVIDRTTLDSISIAQLKLRVPWNVLFGNILKNNV  290

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              V GDA+H M P LGQGGCS+LED+VV+A+CL + A +K   +  ++++ S RI + LEK
Sbjct  291   CVVGDALHPMTPDLGQGGCSALEDSVVIAKCL-AEALIKPITE--QEDDESMRIRKGLEK  347

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLA---KMAFGGAMALFFRNGAAQNEYDCGQL  172
             Y KERR R        YL G      +K+    +  F G + +      A   +DCG+L
Sbjct  348   YAKERRWRSFTFISAAYLSGFIQETDNKIISFLRQHFLGGVTISVTLKIAN--FDCGKL  404



>ref|XP_004144855.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
 ref|XP_004162903.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
 gb|KGN43264.1| hypothetical protein Csa_7G014500 [Cucumis sativus]
Length=409

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 149/419 (36%), Positives = 230/419 (55%), Gaps = 26/419 (6%)
 Frame = -2

Query  1389  ESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQ  1210
             E  D   +IVIVG GI GLATAL LHR G++S+VLE S  LR+ G  +    N W+ALD 
Sbjct  3     EKGDHVEDIVIVGAGISGLATALGLHRLGIRSLVLETSDSLRAAGYALTTWNNAWKALDA  62

Query  1209  LGIGSHLR--------TVALPLQRGR---DIFLGEDKEQKIEYVSGDVRCMARNDLIRSL  1063
             LG+   LR         V      G+   D+     + Q       + R + R  L+ +L
Sbjct  63    LGVADSLRLRHDRLAGNVTFSAVSGKPTSDLLFKAHRNQ-------EGRTLMRKSLLEAL  115

Query  1062  ADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKP  883
             A  LP  TI++  ++ S++ ++      L L++G+ ++ ++LIGCDG  S+VA+ LGLK 
Sbjct  116   AMDLPKDTIKYSSKLVSIEEEAAGFLKLLHLADGTILKTKVLIGCDGVNSVVAKWLGLKK  175

Query  882   AKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGE  706
                 G  ATRG+ TY N H    +F   F   +R G++P + + V+WF T+ P++Q   E
Sbjct  176   PSLSGRNATRGIVTYSNGHGFDNKFMWFFGKGLRFGVMPCNSNTVYWFATWRPSKQ--EE  233

Query  705   KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKG  526
             +   +   +K+ +   + KL  +P + + V+  +E +S     L+YR P EL+     + 
Sbjct  234   EIEENPTKLKEHI---LRKLGKVPDQARAVVEDTEVDSFVSLPLRYRHPWELVCNNFSRS  290

Query  525   TVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEAL  346
              +T+AGDA+H M P LGQGGCS+LED V+LARCLG A +   N + +E +E   RIE+ L
Sbjct  291   NITIAGDALHSMTPDLGQGGCSALEDGVILARCLGEAMSRNPNGE-VEDKEEYKRIEKGL  349

Query  345   EKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ-NEYDCGQL  172
             EKY KERR R  +L + + ++G+   +  K+        +A        + +++DCG L
Sbjct  350   EKYAKERRWRSIKLIIASDVVGSIQESKGKVMNYLRDNILADSLVGVLMKISDFDCGTL  408



>ref|XP_006605859.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
Length=421

 Score =   237 bits (605),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 235/415 (57%), Gaps = 21/415 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLAT+LALHR G++S+VLE S  LR  G  +    N W+ALD LG+G+ L
Sbjct  8     DIVIVGAGIAGLATSLALHRLGVQSLVLEYSDTLRVTGFALTTWTNAWKALDALGVGAIL  67

Query  1188  RTVALPLQRG--RDIFLGEDK-----EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R   + L+      + +G+       E   ++   +VRC+ R  ++ ++A+ LP+GTIRF
Sbjct  68    RHQHVQLKENVTTSLIMGQQTSSLSFEGTGKHGDCEVRCVRRQLMLEAIANVLPSGTIRF  127

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V +++    +K   + L++G+ I+ ++LIGCDG  S+VA+ LG K A   G    RG
Sbjct  128   LSKVVAIEESGFSKIKIVRLADGTSIKTKVLIGCDGINSVVAKWLGFKEASFTGRYVIRG  187

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQ  673
                  + H L  +F  +F    R G++P     V+WF+T+ PT +   ++   + + +KQ
Sbjct  188   YKKVMDNHGLEPKFMHYFGKGFRSGVMPCDDKTVYWFLTWTPTSE--EKELANNPSKMKQ  245

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             +V+  +EK   +P+ +K  I  ++P+ +  S L+YR   EL+LG + KG V V GDA H 
Sbjct  246   LVLRKVEK---MPSNIKTFIEKTDPKDILTSPLRYRHQWELMLGNISKGNVCVVGDAFHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEK-------EERSARIEEALEKYV  334
             M P LGQGGC +LED ++LAR L  A + K     ++K       +E+  +I+ +L KY 
Sbjct  303   MAPDLGQGGCCALEDGIILARYLAEAFSRKTCKHVVKKMGEEGKAKEQYKKIDASLRKYA  362

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
             KERR R   +S+ +Y++G  +    K+        +  F       ++++DCG+L
Sbjct  363   KERRWRNIDISVTSYVLGFVLQGDLKMVAHFRDKVLPDFLAELLLKKSDFDCGKL  417



>ref|XP_010524530.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=327

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 195/335 (58%), Gaps = 10/335 (3%)
 Frame = -2

Query  1170  LQRGRDIFL--GEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDS  997
             + R R +F   G+  E       G V C+ RN+L+++LA+ALP GTIRFG  + S + D 
Sbjct  1     MNRFRSVFYENGKRHETVGPAAYGAVNCLKRNELVKALAEALPEGTIRFGYGLVSANIDE  60

Query  996   VTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLP  817
              + F  L   +G  I A+++IGCDG  S++A+ L + P + FG  A RG T+YP+ H   
Sbjct  61    TSSFPILRFKDGRSIRAKVVIGCDGSNSVIADFLRMNPTRAFGSRAVRGFTSYPDGHGFQ  120

Query  816   IEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDL  637
              E       +V  G LP++  LV WF  FP       +  RD  AI ++   +    +DL
Sbjct  121   PEVVTMKMENVLCGRLPVTDRLVFWFTYFPHYSQQESEISRDREAIAELTKGST---KDL  177

Query  636   PAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSS  457
             P + +E++   +  SL  S ++YRPP E+L+G+ R+GTVTVAGDAMH+MGPFLGQGGC++
Sbjct  178   PEEWREMVKNCDVSSLYMSSIRYRPPWEILVGKFRRGTVTVAGDAMHLMGPFLGQGGCAA  237

Query  456   LEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGA  277
             LEDAVVL RCLG     K    G     R   +EEA+++YV+ERR RV  LS   YL G 
Sbjct  238   LEDAVVLGRCLG-----KKLGQGHVFPPRKGMVEEAIDEYVRERRKRVFALSTQVYLTGK  292

Query  276   SMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              + A+S +AK+     + + F +      YDCG+L
Sbjct  293   LVGASSGVAKVMLLVLLMVLFYDQIRHTRYDCGKL  327



>ref|XP_004497186.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cicer arietinum]
Length=404

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 166/416 (40%), Positives = 238/416 (57%), Gaps = 22/416 (5%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             MES   + +IVIVG GI GL T+L LHR G++S+VLE    LR  G  I +  NGW+ALD
Sbjct  1     MESV-IEEDIVIVGAGIAGLTTSLGLHRLGIRSLVLESWDGLRVSGFAITMWKNGWKALD  59

Query  1212  QLGIGSHLRTVALPLQR--------GRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
              +G+G  LR   L L R        G+        + K +Y   +VRC+ R+ ++ +LA+
Sbjct  60    AVGVGDILRHQHLQLPRNVTTSLITGQQTSTTSFNDNKGKY---EVRCVRRHVMLEALAN  116

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIR+  +V +++     K   L+  +G+ I+ ++LIGCDG  S+VA+ LG+K A 
Sbjct  117   ELPRGTIRYLSKVVAIEESRFFKILHLI--DGTTIKTKVLIGCDGVNSVVAKWLGMKEAS  174

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
               G  ATRG     + H+L   F    KG  R G+ P  H+ ++WF T+ T  + GE+  
Sbjct  175   YTGRYATRGYVELKDTHNLDPMFMYFGKG-FRGGVFPCHHNAIYWFFTW-TPIIQGEELA  232

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
             +D + +KQ V++ +EKL    + V+  I  +E ++   + L+YR P EL++G + KG V 
Sbjct  233   QDTSKLKQYVLKKLEKLS---SDVRIFIEKTEFDAFHLAPLRYRKPWELIMGNISKGNVC  289

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDA+H M P LGQGGC +LED VVLARCL  A A  N     EKEE   RIEE L+KY
Sbjct  290   VAGDALHPMTPDLGQGGCCALEDGVVLARCL--AEAFFNKSIKEEKEEEYKRIEEGLKKY  347

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFR-NGAAQNEYDCGQL  172
               ERR R   L   +Y++G+   + SK         +A F       ++++DCGQL
Sbjct  348   ANERRWRCIDLIATSYIVGSIQQSGSKFVNFFRDKFLASFLALMLLKKSDFDCGQL  403



>ref|XP_010252441.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nelumbo 
nucifera]
Length=359

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/341 (39%), Positives = 207/341 (61%), Gaps = 12/341 (4%)
 Frame = -2

Query  1176  LPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDS  997
             L L R R+I +  +++++      ++RC+ R+DL+  LA+ LP  TIRFGC++ +V  D 
Sbjct  25    LLLSRVREILVDNNRQRETPIGKEELRCVKRSDLVEILAENLPPETIRFGCQIVAVKLDP  84

Query  996   VTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLP  817
             ++    L L +G++I+A+++IG DG  S+VAE LGLK  K F   A RG T +P  H L 
Sbjct  85    LSSDPVLQLYDGTFIKAKVVIGSDGANSVVAEFLGLKATKLFSYCAIRGFTNHPTGHGLN  144

Query  816   IEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE--KFPRDENAIKQMVIENIEKLQ  643
              EF R  +  +  G +P+   LV WF+    RQ T E  +  +D   +K+  +++I+   
Sbjct  145   NEFIRTNREGILQGRIPVDDKLVCWFI---GRQWTPEDSRISKDPKLVKESAVQSIKA--  199

Query  642   DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGC  463
               P+++ E++  S+ +S+S   L+YR P ++LLG  RKG VTVAGDAMHVMGPFLGQGG 
Sbjct  200   -FPSEMVELVKNSDIDSVSLVRLRYRTPWDVLLGSFRKGRVTVAGDAMHVMGPFLGQGGS  258

Query  462   SSLEDAVVLARCLGSAAAVKNNVDGIEKEER----SARIEEALEKYVKERRMRVAQLSMH  295
             + LEDA+VLARCL    +    V+G ++  +    ++ +E AL++Y++ER+MR+ +LS  
Sbjct  259   AGLEDAIVLARCLVKEISSVVGVEGCQQRRKLMPETSVLEAALDRYIRERKMRIVRLSTQ  318

Query  294   TYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             TYL G  +  +  L + +    + + F N      YDCG+L
Sbjct  319   TYLTGLLLRTSVPLIRFSLLILLFVLFGNSLGHTRYDCGRL  359



>ref|XP_008645821.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X4 
[Zea mays]
Length=408

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 225/408 (55%), Gaps = 27/408 (7%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR +GG IGV  NGWR L+QLG+ + 
Sbjct  20    HGIVIVGGGICGLATALALHRKGIASLVLEKSEALRVDGGSIGVHVNGWRVLEQLGVAAE  79

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSS  1012
             LR                  E      + ++R + R DL+ ++A  +PAG IR GC V++
Sbjct  80    LR------------------ETANLVTAKELRWLKRKDLLETMAKDIPAGAIRLGCHVTA  121

Query  1011  V---DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV-VATRGLT  844
             +   D   V   T      G  I A++LIGCDG  S+VA+ LG+ P+K        RG T
Sbjct  122   IHPSDPGVVLTTTPAGGGGGGVIRAKVLIGCDGSNSVVAKYLGMSPSKPTPPRTYLRGFT  181

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDENAIKQM  670
             TY + H     F R       VG  P++   V +FV    P+   +      D    +  
Sbjct  182   TYRHGHPFGDRFLRLRGRRFFVGRSPMTDTRVSFFVACHVPSAATSSSSRVVDARDTRHA  241

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLS-FSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             V++ +   Q  PA+V E++  ++P+SL+  + + YRPP ++ L   RKG VTVAGDAMH 
Sbjct  242   VLQKLRD-QRCPAEVVEMVRDADPDSLNVVTRVWYRPPWQVALAAFRKGAVTVAGDAMHA  300

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR-IEEALEKYVKERRMR  316
             MG ++GQGG ++LEDA+VLAR L  A A          +E        A+ +YV+ERR+R
Sbjct  301   MGSYIGQGGSAALEDALVLARSLARARAAAAGGRDDGDDEPFLLGAATAIREYVRERRLR  360

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             VA+LS+  +++G  + A S   K+A    +AL          YDCG+L
Sbjct  361   VARLSLEAFVMGELLRAKSMATKLACMAILALLGTKALGHTNYDCGRL  408



>gb|AAM61460.1| monooxygenase [Arabidopsis thaliana]
Length=392

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/394 (37%), Positives = 219/394 (56%), Gaps = 14/394 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +I+IVG GI GLATAL LHR G++SIVLE S+ LR+ G  + +  N W+A++ LGI
Sbjct  4     ESTQDIIIVGAGISGLATALGLHRLGIRSIVLESSEQLRATGFALSLYFNAWKAMEALGI  63

Query  1200  GSHLRTVALPLQRG--RDIFLGEDKEQKI--EYVSGDVRCMARNDLIRSLADALPAGTIR  1033
               H+R++    Q    R I  G+  ++ +  E    +VRC+ R  L+ +LA  LP GTIR
Sbjct  64    SQHIRSLGDRFQGWVVRPISAGDPPKEMLFPESEEYEVRCIQRKLLLDALAGELPQGTIR  123

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             F  ++  ++     K   L  S+G+ ++ ++L+GCDG +S+V + LG K   +   VA R
Sbjct  124   FSSKLVHIELSGHYKMVHL--SDGTILKTKVLVGCDGVKSVVGKWLGFKNPVKTSRVAIR  181

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G+  +   H L   F + +   VR G +    + V+WF+T  +  L      ++   IKQ
Sbjct  182   GIAHFQTGHELGRRFFQFYGNGVRSGFISCDQNTVYWFLTHTSTDLD----KKNHQKIKQ  237

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V+    K++DLP  +K ++  ++ +SL  + L YRPP ELL   + K  V VAGDA+H 
Sbjct  238   FVLT---KIKDLPDNIKSILETTDLDSLVMNPLMYRPPWELLWANIAKDNVCVAGDALHP  294

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSA-RIEEALEKYVKERRMR  316
             M P +GQGGCS++ED V+LARCLG A   KN     E E  S  RIE+ L+KY   R+ R
Sbjct  295   MTPDIGQGGCSAMEDGVILARCLGEAMKAKNMKGETEDENESYRRIEDGLKKYAGSRKWR  354

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF  214
                L   +Y +G    +  K   +     M+ F 
Sbjct  355   SIDLITTSYTVGFIQQSRGKWMTLFRDKFMSSFL  388



>ref|XP_010436949.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=429

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 225/420 (54%), Gaps = 44/420 (10%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G++S+VLE S+ILR+ G       N W+A++ LG+  HL
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIRSMVLESSEILRATGFAFTTWFNAWKAMEALGVSQHL  67

Query  1188  RTVALPLQ-----------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             R++   LQ             +++   E +E        + RC+ R  L+ +LA  LP  
Sbjct  68    RSLHDRLQGWVVGSISAANPSKEMLFPESEEY-------ESRCVQRKLLLEALAGELPEE  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRF  +V  ++     K   L  S+G+ ++ ++LIGCDG  S+V + LG K       +
Sbjct  121   TIRFSSKVVHIELSGHYKMVHL--SDGTILKTKVLIGCDGLYSVVGKWLGFKNPATTSRL  178

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT +P  H     F + +   VR G +P  H+ V+WF+T  +  +  E    D   
Sbjct  179   AIRGLTHFPAGHGFGKRFFQFYGNGVRTGFIPCDHNTVYWFLTHSSTDIDEET---DPEI  235

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +K+ V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA
Sbjct  236   LKEFVLN---KIKDLPENIKSVVETTDLDSMVMSRLKYRPPWELLWSNITKDNVCVAGDA  292

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEALEKYVKER  325
             +H M P +GQGGCS++ED V+LARCLG A   KN     E EE S  RIE+ L+KY  ER
Sbjct  293   LHPMTPDIGQGGCSAMEDGVILARCLGEAIRAKNLKSETEDEEESHKRIEQGLKKYAGER  352

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF---------FRNGAAQNEYDCGQL  172
             + R   L    Y +G        L + + G  M LF          R    ++ +DCG L
Sbjct  353   KWRSIDLITTAYTVG--------LIQQSRGKWMNLFRDRFLSSFLSRLLLKKSHFDCGSL  404



>gb|KHN11493.1| 3-hydroxybenzoate 6-hydroxylase 1 [Glycine soja]
Length=421

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 234/416 (56%), Gaps = 23/416 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLAT+LALHR G++S+VLE S  LR  G  +    N W+ALD LG+G+ L
Sbjct  8     DIVIVGAGIAGLATSLALHRLGVQSLVLEYSDTLRVTGFALTTWTNAWKALDALGVGAIL  67

Query  1188  RTVALPLQRG--RDIFLGEDK-----EQKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R   + L+      + +G+       E   ++   +VRC+ R  ++ ++A+ LP+GTIRF
Sbjct  68    RHQHVQLKENVTTSLIMGQQTSSLSFEGTGKHGDCEVRCVRRQLMLEAIANVLPSGTIRF  127

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V +++    +K   + L++G+ I+ ++LIGCDG  S+VA+ LG K A   G    RG
Sbjct  128   LSKVVAIEESGFSKIKIVRLADGTTIKTKVLIGCDGINSVVAKWLGFKEASFTGRYVIRG  187

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQ  673
                  + H L  +F  +F    R G++P     V+WF+T+ PT +   ++   + + +KQ
Sbjct  188   YKKVMDNHGLEPKFMHYFGKGFRSGVMPCDDKTVYWFLTWTPTSE--EKELANNPSKMKQ  245

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
             +V+  +EK   +P+ +K  I  ++P+ +  S L+YR   EL+LG + KG V V GDA H 
Sbjct  246   LVLRKVEK---MPSNIKTFIEKTDPKDILTSPLRYRHQWELMLGNISKGNVCVVGDAFHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKE--------ERSARIEEALEKY  337
             M P LGQGGC +LED ++LAR L  A + K     + KE        E+  +I+ +L KY
Sbjct  303   MAPDLGQGGCCALEDGIILARYLAEAFS-KKTCKHVVKEMGEEGKAKEQYKKIDASLRKY  361

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
              KERR R   +S+ +Y++G  +    K+        +  F       ++++DCG+L
Sbjct  362   AKERRWRNIDISVTSYVLGFVLQGDLKMVAHFRDKVLPDFLAELLLKKSDFDCGKL  417



>ref|XP_008386050.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
 ref|XP_008349956.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=406

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 151/409 (37%), Positives = 228/409 (56%), Gaps = 21/409 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++++VLE+S  LR+ G  + + PN W ALD LG+  HL
Sbjct  7     DVVIVGAGIAGLATAVALKRAGVEALVLEKSDGLRATGAALTLFPNAWCALDALGVSQHL  66

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRSLADALPAGTIRFG  1027
              ++  P+++G   DI  GE +E      +G+     R + R  L+++LAD LP  +IRF 
Sbjct  67    TSLYAPIKKGYVTDIDTGEIQEVSFAASNGNDPVXPRSVNRKALLKTLADELPPNSIRFA  126

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++++++      +  + + + +G+ I+A+ILIGCDG  S+VA  LGL      G  A R
Sbjct  127   SKLTAIETQEHEGSSISVIHMGDGTIIKAKILIGCDGIHSVVARWLGLAEPVYSGRWAVR  186

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  +P  H L     ++   + R G +P++   ++WF  F T    G     +   I+Q
Sbjct  187   GLAVFPEGHRLDYNVQQYVGLNRRAGFVPLNDKEIYWF--FGTSPAKGTDLGDEPEVIRQ  244

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  DLP    +++  S+  +LS++ L +R P  ++ G L K  +TVAGDAMH 
Sbjct  245   EVIENYAK--DLPPIYLDIVQHSDLSTLSWAPLMFRYPWNVVFGNLGKQNITVAGDAMHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +G++      +  + KE     I+ A+ KYV+ERR RV
Sbjct  303   MTPDLGQGGCLALEDAVVLGRYIGTSFVQNGRL--VPKE-----IDSAIGKYVEERRWRV  355

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMA--LFFRNGAAQNEYDCGQL  172
             A L+  +YL G          +     A+     F      + YDCG+L
Sbjct  356   ALLTAGSYLSGWVQHLGPGWVRKFLRDAIFYRFIFTKLVKLSHYDCGKL  404



>ref|XP_006299765.1| hypothetical protein CARUB_v10015961mg [Capsella rubella]
 gb|EOA32663.1| hypothetical protein CARUB_v10015961mg [Capsella rubella]
Length=406

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 230/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +S  +I+IVG GI GLATAL LHR G++SIVLE S+ LR+ G  I +  N W+A++ LGI
Sbjct  4     ESTQDIIIVGAGISGLATALGLHRLGIRSIVLESSEKLRATGFAISLYFNAWKAMEALGI  63

Query  1200  GSHLRTVALPLQRG--RDIFLGEDKEQKI--EYVSGDVRCMARNDLIRSLADALPAGTIR  1033
               H+R++    Q    R I  G+  ++ +  E    +VRC+ R  L+ +LA  LP GTIR
Sbjct  64    SQHVRSLGDRFQGWVVRPISSGDPPKEMVFQESEEYEVRCVQRKLLLEALAGELPEGTIR  123

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             F  ++  ++     K   L  S+G  ++ ++L+GCDG +S+V + LG K   +   +  R
Sbjct  124   FSSKLVHIELSGHYKMVHL--SDGIILKTKVLVGCDGVKSVVGKWLGFKNPAKSPRLEIR  181

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GLT +P  H L   F + +   VR G +    + V+WF+T  +  L      ++   IKQ
Sbjct  182   GLTHFPTGHGLGRRFFQFYGKGVRSGFISCDQNTVYWFLTHTSTDLD----KKNHENIKQ  237

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V+    K++DLP  +K ++  ++ ++L  S LKYRPP ELL   + K  V VAGDA+H 
Sbjct  238   FVLA---KIKDLPDNIKSIVETTDLDNLVMSPLKYRPPWELLWANIAKDNVCVAGDALHP  294

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIE-KEERSARIEEALEKYVKERRMR  316
             M P +GQGGCS++ED V+LARCLG A   +     IE K+E   RIE+ L KY +ERR R
Sbjct  295   MTPDIGQGGCSAMEDGVILARCLGEAMKAEYIKGEIEDKDENYKRIEDGLNKYARERRWR  354

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-GAAQNEYDCGQL  172
                L   +Y IG    +  K   +     ++ F       ++ ++CG+L
Sbjct  355   SIDLITTSYTIGFIQQSRGKWMALFRDKFLSSFLSWLLMKKSHFNCGKL  403



>ref|XP_006358984.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=408

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 159/421 (38%), Positives = 226/421 (54%), Gaps = 36/421 (9%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++  IVIVG GI GLAT+LALHR GL+SIVLE +  LR+ G  + +  N WRALD L I
Sbjct  3     ETEENIVIVGAGIAGLATSLALHRLGLRSIVLESADSLRATGFALALWTNAWRALDALDI  62

Query  1200  GSHLRTVALPL--------QRGRDI----FLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             G  LR  +L +          G  I    F+G +    +EY S   RC+ R DL+ +LA+
Sbjct  63    GDSLRQRSLSITGLKSFSADSGAPIKEVSFVGNN---SVEYES---RCVRRKDLLETLAN  116

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP G IR+  +V S++     K     L++GS I  + LIGCDG  S+VA  LGL+   
Sbjct  117   ELPQGAIRYSSKVDSIEESGPLKLVH--LADGSTIRTKALIGCDGVNSVVANWLGLQKPV  174

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RG   YP  H    +FH +F G VR G LP     ++WF TF P+        
Sbjct  175   YSGRSAIRGFVEYPEKHGYQPKFHAYFGGGVRFGFLPSDEKSLYWFCTFTPSVVHFDGNA  234

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              +D   +KQ V   + K  ++  ++  +I  +  + +S + LK R P  +LLG + K  V
Sbjct  235   EQDPMKLKQFV---LNKASNVSKELSTIIDRTTLDCISIAQLKLRLPWNVLLGNILKNNV  291

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              V GDA+H M P LGQGGCS+LED+VV+A+CLG  A +K   +  ++++ S +I + LEK
Sbjct  292   CVVGDALHPMTPDLGQGGCSALEDSVVIAKCLGE-ALIKPITE--QEDDESTKIRKGLEK  348

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAK-----MAFGGAMALFFRNGAAQNEYDCGQ  175
             Y KERR R        YL G    + +K+          G  +++  R       +DCG+
Sbjct  349   YAKERRWRSFTFISAAYLSGFIQESDNKIISFLRQHFLAGVTISVTLRIA----NFDCGR  404

Query  174   L  172
             L
Sbjct  405   L  405



>emb|CDP09665.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   234 bits (597),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 226/412 (55%), Gaps = 19/412 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLAT+L LHR GL+S+VLE S+ LR+ G  + +  N WR+LD LG+G +L
Sbjct  6     DIVIVGAGISGLATSLGLHRYGLQSLVLESSESLRTTGFALTLWTNAWRSLDALGVGDYL  65

Query  1188  RTVALPLQRGRDIF-------LGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             R ++L   RG  I         GE   ++  Y + + RC+ R DL+++LA  LP GTIR+
Sbjct  66    RQLSLAF-RGFQIANVDTGLPSGEVLLEESTYGNYEARCVRRKDLLQTLAKELPEGTIRY  124

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V S++     K     L++G  I A++LIGCDG  S+VA+ LG K     G  A RG
Sbjct  125   SSKVVSIEESGHLKLVH--LADGCVIRAKVLIGCDGVNSVVAKWLGFKKPIRVGRSAIRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTG-EKFPRDENAIKQ  673
                +P AH    + + +F G VR G  P     ++WF TF     TG E    +   +K+
Sbjct  183   YVEFPAAHGFKPQIYAYFGGGVRFGFAPCDDKSIYWFCTFKPSTATGHENMSDNPVLLKE  242

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V   + K  ++P +V  ++  +E ES+S + LK R P ++L+    K ++ + GDA+H 
Sbjct  243   FV---LRKTANVPKEVYGIVERTELESISCAELKMRLPWDILIRDFAKSSICLVGDALHP  299

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSA-AAVKNNVDGIEKEE---RSARIEEALEKYVKER  325
             M P LGQGG S+LED ++LARC+G     + +   G EKE+   + A   + LE Y KER
Sbjct  300   MTPDLGQGGSSALEDCIMLARCIGECFPKMTSRKFGEEKEDVNVKMAAFNKGLENYAKER  359

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
             R R   L    +++G    + +K  +      ++ +         ++DCG+L
Sbjct  360   RWRSFSLIATAFVVGFIQESDNKFIRFLRERFLSKYTVPTLLWMADFDCGKL  411



>ref|XP_010930471.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Elaeis guineensis]
Length=315

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 188/312 (60%), Gaps = 9/312 (3%)
 Frame = -2

Query  1101  VRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDG  922
             +RC+ R+DLI +LA  LP G+IRFGC++ +V+ D ++ F  L  ++G+ I+A++LIGCDG
Sbjct  11    LRCLKRSDLIETLAKNLPVGSIRFGCQIVAVELDPLSSFPILYANDGATIKAKVLIGCDG  70

Query  921   GRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGD-VRVGILPISHDLVH  745
               S++A+ L L+  K   + A RG T+Y   HS    F R  +GD V  G LPI   LVH
Sbjct  71    SNSVIAKSLELQAPKVCPISAVRGFTSYSYGHSFDSHFIR-LRGDGVAFGRLPIDEKLVH  129

Query  744   WFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYr  565
             WFV     Q       +D   IK++    +E L++ P +V E++   +  SLS +H++YR
Sbjct  130   WFVGRLCPQ--DSIVQKDPELIKKV---TLEMLKEFPPEVIEMVEHCDSSSLSLTHIRYR  184

Query  564   ppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGI  385
              P  L      +GT+TVAGDAMHVMGPFLGQGG + LEDA+VLARC+     +       
Sbjct  185   APWHLFFANFWQGTMTVAGDAMHVMGPFLGQGGSAGLEDAIVLARCIAQEMPMGPE-GAT  243

Query  384   EKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG  205
                E   RI  AL KYVKERR+R+ +LS  +YL G+ + A+S + K+     + +F R G
Sbjct  244   SDREMVKRIGIALSKYVKERRLRIIRLSTQSYLTGSVITASSWVRKLICLAMLIVFLRGG  303

Query  204   A-AQNEYDCGQL  172
             + + + YDCG L
Sbjct  304   SLSHSNYDCGSL  315



>gb|KEH43301.1| FAD/NAD(P)-binding oxidoreductase family protein [Medicago truncatula]
Length=408

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 237/412 (58%), Gaps = 23/412 (6%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + +IVIVG GI GL T+LALHR G++S+VLE S  LR  G  + +  N W+ALD +G+G+
Sbjct  6     EEDIVIVGAGIAGLTTSLALHRLGVESLVLESSDSLRVGGFALTLWENAWKALDVVGVGN  65

Query  1194  HLRTVALPLQR--------GRDIFLGEDKEQKI-EYVSGDVRCMARNDLIRSLADALPAG  1042
              LR   L L R        G+       K++K+ ++   +VRC+ R  L+ +LA  LP+G
Sbjct  66    ILRHQHLQLHRLVTTTLITGQQTSTTSFKDRKLAKHGPYEVRCVRRQLLLEALASELPSG  125

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIR+  +V ++       F  L L++G+ I+ ++LIGCDG  S+VA+ LG K A   G  
Sbjct  126   TIRYLSKVVAIQESGF--FKILHLADGTTIKTKVLIGCDGVNSLVAKWLGFKEASYTGRY  183

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDEN  685
             A RG +     H L   F ++F    R G LP +   V+WF T+ PT Q   ++  +D  
Sbjct  184   AARGYSECETNHELEPMFMQYFGKGFRAGALPCNEKGVYWFFTWTPTSQ--EKELLQDPA  241

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +K+ V++ +EK   +P+ V+  I  +E ++   + L+YR P EL++G + KG V V GD
Sbjct  242   KLKEYVLKKLEK---MPSDVRSFIENTEIDAFHSAPLRYRNPWELIMGNISKGNVCVVGD  298

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             A+H M P L QGGCS+LED VVLARCL    + +     +++E+   RIEE L+KY KER
Sbjct  299   ALHSMAPDLAQGGCSALEDGVVLARCLAEIFSKR-----LKEEDEYKRIEEGLKKYAKER  353

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG-AAQNEYDCGQL  172
             R R   L   +Y++G+     SKL        +A F  +    ++++DCG+L
Sbjct  354   RWRSIDLIGRSYVVGSIQQGGSKLVNFFRDKILATFLAHQLLKKSDFDCGKL  405



>ref|XP_003536718.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
Length=412

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/417 (36%), Positives = 232/417 (56%), Gaps = 25/417 (6%)
 Frame = -2

Query  1383  TDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLG  1204
             T+   +IVIVG GI GL T+L LH+ G++S+VLE S  LR  G  + +  N W+ALD +G
Sbjct  3     TEVVEDIVIVGAGIAGLTTSLGLHKLGIRSLVLESSDTLRVTGFALSIWENAWKALDTVG  62

Query  1203  IGSHLRTVALPL-----------QRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             +G  LR   L L           Q+  D+   E   Q+    + ++RC+ R  L+ +LA+
Sbjct  63    VGDFLRHQHLQLNGIVTTSLVTGQQTSDMPFTETGNQQ---RNREIRCVKRKLLLEALAN  119

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP+ TIR+  +V +++     K   L  ++G+ I+ ++LIGCDG  SIVA+ LG K A 
Sbjct  120   ELPSDTIRYLSKVVAIEESGFYKIVHL--ADGTTIKTKVLIGCDGVNSIVAKWLGFKNAS  177

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RG     + H L   F + F    R G++P   ++V+WF T+ P  Q   ++ 
Sbjct  178   FTGRYAIRGCAEVQSNHGLEPRFMQFFGKGFRAGVIPCDGNVVYWFFTWTPNNQ--DKEL  235

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
               +   +K+ V+    KL+++P+ V+  I  +E ++   + L+YR P EL+ G + KG +
Sbjct  236   EENPAKLKEHVLN---KLENMPSDVRYYIEKTEIDAFQLAPLRYRHPWELMFGNISKGNI  292

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              V GDA H M P LGQGGC +LED +VLARCL  AAA   ++   ++E++  RIE +L+K
Sbjct  293   CVGGDAFHPMTPDLGQGGCCALEDGIVLARCL--AAAFSKHIKEKDEEDQFKRIEGSLKK  350

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE-YDCGQL  172
             Y KERR R   +    Y++G+   A SKL        +A F  +   +   YDCG+L
Sbjct  351   YAKERRWRSIDVIATAYMVGSIQQAESKLVTFLRDNILAAFLASQLFKKSGYDCGKL  407



>ref|XP_010230267.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Brachypodium 
distachyon]
Length=407

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/408 (37%), Positives = 224/408 (55%), Gaps = 13/408 (3%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             D+  ++VI G G+ GLA AL LHRKG++S+VLE S   R+ G       N +RALD LG+
Sbjct  8     DAAADVVIAGAGLAGLAVALGLHRKGVRSVVLESSPERRTSGFAFFTWTNAFRALDALGV  67

Query  1200  GSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             G  +R   L LQ  R +     +  +   +  +VRC+ RN L+++L + LPAGTIR+  +
Sbjct  68    GDKMRGRHLQLQGLRVMSSSTGEIAREMDLQDEVRCVQRNVLLQALEEELPAGTIRYSSK  127

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             + S+D +       L L++GS ++A++LIGCDG  S+VA+ LGL    E G  ATRG   
Sbjct  128   IVSIDDEGGDAKKLLHLADGSTLKAKVLIGCDGINSVVAKWLGLAKPSESGRTATRGHAK  187

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTG-EKFPRDENAIKQMVI  664
             YP+ H    +F +      R G++P S   V+WF T+      G +   +  +A+KQ V+
Sbjct  188   YPDGHGFEPKFLQFVGEGFRAGMVPCSDTDVYWFFTWSPSTANGTDGVDQSPSAMKQFVL  247

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +   +  P +V E +  SE   +  + L++R P  LLL  + KG V VAGDA+H   P
Sbjct  248   SKLRSAKVTP-QVLEAVERSEMSDVLAAPLRFRAPLSLLLASISKGNVCVAGDALHPTTP  306

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQL  304
              L QG C++LED VVLARCLG A       +G  +EE+  RI+ AL KY   RR R AQ+
Sbjct  307   DLAQGACTALEDGVVLARCLGDAIV---GEEGGAREEKE-RIKAALRKYAGIRRWRSAQV  362

Query  303   SMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                +Y++G    +     S +      G +A   +      +YDCG+L
Sbjct  363   IAASYVVGFVQESDHPVVSFVRDKMLSGVLA---KTLLMMPDYDCGKL  407



>ref|XP_007199878.1| hypothetical protein PRUPE_ppa006383mg [Prunus persica]
 gb|EMJ01077.1| hypothetical protein PRUPE_ppa006383mg [Prunus persica]
Length=414

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 234/420 (56%), Gaps = 35/420 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLAT+L LHR G++S+VLE S  LR+ G  +    N W+ALD LG+   L
Sbjct  6     DVVIVGAGISGLATSLGLHRLGIRSLVLESSDSLRTTGFALTTWTNAWKALDALGLADSL  65

Query  1188  RTVALPLQ--------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             R   +PL          G   F    K  K ++ + ++RC+ RN L+  LA+ LP+GTIR
Sbjct  66    RQQHVPLDGNVTSSRITGLQTFEMSFK-AKGKHGNHEIRCVKRNLLLEGLANELPSGTIR  124

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             F  +V SVD     K   L  ++G+ ++A++L+GCDG  S+VA+ LG K     G  A R
Sbjct  125   FSSKVVSVDESGYFKLVHL--ADGTILKAKVLVGCDGVNSVVAKWLGFKQPAFTGRSAIR  182

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIK  676
             G  T+ ++H +  +F+++F   +R G +P     V+W++T+ P+ Q   ++   +   +K
Sbjct  183   GCATFKSSHGVDPKFNQYFGNGIRSGAIPCDDTNVYWYITWTPSSQ--EKELEENPAQLK  240

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             Q ++    KL  +P KVK V+  +E ++   S L+YR P ELL G + KG   VAGDA+H
Sbjct  241   QYMLS---KLGKIPDKVKAVVENTELDAFISSPLRYRHPWELLWGNISKGNACVAGDALH  297

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEE--------RSARIEEALEK  340
              M P +GQGGC +LED+VVL+RCLG  A +KN+  G E+++           RIE  L K
Sbjct  298   PMTPDIGQGGCCALEDSVVLSRCLGE-ALLKNS--GGERKDKEGEEGKEEYERIEMGLNK  354

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAKM----AFGGAMALFFRNGAAQNEYDCGQL  172
             Y  ERR R   L   + ++G    +  K         F   MA        ++++DCG+L
Sbjct  355   YANERRWRSFDLISTSRVVGFLQESNGKFMNFFRDKFFSPIMAGLL---LKKSDFDCGKL  411



>ref|XP_006299566.1| hypothetical protein CARUB_v10015741mg [Capsella rubella]
 gb|EOA32464.1| hypothetical protein CARUB_v10015741mg [Capsella rubella]
Length=433

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 158/437 (36%), Positives = 237/437 (54%), Gaps = 39/437 (9%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME+  ++ +IVIVG GI GLATA+ LHR G++S VLE S+ LR+ G  +    N W+AL+
Sbjct  1     MEAEGTR-DIVIVGAGISGLATAVGLHRLGIRSTVLESSEKLRATGFALSTYFNAWKALE  59

Query  1212  QLGIGSHLRTV---------------------ALP-LQRG---RDIFLGEDKEQKIEYVS  1108
              LGI  HLR +                      LP  + G     +++   K++K   +S
Sbjct  60    ALGISQHLRDLHDRLHGWMVGPISAETPPKEMLLPDFEYGFLLDGLYIITTKKEKFLTLS  119

Query  1107  GDVRCM--ARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEI-L  937
              ++      R  L+ +LA  LP GTIRF  ++  +++    ++  + LS+GS ++ ++ L
Sbjct  120   VEMVLQENMRKMLLEALASELPEGTIRFLSKLVHIEFSG--RYKMVHLSDGSVLKTKVVL  177

Query  936   IGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISH  757
             +GCDG  S+VA+ LG K       +A RGL  +P  H     F + +   VR G +P +H
Sbjct  178   VGCDGVNSVVAKWLGFKNPVTTNRLAIRGLAHFPTGHGFEKRFFQFYGNGVRSGFVPCNH  237

Query  756   DLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSH  577
             + V+WFVT  +  L  E  P +   IKQ V++ I   +DLP  +K V+  ++ +++  S 
Sbjct  238   NSVYWFVTHTSTNLAEETSPEN---IKQFVLDMI---RDLPKNIKNVVETTDLDNMVMSR  291

Query  576   LKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNN  397
             LKYRPP ELL   + K  V VAGDA+H M P +GQGGCS++ED V+LARCLG A   KN 
Sbjct  292   LKYRPPWELLWANIAKDNVCVAGDALHPMTPDIGQGGCSAMEDGVILARCLGEAIKFKNL  351

Query  396   VDGIEKEERS-ARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMAL  220
                 E E+ S  RIE  L+KY  +R+ R  +L M +Y++G    +  K   +     +  
Sbjct  352   KGETEDEKESYKRIEVGLKKYAGQRKWRSIELIMASYIVGFIQQSRGKCMNLFTDMFLRS  411

Query  219   FF-RNGAAQNEYDCGQL  172
             F  R     + +DCG L
Sbjct  412   FLSRLRLKMSHFDCGSL  428



>ref|XP_003558784.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Brachypodium 
distachyon]
Length=403

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 223/419 (53%), Gaps = 28/419 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M+  D+  +IVIVG G+ GLA AL LHRKG++S+VLE S +LR+ G       N +RALD
Sbjct  1     MKQQDAAEDIVIVGAGLAGLAVALGLHRKGVRSVVLESSPVLRTSGFAFMTWTNAFRALD  60

Query  1212  QLGIGSHLRTVALPLQ--RGRDIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADA  1054
              LG+G  +R+  L +Q  R      GE   +    V G     + RC+ RN L+++L + 
Sbjct  61    ALGVGDKMRSQHLQVQGVRVMSSSTGEVAREIDLRVQGKLGPHEARCVQRNVLLQALEEE  120

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP GTIR+  +++S+D D   K     L++GS + A++LIGCDG  S+VA+ LGL    +
Sbjct  121   LPRGTIRYSAKIASIDEDGDVKIIH--LADGSTLRAKVLIGCDGINSVVAKWLGLAKPCD  178

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFP  697
              G  ATRG   YP+ H    +F +      R G++P     V+WF+T+ P+    G +  
Sbjct  179   SGRTATRGHAKYPDGHGFEPKFMQFTGNGFRAGLVPCGLTDVYWFLTWSPSPNKEGIEHQ  238

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
                 A+KQ V+  +  + + P++V E +  SE   +  + L+YRPP  LL   + KG   
Sbjct  239   ESAAAMKQFVLGKLRSI-NAPSEVLEAVERSEMNDVLVAPLRYRPPLSLLFANISKGNAC  297

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDA+H   P L QG C +LED VVLARCLG A A                +E AL++Y
Sbjct  298   VAGDALHPTTPDLAQGACQALEDGVVLARCLGDAMAGGGG----------ESVEAALQRY  347

Query  336   VKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                RR R AQ+   +Y++G    +  AA   +      G +A          +YDCG L
Sbjct  348   AGLRRWRSAQVIAASYMVGLMQQSENAALRFVRDRLLSGVLAKVL---LMMPDYDCGTL  403



>ref|XP_006358986.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=407

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 158/421 (38%), Positives = 224/421 (53%), Gaps = 36/421 (9%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++  IVIVG GI GLAT+LALHR GL+SIVLE +  LR+ G  + +  N WRALD L I
Sbjct  2     ETEENIVIVGAGIAGLATSLALHRLGLRSIVLESTDSLRATGFALALWTNAWRALDALDI  61

Query  1200  GSHLRTVALPL--------QRGRDI----FLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             G  LR  +L +          G  I    F+G +    +EY S   RC+ R DL+ +LA+
Sbjct  62    GDSLRQRSLSITGLKSFSADSGAPIKEVSFVGNN---SVEYES---RCVRRKDLLETLAN  115

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP G IR+  +V S++     K     L++GS I  + LIGCDG  S+VA  LGL+   
Sbjct  116   ELPQGVIRYSSKVDSIEESGPLKLVH--LADGSTIRTKALIGCDGVNSVVANWLGLQKPV  173

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RG   YP  H    +FH +F G VR G LP     ++WF TF P+        
Sbjct  174   YSGRSAIRGFVEYPEKHGYQPKFHAYFGGGVRFGFLPSDEKSLYWFCTFTPSVVHFDGNA  233

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              +D   +KQ V   + K  ++  ++  VI  +  + +S + LK R P  +L G + K  V
Sbjct  234   EQDPMKLKQFV---LNKASNVSKELSTVIERTTLDCISVAQLKLRLPWNVLFGNILKNNV  290

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              V GDA+H M P LGQGGCS++ED+VV+A+CLG  A +K   +  ++++ S  I + LEK
Sbjct  291   CVVGDALHPMTPDLGQGGCSAVEDSVVIAKCLGE-ALIKPITE--QEDDESMNIRKGLEK  347

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAK-----MAFGGAMALFFRNGAAQNEYDCGQ  175
             Y KERR R        YL G    + +K+          G  +++  R       +DCG+
Sbjct  348   YAKERRWRSFTFISAAYLSGFIQESDNKIISFLRQHFLAGVTISVTLRIA----NFDCGR  403

Query  174   L  172
             L
Sbjct  404   L  404



>ref|XP_006301569.1| hypothetical protein CARUB_v10022007mg [Capsella rubella]
 gb|EOA34467.1| hypothetical protein CARUB_v10022007mg [Capsella rubella]
Length=406

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 148/383 (39%), Positives = 217/383 (57%), Gaps = 31/383 (8%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME+ D + +IVIVG GI GLATA+ LHR G++S+VLE S+ LR+ G  +    N W+A+D
Sbjct  1     MEAEDIQ-DIVIVGAGISGLATAVGLHRLGIRSMVLESSEQLRATGFALITWFNAWKAMD  59

Query  1212  QLGIGSHLRTVALPLQRG-----------RDIFLGEDKEQKIEYVSGDVRCMARNDLIRS  1066
              LG+  H+R +   LQ             +++   E +E        + RC+ R  L+ +
Sbjct  60    ALGVSQHIRNLHDRLQGWVVGPISSENPPKEMLFPESEEY-------EARCVQRKLLLEA  112

Query  1065  LADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
             LA  LP GTIRF  ++  ++     K   L  S+G+ ++A++L+GCDG  S+V + LG K
Sbjct  113   LACELPEGTIRFSSKLVHIELSGHYKMVHL--SDGTILKAKVLVGCDGVNSVVGKWLGFK  170

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
               +    +A RG T +P  H     F + +   VR G +P   + VHWF+T  +  L  E
Sbjct  171   NPETTSRLAIRGFTHFPTGHGFGKRFFQFYGNGVRSGFIPCDQNTVHWFLTHSSTDLDEE  230

Query  705   KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKG  526
                 +   +KQ V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K 
Sbjct  231   T---NTETMKQFVLN---KIKDLPEDIKTVVATTDLDSMVMSRLKYRPPWELLWANIVKD  284

Query  525   TVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEA  349
              V VAGDA+H M P +GQGGCS++ED V+LARCLG A  +K      E E++S  RI E 
Sbjct  285   NVCVAGDALHPMTPDIGQGGCSAMEDGVILARCLGEAKDLKGET---EDEDKSYKRIGEG  341

Query  348   LEKYVKERRMRVAQLSMHTYLIG  280
             L+KY KER+ R   L    Y++G
Sbjct  342   LKKYAKERKWRSIDLITTAYIVG  364



>ref|XP_002866806.1| hypothetical protein ARALYDRAFT_490619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43065.1| hypothetical protein ARALYDRAFT_490619 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 225/412 (55%), Gaps = 28/412 (7%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
             I+IVG GI GL+TA+ LHR G+KS+VLE S+ LR+ G  +    N W+A++ L +  H+R
Sbjct  9     IIIVGAGISGLSTAVGLHRLGIKSMVLESSEKLRATGFALTTYFNAWKAMEALDVAQHIR  68

Query  1185  T--------VALPLQRG---RDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGT  1039
             T        V  P+  G   +++   E +E        + RC+ R  L+ +LA  LP  T
Sbjct  69    TLHDRLQGWVVGPISAGNPSKEMLFPESEEY-------ESRCIHRKLLLEALAGELPEET  121

Query  1038  IRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             IR+  +V  +D     ++  + LS+G+ ++ ++L+GCDG  S+V + LG K       +A
Sbjct  122   IRYSSKVVHIDLSG--RYKMVHLSDGTILKTKVLVGCDGVYSVVGKWLGFKNLATTARLA  179

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAI  679
              RGLT +P  H    +F + +   VR G +   H+ V+WF+T  +  +  E  P     +
Sbjct  180   IRGLTHFPEGHGFGKKFFQFYGDGVRSGFVTCDHNTVYWFLTHTSTDIDEETNPE---IL  236

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             K+ V+    K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA+
Sbjct  237   KEFVLN---KIKDLPENIKNVVETTDLDSMVMSRLKYRPPWELLWSNITKDNVCVAGDAL  293

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H M P +GQGGCS++ED V+LARCLG A   KN   G  +EE   RIE  L+KY  ER+ 
Sbjct  294   HPMTPDIGQGGCSAMEDGVILARCLGEAIKAKNQ-KGETEEESYKRIEGGLKKYAGERKW  352

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL*P  166
             R   L    Y +G    +  K   M     ++ +  R    ++ +DCG L P
Sbjct  353   RSIDLITTAYTVGFIQQSRGKWMNMLRDRFLSSYLSRTLLKKSHFDCGSLVP  404



>ref|XP_009787875.1| PREDICTED: uncharacterized protein LOC104235761, partial [Nicotiana 
sylvestris]
Length=243

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 157/257 (61%), Gaps = 14/257 (5%)
 Frame = -2

Query  942  ILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPI  763
            ILIGCDG RS+V+  LG+KP K   V A RGLT+YPN HS P+EF R   G  + GILPI
Sbjct  1    ILIGCDGSRSVVSSFLGVKPTKTLRVAAIRGLTSYPNGHSFPLEFVRLISGHTKFGILPI  60

Query  762  SHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSF  583
            +  LVHWF+       T  KFP+D   IKQ     +E   D P  V+E+I   + +SLSF
Sbjct  61   TDKLVHWFINL--HHGTDTKFPQDAELIKQTA---LEATSDHPKHVQEIIEGCDLDSLSF  115

Query  582  SHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK  403
             HL+Y  P  L+LG   + TVTVAGDAMHVMGPFLGQGG + +EDAVVLAR L  A  +K
Sbjct  116  FHLRYHEPWNLMLGNFSENTVTVAGDAMHVMGPFLGQGGSAGIEDAVVLARNL--AKTLK  173

Query  402  NNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMA  223
               D         ++ EAL++Y+KERRMRV +L+   YL    +     L K     AMA
Sbjct  174  GGFD-------HEKVGEALDQYIKERRMRVVKLATQAYLTALLIEDRPMLTKKFVTAAMA  226

Query  222  LFFRNGAAQNEYDCGQL  172
            LFF+N  A  +YDCG L
Sbjct  227  LFFKNPFAHVQYDCGHL  243



>ref|XP_002468485.1| hypothetical protein SORBIDRAFT_01g046710 [Sorghum bicolor]
 gb|EER95483.1| hypothetical protein SORBIDRAFT_01g046710 [Sorghum bicolor]
Length=407

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/409 (38%), Positives = 231/409 (56%), Gaps = 18/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVI G G+ GLATAL LHRKG++ +VLE S  LR+ G       N +RALD LG+G  +
Sbjct  7     DIVIAGAGLAGLATALGLHRKGVRCLVLESSPTLRASGFAFNTWTNAFRALDALGVGDKI  66

Query  1188  RTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAGTIRF  1030
             R   L  +R        GE   +   KI+  SG  ++RC+ R+ L+++LA+ LP GTIR+
Sbjct  67    REHHLLYERMIAFSAATGEAAAEVSLKIQGKSGPHEIRCVKRDFLLQTLANELPEGTIRY  126

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               ++++++ D  +  T L L++GS I+A+++IGCDG  S+VA+ LGL      G  ATRG
Sbjct  127   SSKLAAMEEDDGSVKT-LHLADGSIIKAKVVIGCDGVNSVVAKWLGLPKPILSGRSATRG  185

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             L  YP  H    E  +      R G+LP S   V+W  T+      G+     E ++ +M
Sbjct  186   LAEYPAGHGFGPEILQFIGHGFRSGVLPCSDTSVYWNYTWYPSPADGDA----EESVAKM  241

Query  669   VIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
                 + KL+   +PA+  EVI  SE   ++ S L++R P  L+ G + +G V VAGDA+H
Sbjct  242   RSHVVGKLRGAKIPAEALEVIERSEMSDVASSPLRFRSPLALVRGSISRGGVCVAGDALH  301

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
              M P LGQGGC++LED VVLARCLG A    ++  G ++++   R   ALEKY + RR R
Sbjct  302   PMTPELGQGGCAALEDGVVLARCLGEAF---SHGHGHDEQDEGRRFTAALEKYAEARRWR  358

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
               QL    Y++G    + + + +      ++ L  +   A  +YDCG L
Sbjct  359   SIQLITAAYVVGFIQQSNNAVIRFLRDKFLSRLLSKTLVAMADYDCGTL  407



>ref|NP_001049002.1| Os03g0154100 [Oryza sativa Japonica Group]
 gb|ABF94042.1| FAD binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10916.1| Os03g0154100 [Oryza sativa Japonica Group]
Length=406

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 223/408 (55%), Gaps = 20/408 (5%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
             IVI G G+ GLATAL LHRKG++S+VLE S  LR+ G       N +RALD LG+G  +R
Sbjct  9     IVIAGAGLAGLATALGLHRKGVRSLVLESSATLRASGFAFTTWTNAFRALDALGVGDKIR  68

Query  1185  TVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAGTIRFG  1027
                L  +R        GE   +   K++  SG  ++RC+ RN L+ +L + LP GTIRF 
Sbjct  69    EHHLLYERLLAFSASTGEPAAKLSLKMQGKSGPHEIRCVKRNFLLETLENELPEGTIRFS  128

Query  1026  CEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
              ++ S++ D   K   L LS+GS I A++LIGCDG  S+VA+ LGL      G  ATRGL
Sbjct  129   SKIVSIEEDGNVKL--LHLSDGSTIRAKVLIGCDGVNSVVAKWLGLPKPILSGRSATRGL  186

Query  846   TTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMV  667
               YP  H    E  +      R G+LP S   V+W  T+      G+     E ++ +M 
Sbjct  187   AEYPAGHGFGPEILQFIGQGFRSGVLPCSDTSVYWNYTWYPSPDDGDA----EESVAKMR  242

Query  666   IENIEKLQD--LPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
                + KL+   +PA+  +VI  SE   +  S L++R P  L+ G + +G V VAGDA H 
Sbjct  243   SYVVAKLRAARIPAEALDVIERSEMSDVVSSPLRFRSPLALVRGSISRGNVCVAGDAFHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
               P LGQGGC++LED VVLARCL  A       DG E +     ++ ALEKY +ERR R 
Sbjct  303   TTPELGQGGCAALEDGVVLARCLSEAFL----ADGAEHDPGYEAVKAALEKYAEERRWRG  358

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
              +L    Y++G    +T+ + K      ++ L  +   A  +YDCG+L
Sbjct  359   IRLITAAYVVGFIQQSTNPVIKFLREKFLSGLLAKTMIAMADYDCGKL  406



>gb|EEC74541.1| hypothetical protein OsI_10065 [Oryza sativa Indica Group]
Length=406

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 223/408 (55%), Gaps = 20/408 (5%)
 Frame = -2

Query  1365  IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLR  1186
             IVI G G+ GLATAL LHRKG++S+VLE S  LR+ G       N +RALD LG+G  +R
Sbjct  9     IVIAGAGLAGLATALGLHRKGVRSLVLESSATLRASGFAFTTWTNAFRALDALGVGDKIR  68

Query  1185  TVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAGTIRFG  1027
                L  +R        GE   +   K++  SG  ++RC+ RN L+ +L + LP GTIRF 
Sbjct  69    EHHLLYERLLAFSASTGEPAAKLSLKMQGKSGPHEIRCVKRNFLLETLENELPEGTIRFS  128

Query  1026  CEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
              ++ S++ D   K   L LS+GS I A++LIGCDG  S+VA+ LGL      G  ATRGL
Sbjct  129   SKIVSIEEDGNVKL--LHLSDGSTIRAKVLIGCDGVNSVVAKWLGLPKPILSGRSATRGL  186

Query  846   TTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMV  667
               YP  H    E  +      R G+LP S   V+W  T+      G+     E ++ +M 
Sbjct  187   AEYPAGHGFGPEILQFIGQGFRSGVLPCSDTSVYWNYTWYPSPDDGDA----EESVAKMR  242

Query  666   IENIEKLQD--LPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
                + KL+   +PA+  +VI  SE   +  S L++R P  L+ G + +G V VAGDA H 
Sbjct  243   SYVVAKLRAARIPAEALDVIERSEMSDVVSSPLRFRSPLALVRGSISRGNVCVAGDAFHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
               P LGQGGC++LED VVLARCL  A       DG E +     ++ ALEKY +ERR R 
Sbjct  303   TTPELGQGGCAALEDGVVLARCLSEAFL----ADGAEHDLGYEAVKAALEKYAEERRWRG  358

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
              +L    Y++G    +T+ + K      ++ L  +   A  +YDCG+L
Sbjct  359   IRLITAAYVVGFIQQSTNPVIKFLREKFLSGLLAKTMIAMADYDCGKL  406



>ref|XP_008645818.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Zea mays]
 gb|AFW71845.1| hypothetical protein ZEAMMB73_589629 [Zea mays]
Length=453

 Score =   232 bits (592),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 235/435 (54%), Gaps = 36/435 (8%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
             H IVIVGGGICGLATALALHRKG+ S+VLE+S+ LR +GG IGV  NGWR L+QLG+ + 
Sbjct  20    HGIVIVGGGICGLATALALHRKGIASLVLEKSEALRVDGGSIGVHVNGWRVLEQLGVAAE  79

Query  1191  LRTVA----------LPL---QRGRDIFLGE----DKEQKIEYVSG----------DVRC  1093
             LR  A          +PL   Q   D    +    +  Q    V+G          ++R 
Sbjct  80    LRETANLVTAFIRLRMPLISYQMPPDQIQNQRSLPNCFQVPRRVAGRKEEHPDTRQELRW  139

Query  1092  MARNDLIRSLADALPAGTIRFGCEVSSV---DYDSVTKFTRLLLSNGSYIEAEILIGCDG  922
             + R DL+ ++A  +PAG IR GC V+++   D   V   T      G  I A++LIGCDG
Sbjct  140   LKRKDLLETMAKDIPAGAIRLGCHVTAIHPSDPGVVLTTTPAGGGGGGVIRAKVLIGCDG  199

Query  921   GRSIVAELLGLKPAKEFGV-VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVH  745
               S+VA+ LG+ P+K        RG TTY + H     F R       VG  P++   V 
Sbjct  200   SNSVVAKYLGMSPSKPTPPRTYLRGFTTYRHGHPFGDRFLRLRGRRFFVGRSPMTDTRVS  259

Query  744   WFVT--FPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSF-SHL  574
             +FV    P+   +      D    +  V++ +   Q  PA+V E++  ++P+SL+  + +
Sbjct  260   FFVACHVPSAATSSSSRVVDARDTRHAVLQKLRD-QRCPAEVVEMVRDADPDSLNVVTRV  318

Query  573   KYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNV  394
              YRPP ++ L   RKG VTVAGDAMH MG ++GQGG ++LEDA+VLAR L  A A     
Sbjct  319   WYRPPWQVALAAFRKGAVTVAGDAMHAMGSYIGQGGSAALEDALVLARSLARARAAAAGG  378

Query  393   DGIEKEERSAR-IEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF  217
                  +E        A+ +YV+ERR+RVA+LS+  +++G  + A S   K+A    +AL 
Sbjct  379   RDDGDDEPFLLGAATAIREYVRERRLRVARLSLEAFVMGELLRAKSMATKLACMAILALL  438

Query  216   FRNGAAQNEYDCGQL  172
                      YDCG+L
Sbjct  439   GTKALGHTNYDCGRL  453



>ref|XP_007142809.1| hypothetical protein PHAVU_007G018600g [Phaseolus vulgaris]
 gb|ESW14803.1| hypothetical protein PHAVU_007G018600g [Phaseolus vulgaris]
Length=416

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/423 (38%), Positives = 229/423 (54%), Gaps = 41/423 (10%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL T+L LHR G+ S+VLE S  LR  G  + +  N W+ALD +G+G  L
Sbjct  8     DIVIVGAGIAGLTTSLGLHRLGIPSLVLESSDTLRVTGFALSIWQNAWKALDAVGVGDIL  67

Query  1188  RTVALPL------------QRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
             R   L L            Q     F      + IE     +RC+ R  ++  L + LP 
Sbjct  68    RDQHLQLNGIVTTSLVTGKQTAAIPFRATPNSKDIE-----IRCVKRRSMLEVLVNELPR  122

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+R+  +V S++     K   L L++G+ I+ ++LIGCDG  S+VA+ LG K A   G 
Sbjct  123   GTLRYLSKVVSIEESGFYKI--LHLADGTTIKTKVLIGCDGVNSLVAKWLGFKEASFTGR  180

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
              A RG     ++H L   F ++F    R G++P     V+WF T+ PT Q   ++   + 
Sbjct  181   YAIRGCAEVNSSHRLEPRFMQYFGKGFRAGVIPCDEKAVYWFFTWTPTSQ--EKELEENP  238

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               +KQ V+    KL+++P+ V+  I  +E +S   + L+YR P E++LG + +G V V G
Sbjct  239   AKLKQYVLN---KLENMPSDVRYYIENTELDSFLLAPLRYRHPWEVMLGNISRGNVCVGG  295

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK-----NNVDGIEKEERSARIEEALE  343
             DA H M P LGQGGC +LED VVLARCL  A + +        D  E+EE+  RIEE+L+
Sbjct  296   DAFHPMTPDLGQGGCCALEDGVVLARCLAEAFSKEPRRHAKEKDEDEEEEQHRRIEESLK  355

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAK------MAFGGAMALFFRNGAAQNEYDC  181
             KY KERR R   +    Y++G+   A SKL        +A   A+ LF ++G     YDC
Sbjct  356   KYAKERRWRSIDVIATAYMVGSIQQAQSKLVSFLRDKILAPFLAIQLFKKSG-----YDC  410

Query  180   GQL  172
             G L
Sbjct  411   GNL  413



>emb|CDP07354.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/423 (36%), Positives = 223/423 (53%), Gaps = 39/423 (9%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              +IVIVG GI GLA +L L R GL S+VLE S+ LRS G  + +  N WR+LD LG+G H
Sbjct  5     EDIVIVGAGISGLAASLGLLRYGLHSLVLESSESLRSTGFALTLWTNAWRSLDALGVGDH  64

Query  1191  LRTVALPLQ--RGRDIFLGEDKE----QKIEYVSGDVRCMARNDLIRSLADALPAGTIRF  1030
             LR  +LP +  +  D+  G   E    Q+  Y + + RC+ R DL+ +LA  LP GTIR+
Sbjct  65    LRQCSLPFRGFQTADVNTGLPTEELILQESTYGNYEARCVRRKDLLETLAKELPEGTIRY  124

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +V S++     K     L++G  I A++LIGCDG  S+VA+ LG K     G  A RG
Sbjct  125   SSKVVSIEKSGHLKLVH--LADGCVIRAKVLIGCDGVNSVVAKCLGFKKPIGVGRSAIRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTG-EKFPRDENAIKQ  673
                +P AH    + + +F G VR G  P     ++WF TF     TG E    +   +K+
Sbjct  183   YVEFPAAHGFKPQLYMYFGGGVRFGFAPCDDKSIYWFCTFKPSTATGYENMSDNPVLLKE  242

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V   + K  ++  +V   +  ++ ES+S + LK R P ++L+    K ++ + GDA+H 
Sbjct  243   FV---LSKTANVRKEVSGFVERTQLESISCAELKMRLPWDILIRDFAKSSICLVGDALHP  299

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAA------VKNNVDGIEKEERSARIEEALEKYVK  331
             M P LGQGG S+LED  +LARC+G +         +   DG++   + A   + LE Y K
Sbjct  300   MTPDLGQGGSSALEDCSILARCIGESFPRMMSRKFEEKRDGVDV--KIAAFNKGLENYAK  357

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN-------GAA---QNEYDC  181
             ERR R   L    Y++G    + +KL +         FFR+       GA      ++DC
Sbjct  358   ERRWRSFSLISTAYMVGLIQESENKLVR---------FFRDRFFSKYTGATVLRMADFDC  408

Query  180   GQL  172
             G+L
Sbjct  409   GKL  411



>ref|XP_007142791.1| hypothetical protein PHAVU_007G017100g [Phaseolus vulgaris]
 gb|ESW14785.1| hypothetical protein PHAVU_007G017100g [Phaseolus vulgaris]
Length=436

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/423 (36%), Positives = 225/423 (53%), Gaps = 41/423 (10%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              +IVIVG GI GL T+L LHR G+ S+VLE S  LR  G  + +  N W+ALD +G+G  
Sbjct  21    QDIVIVGAGIAGLTTSLGLHRLGVPSLVLESSDTLRVTGFALSIWENAWKALDAVGVGDI  80

Query  1191  LR-------------------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIR  1069
             LR                   T A+PL+   ++   +D E         +RC+ R  ++ 
Sbjct  81    LRDQHLQLKGIATTSLVTGQQTAAMPLRATPNL---KDLE---------LRCVKRKSMLE  128

Query  1068  SLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGL  889
              L + LP GT+R+  +V +++     K   L L++G+ I+ ++LIGCDG  S+VA+ LG 
Sbjct  129   VLVNELPKGTVRYLSKVVAIEESGFYKI--LHLADGTTIKTKVLIGCDGVNSLVAKWLGF  186

Query  888   KPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTG  709
             K A   G  + RG   +   H    +  R F   +R G +P     V+WF T+     TG
Sbjct  187   KEASFTGRHSIRGCADFKTNHGFEHKSIRFFGKGIRAGAIPCDEKTVYWFFTWIP---TG  243

Query  708   EKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRK  529
             ++   +EN  K +    ++KL++ P  V++ I  +E +    S L+YR P +L++G + K
Sbjct  244   QEKDLEENPAK-LKQHMLKKLENTPCHVRDCIEKTEEDGFLSSPLRYRHPWDLMMGNISK  302

Query  528   GTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSA---RI  358
             G V +AGDA+H M P LGQGGC +LED VVLARCL  A   +   D  EK+E      RI
Sbjct  303   GNVCIAGDALHPMTPDLGQGGCCALEDGVVLARCLAKAFPKEAGRDMKEKDEEEVHYKRI  362

Query  357   EEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE-YDC  181
             EE+L+KY +ERR R   ++   Y++G+   A SK         +A F  +   +   YDC
Sbjct  363   EESLKKYARERRWRSIDVTTTAYVVGSIQQAESKFVIFLRENILATFLASQYLKKSGYDC  422

Query  180   GQL  172
             G+L
Sbjct  423   GKL  425



>ref|XP_009405099.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/420 (37%), Positives = 223/420 (53%), Gaps = 34/420 (8%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             + +HE+VIVG GI GLATA+AL   GL+++VLERS  LR+ G  IG+  N WRALD LG+
Sbjct  3     EEQHEVVIVGAGIAGLATAVALQIVGLQTLVLERSPELRATGAAIGLSSNAWRALDVLGV  62

Query  1200  GSHLRTVALPLQRGRDIFLGEDKEQKIEYVS---GDV--RCMARNDLIRSLADALPAGTI  1036
                L      + +     L     Q + +     GD   R + R DL+ +LA+ L  GTI
Sbjct  63    AHKLLPSCPTVPKAVVTDLPTGSIQAVPFTRSQRGDTATRIVHRKDLLETLAEELKPGTI  122

Query  1035  RFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             RF  +++S+D D+ +  T + L +GS ++A++LIGCDG  S+VA  LGL      G  A 
Sbjct  123   RFSSKITSIDQDASSSVTAVHLDDGSVVKAKVLIGCDGVHSVVARWLGLSEPVHSGRSAV  182

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK  676
             RGL  +P  H L     ++   D R G  P++ + ++WF+T P+     E   RD   I 
Sbjct  183   RGLAVFPEGHGLKNGAAQYVIDDKRAGFAPLNSNDLYWFITHPSTAREKE-IQRDPELIL  241

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
               V E +    D P + + V+   +  +LS++ L +R P ++LLGR+ KG VTVAGDAMH
Sbjct  242   AEVTEKLAI--DFPPEFQMVVRHVDLATLSWAPLVFRLPWDVLLGRIHKGCVTVAGDAMH  299

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
              M P L QGGC++LEDA+VLAR L  A                 ++   LE YV+ERR R
Sbjct  300   PMTPDLAQGGCTALEDAIVLARNLAGA-------------RSRGQLAAGLESYVRERRWR  346

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRN----------GAAQNEYDCGQL*P  166
              A L   +YL G      +      +  ++  F RN            A ++YDCG L P
Sbjct  347   AAWLIAASYLSGWVQQGGN---AGVWRSSVEWFRRNIYYKFLHSRIFFAVHQYDCGDLLP  403



>ref|XP_008236046.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=414

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 158/431 (37%), Positives = 237/431 (55%), Gaps = 49/431 (11%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++ ++VIVG GI GLAT+L LHR G++S+VLE S  LR+ G       N W+ALD LG+
Sbjct  2     EAEADVVIVGAGISGLATSLGLHRLGIRSLVLESSDSLRTTGFAFTTWTNAWKALDALGL  61

Query  1200  GSHLRTVALPLQ--------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
                LR   + L          G   F    K  K ++   ++RC+ RN L+  LA+ LP+
Sbjct  62    ADSLRQQHVTLDGNVTSSRITGLQTFEMSFK-AKGKHGDHEIRCVKRNLLLEGLANELPS  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIRF  +V SVD     K   L  ++G+ ++A++L+GCDG  S+VA+ LG K     G 
Sbjct  121   GTIRFSSKVVSVDESGYFKLVHL--ADGTILKAKVLVGCDGVNSVVAKWLGFKQPAFTGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTG-EKFPRD  691
              A RG  T+ ++H +  +F+++F   +R G +P     V+W++T+ P+ Q    E++P  
Sbjct  179   SAIRGCATFKSSHGVDPKFNQYFGNGIRSGAIPCDDTNVYWYITWTPSSQEKELEEYPAQ  238

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
                +KQ ++    KL  +P KVK V+  +E ++   S L+YR P ELL G + KG   VA
Sbjct  239   ---LKQYMLS---KLGKIPDKVKAVVENTELDAFISSPLRYRHPWELLWGNISKGNACVA  292

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEE--------RSARIE  355
             GDA+H M P +GQGGC++LED+VVLARCLG  A +KN+  G E+++           RIE
Sbjct  293   GDALHPMTPDIGQGGCAALEDSVVLARCLGE-ALLKNS--GGERKDKEGEEGKEEYERIE  349

Query  354   EALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG----------  205
               L KY  ERR R   L   + ++G    +  K            FFR+           
Sbjct  350   MGLNKYANERRWRSFDLISTSRVVGFLQESNGKFMN---------FFRDKFLSPILAGLL  400

Query  204   AAQNEYDCGQL  172
               ++++DCG+L
Sbjct  401   LKKSDFDCGKL  411



>ref|XP_010696596.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=423

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/385 (41%), Positives = 212/385 (55%), Gaps = 34/385 (9%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLATALALHR G+KS+VLE S ILR+ G       N WRALD LGIG  L
Sbjct  7     DIVIVGAGISGLATALALHRLGIKSLVLESSDILRAAGIAFTTWTNAWRALDALGIGDSL  66

Query  1188  RTVALPLQRGRDIFLGEDKEQKI-----EYVS-------GD--VRCMARNDLIRSLADAL  1051
             R      Q G+    G +    +      YVS       GD  VRC+ R  L+ +LA  L
Sbjct  67    RQ-----QHGQ--LFGINTSSSVTGALTSYVSFTNKGTHGDHEVRCVKRKALLEALAKEL  119

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTIR+  +V S++    +K     L++GS ++ ++L+GCDG  S+VA+ LG K     
Sbjct  120   PSGTIRYSSKVVSIEESGFSKLVH--LADGSTLKTKVLVGCDGVTSVVAKWLGFKQPSLT  177

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPR  694
             G  A RG   Y   H+   +F++     VR GI+P   + V+WF T+ P+ Q + +    
Sbjct  178   GRSAIRGCAYYKEGHNFEPKFYQLVGNGVRYGIVPCDDNAVYWFFTWSPSAQESRKLIEA  237

Query  693   DENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
             D+  +KQ V   + KL  +P +VK VI  ++ E +  S L YRPP E+L+G + K  V V
Sbjct  238   DQVKLKQFV---LSKLGKVPDEVKTVIEDTKIEEIVRSPLGYRPPLEILIGNISKDNVCV  294

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAV-----KNNVDGIEKEERS--ARIE  355
             AGDA H M P LGQGGCS+LED V+LA+CL  A        + + D   K+E     RI 
Sbjct  295   AGDACHPMTPDLGQGGCSALEDGVILAKCLADALLTNSKDQRTSTDYENKDEYKLYTRIR  354

Query  354   EALEKYVKERRMRVAQLSMHTYLIG  280
               L  Y K RR R   L    Y++G
Sbjct  355   NGLNSYAKNRRWRAFGLISTGYMLG  379



>ref|XP_009628234.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=412

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 160/421 (38%), Positives = 223/421 (53%), Gaps = 31/421 (7%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++  IVIVG GI GLAT LALHR GL+SIVLE S  LR+ G  + +  N W+ALD LGI
Sbjct  2     ETEENIVIVGAGIAGLATCLALHRVGLRSIVLESSDSLRATGFALLLWTNAWKALDALGI  61

Query  1200  GSHLRTVALPLQRGRDIFLGED----------KEQKIEYVSGDVRCMARNDLIRSLADAL  1051
             G  LR ++L +  G   F  +              +I+Y S   RC+ R DL+  L + +
Sbjct  62    GDSLRQISLSIT-GVKSFSADSGAPIKEVSFVDNNRIDYES---RCVRRKDLLEKLENEV  117

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P G IR+  +V S++     K     L++GS I  + LIGCDG  S+VA  LGL+     
Sbjct  118   PQGVIRYSSKVVSIEESGPMKVVH--LADGSIIRTKALIGCDGVNSVVANWLGLQKPVNS  175

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPR  694
             G  A RG   YP+ H    +FH  F G  R G LP     ++WF TF P+         +
Sbjct  176   GRSAIRGFVEYPDKHGYQPKFHAFFGGGARFGFLPSDEKSLYWFCTFTPSVVHFDGNAEQ  235

Query  693   DENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
             D   +KQ V   + K  ++  ++  V+  +  +S+S + LK R P  +L G + K  V V
Sbjct  236   DPIKLKQFV---LNKASNMSKELSAVVERTTLDSISCAQLKLRLPWNVLTGNILKNNVCV  292

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA--AAVKNNVDGIEKEERSARIEEALEK  340
              GDA+H M P LGQGGCS+LED+VV+A+CLG A    +K+   G E E+   +I++ LEK
Sbjct  293   VGDALHPMTPDLGQGGCSALEDSVVIAKCLGEALVKPIKDRGVGQEDEDEFNKIKKGLEK  352

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKL-----AKMAFGGAMALFFRNGAAQNEYDCGQ  175
             Y KERR R        YL G    + SK+      +   G  +A+  R       YDCG+
Sbjct  353   YAKERRWRSFTFISAAYLSGFIQESGSKVISFLRERFLAGVTIAVTLR----MANYDCGK  408

Query  174   L  172
             L
Sbjct  409   L  409



>ref|XP_006342708.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=408

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 148/419 (35%), Positives = 221/419 (53%), Gaps = 34/419 (8%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
               +IVIVG GI GLAT+L LHR G++SIVLE S  LR+ G  + +  N WRALD LG+G 
Sbjct  4     NEDIVIVGAGIGGLATSLGLHRLGVRSIVLESSDSLRTSGFALALWTNAWRALDALGVGD  63

Query  1194  HLRTVALPLQRGR-----------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALP  1048
              LR  ++   R +           +I L  D  + I+Y   D RC+ R +++ +L   LP
Sbjct  64    SLRQRSIHFTRFQAFSANSGLPTAEISLEADN-KPIDY---DSRCIKRQEIVETLEKELP  119

Query  1047  AGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
              GTI++   V S+      ++  + L++ + I  ++LIGCDG  S+VA+ +GL    +  
Sbjct  120   PGTIKYLSRVISI--QQFGQYKLVHLADKTIIRTKVLIGCDGVNSVVAKWMGLPKPIDAN  177

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRD  691
               A RG   YP AH    +F  +F G VR+G LP  H  ++WF TF P+     EK    
Sbjct  178   RSAIRGYVEYPKAHGFEPKFCAYFGGGVRIGFLPCDHKSLYWFCTFTPSAVDYDEKIEGS  237

Query  690   ENAIKQMVI---ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllgrlRKGT  523
                +KQ V+    N+ K      +   ++  +  +SL  + LK R     L+   + K  
Sbjct  238   PTKMKQFVLSLANNVSK------EAYNILERTSLDSLYCAKLKLRTPWNILMKENIVKNN  291

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR-IEEAL  346
               + GDA+H M P +GQGGCS+LED+VVLARC+  A   KN    +E +++  + IE  L
Sbjct  292   TCLVGDALHPMTPDIGQGGCSTLEDSVVLARCISEAIFAKN----LEDDDQLCKIIEVGL  347

Query  345   EKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
             EKY KER+ R+  L   +YL+G +  +  K+        +A F         ++DCG+L
Sbjct  348   EKYAKERKWRIFNLISTSYLVGLAQESNGKVISYLREKFLAQFTIETMVKMGDFDCGKL  406



>ref|XP_011092960.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=410

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 147/415 (35%), Positives = 220/415 (53%), Gaps = 25/415 (6%)
 Frame = -2

Query  1377  SKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIG  1198
             S  ++VIVG GI GLAT+L LHR G++S+V+E    LR+ G  +G+  NGWRALD LG+G
Sbjct  4     SVEDVVIVGAGIAGLATSLGLHRLGIRSLVVESGDSLRTSGFALGIWTNGWRALDALGLG  63

Query  1197  SHLRT------------VALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
               LR+            V   L   +  F       K ++   ++R + R  L+ +L   
Sbjct  64    DILRSNHKQLTGTITTSVISGLTTSQLPFTAIHSWGKSDH---ELRAVNRKVLLETLESE  120

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP GTIRF  +V  ++ D    F  L L++G+ ++ ++LIGCDG  S+VA  LG      
Sbjct  121   LPKGTIRFSSKVVHIETDHHHHFNSLHLADGTVLQTKVLIGCDGVNSVVARFLGFSNPSF  180

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPR  694
              G  A RGL  + N H    +F + F   +R G++P     V+WF  F   Q T  +   
Sbjct  181   AGRSAVRGLVHFENGHGFEPKFMQFFGKGIRYGVIPCDDRTVYWFFAFSPLQETETEVEE  240

Query  693   DENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
             D   +KQ ++  + K+ D    ++ V   ++ +++  S L++R P ELL G + K +V V
Sbjct  241   DPAKLKQFILSKLGKVSD---HIRAVFEKTQVQNMVCSPLRFRLPWELLWGNISKDSVCV  297

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P LGQGGC++LED++VLAR L  A   K +    EKE +  RI++ LEK+ 
Sbjct  298   AGDALHPMTPDLGQGGCAALEDSIVLARVLAEALKEKAS----EKEHQ--RIQKGLEKFA  351

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE-YDCGQL  172
             +ERR R   L    Y++G    +   +        MA F      +   +DCG+L
Sbjct  352   RERRWRSIDLISTAYMVGLMQQSDGVVMSFVRDKIMARFMAGMLLKKAGFDCGKL  406



>ref|XP_010431792.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=415

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/423 (35%), Positives = 220/423 (52%), Gaps = 47/423 (11%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G++S+VLE S+ILR+ G       N W+A++ LG+  HL
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIRSMVLESSEILRATGFAFTTWFNAWKAMEALGVSQHL  67

Query  1188  RTVALPLQ-----------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             R++   LQ             +++   E +E        + RC+ R  L+ +LA  LP  
Sbjct  68    RSLHDRLQGWVVGSISAANPSKEMLFPESEEY-------ESRCVQRKLLLEALAGELPEE  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TIRF  +V  ++     K   L  S+G+ ++ ++LIGCDG  S+V + LG K       +
Sbjct  121   TIRFSSKVVHIELSGHYKMVHL--SDGTILKTKVLIGCDGLYSVVGKWLGFKNPATTSRL  178

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RGLT +P  H     F + +   VR G +P  H+ V+WF+T  +  +  E  P     
Sbjct  179   AIRGLTHFPAGHGFGKRFFQFYGNGVRTGFIPCDHNTVYWFLTHTSTDIDEETNPE---I  235

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYr--ppgelllgrlRKGTVTVAG  508
             +K+ V   + K++DLP  +K V+  ++ +S+  S LKYR           + K  V VAG
Sbjct  236   LKEFV---LNKIKDLPENIKSVVETTDLDSMVMSRLKYRPPWELLWSNSNITKDNVCVAG  292

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNV--DGIEKEERSARIEEALEKYV  334
             DA+H M P +GQGGCS++ED V+LARCLG A     N+  +  ++EE   RIE  L+KY 
Sbjct  293   DALHPMTPDIGQGGCSAMEDGVILARCLGEAIIRAKNLKSETEDEEESHKRIEHGLKKYA  352

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF---------FRNGAAQNEYDC  181
              ER+ R   L    Y +G        L + + G  M LF          R    ++ +DC
Sbjct  353   AERKWRSIDLITTAYTVG--------LIQQSRGKWMNLFRDRFLSSFLSRLLLKKSHFDC  404

Query  180   GQL  172
             G L
Sbjct  405   GSL  407



>ref|XP_009355537.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=406

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 226/416 (54%), Gaps = 35/416 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL + G+K++VLE+S  LR+ G  + + PN W ALD LG+  HL
Sbjct  7     DVVIVGAGIAGLATAVALKKAGVKALVLEKSDGLRTTGAALTLFPNAWCALDALGVSHHL  66

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRSLADALPAGTIRFG  1027
              ++   +++G   +I  GE KE      +G+     R + R  L+++LAD LP  +IRF 
Sbjct  67    TSLYATIKKGYVTNIDTGEIKEISFPASNGNDLVGPRSVHRKALLKALADELPPNSIRFA  126

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++++++      +  + +   +G+ I+A++LIGCDG  S+VA  LGL      G    R
Sbjct  127   SKLTAIETQEHEGSSISVIHFGDGTIIKAKVLIGCDGIHSVVARSLGLAEPVYAGRSGVR  186

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  +P  H L     ++   + + G +P++   ++WF  F T    G     D   IK+
Sbjct  187   GLAVFPQGHGLDNNVQQYGGLNRKAGFVPLNDKEIYWF--FTTCLAKGADPSNDPEVIKR  244

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  DLP    +V+  S+  +LS+  L +R P  ++ G L K  +TVAGDAMH 
Sbjct  245   EVIENYAK--DLPPIYLDVVRHSDLSTLSWGPLMFRYPWHVVFGNLGKQNITVAGDAMHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +G++      +  + KE  S     A+ KYV+ERR RV
Sbjct  303   MTPDLGQGGCVALEDAVVLGRYIGTSFVQNGQI--VPKEMVS-----AIGKYVEERRWRV  355

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAM---------ALFFRNGAAQNEYDCGQL  172
             A L   +YL G +  A S       GG M            FR     + YDCG+L
Sbjct  356   ALLIAGSYLSGWTQQAGS-------GGVMKFLRDTIFYGFIFRKLVKLSHYDCGKL  404



>ref|XP_010028755.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW55574.1| hypothetical protein EUGRSUZ_I01444 [Eucalyptus grandis]
Length=406

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 155/408 (38%), Positives = 218/408 (53%), Gaps = 19/408 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL TAL LHR G++S+VLE S  LR+ G  +    N WRALD +GIG  L
Sbjct  6     DIVIVGAGIAGLTTALGLHRLGIRSLVLESSDGLRATGFALTTWTNAWRALDAVGIGEPL  65

Query  1188  RTV---ALPLQRGRDIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADALPAGTIR  1033
             R      L LQ           E++ + V+G     ++RC+ R  L+ +LA+ LP+GTIR
Sbjct  66    RQQHHRLLGLQTASTSTGLPTAERQFD-VTGTQRGHEIRCLRRRALLETLANELPSGTIR  124

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             +  +V S++     K     LS+GS ++A++LIGCDG  S VA+ LG K     G    R
Sbjct  125   YSSKVVSIEESCYLKLVH--LSDGSILKAKVLIGCDGVHSAVAKWLGFKKPAFVGRSCIR  182

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G   Y + HS   +  R F   +R G++P     + WF TF +     E+       +KQ
Sbjct  183   GSVHYEHGHSFEPKSFRCFGEGIRSGVIPCDDKSILWFFTFSSSS-KNEEMEESPAKMKQ  241

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V   + KL  +P  ++  I  +E +    S L++RPP E+LLG + K  V VAGDA H 
Sbjct  242   FV---LGKLGKIPDNMRAAIEKTELDDFILSPLRFRPPWEILLGNISKTNVCVAGDAFHP  298

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P +GQGGC++LED +VLARCLG A   K    G+  E+   RIE  L+ Y KERR R 
Sbjct  299   MTPDIGQGGCAALEDGIVLARCLGEALRDKQ---GMSSEKEYKRIEMGLKSYAKERRWRA  355

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ-NEYDCGQL  172
              +L    Y++G    +  ++        +A F      +   YDCG+L
Sbjct  356   FELISTAYMLGYIQQSNGRVLNFLRDRVLASFLAGLPLKMASYDCGKL  403



>ref|XP_002272352.2| PREDICTED: zeaxanthin epoxidase, chloroplastic [Vitis vinifera]
 emb|CBI37629.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 156/413 (38%), Positives = 227/413 (55%), Gaps = 25/413 (6%)
 Frame = -2

Query  1377  SKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIG  1198
             ++ E+VIVG GI GLATA+AL R G++++VLERS  LR+ G  + + PN WRALD LG+ 
Sbjct  5     AEEEVVIVGAGIAGLATAVALKRVGIRALVLERSDCLRATGAALTLFPNAWRALDALGV-  63

Query  1197  SHLRTVALPLQRGRD-IFLGEDKEQKIEYVS------GDVRCMARNDLIRSLADALPAGT  1039
             SH  T   PL   R+  ++       I+ VS      G    + R  L+ SLA+ LP+ +
Sbjct  64    SHKLT---PLYAVREKSYVTNVTTGAIQEVSLSRNNRGGPITVHRKALLESLAEELPSNS  120

Query  1038  IRFGCEVSSVDYDSVTK--FTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             IRF  ++ S + ++  +     + L +G+ I A++LIGCDG  S+VA  LGL      G 
Sbjct  121   IRFSSKLISFEVEAQAEEGLYIIRLEDGTVITAKVLIGCDGVHSLVARKLGLAEPVNSGR  180

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
              A RGL  +   H L  E  +    ++R G++P++   ++WF+TF +  L GE   RD  
Sbjct  181   SAVRGLAVFQEGHGLGDEVQQFLDVNIRAGMVPLNDKEIYWFLTFKS-TLQGEAMARDPE  239

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I++ VIEN  K  + P    EV+   +  +L+++ L  R P  L+ G + KGT+TVAGD
Sbjct  240   QIQRQVIENFAK--NFPPTYAEVVRHCDLSTLTWAPLLMRLPWHLIFGNVSKGTMTVAGD  297

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P LGQGGCS+LEDAVVL R +G++      +           +  A+E YVKER
Sbjct  298   AMHPMTPDLGQGGCSALEDAVVLGRHIGNSFIDNGRL-------VPGAVAGAIEGYVKER  350

Query  324   RMRVAQLSMHTYLIG-ASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
             R R   L   +Y+ G A +     L K+        F F+      +YDCG+L
Sbjct  351   RWRTTGLITGSYISGWAQLGGDGWLMKLFRDVIFYRFIFKRLVGGADYDCGKL  403



>ref|XP_006358985.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=408

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 155/421 (37%), Positives = 224/421 (53%), Gaps = 36/421 (9%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++  IV VG GI GLAT+LALHR GL+S+VLE +  LR+ G  + +  N WRALD LGI
Sbjct  3     ETEENIVTVGAGIAGLATSLALHRLGLRSVVLESADSLRATGFALALWTNAWRALDALGI  62

Query  1200  GSHLRTVALPLQRGRDI------------FLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             G  LR  +L +   +              F+G +    +EY S   RC+ R DL+ +LA+
Sbjct  63    GGSLRQRSLSITGFKSFSADSGAPIKEVSFVGNN---SVEYES---RCVRRKDLLETLAN  116

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP G IR+  +V S++     K     L++GS I  + LIGCDG  S+VA  LGL+   
Sbjct  117   ELPQGAIRYSSKVDSIEESGPLKLVH--LADGSTIRTKALIGCDGVNSVVANWLGLQKPI  174

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
               G  A RGL +    H    +FH +F G VR G LP     ++WF TF P+        
Sbjct  175   YSGRSAIRGLLSIRKKHGYQPKFHAYFGGGVRFGFLPSDEKNLYWFCTFTPSVVHFDGNA  234

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              +D   +KQ V   + K  ++  ++  +I  +  + +S + LK R P  +LLG + K  V
Sbjct  235   EQDPMKLKQFV---LNKASNVSKELSTIIDRTTLDCISIAQLKLRLPWNVLLGNILKNNV  291

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              V GDA+H M P LGQGGCS+LED+VV+A+CLG  A +K   +  ++++ S +I   LEK
Sbjct  292   CVVGDALHPMTPDLGQGGCSALEDSVVIAKCLGE-ALIKPITE--QEDDESMKIRIGLEK  348

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAK-----MAFGGAMALFFRNGAAQNEYDCGQ  175
             Y KERR R        YL G    + +K+          G  +++  R       +DCG+
Sbjct  349   YAKERRWRSFTFISAAYLSGFIQESDNKIISFLRQHFLAGVTISVTLRIA----NFDCGR  404

Query  174   L  172
             L
Sbjct  405   L  405



>ref|XP_003555852.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Glycine 
max]
 gb|KHN11513.1| 3-hydroxybenzoate 6-hydroxylase 1 [Glycine soja]
Length=412

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 153/418 (37%), Positives = 231/418 (55%), Gaps = 20/418 (5%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME+ +   +IVIVG GI GL+T+L LHR G++S+VLE S  LR  G  + +  N W+ALD
Sbjct  1     METKEVVEDIVIVGAGIAGLSTSLGLHRLGIRSLVLESSDSLRITGFALSIWENAWKALD  60

Query  1212  QLGIGSHL--------RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
              +G+G  L        R V   L  G+   +    E   +    ++RC+ R  L+ +LA+
Sbjct  61    AVGVGDFLRQQHPQLNRVVTTSLVTGQQTSVMSFTETGNQQRDREIRCVKRKLLLEALAN  120

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP+GTIR+  +V +++     K   L L++G+ I+ ++LIGCDG  S+VA+ LG K A 
Sbjct  121   ELPSGTIRYLSKVVALEESGFYKI--LHLADGTTIKTKVLIGCDGVNSVVAKWLGFKNAS  178

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
               G  + RG     + H L     + F    R G++P     V+WF T+  +    E   
Sbjct  179   FTGRYSIRGCAEVQSNHGLEPRTMQFFGKGFRAGVIPCDEKAVYWFFTWTPKSHDKE---  235

Query  696   RDENA--IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
              D+N   +K+ V+  +EK   +P+ ++  I  +E + +    L+YR P EL+ G + KG 
Sbjct  236   LDDNPAKLKEYVLNKLEK---MPSDIRYYIEKTELDVILLVPLRYRHPWELMFGNISKGN  292

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
             V V GDA+H M P LGQGGC +LED VVLAR LG A + K+  +  E++++  RIEE+L+
Sbjct  293   VCVGGDALHPMTPDLGQGGCCALEDGVVLARFLGEAFS-KHIKEKDEEDDQFKRIEESLK  351

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE-YDCGQL  172
             KY KERR R   +    Y++G+   A SKL        +A F  +   +   YDCG+L
Sbjct  352   KYAKERRWRSIDVIATAYMVGSIQQAESKLVTFLRDNILAAFLASQYLKKSGYDCGKL  409



>emb|CDP01501.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 149/418 (36%), Positives = 224/418 (54%), Gaps = 23/418 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             D + +IVIVG GI GL  +LALH  GL+S+VLE S+ LR+ G  + + PN WRALD +G+
Sbjct  2     DIEQDIVIVGAGISGLTASLALHSYGLRSLVLESSECLRTTGYALTLWPNAWRALDAVGV  61

Query  1200  GSHLRTVALPLQRGRDI-------FLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             G HLR  ++P  RG  +         GE   ++ +Y   + R + R  L+ +L   LP G
Sbjct  62    GDHLRQNSVPF-RGIQVGSVDTGFPTGELAFEQNKYGKHECRRVRRKGLLEALEKELPQG  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TI +  +V S++    +K  +  L++G  I  +++IGCDG  S+VA+ LGL      G  
Sbjct  121   TIWYSSKVVSIEESGHSKLVQ--LADGCVIRTKVVIGCDGVNSVVAKWLGLPTPISAGRS  178

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             + RG   YP  H     F+ +F G VR G +P     ++WF  F     T  +   +E  
Sbjct  179   SIRGFAEYPAGHFFKPNFYIYFGGGVRFGFVPCDDKSINWFCNFNLSNATWHQNMSEEPV  238

Query  681   -IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              +K  V   + K+ ++P +V +++  +E  S+S + LK R P ++L   + K ++ VAGD
Sbjct  239   KLKAFV---LSKIVNIPREVSDIVQRTEVGSISCAELKMRLPWDILRRDIAKSSICVAGD  295

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSA---AAVKNNVDGIEK-EERSARIEEALEKY  337
             A+H M P LGQGGCS+LED V+LARC+G +      K+  DG E  + +    ++ +E Y
Sbjct  296   ALHPMTPDLGQGGCSALEDGVILARCIGESFLKIPRKDVGDGKEDVDPKVVAFKKGVENY  355

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAA---QNEYDCGQL  172
              KERR R   L    Y IG   A+ +K   + F     L     AA     ++DCG L
Sbjct  356   AKERRWRSFSLIAAAYAIGFVQASENKF--ICFLREKFLSMLTVAAVLKMADFDCGNL  411



>ref|XP_006836913.1| hypothetical protein AMTR_s00099p00135090 [Amborella trichopoda]
 gb|ERM99766.1| hypothetical protein AMTR_s00099p00135090 [Amborella trichopoda]
Length=494

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 147/387 (38%), Positives = 222/387 (57%), Gaps = 13/387 (3%)
 Frame = -2

Query  1323  LALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGRDIFL  1144
             +   R G+KS+VLER ++LRSEG  + +  NGWRALD LG+G  LR  ++P+    D+  
Sbjct  113   ITYSRHGVKSLVLERGELLRSEGAALAMWTNGWRALDALGVGETLRHKSIPIHTVTDVCF  172

Query  1143  GEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTR--LLL  970
              E +++ I     +VRC+ R+DL+ +L ++LP  TIRF C+V  V   +++ F+   + L
Sbjct  173   EEGRQRSIPIGRDEVRCLKRSDLMETLGESLPPETIRFNCKVVGV---TISPFSHSAVHL  229

Query  969   SNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP-NAHSLPIEFHRHFK  793
              NG+ I A++++GCDG  S VA+ LGL+        A RG T+Y    H +  +  R   
Sbjct  230   ENGTTISAKVVLGCDGVNSAVAKSLGLRNPCFDSFAAIRGFTSYSGKGHCIGNQIIRLKN  289

Query  792   GDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVI  613
               + VG LP++H+LVHWF++        E   ++   IK+  +  I K    P ++ E++
Sbjct  290   DRMVVGRLPVNHNLVHWFISRAWVPQDCE-ISKEPKLIKEAALGAISK---FPDEITEMV  345

Query  612   HLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLA  433
                +   LS +  + R P ELL+  L K +VT+AGDAMH MGP+ GQG    LED+VVL 
Sbjct  346   KSCDQSCLSLTQYRARSPWELLVRTLHKHSVTLAGDAMHAMGPYTGQGCAVGLEDSVVLG  405

Query  432   RCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKL  253
             RCLG   A++   +  E + R  RI  ALE+YVKER+MRV +++  TYL+G  +  +   
Sbjct  406   RCLG--LAMRGCHEESEDQTR-VRISMALERYVKERKMRVIRMASQTYLVGLLVKPSFSP  462

Query  252   AKMAFGGAMALFFRNGAAQNEYDCGQL  172
              K+     + LFF       +YDCG L
Sbjct  463   LKLIVLVVLLLFFGGLQGGTQYDCGTL  489


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 75/145 (52%), Gaps = 14/145 (10%)
 Frame = -2

Query  1074  IRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELL  895
             + +LA ALP   IRF C    V   S   F  + L +G+ I +++++GCDG  SIVAE L
Sbjct  1     METLAHALPLDAIRFNCRAIDVQI-SPNSFPIVHLDDGTTIYSKVVVGCDGVNSIVAESL  59

Query  894   GLKPAKEFGVVATRGLTTYP-NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQ  718
             G++      +   R +TTYP   H    +  R     + +G +PI+H+LVHWF+T+    
Sbjct  60    GVRAPSFDSMGRIRVVTTYPGKGHDFGNKSSRVTSTQIVLGRIPINHNLVHWFITY----  115

Query  717   LTGEKFPRDENAIKQMVIENIEKLQ  643
                       + +K +V+E  E L+
Sbjct  116   --------SRHGVKSLVLERGELLR  132



>ref|XP_002284737.3| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Vitis vinifera]
Length=457

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 149/403 (37%), Positives = 217/403 (54%), Gaps = 25/403 (6%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             L T L LHR GL+S+VLE S  LR  G  +    N WRALD +G+G  +R   + +Q G 
Sbjct  62    LTTCLGLHRLGLRSLVLESSDSLRVTGFALTTWKNAWRALDAVGVGDSIRQQHMQIQ-GL  120

Query  1155  DIFLGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSV  994
              +F     +   E   G      ++RC+ R  L+ +L   LP G+IR+  +V S+     
Sbjct  121   QVFSTISGQPTSEISFGGKWGIHEIRCVRRKVLLETLERELPRGSIRYSSKVVSIQESG-  179

Query  993   TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPI  814
               +  + L++GS ++ ++LIGCDG  S+VA  LGL    + G  A RGL  +P+ H L  
Sbjct  180   -HYKTVHLADGSVLKTKVLIGCDGVNSLVANWLGLDKPVDSGRSAVRGLVEFPDGHGLEP  238

Query  813   EFHRHFKGDVRVGILPISHDLVHWFVTF--PTRQLTGEKFPRDENAIKQMVIENIEKLQD  640
             +F +HF   VR G++P     ++WF+TF      +  E+  ++   +K  V   + KL  
Sbjct  239   KFRQHFGNGVRHGVIPCGPTTLYWFLTFAPSVHGVDTEEMDQNPAKMKDFV---LSKLGK  295

Query  639   LPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCS  460
             +P  ++ V   +  + +S S LK+R P ++  G + KG V VAGDA+H M P +GQGGCS
Sbjct  296   VPQHIENVFEKTALDCMSCSPLKFRLPWKVATGHIYKGNVCVAGDALHPMTPDIGQGGCS  355

Query  459   SLEDAVVLARCLGSAAAVK-NNVDGIEKEERS-ARIEEALEKYVKERRMRVAQLSMHTYL  286
             ++ED VVLARCLG     K    DG  K+E    RI E LEKY KERR R  +L    Y+
Sbjct  356   AMEDGVVLARCLGEVLLRKPTREDGEGKDEECYKRISEGLEKYAKERRWRSFKLITTAYV  415

Query  285   IGASMAATSKLAKMA----FGGAMA-LFFRNGAAQNEYDCGQL  172
             +G    +  K+ +        G +A LF R G    ++DCGQL
Sbjct  416   VGLIQESDWKVVRFLREKFLSGFLANLFLRMG----DFDCGQL  454



>ref|XP_006427866.1| hypothetical protein CICLE_v10025675mg [Citrus clementina]
 ref|XP_006464571.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Citrus sinensis]
 gb|ESR41106.1| hypothetical protein CICLE_v10025675mg [Citrus clementina]
Length=425

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 151/412 (37%), Positives = 231/412 (56%), Gaps = 19/412 (5%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + ++VI+G GI GLATA+AL R G+K++VLE+S  LR+ G  + + PN W ALD LG+  
Sbjct  5     EEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSH  64

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEY-----VSGDVRCMARNDLIRSLADALPAGTIRF  1030
              L +V  P +R     LG    +++ Y     +   +R + R  L+ +LAD LP  TI+F
Sbjct  65    KLTSVYAPAKRVFVTNLGTGATRELSYAGKSGIGSGLRSVHRQSLLEALADELPDDTIQF  124

Query  1029  GCEVSSVDYDSVTKFTRLLLSNG--SYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
               +++++D  ++   +  +++ G  + I+A++LIGCDG  S+VA+ LGL  +   G  + 
Sbjct  125   SSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSV  184

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDENA  682
             RGL  +P+ H L  +  +      R G +P++   V+WF+    P +   GE   +D   
Sbjct  185   RGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK---GEIIVKDPEL  241

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             I++ V+E  + +  LP    +VI   +  +L+ + L +R P ++L G L KG VTVAGDA
Sbjct  242   IQREVLEKYDNV--LPPLYLDVIQHCDLSTLTRAPLMFRRPWDILFGNLSKGNVTVAGDA  299

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH M P LGQGGCS+LEDAVVL R +G+ + +KN    +   +    I +ALE+YVKER+
Sbjct  300   MHPMTPDLGQGGCSALEDAVVLGRHIGN-SLIKNKGHIVISGDND--IGQALERYVKERK  356

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE--YDCGQL  172
              RV  L   +YL G    A S          +   F  G   N   YDCG+L
Sbjct  357   WRVTWLVTGSYLSGWVQNAGSNWLMKFLRDVIYYKFLFGWTANVACYDCGKL  408



>ref|XP_006427865.1| hypothetical protein CICLE_v10025675mg [Citrus clementina]
 gb|ESR41105.1| hypothetical protein CICLE_v10025675mg [Citrus clementina]
Length=426

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 151/413 (37%), Positives = 231/413 (56%), Gaps = 20/413 (5%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + ++VI+G GI GLATA+AL R G+K++VLE+S  LR+ G  + + PN W ALD LG+  
Sbjct  5     EEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSH  64

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEY------VSGDVRCMARNDLIRSLADALPAGTIR  1033
              L +V  P +R     LG    +++ Y      +   +R + R  L+ +LAD LP  TI+
Sbjct  65    KLTSVYAPAKRVFVTNLGTGATRELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQ  124

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNG--SYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             F  +++++D  ++   +  +++ G  + I+A++LIGCDG  S+VA+ LGL  +   G  +
Sbjct  125   FSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSS  184

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDEN  685
              RGL  +P+ H L  +  +      R G +P++   V+WF+    P +   GE   +D  
Sbjct  185   VRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK---GEIIVKDPE  241

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I++ V+E  + +  LP    +VI   +  +L+ + L +R P ++L G L KG VTVAGD
Sbjct  242   LIQREVLEKYDNV--LPPLYLDVIQHCDLSTLTRAPLMFRRPWDILFGNLSKGNVTVAGD  299

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P LGQGGCS+LEDAVVL R +G+ + +KN    +   +    I +ALE+YVKER
Sbjct  300   AMHPMTPDLGQGGCSALEDAVVLGRHIGN-SLIKNKGHIVISGDND--IGQALERYVKER  356

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNE--YDCGQL  172
             + RV  L   +YL G    A S          +   F  G   N   YDCG+L
Sbjct  357   KWRVTWLVTGSYLSGWVQNAGSNWLMKFLRDVIYYKFLFGWTANVACYDCGKL  409



>gb|EAY88588.1| hypothetical protein OsI_10063 [Oryza sativa Indica Group]
Length=407

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 155/420 (37%), Positives = 222/420 (53%), Gaps = 26/420 (6%)
 Frame = -2

Query  1392  MESTDSKHE-IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             M+  ++  E +V+VG GI GLA AL LHRKG+K  VLE S  LR+ G       N W+AL
Sbjct  1     MQQKEAGEEAVVVVGAGIAGLAVALGLHRKGVKCSVLESSPELRASGFAFATWTNAWQAL  60

Query  1215  DQLGIGSHLRTVALPLQRGRDIF---LGEDKEQKIEYVSG-----DVRCMARNDLIRSLA  1060
             D LG+G  +R + L LQ    +F    GE   +    V G     ++RC+ R+ L+R+L 
Sbjct  61    DNLGVGDKIRKLHLHLQE-LHVFSSSTGEITRRADLTVQGKRGPNELRCVRRDWLLRALE  119

Query  1059  DALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPA  880
             + LP GTIR+  ++ +++ D   K     L++G+ + A++LIGCDG  S+VA+ LGL   
Sbjct  120   EELPKGTIRYSSKIVAIEEDGNAKIIH--LADGAILRAKVLIGCDGVNSVVAKWLGLTKP  177

Query  879   KEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKF  700
                G +ATRGL  YP+ H L   F        R G++P +    +WF T+   +      
Sbjct  178   SSSGRLATRGLAHYPDGHGLDPRFKMFVGHGFRAGVIPCNETDAYWFFTWSPSEHESNGV  237

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
                   +KQ V+  + +   +P +V EV+  S    +  S L++RPP  LLL  + KG  
Sbjct  238   EESAEKMKQFVLTKL-RSSKIPTEVLEVVERSNINDVVASPLRFRPPLSLLLASISKGNA  296

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              VAGDA+H M P LGQGGC++LED VVLARCLG A               S RIE +L +
Sbjct  297   CVAGDALHPMTPDLGQGGCAALEDGVVLARCLGDALLGGG------GAAESERIEASLRE  350

Query  339   YVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             Y + RR R  +L    Y++G    ++ A  S L      G +A      A   +YDCG+L
Sbjct  351   YARIRRWRSVELVGTAYVVGIVQQSNNAVISFLRDKWLAGVLAGRLLKMA---DYDCGKL  407



>ref|XP_009355536.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=453

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 231/425 (54%), Gaps = 28/425 (7%)
 Frame = -2

Query  1404  RKREMESTDSKHE-IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNG  1228
             R+RE  S  ++ E +VIVG GI GLATA+AL + G+K++VLE+S  LR+ G  + + PN 
Sbjct  41    RERERRSMMARVEDVVIVGAGIAGLATAVALKKAGVKALVLEKSDGLRTTGAALTLFPNA  100

Query  1227  WRALDQLGIGSHLRTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRS  1066
             W ALD LG+  HL ++   +++G   +I  GE KE      +G+     R + R  L+++
Sbjct  101   WCALDALGVSHHLTSLYATIKKGYVTNIDTGEIKEISFPASNGNDLVGPRSVHRKALLKA  160

Query  1065  LADALPAGTIRFGCEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLG  892
             LAD LP   IRF  ++++++      +  + + L +G+ I+A++LIGCDG  S+VA LLG
Sbjct  161   LADELPPNAIRFASKLTAIETQEHEGSSISVIHLGDGTIIKAKVLIGCDGIHSVVARLLG  220

Query  891   LKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLT  712
             L      G    RGL  +P  H L     ++   + R G +P++   ++WF  F T    
Sbjct  221   LAEPVYAGRSGVRGLAVFPQGHGLDNNVQQYGGLNRRAGFVPLNDKEIYWF--FITCLAK  278

Query  711   GEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlR  532
             G     D   IK+ VIE   K  DLP    +V+  S+  +LS++ L +R P  ++ G L 
Sbjct  279   GADPSNDPEVIKREVIEKYAK--DLPPIYLDVVRHSDLSTLSWAPLMFRYPWHVVFGNLG  336

Query  531   KGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEE  352
             K  +TVAGDAMH M P LGQGGC +LEDAVVL R +G++      +  + KE  S     
Sbjct  337   KQNITVAGDAMHPMTPDLGQGGCVALEDAVVLGRYIGTSFVQNGQI--VPKEMVS-----  389

Query  351   ALEKYVKERRMRVAQLSMHTYLIG-----ASMAATSKLAKMAFGGAMALFFRNGAAQNEY  187
             A+ KYV+ERR RVA L   +YL G      S      L    F G     F      + Y
Sbjct  390   AIGKYVEERRWRVALLIAGSYLSGWIQQPGSGGVMKFLRDTVFYG---FIFHKLVKLSHY  446

Query  186   DCGQL  172
             DCG+L
Sbjct  447   DCGKL  451



>ref|XP_010030694.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW55577.1| hypothetical protein EUGRSUZ_I01448 [Eucalyptus grandis]
Length=405

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 210/414 (51%), Gaps = 32/414 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG G  GL TAL LHR G+KS+VLE    LR  G  +    N W+ALD LGI   L
Sbjct  6     DIVIVGAGTAGLTTALGLHRLGIKSLVLESHDSLRITGFALTTWTNAWKALDALGITESL  65

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSG--------------DVRCMARNDLIRSLADAL  1051
             R       R  +  LG      I  +                +VRCM R  L+ +L   L
Sbjct  66    R-------RQHNQLLGVMTTSTISGLPTAERPFSATGTQRDHEVRCMQRKILMETLVKEL  118

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTI+F  +V S++     K   L  S+GS + A++L+GCDG  S+VA+ LG K     
Sbjct  119   PSGTIKFSSKVVSIEQSGNLKLIHL--SDGSNLRAKVLLGCDGVNSVVAKWLGFKAPAFV  176

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G    RG   Y N H    +F +     V  GI+  +   ++WF +F T  ++ ++   +
Sbjct  177   GRFDIRGTVYYENGHGFEPKFFQFVGQGVMSGIIACNDKTMYWFASFST-SMSSQEMEEN  235

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
                 KQ V+  + K+ D     K VI  +E E+LS + L++R P ++L GR+ K  V VA
Sbjct  236   PAEAKQFVLSKLGKVAD---NFKAVIRDTELENLSIAPLRFRHPWDILWGRISKSNVCVA  292

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVK  331
             GDA H M P +GQGGCS+LED V LARCLG A   K    GI  EE   RIE  L+ Y K
Sbjct  293   GDAFHPMTPDIGQGGCSALEDGVTLARCLGEALRDKQ---GIRSEEYK-RIEMGLKNYAK  348

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL  172
             ERR R  +L    Y++G    +  K+        +  FF R       +DCG+L
Sbjct  349   ERRWRAFELISTAYMVGYIQTSNGKILSFLRNKVLGGFFARQQLKLASFDCGKL  402



>gb|EMS68723.1| 3-hydroxybenzoate 6-hydroxylase 1 [Triticum urartu]
Length=410

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 150/421 (36%), Positives = 225/421 (53%), Gaps = 26/421 (6%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             +E  D+  +IVI G G+ GLA AL LHRKG+  +VLE S +LR+ G  I    N +RALD
Sbjct  2     VEQQDAGEDIVIAGAGVAGLAVALGLHRKGVGCVVLESSPVLRTSGFAIAAWTNAFRALD  61

Query  1212  QLGIGSHLRTVALPLQRGRDIF------LGEDKEQKIEYVSG--DVRCMARNDLIRSLAD  1057
              LG+G  +R+  L +Q G  +       +  + + +++   G  + RC+ RN L+ +L +
Sbjct  62    ALGVGDTIRSKHLQIQ-GACVMSPTTGDVAREIDLRVQGKCGPHEARCVQRNVLLHALEE  120

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTR---LLLSNGSYIEAEILIGCDGGRSIVAELLGLK  886
              LP GTIR+  ++ S+D            L L++GS + A++LIGCDG  S+VA+ LGL 
Sbjct  121   ELPPGTIRYSSKIVSIDDQDGDGDGDAKILHLADGSILRAKVLIGCDGINSVVAKWLGLA  180

Query  885   PAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGE  706
                + G  ATRG   YP+ H    +  +      R G++P +H  V+WF T+      G 
Sbjct  181   KPSDSGRRATRGHAKYPDGHGFEPKMLQFSGQGFRAGLVPCNHTDVYWFFTWSPSPTPGG  240

Query  705   KFPRDENA--IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlR  532
             K   ++N   +KQ V+  +  ++  P +V E +  SE   +  + L+YRPP  LL   + 
Sbjct  241   KDDAEQNPAEMKQFVLAKLRSIK-APPEVLEAVERSEMNDVLVAPLRYRPPLSLLSASIS  299

Query  531   KGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEE  352
             KG V VAGDA+H   P L QG C +LEDAVVLARCLG A      + G E+E     +E 
Sbjct  300   KGNVCVAGDALHPTTPDLAQGACVALEDAVVLARCLGDA------IVGTERES----VEA  349

Query  351   ALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG-AAQNEYDCGQ  175
             AL +Y   RR R AQ+   +Y++G    +   + + A    ++     G     ++DCG 
Sbjct  350   ALRRYAGIRRWRSAQVIAASYMVGRVQQSDHAVVRFARDRLLSGMLAKGLLMMPDFDCGT  409

Query  174   L  172
             L
Sbjct  410   L  410



>ref|XP_004144922.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
Length=409

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 229/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +++IVG GI GL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  6     DVLIVGAGISGLTTALGLHRLGIRSLVLESSDDLRVTGYALSLWTNGWKALDAVGIGDSL  65

Query  1188  RTVALPLQR-GRDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R     L        +  DK  ++ + +   G VRC+ R  L+  LA ALP+GTI+F  +
Sbjct  66    RQNHDQLDGIITTSMISGDKTSELLFPAPEEGGVRCVRRKFLLECLAKALPSGTIKFSSK  125

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             V +++   + K   L+  +G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG   
Sbjct  126   VVAIEESGLLKLVHLV--DGTSIKTKVLIGCDGVKSVVAKWLGFKAPAFTGRCAVRGCLQ  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQMVI  664
               + H    +  ++    VR GI+P  +  ++WF T+ P+ ++  ++  R+   +KQ+V 
Sbjct  184   LDSNHYFERKMSQYAGEGVRAGIIPCDYKTLYWFFTWTPSAEV--KEMKRNPVKLKQLV-  240

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +  L ++P   + VI  ++      + L+YR P EL+LG + KG V VAGDA+H M P
Sbjct  241   --LSMLGEIPEAARVVIEETDVSCFQPAALQYRSPWELMLGNIVKGNVCVAGDALHPMTP  298

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVA  310
              LGQGGC++LED V+LARC+  A   K +    EK ER    ++E  L+KY  ER+ R  
Sbjct  299   DLGQGGCAALEDGVILARCVAEALLKKPSSQEGEKAEREQQKQVEMGLKKYAAERKWRSI  358

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  359   ELISTAYMVGRMQQSSGVFAKFIRDKILSKFLVGLLLRNAKFDCGKLTP  407



>ref|XP_003558786.2| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Brachypodium 
distachyon]
Length=414

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 160/427 (37%), Positives = 227/427 (53%), Gaps = 40/427 (9%)
 Frame = -2

Query  1401  KREMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWR  1222
             +R   +   + +IVIVG G+ GLA AL LHRKG+KS+VLE S +LR+ G      PN +R
Sbjct  11    ERSEAAGGGQADIVIVGAGLAGLAVALGLHRKGVKSLVLESSPVLRASGFAFATWPNAFR  70

Query  1221  ALDQLGIGSHLRTVALPLQRGRDIFLGEDKE--QKIEYVS----GDVRCMARNDLIRSLA  1060
             ALD LG+G  +R   L L +G  +F     E  Q +++ +     + RC+ R+ L+++L 
Sbjct  71    ALDALGVGDKIRKPHL-LTQGLRVFSSSTGELIQDVDFTNEGKRNEFRCVRRDVLLQTLE  129

Query  1059  DALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPA  880
             + LP G IR+  ++ S+  +       L L++GS + A++LIGCDG  S+VA+ LGL  A
Sbjct  130   EELPRGAIRYNSKIVSIQEEE-GHVKILHLADGSTLRAKVLIGCDGINSVVAKWLGLAKA  188

Query  879   KEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKF  700
                G  ATRGL  YP+ H     F +      R G++P +   V+WF T+          
Sbjct  189   TGSGRAATRGLAHYPDGHGFEPRFLQFIGHGYRAGLIPCNDTDVYWFYTW--------SH  240

Query  699   PRDENAI-------KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllg  541
              R++N +       KQ V+  + +   +PA+  +V+  SE    +    + RPP  LL  
Sbjct  241   SRNDNGVDGSAAKMKQHVLAEL-RGSKVPAEAVDVVERSEMSDAAPL--RLRPPLSLLWT  297

Query  540   rlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSAR  361
              + KG V VAGDA+H M P LGQGGCS+LED VVLARCLG A     +  G EKE    R
Sbjct  298   SISKGNVCVAGDALHPMTPDLGQGGCSALEDGVVLARCLGDAII---HGAGTEKE----R  350

Query  360   IEEALEKYVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQN  193
             IE  L +Y   RR R   L    Y++G    +     S L +   GG +A   R     +
Sbjct  351   IESGLREYAGMRRWRSVDLIGTAYVVGFVQQSGNPIVSFLREKVLGGVLA---RRLVKMS  407

Query  192   EYDCGQL  172
             EYDCG L
Sbjct  408   EYDCGML  414



>ref|XP_008231570.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=402

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/408 (37%), Positives = 224/408 (55%), Gaps = 19/408 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++++VLERS+ LR+ G  + + PN W ALD LGI  +L
Sbjct  3     DVVIVGAGIAGLATAVALKRAGVEALVLERSEGLRATGAALTLFPNAWVALDALGISQNL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGD-----VRCMARNDLIRSLADALPAGTIRFGC  1024
               +  P+++G    L   + Q + +V+ +      R + R  L+ +LAD LP  +IRF  
Sbjct  63    APLYAPVKKGYITNLDTGEIQDVSFVASNGDPVGPRSVHRKALLNALADQLPINSIRFSS  122

Query  1023  EVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
             ++++++      +  + + +++G+ I+A++LIGCDG  S+VA  LGL      G  A RG
Sbjct  123   KLTAIETQEHEGSSISIIHMADGTVIKAKVLIGCDGMHSVVARWLGLAEPVYSGRSAVRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             L  +P  H L     ++     R G +P++   ++WF T  T    G     +   IK+ 
Sbjct  183   LAVFPQGHGLDNNVQQYLGLGRRAGFVPLNDKEIYWFFTC-TSPAKGADMADEPGVIKRE  241

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             VIEN  K  DLP    +V+  S+  +L+++ L +R P  +++G L K  +TVAGDAMH M
Sbjct  242   VIENYAK--DLPPIYLDVVQHSDLSTLTWAPLMFRYPWHVVVGNLSKQNITVAGDAMHPM  299

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P L QGGCS+LEDAVVL R +G   +   N   + KE     +   + KYV+ERR RVA
Sbjct  300   TPDLAQGGCSALEDAVVLGRHIGK--SFIQNGRLLPKE-----MAVTIGKYVEERRWRVA  352

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMA--LFFRNGAAQNEYDCGQL  172
              L   +YL G    A S         A+    F+        YDCG+L
Sbjct  353   LLIAGSYLSGWVQQAGSGWGMKFLRDAIFYRFFYSIIIKFTSYDCGKL  400



>ref|XP_009349776.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=406

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 225/412 (55%), Gaps = 27/412 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL + G+K++VLE+S  LR+ G  + + PN W ALD LG+  HL
Sbjct  7     DVVIVGAGIAGLATAVALKKAGVKALVLEKSDGLRTTGAALTLFPNAWCALDALGVSHHL  66

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRSLADALPAGTIRFG  1027
              ++   +++G   +I  GE KE      +G+     R + R  L+++LAD LP  +IRF 
Sbjct  67    TSLYATIKKGYVTNIDTGEIKEISFPASNGNDLVGPRSVHRKALLKALADELPPNSIRFA  126

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++++++      +  + +   +G+ I+A++LIGCDG  S+VA  LGL      G    R
Sbjct  127   SKLTAIETQEHEGSSISVIHFGDGTIIKAKVLIGCDGIHSVVARSLGLAEPVYAGRSGVR  186

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  +P  H L     ++   + + G +P++   ++WF  F T    G     D   IK+
Sbjct  187   GLAVFPQGHGLDNNVQQYGGLNRKAGFVPLNDKEIYWF--FTTCLAKGADPSNDPEVIKR  244

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  DLP    +V+  S+  +LS+  L +R P  ++ G L K  +TVAGDAMH 
Sbjct  245   EVIENYAK--DLPPIYLDVVRHSDLSTLSWGPLMFRYPWHVVFGNLGKQNITVAGDAMHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +G++      +  + KE  S     A+ KYV+ERR RV
Sbjct  303   MTPDLGQGGCVALEDAVVLGRYIGTSFVQNGQI--VPKEMVS-----AIGKYVEERRWRV  355

Query  312   AQLSMHTYLIGASMAATSK-----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             A L   +YL G    A S      L    F G     FR     + YDCG+L
Sbjct  356   ALLIAGSYLSGWMQQAGSGGVLKFLRDTIFYG---FIFRKLVKLSHYDCGKL  404



>gb|KGN43265.1| hypothetical protein Csa_7G014510 [Cucumis sativus]
Length=482

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/409 (37%), Positives = 227/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +I+IVG GICGL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  79    DILIVGAGICGLTTALGLHRLGIRSLVLESSDDLRVTGYALSIWTNGWKALDAVGIGDSL  138

Query  1188  RTVALPLQR--GRDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGC  1024
             R     L       I  G DK  ++ + +   G VRC+ R  L+  LA ALP+GTI+F  
Sbjct  139   RQNHDQLDGVITTSIISG-DKTSELLFSAPEEGGVRCVRRKFLLECLAKALPSGTIKFSS  197

Query  1023  EVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLT  844
             +V +++   + K     L++G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG  
Sbjct  198   KVVAIEESGLLKLVH--LADGTSIKTKVLIGCDGVKSVVAKWLGFKALAFTGRCAVRGCL  255

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVI  664
                + H+   +   +    VR GI+P  +  ++WF ++ T     ++  R+   +KQ++ 
Sbjct  256   QLESNHNFERKVRLYAGEGVRAGIIPCDYKTLYWFFSW-TPSADVKEMKRNPVKLKQLL-  313

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +  L ++P   + VI  ++        L+YR P EL+LG + KG V VAGDA+H M P
Sbjct  314   --LSMLGEIPEAARAVIEETDVSCFHPVALQYRSPWELMLGNIVKGNVCVAGDALHPMTP  371

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVA  310
              LGQGGC++LED V+LARC+  A   K +    EK ER    ++E  L+KY  ER+ R  
Sbjct  372   DLGQGGCAALEDGVILARCVAEALLKKPSSQEGEKAEREQQKQVEMGLKKYAAERKWRSI  431

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  432   ELIGTAYMVGKIQQSSGVFAKFIRDKILSKFLAGLLLKNAKFDCGKLTP  480



>ref|XP_008386052.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Malus domestica]
Length=406

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 228/416 (55%), Gaps = 35/416 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL + GLK++VLE+S  LR  G  + + PN W ALD LG+  HL
Sbjct  7     DVVIVGAGIAGLATAVALKKAGLKALVLEKSDSLRVTGAALTLFPNAWCALDALGVSHHL  66

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRSLADALPAGTIRFG  1027
              ++   +++G   +I  GE +E  +   +G+     R + R  L+++LAD LP  +IRF 
Sbjct  67    TSLYATIKKGYITNIDTGEIQEVSLAASNGNDLVGPRSVHRKALLKALADELPPNSIRFA  126

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++++++      +  + + L +G+ I+A++LIGCDG  S+V   LGL      G    R
Sbjct  127   SKLTAIEAQEHEGSSISVIHLGDGTIIKAKVLIGCDGIHSVVGRSLGLAEPVYAGRSGVR  186

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  +P  H L     ++   + R G +P++   ++WF  F T    G     +   IK+
Sbjct  187   GLAVFPQGHGLDNNVQQYVGLNRRAGFVPLNDKEIYWF--FVTYLAKGADLANEPEVIKR  244

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  DLP    +V+  S+  +LS++ L +R P  ++ G L K  +TVAGDAMH 
Sbjct  245   EVIENYAK--DLPPIYLDVVRHSDLSTLSWAPLMFRYPWHVVFGNLGKQNITVAGDAMHP  302

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +G++      +  + KE  S     A+ KYV+ERR RV
Sbjct  303   MTPDLGQGGCLALEDAVVLGRYIGTSFVQNGQI--VPKEMVS-----AIGKYVEERRWRV  355

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAM-----ALFFRNGAAQ----NEYDCGQL  172
             A L   +YL G      S       GG M      +F+R    Q    + YDCG+L
Sbjct  356   ALLIAGSYLSGWIQQPGS-------GGVMKFLRETIFYRFIFNQLVKLSRYDCGKL  404



>dbj|BAJ99036.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95578.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88122.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 155/412 (38%), Positives = 222/412 (54%), Gaps = 32/412 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             EIVI G G+ GLATAL LHRKG++S+VLE S  LR+ G       N +RALD LG+G  +
Sbjct  6     EIVIAGAGLAGLATALGLHRKGVRSVVLESSATLRASGYAFNTWTNAFRALDALGVGDKI  65

Query  1188  RTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAGTIRF  1030
             R   L  +R        GE   +   K++  SG  ++RC+ RN L+ +L + LP GTIR+
Sbjct  66    REHHLLYERLVAFSASTGEAAAEVSLKMQGKSGPHEIRCVKRNFLLETLENELPEGTIRY  125

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               ++ +++ +   K   L +++GS + A +L+GCDG  S+VA+ LGL      G  ATRG
Sbjct  126   SSKIVAIEEEGSVKL--LHMADGSTMRANVLVGCDGVNSVVAKWLGLPKPILSGRSATRG  183

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             +  YP+ H    E  +      R G+LP S   V+W  T+      G+     E ++ +M
Sbjct  184   MAEYPDGHGFRPEILQFIGQGFRSGVLPCSDTSVYWNYTWYPSPADGDA----EESVAKM  239

Query  669   VIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
                 + KL+   +PA+  +VI  SE   +  S L++R P  L+ G + +G V VAGDA H
Sbjct  240   RQHVLAKLKAAKIPAEALDVIERSEMSEVVSSPLRFRSPLSLVRGSICRGGVCVAGDAFH  299

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
              M P LGQGGC++LED VVLARCLG A A   +             E AL KY +ERR R
Sbjct  300   PMTPELGQGGCAALEDGVVLARCLGVAFAAGGH----------GSAEAALAKYAEERRWR  349

Query  315   VAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               +L    Y++G    +S  A   L +    G +A    + A   +YDCG+L
Sbjct  350   AIRLVTAAYVVGFVQQSSNPAIKFLREKFLSGLLARVMVDMA---DYDCGKL  398



>ref|XP_004144856.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
Length=482

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/409 (37%), Positives = 227/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +I+IVG GICGL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  79    DILIVGAGICGLTTALGLHRLGIRSLVLESSDDLRVTGYALSIWTNGWKALDAVGIGDSL  138

Query  1188  RTVALPLQR--GRDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGC  1024
             R     L       I  G DK  ++ + +   G VRC+ R  L+  LA ALP+GTI+F  
Sbjct  139   RQNHDQLDGVITTSIISG-DKTSELLFPAPEEGGVRCVRRKFLLECLAKALPSGTIKFSS  197

Query  1023  EVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLT  844
             +V +++   + K     L++G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG  
Sbjct  198   KVVAIEESGLLKLVH--LADGTSIKTKVLIGCDGVKSVVAKWLGFKALAFTGRCAVRGCL  255

Query  843   TYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVI  664
                + H+   +   +    VR GI+P  +  ++WF ++ T     ++  R+   +KQ++ 
Sbjct  256   QLESNHNFERKVRLYAGEGVRAGIIPCDYKTLYWFFSW-TPSADVKEMKRNPVKLKQLL-  313

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +  L ++P   + VI  ++        L+YR P EL+LG + KG V VAGDA+H M P
Sbjct  314   --LSMLGEIPEAARAVIEETDVSCFHPVALQYRSPWELMLGNIVKGNVCVAGDALHPMTP  371

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVA  310
              LGQGGC++LED V+LARC+  A   K +    EK ER    ++E  L+KY  ER+ R  
Sbjct  372   DLGQGGCAALEDGVILARCVAEALLKKPSSQEGEKAEREQQKQVEMGLKKYAAERKWRSI  431

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  432   ELIGTAYMVGKIQQSSGVFAKFIRDKILSKFLAGLLLKNAKFDCGKLTP  480



>gb|KGN43266.1| hypothetical protein Csa_7G014520 [Cucumis sativus]
Length=409

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 228/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +++IVG GI GL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  6     DVLIVGAGISGLTTALGLHRLGIRSLVLESSDDLRVTGYALSLWTNGWKALDAVGIGDSL  65

Query  1188  RTVALPLQR-GRDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R     L        +  DK  ++ + +   G VRC+ R  L+  LA ALP+GTI+F  +
Sbjct  66    RQNHDQLDGIITTSMISGDKTSELLFPAPEEGGVRCVRRKFLLECLAKALPSGTIKFSSK  125

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             V +++   + K   L+  +G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG   
Sbjct  126   VVAIEESGLLKLVHLV--DGTSIKTKVLIGCDGVKSVVAKWLGFKAPAFTGRCAVRGCLQ  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQMVI  664
               + H    +  ++    VR GI+P     ++WF T+ P+ ++  ++  R+   +KQ+V 
Sbjct  184   LDSNHYFERKMSQYAGEGVRAGIIPCDDKTLYWFFTWTPSAEV--KEMKRNPVKLKQLV-  240

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +  L ++P   + VI  ++      + L+YR P EL+LG + KG V VAGDA+H M P
Sbjct  241   --LSMLGEIPEAARVVIEETDVSCFQPAALQYRSPWELMLGNIVKGNVCVAGDALHPMTP  298

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVA  310
              LGQGGC++LED V+LARC+  A   K +    EK ER    ++E  L+KY  ER+ R  
Sbjct  299   DLGQGGCAALEDGVILARCVAEALLKKPSSQEGEKAEREQQKQVEMGLKKYAAERKWRSI  358

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  359   ELISTAYMVGRMQQSSGVFAKFIRDKILSKFLVGLLLRNAKFDCGKLTP  407



>ref|XP_010649434.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Vitis 
vinifera]
Length=411

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 156/412 (38%), Positives = 220/412 (53%), Gaps = 16/412 (4%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME    + EIVIVGGGI GLATA+AL R G++++VLERS  LR+ G  +G+ PN WRALD
Sbjct  1     MEKMVPEEEIVIVGGGIAGLATAVALQRVGIRALVLERSDGLRATGAALGLFPNAWRALD  60

Query  1212  QLGIGSHLRTVALPLQRG--RDIFLGEDKEQKIEYVSGD-VRCMARNDLIRSLADALPAG  1042
              LG+   L  V    ++    D+  G  +E  +   + D    + R  L+ SLA+ LP  
Sbjct  61    ALGVAHKLTAVYAVRKKAYVTDVATGAVQEVSLMGNNSDGPITVHRKALLESLAEELPRN  120

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             +IRF  +  S++         + L +G+ I  ++LIGCDG  S VA  LGL      G  
Sbjct  121   SIRFSSKPISIEAQGQEGPYAIRLEDGTVITTKVLIGCDGVNSFVARKLGLTQPVNSGRS  180

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A   L  +P  H +  +  +      R GI+P++   ++WF+TF T +  GE   +D   
Sbjct  181   ALVALAVFPEGHGVREDVQQFVDVGKRGGIVPLNDKEIYWFLTFNTPK--GETMTKDPQE  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             I++ VIEN  K  DLP    EV+   +  +L+ + L+ R P +L+ G + KG +TV GDA
Sbjct  239   IQKQVIENYAK--DLPPIYAEVVRHCDLSTLTLAPLRLRLPWDLIFGNVSKGNMTVVGDA  296

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH M P LGQGGC++LEDAVVL R +G     K+ +D          + EA+E YVKERR
Sbjct  297   MHPMTPDLGQGGCAALEDAVVLGRHIG-----KSFID--NGRLVPGAVAEAIEGYVKERR  349

Query  321   MRVAQLSMHTYLIG-ASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
              R A L   +Y  G A +     L KM        F  +      +YDCG+L
Sbjct  350   WRAAWLIAGSYFSGWAQVGREGWLMKMFRDMIFYRFVLKRLIGIADYDCGKL  401



>ref|XP_004289394.1| PREDICTED: FAD-dependent urate hydroxylase-like [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 146/375 (39%), Positives = 210/375 (56%), Gaps = 17/375 (5%)
 Frame = -2

Query  1383  TDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLG  1204
             T +   +VIVGGGI GLAT +AL R G++++VLERSK LR  G  + + PN W ALD LG
Sbjct  3     TITVENVVIVGGGIAGLATGVALKRAGIEALVLERSKGLRVNGTALTLFPNAWFALDSLG  62

Query  1203  IGSHLRTVALPLQRG--RDIFLGEDKEQKIEYVSGDV---RCMARNDLIRSLADALPAGT  1039
             + SH      P  +G   DI  GE +E      +GD    R + R  L+ +LA  LP  +
Sbjct  63    V-SHKLASYTPSLKGYITDIDTGEVRELSFTKANGDAVGPRSVHRKALLETLAGELPVHS  121

Query  1038  IRFGCEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             IRF  ++S++D      +    + + NG+ I+A++LIGCDG  S+V+  LGL+     G 
Sbjct  122   IRFSSKISAIDTQQHEGSSIAIVHMENGTIIKAKVLIGCDGVHSVVSRWLGLREPVHSGR  181

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDEN  685
              A RGL  YP  H L     ++     R G +P++   V+WF T  T    G     D  
Sbjct  182   SAVRGLAVYPQGHGLKQIVQQYAGSGRRAGFVPLNDKEVYWFFT-GTSPAKGTSLAEDPE  240

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I++ ++EN     DLP    +V+  S+  +L+++ L +R P  ++ G L K  +TVAGD
Sbjct  241   EIQKEILENYA--NDLPPIYLDVVQHSDLSTLTWAPLMFRYPWNVVFGSLSKQNITVAGD  298

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P L QGGCS+LEDAV+L R +G+  + K+N   +  +E S    E L KYV+ER
Sbjct  299   AMHPMTPDLAQGGCSALEDAVILGRHIGT--SFKHNGHVLVPKEMS----EVLSKYVEER  352

Query  324   RMRVAQLSMHTYLIG  280
             R R+A L   +Y+ G
Sbjct  353   RWRIALLITGSYIAG  367



>ref|XP_004162912.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
Length=409

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 228/409 (56%), Gaps = 15/409 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +++IVG GI GL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  6     DVLIVGAGISGLTTALGLHRLGIRSLVLESSDDLRVTGYALSLWTNGWKALDAVGIGDSL  65

Query  1188  RTVALPLQR-GRDIFLGEDKEQKIEYVS---GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R     L        +  DK  ++ + +   G VRC+ R  L+  LA ALP+GTI+F  +
Sbjct  66    RQNHDQLDGIITTSMISGDKTSELLFPAPEEGGVRCVRRKFLLECLAKALPSGTIKFSSK  125

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             V +++   + K   L+  +G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG   
Sbjct  126   VVAIEESGLLKLVHLV--DGTSIKTKVLIGCDGVKSVVAKWLGFKAPAFTGRCAVRGCLQ  183

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQMVI  664
               + H    +  ++    VR GI+P     ++WF T+ P+ ++  ++  R+   +KQ+V 
Sbjct  184   LDSNHYFERKMSQYAGEGVRAGIIPCDDKTLYWFFTWTPSAEV--KEMKRNPVKLKQLV-  240

Query  663   ENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGP  484
               +  L ++P   + VI  ++      + L+YR P EL+LG + KG V VAGDA+H M P
Sbjct  241   --LSMLGEIPEAARVVIEETDVSCFQPAALQYRSPWELMLGNIVKGNVCVAGDALHPMTP  298

Query  483   FLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKERRMRVA  310
              LGQGGC++LED V+LARC+  A   K +    EK ER    ++E  L+KY  ER+ R  
Sbjct  299   DLGQGGCAALEDGVILARCVAEALLKKPSSQVGEKAEREQQKQVEMGLKKYAAERKWRSI  358

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  359   ELISTAYMVGRMQQSSGVFAKFIRDKILSKFLVGLLLRNAKFDCGKLTP  407



>ref|XP_004497185.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cicer arietinum]
Length=407

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 234/416 (56%), Gaps = 19/416 (5%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             MES   + +IVIVG GI GL T+L LHR G++S++LE    LR  G  + +  NGW+ALD
Sbjct  1     MESV-IEEDIVIVGAGIAGLTTSLGLHRLGVRSLILESWDGLRVSGFALTIWENGWKALD  59

Query  1212  QLGIGSHLR--------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
              +G+G  LR         V   +  G+       K+ K +Y + +VRC+ R  L+ +LA+
Sbjct  60    AVGVGDILRHQHLLLHGNVTTSMITGQQTSTTSFKDNKGKYGAREVRCVKRQLLLEALAN  119

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP+GTIRF  +V +++    +K   L+  +G+ I+ ++LIGCDG  S+VA+ LGLK A 
Sbjct  120   ELPSGTIRFLSKVVAIEDLGFSKILHLV--DGTTIKTKVLIGCDGVNSVVAKWLGLKKAS  177

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
                  ATRG     N H L   F ++F    R G +P     V+WF T  ++    E+  
Sbjct  178   YTERYATRGYADLKNTHQLEPIFMQYFGKGFRAGAIPCDQKGVYWFFTCISQD---EELA  234

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
             +D   +KQ V+  +EK+   P+ V+  I  +E  +   + L+YR P EL++G + KG V 
Sbjct  235   QDPAKLKQYVLNKLEKM---PSDVRIFIEKTELHAFQSAPLRYRKPWELIMGNISKGNVC  291

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDA+H M P LGQGGC +LED VVLARCL  A +   ++   ++EE   RIEE L+KY
Sbjct  292   VAGDALHPMTPDLGQGGCCALEDGVVLARCLAEAFS-NKSIKEEKEEEEYKRIEEGLKKY  350

Query  336   VKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFR-NGAAQNEYDCGQL  172
               ERR R   L   +Y++G+   + SK         +A F       ++E+DCGQL
Sbjct  351   ANERRWRCIDLIATSYIVGSIQQSGSKFVNFFRDKFLASFLALMLLKKSEFDCGQL  406



>gb|KFK30455.1| hypothetical protein AALP_AA7G263400 [Arabis alpina]
Length=401

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 222/419 (53%), Gaps = 47/419 (11%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL+TA+ LHR G+KS+VLE S  LR+ G       N W+A++ LG+  H+
Sbjct  8     DIVIVGAGISGLSTAVGLHRLGIKSMVLESSDKLRATGFAFTTWFNAWKAMEALGVSEHI  67

Query  1188  RTV----------ALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGT  1039
             R +          ++  +      L  D E   EY S   RC+ R  L+ +LA  LP  T
Sbjct  68    RDLHDRLEGWVVGSISAENPTKEMLFPDSE---EYES---RCVERKLLLEALAGELPEET  121

Query  1038  IRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             IRF  +V  ++     K   L  S+G+ ++ ++LIGCDG  S+V + LG K       +A
Sbjct  122   IRFSAKVVHIELSGHYKLVHL--SDGTILKTKVLIGCDGVYSVVGKWLGFKNLATTARLA  179

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAI  679
              RGLT +P  H     F + +   VR G +P +++ V+WF+T  + ++  E  P +   +
Sbjct  180   IRGLTHFPTGHGFGKRFFQFYGDGVRSGFIPCNNNTVYWFLTHTSTEIDEETNPEN---L  236

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             KQ  +    KL+DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA+
Sbjct  237   KQFALN---KLKDLPENIKNVMETTDLDSIVMSRLKYRPPWELLWANITKDNVCVAGDAL  293

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEALEKYVKERR  322
             H M P +GQGGCS++ED V+LARCLG A   +      E E+ S  RIEE LEKY +ER+
Sbjct  294   HPMTPDIGQGGCSAMEDGVILARCLGEAMKGET-----ENEDASYKRIEEGLEKYARERK  348

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF---------FRNGAAQNEYDCGQL  172
              R   L    Y +G          + + G  M LF          R    +  +DCG L
Sbjct  349   WRSIDLITTAYTVG--------FIQQSRGKWMNLFRDKFLSSFLSRLLLKKAHFDCGSL  399



>ref|XP_003558783.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Brachypodium 
distachyon]
Length=399

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 154/417 (37%), Positives = 227/417 (54%), Gaps = 41/417 (10%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVI G G+ GLATAL LHRKG++S+VLE S  LR+ G       N +RALD LG+G  +
Sbjct  6     DIVIAGAGLAGLATALGLHRKGVRSVVLESSATLRASGYAFTTWTNAFRALDALGVGDKI  65

Query  1188  RTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAGTIRF  1030
             R   L  +R        GE   +   K++  SG  ++RC+ RN L+ +L   LP GTIR+
Sbjct  66    REHHLLYERLVAFSASTGEAAAKVSLKMQGKSGPHEIRCVKRNFLLETLESELPEGTIRY  125

Query  1029  GCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
               +++++D +   K   L +++GS I+A++LIGCDG  S+VA+ LGL    + G  ATRG
Sbjct  126   SSKIAAIDEEGDVKL--LHMADGSIIKAKVLIGCDGVNSVVAKWLGLPKPIQSGRSATRG  183

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHW-FVTFPTRQLTGEKFPRDENA---  682
             +  YP+ H    E  +      R G+LP S   V+W +  +P+        P D++A   
Sbjct  184   MAEYPDGHGFGPEMLQFIGQGFRSGVLPCSDTSVYWNYTWYPS--------PDDKDAEES  235

Query  681   ---IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
                ++Q V+  + +   +P +  +VI  SE   +  S L++R P  L+ G + +G V VA
Sbjct  236   VAKMRQHVLTKL-RAAKIPLEALDVIERSEMSEVVSSPLRFRSPLSLVRGSISRGNVCVA  294

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVK  331
             GDA H M P LGQGGC++LED VVLARCLG A A      G   E     ++  LEKY  
Sbjct  295   GDAFHPMTPELGQGGCAALEDGVVLARCLGDAFA-----HGYACES----VKAGLEKYAD  345

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMA----FGGAMALFFRNGAAQNEYDCGQL  172
             ERR R  +L    Y++G    + + + K        G +A    + A   ++DCG+L
Sbjct  346   ERRGRAIRLVTAAYVVGFVQQSNNTVVKFLREKFLSGLLAKLMVDMA---DFDCGEL  399



>ref|XP_004307200.1| PREDICTED: 3-hydroxybenzoate 6-hydroxylase 1-like [Fragaria vesca 
subsp. vesca]
Length=258

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 149/226 (66%), Gaps = 1/226 (0%)
 Frame = -2

Query  1407  KRKREME-STDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPN  1231
             K    ME + D+   IVIVGGGICGLATALALHRKG++S+VLERS+ LR+ G  I +  N
Sbjct  2     KMSTNMEMAEDAGENIVIVGGGICGLATALALHRKGIRSLVLERSESLRATGAAIILHAN  61

Query  1230  GWRALDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADAL  1051
             GWRALDQLG+ S LR  ++P+   +   L +D+ Q+I     ++RC+ R DL+  LAD L
Sbjct  62    GWRALDQLGVASSLRQTSIPILSAQFTSLDDDRLQQIPVWKDELRCVKRTDLMNILADNL  121

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P  TIRFGC V S++ D +     L L +G+ + A+++IGCDG  S+++ +LG++P   F
Sbjct  122   PQNTIRFGCYVLSIELDPIISSPVLKLQDGTSLNAKVVIGCDGLNSMISYMLGVRPTNTF  181

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT  733
              V   RG T+ P+ H    EF    K DV+VG++P++  LV+WFVT
Sbjct  182   NVCVIRGFTSCPSGHEFGSEFKMAKKDDVQVGLIPMTTSLVYWFVT  227



>ref|XP_006384582.1| hypothetical protein POPTR_0004s18310g [Populus trichocarpa]
 gb|ERP62379.1| hypothetical protein POPTR_0004s18310g [Populus trichocarpa]
Length=415

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 157/417 (38%), Positives = 223/417 (53%), Gaps = 33/417 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GL T+L LHR G++S+VLE S  LR  G       N WRALD +GIG  L
Sbjct  11    EVVIVGAGIAGLTTSLGLHRLGIRSLVLESSAGLRVTGFAFTTWTNAWRALDAVGIGHSL  70

Query  1188  RTVALPLQRGRDIFL-------------GEDKEQKIEYVSGD--VRCMARNDLIRSLADA  1054
             R      Q G   FL             G     K++   GD  VRC+ R  L+ +L   
Sbjct  71    RQ-----QHG---FLDGLVASSSVVSKPGTQISFKVKGTIGDHEVRCVRRKLLLEALEKE  122

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP GTIR+  +V S++     K   L  ++ + I+ ++LIGCDG  S+VA  +G K    
Sbjct  123   LPDGTIRYSSKVVSIEESGYLKLVHL--ADDTIIKTKVLIGCDGVNSVVARFIGFKKPAF  180

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFP  697
              G  A RG   +   H    +F + F   VR G LP     ++WF T+ PT Q   ++  
Sbjct  181   AGRSAIRGYADFKVNHGFGSKFLQLFGKGVRSGFLPCDDTTIYWFFTYIPTGQ--DKELE  238

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
              +   +KQ V+    KL ++P   +  + ++E +S++ S L++R P E+L G + KG V+
Sbjct  239   DNPTEMKQFVLS---KLGNVPDHARTSVEITELDSITSSPLRFRHPWEVLWGNISKGNVS  295

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKE-ERSARIEEALEK  340
             VAGDA+H M P +GQGGC++LED VVLARCL  A   + NV+G EKE E   R+E  L+K
Sbjct  296   VAGDALHPMTPDIGQGGCAALEDGVVLARCLAEALKKELNVEGKEKEREEYKRVEMGLKK  355

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             Y  ERR R  +L    Y++GA      K+  +     +A F      +  ++DCG+L
Sbjct  356   YAAERRWRSFELISTAYIVGAIQQGDGKIMNILRDAFLAKFLAGLLLKKADFDCGKL  412



>ref|NP_001049000.1| Os03g0153900 [Oryza sativa Japonica Group]
 gb|ABF94039.1| FAD binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10914.1| Os03g0153900 [Oryza sativa Japonica Group]
 gb|EAZ25624.1| hypothetical protein OsJ_09452 [Oryza sativa Japonica Group]
Length=407

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 154/420 (37%), Positives = 221/420 (53%), Gaps = 26/420 (6%)
 Frame = -2

Query  1392  MESTDSKHE-IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             M+  ++  E +V+VG GI GLA AL LHRKG+K  VLE S  LR+ G       N W+AL
Sbjct  1     MQQKEAGEEAVVVVGAGIAGLAVALGLHRKGVKCSVLESSPELRASGFAFATWTNAWQAL  60

Query  1215  DQLGIGSHLRTVALPLQRGRDIF---LGEDKEQKIEYVSG-----DVRCMARNDLIRSLA  1060
             D LG+G  +R + L LQ    +F    GE   +    V G     ++RC+ R+ L+R+L 
Sbjct  61    DNLGVGDKIRKLHLHLQE-LHVFSSSTGEITRRADLTVQGKRGPNELRCVRRDWLLRALE  119

Query  1059  DALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPA  880
             + LP GTIR+  ++ +++ D   K     L++ + + A++LIGCDG  S+VA+ LGL   
Sbjct  120   EELPKGTIRYSSKIVAIEEDGNAKIIH--LADAAILRAKVLIGCDGVNSVVAKWLGLTKP  177

Query  879   KEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKF  700
                G +ATRGL  YP+ H L   F        R G++P +    +WF T+   +      
Sbjct  178   SSSGRLATRGLAHYPDGHGLDPRFKMFVGHGFRAGVIPCNETDAYWFFTWSPSEHESNGV  237

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
                   +KQ V+  + +   +P +V EV+  S    +  S L++RPP  LLL  + KG  
Sbjct  238   EESAEKMKQFVLTKL-RSSKIPTEVLEVVERSNINDVVASPLRFRPPLSLLLASISKGNA  296

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              VAGDA+H M P LGQGGC++LED VVLARCLG A               S RIE +L +
Sbjct  297   CVAGDALHPMTPDLGQGGCAALEDGVVLARCLGDALLGGG------GAAESERIEASLRE  350

Query  339   YVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             Y + RR R  +L    Y++G    ++ A  S L      G +A      A   +YDCG+L
Sbjct  351   YARIRRWRSVELVGTAYVVGIVQQSNNAVISFLRDKWLAGVLAGRLLKMA---DYDCGKL  407



>ref|XP_008386051.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Malus domestica]
Length=461

 Score =   225 bits (573),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 228/416 (55%), Gaps = 35/416 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL + GLK++VLE+S  LR  G  + + PN W ALD LG+  HL
Sbjct  62    DVVIVGAGIAGLATAVALKKAGLKALVLEKSDSLRVTGAALTLFPNAWCALDALGVSHHL  121

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGD----VRCMARNDLIRSLADALPAGTIRFG  1027
              ++   +++G   +I  GE +E  +   +G+     R + R  L+++LAD LP  +IRF 
Sbjct  122   TSLYATIKKGYITNIDTGEIQEVSLAASNGNDLVGPRSVHRKALLKALADELPPNSIRFA  181

Query  1026  CEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              ++++++      +  + + L +G+ I+A++LIGCDG  S+V   LGL      G    R
Sbjct  182   SKLTAIEAQEHEGSSISVIHLGDGTIIKAKVLIGCDGIHSVVGRSLGLAEPVYAGRSGVR  241

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             GL  +P  H L     ++   + R G +P++   ++WF  F T    G     +   IK+
Sbjct  242   GLAVFPQGHGLDNNVQQYVGLNRRAGFVPLNDKEIYWF--FVTYLAKGADLANEPEVIKR  299

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              VIEN  K  DLP    +V+  S+  +LS++ L +R P  ++ G L K  +TVAGDAMH 
Sbjct  300   EVIENYAK--DLPPIYLDVVRHSDLSTLSWAPLMFRYPWHVVFGNLGKQNITVAGDAMHP  357

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +G++      +  + KE  S     A+ KYV+ERR RV
Sbjct  358   MTPDLGQGGCLALEDAVVLGRYIGTSFVQNGQI--VPKEMVS-----AIGKYVEERRWRV  410

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAM-----ALFFRNGAAQ----NEYDCGQL  172
             A L   +YL G      S       GG M      +F+R    Q    + YDCG+L
Sbjct  411   ALLIAGSYLSGWIQQPGS-------GGVMKFLRETIFYRFIFNQLVKLSRYDCGKL  459



>gb|AFK34459.1| unknown [Lotus japonicus]
Length=416

 Score =   224 bits (570),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 228/419 (54%), Gaps = 23/419 (5%)
 Frame = -2

Query  1383  TDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLG  1204
             T    +I+IVG GI GL T+L LHR G++S+VLE S  LR+ G  +    N W+AL+ +G
Sbjct  3     TQVVEDILIVGAGIAGLTTSLGLHRLGVRSLVLESSDTLRATGFALATWKNAWKALEAVG  62

Query  1203  IGSHLRTVAL--------PLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALP  1048
             +G+ LR   L         L  G+       K+   ++ S +VRC+ R  ++ +LA+ LP
Sbjct  63    VGTILRDRHLQVNGITITSLITGQPTSTVSFKDNG-KHGSCEVRCVRRKLMLEALANELP  121

Query  1047  AGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
             +GTIR+  +V +++     K   L L++G+ I+ ++LIGCDG  S+VA+ LG K A   G
Sbjct  122   SGTIRYLSKVVAIEESGFYKI--LHLADGTIIKTKVLIGCDGVNSMVAKWLGFKEASFTG  179

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRD  691
               A RG     + H       + F    R G++P   + ++WF T+ PT Q  GE+   +
Sbjct  180   RQAIRGCVELESNHGFDPMLKQFFGQGFRAGVVPCDQETIYWFFTWTPTTQ--GEELEEN  237

Query  690   ----ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
                 +  +KQ V+  +EK+   P+ V+  I  +E +    + L+YR P EL+LG + KG 
Sbjct  238   PAKLKTKLKQFVLNKLEKM---PSDVRCFIEKTELDCFHSAPLRYRQPWELMLGNISKGN  294

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA-AAVKNNVDGIEKEERSARIEEAL  346
             V VAGDA+H M P LGQGGC +LED VVLARCL  A +       G E EE+  RIEE+L
Sbjct  295   VCVAGDALHPMTPDLGQGGCCALEDGVVLARCLAKAFSEKSKEKKGEEDEEQYKRIEESL  354

Query  345   EKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             +KY  ER+ R   L    Y+ G    A SK         +A+F  +   +   +DCG L
Sbjct  355   KKYADERKWRSIDLISTAYMAGFVQQANSKWVTFLRDKVLAIFLADILLKKANFDCGTL  413



>ref|NP_195566.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis 
thaliana]
 emb|CAA07575.1| monooxygenase [Arabidopsis thaliana]
 emb|CAB37510.1| monooxygenase 2 (MO2) [Arabidopsis thaliana]
 emb|CAB80518.1| monooxygenase 2 (MO2) [Arabidopsis thaliana]
 gb|AEE86944.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis 
thaliana]
Length=407

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 147/408 (36%), Positives = 224/408 (55%), Gaps = 15/408 (4%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +I+IVG GI GL+TA+ LHR G++S+VLE S+ LR+ G       N W+A++ LG+  H+
Sbjct  8     DIIIVGAGISGLSTAVGLHRLGIRSMVLESSETLRATGFAFTTWFNAWKAMEALGVSQHI  67

Query  1188  RTVALPLQRGR--DIFLGEDKEQKI--EYVSGDVRCMARNDLIRSLADALPAGTIRFGCE  1021
             R++   L+      I  G    + +  E    + RC+ R  L+ +LA  LP  TIRF  +
Sbjct  68    RSLHDRLEGWVVGTISAGTPPTEMLFPESEEYESRCVQRKLLLEALAGELPEETIRFSSK  127

Query  1020  VSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             V  ++     K  ++ LS+G+ ++ ++L+GCDG  S+V + LG K       +A RGLT 
Sbjct  128   VVHIELSGCYK--KVHLSDGTILKTKVLVGCDGVYSVVGKWLGFKNPATTARLAIRGLTH  185

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             +P  H     F + +   VR G +P  H+ V+WF+T  +  +  E    +   +K+ V+ 
Sbjct  186   FPEGHGFGKRFFQFYGDGVRSGFIPCDHNTVYWFLTHTSTDIDEET---NSEILKEFVLN  242

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
                K++DLP  +K V+  ++ +S+  S LKYRPP ELL   + K  V VAGDA+H M P 
Sbjct  243   ---KIKDLPENIKNVVETTDLDSMVMSQLKYRPPWELLWSNITKDNVCVAGDALHPMTPD  299

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKN--NVDGIEKEERSARIEEALEKYVKERRMRVAQ  307
             +GQGGCS++ED V+LARCLG A   K+        +EE   RIEE L+KY  ER+ R   
Sbjct  300   IGQGGCSAMEDGVILARCLGEAIKAKSLKGETEENEEEGYKRIEEGLKKYAGERKWRSID  359

Query  306   LSMHTYLIGASMAATSKLAKMAFGGAMALFF-RNGAAQNEYDCGQL*P  166
             L    Y +G    +  K   M     ++ +  R    ++ +DCG L P
Sbjct  360   LITTAYTVGFIQQSRGKWMNMFRDRFLSSYLSRMLLKKSHFDCGSLVP  407



>ref|XP_004162913.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus]
Length=480

 Score =   225 bits (574),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 150/414 (36%), Positives = 222/414 (54%), Gaps = 27/414 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +I+IVG GICGL TAL LHR G++S+VLE S  LR  G  + +  NGW+ALD +GIG  L
Sbjct  79    DILIVGAGICGLTTALGLHRLGIRSLVLESSDDLRVTGYALSIWTNGWKALDAVGIGDSL  138

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
             R       +  D   G    ++     G VRC+ R  L+  LA ALP+GTI+F  +V ++
Sbjct  139   R-------QNHDQLDGVITPEE-----GGVRCVRRKFLLECLAKALPSGTIKFSSKVVAI  186

Query  1008  DYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNA  829
             +   + K     L++G+ I+ ++LIGCDG +S+VA+ LG K     G  A RG     + 
Sbjct  187   EESGLLKLVH--LADGTSIKTKVLIGCDGVKSVVAKWLGFKALAFTGRCAVRGCLQLESN  244

Query  828   HSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIK--QMVIENI  655
             H+   +   +    VR GI+P  +  ++WF   P +     ++ R     K   + ++N 
Sbjct  245   HNFERKVRLYAGEGVRAGIIPCDYKTLYWFFLGPLQLTVSPQWLRSRRPKKLPHLNLKNP  304

Query  654   EKLQDL--------PAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
              KL+ L        P   + VI  ++        L+YR P EL+LG + KG V VAGDA+
Sbjct  305   VKLKQLLLSMLGEIPEAARAVIEETDVSCFHPVALQYRSPWELMLGNIVKGNVCVAGDAL  364

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEER--SARIEEALEKYVKER  325
             H M P LGQGGC++LEDAV+LARC+  A   K +    EK ER    ++E  L+KY  ER
Sbjct  365   HPMTPDLGQGGCAALEDAVILARCVAEALLKKPSSQEGEKAEREQQKQVEMGLKKYAAER  424

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL*P  166
             + R  +L    Y++G    ++   AK      ++ F      +N ++DCG+L P
Sbjct  425   KWRSIELIGTAYMVGKIQQSSGVFAKFIRDKILSKFLAGLLLKNAKFDCGKLTP  478



>ref|XP_009769331.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Nicotiana sylvestris]
Length=421

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 220/425 (52%), Gaps = 26/425 (6%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  +   +IVIVG GI GLAT+LALHR GL+SIVLE S  LR+ G  + +  N WRAL
Sbjct  4     QKEQMEINEDIVIVGAGIAGLATSLALHRLGLRSIVLESSDSLRTSGFALALWTNAWRAL  63

Query  1215  DQLGIGSHLRTVALPLQRGR-----------DIFLGEDKEQKIEYVSGDVRCMARNDLIR  1069
             D LG+G  LR  +L   R             +I L  +K+ + +Y   D RCM R +++ 
Sbjct  64    DALGVGDSLRQRSLQFSRFEAFSAVSGKPTAEISLDANKKPR-DY---DSRCMKRQEIVE  119

Query  1068  SLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGL  889
             +L   LP GTI++   V S+    +  F  L L++ + +  ++LIGCDG  S+VA+ +GL
Sbjct  120   TLEKELPPGTIKYSSRVVSIQDSGL--FKLLHLADKTVLRTKVLIGCDGVNSVVAKWMGL  177

Query  888   KPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLT  712
             +   +    A RG   Y   H    +F  +F G VR+G LP     ++WF TF P+    
Sbjct  178   QKLVDANRSAIRGYVEYIEGHGFEPKFCAYFGGGVRIGFLPCDDKSLYWFCTFTPSAVNY  237

Query  711   GEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllgrl  535
              E        +KQ V   +    ++  +   ++  +  +SL  + LK R     L+   +
Sbjct  238   DESIEGSPIKMKQFV---LSMASNVSKEAYNILQRTSLDSLYCAKLKLRSPLNILMRDNI  294

Query  534   RKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK---NNVDGIEKEERSA  364
              K    + GDA+H M P +GQGGCS+LED+VVLARC+    + K     ++ +E +E   
Sbjct  295   VKRNTCLVGDALHPMTPDIGQGGCSALEDSVVLARCIAEPFSRKLPTGILEKLEDDEFYN  354

Query  363   RIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEY  187
             RI+  LEKY K RR R+  L   +YL+G +  +  K+        +A F         ++
Sbjct  355   RIKVGLEKYAKARRWRIFNLISTSYLVGLAQESNGKVISYLREKFLAQFTIETMLRMGDF  414

Query  186   DCGQL  172
             DCG+L
Sbjct  415   DCGKL  419



>ref|XP_009624704.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Nicotiana tomentosiformis]
Length=400

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 143/413 (35%), Positives = 213/413 (52%), Gaps = 26/413 (6%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  +   +IVIVG GI GLAT+LALHR GL+S+VLE S  LR+ G  + +  N WRAL
Sbjct  4     QKEQMEINEDIVIVGAGIAGLATSLALHRLGLRSLVLESSDSLRTSGFALTLWTNAWRAL  63

Query  1215  DQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTI  1036
             D LG+G  LR  +L   R RD                D RCM R +++ +L   LP GTI
Sbjct  64    DALGVGDTLRQHSLQFSR-RDY---------------DSRCMKRQEIVETLEKELPPGTI  107

Query  1035  RFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             ++   V S+    +  F  L L++ + +  ++LIGCDG  S+VA+ +GL    +    A 
Sbjct  108   KYSSLVVSIQDSGL--FKLLHLADKTVLRTKVLIGCDGVNSVVAKWMGLPKLVDANRSAI  165

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAI  679
             RG   Y   H    +F  +F   VR+G LP     ++WF TF P+     E        +
Sbjct  166   RGYVEYSEGHEFEPKFCAYFGRGVRIGFLPCDDKSLYWFCTFTPSALNYDESIEGSPVKM  225

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllgrlRKGTVTVAGDA  502
             KQ V   +    ++  +V  ++  +  +SL  + LK R     L++  + K    + GDA
Sbjct  226   KQFV---LSMASNVSKEVYNILQRTSLDSLYCAKLKLRSPLNILMIYNIVKRNTCLVGDA  282

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK--NNVDGIEKEERSARIEEALEKYVKE  328
             +H M P +GQGGCS+LED VVLARC+    + K    ++ +E ++   RI+  LEKY KE
Sbjct  283   LHPMTPDIGQGGCSALEDGVVLARCIAETFSKKLPTGMEKLEDDDFYNRIKVGLEKYAKE  342

Query  327   RRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEYDCGQL  172
             RR R+  L   +YL+G +  +  K+        +A F         ++DCG+L
Sbjct  343   RRWRIFNLISTSYLVGLAQESNGKVISYLREKFLAQFTIETMLRMGDFDCGKL  395



>ref|XP_004288322.1| PREDICTED: FAD-dependent urate hydroxylase-like [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 222/409 (54%), Gaps = 20/409 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++++VLE+S+ LR+ G  + + PN W ALD LG+ SH 
Sbjct  7     DVVIVGAGIAGLATAVALKRAGIEALVLEKSEGLRTTGAALTLFPNAWIALDALGV-SHK  65

Query  1188  RTVALPLQRGR--DIFLGEDKEQKIEYVSGDV---RCMARNDLIRSLADALPAGTIRFGC  1024
                  P ++    D+  GE +   +   +GD    R + R  L+ +LAD LP  +IRF  
Sbjct  66    LASYTPSRKNHVTDLDTGEVQTVSLIKANGDAVGPRSVHRKALLEALADELPIHSIRFSS  125

Query  1023  EVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
             ++S++D      +    + + NG+ I+A++LIGCDG  S+V+ LLGL      G  A RG
Sbjct  126   KISAIDTQQYEGSSIAIVHIENGTVIKAKVLIGCDGVHSVVSRLLGLSEPVHSGRSAVRG  185

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             L  YP  H L  E  ++     R G +P++   + WF +  T    G    +D   I++ 
Sbjct  186   LAVYPQGHGLEQEVRQYVGLGRRAGFVPLTDKEIFWFFS-GTTPAKGTSLAKDPEEIQKE  244

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             ++EN  K  DLP    +V+  ++  +L+++ L +R P  ++   L K  +TVAGDAMH M
Sbjct  245   ILENYAK--DLPPIYLDVVQHADVSTLTWAPLMFRYPWNVVFSSLSKQNITVAGDAMHPM  302

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P L QGGCS+LEDA +L R +G+  + K N   +  +E S    E L KYV+ERR RV 
Sbjct  303   TPDLAQGGCSALEDAAILGRHIGT--SFKQNGHVLVPKEMS----EVLSKYVEERRWRVV  356

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAM---ALFFRNGAAQNEYDCGQL  172
              L   +Y+ G      S         A+    +F +  +  N  DCG+L
Sbjct  357   FLIAGSYISGWVQQGGSGWGMKFLRDAIFYKFIFPKMVSYVNYVDCGKL  405



>gb|KEH44372.1| FAD-dependent urate hydroxylase-like protein [Medicago truncatula]
Length=398

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 162/412 (39%), Positives = 232/412 (56%), Gaps = 31/412 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIG---  1198
             +IVIVG GI GL T+LALHR G++S+VLE S  LR  G  + +  N W+ LD +G+G   
Sbjct  4     DIVIVGAGIAGLTTSLALHRLGVRSLVLESSDSLRVSGFALTIWENAWKVLDVVGVGDIL  63

Query  1197  --SHLR---TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
                HLR    V   L  G+       K  K ++   +VRC+ R  L+ +LA+ LP GTIR
Sbjct  64    RHQHLRLHGNVTTSLITGQQTSTTPFKNNKGKH---EVRCVKRKLLLEALANELPNGTIR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
             +  +V +++    +K   L L +G+ I+ ++LIGCDG  S+VA+ LG K A   G  ATR
Sbjct  121   YMSKVVAIEESGFSKI--LHLVDGTTIKTKVLIGCDGVNSVVAKWLGFKEASYTGRYATR  178

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIK  676
             G       H+L   F ++F    R G +P     V+WF T+ P  Q   ++  +D   +K
Sbjct  179   GYAELKTTHNLEPMFMQYFGKGFRAGAIPCDEKSVYWFFTWTPINQ--DKELAQDPAKLK  236

Query  675   QMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMH  496
             Q V+  +EK+   P+ VK  I  +E ++   + L++R P EL++G + KG V VAGDA+H
Sbjct  237   QYVLNKLEKM---PSDVKHFIENTELDAFQSAPLRHRHPWELMMGNISKGNVCVAGDALH  293

Query  495   VMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMR  316
              M P LGQGGCS+LED VVLARCL  A + K      ++EE   RIEE+L+KY  ER+ R
Sbjct  294   PMTPDLGQGGCSALEDGVVLARCLAEAFSKKP-----KEEEEYKRIEESLKKYANERKWR  348

Query  315   VAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQ----NEYDCGQL  172
                L   +Y++G    + SK         +A F    AAQ    +++DCGQL
Sbjct  349   CIDLITASYIVGYIQQSGSKSVNFFRDKILATFL---AAQLLKKSDFDCGQL  397



>ref|XP_008231579.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Prunus mume]
Length=402

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/408 (37%), Positives = 224/408 (55%), Gaps = 19/408 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++++VLERS+ LR+ G  + +  N W ALD LGI  +L
Sbjct  3     DVVIVGAGIAGLATAVALKRAGVEALVLERSEGLRATGAALTLSRNAWVALDALGISQNL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGD-----VRCMARNDLIRSLADALPAGTIRFGC  1024
               +  PL++G    L   + Q + +V+ +      R + R  L+ +LAD LP  +IRF  
Sbjct  63    APLYAPLKKGYITNLDTGEIQDVSFVASNGDPVGPRSVHRKALLNALADQLPINSIRFSS  122

Query  1023  EVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
             ++++++      +  + + +++G+ I+A++LIGCDG  S+VA  LGL      G  A RG
Sbjct  123   KLTAIETQEHEGSSISIIHMADGTVIKAKVLIGCDGMHSVVARWLGLAEPVYSGRSAVRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             L+ +P  H L     ++     + G +P++   ++WF T  T    G     +   IK+ 
Sbjct  183   LSVFPQGHGLDNNVQQYLGLGRKAGFVPLNDKEIYWFFTC-TSPAKGADMADEPEVIKRE  241

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             VIEN  K  DLP    +V+  S+  +L+++ L +R P  +++G L K  +TVAGDAMH M
Sbjct  242   VIENYAK--DLPPIYLDVVQHSDLSTLTWAPLMFRYPWHVVVGNLSKQNITVAGDAMHPM  299

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P L QGGCS+LEDAVVL R +G   +   N   + KE     +   + KYV+ERR RVA
Sbjct  300   TPDLAQGGCSALEDAVVLGRHIGK--SFIQNGRLVPKE-----MAVTIGKYVEERRWRVA  352

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG--AAQNEYDCGQL  172
              L   +YL G    A S         A+   F N        YDCG+L
Sbjct  353   LLIAGSYLSGWVQQAGSGWGMKFLRDAIFYRFFNSIIIKFTRYDCGKL  400



>gb|EAY88589.1| hypothetical protein OsI_10064 [Oryza sativa Indica Group]
Length=416

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 220/419 (53%), Gaps = 21/419 (5%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  D + EIVI G G+ GLA AL LHRKGL+S+VLE S  LR+ G       N +RAL
Sbjct  2     QQEQADGR-EIVIAGAGLAGLAVALGLHRKGLRSVVLESSPTLRTSGLAFITWTNAFRAL  60

Query  1215  DQLGIGSHLRTVALPLQRGR-------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             D LG+G  +R+    +QR         +I    D   + +  + + RC++R  L+ +L +
Sbjct  61    DALGVGDKMRSQHQQIQRLNVMSSATGEIVQEIDLRAQGKRGTHEARCVSRTALLLALEE  120

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIR+  ++ S++ D   K   L LS+GS + A++LIGCDG  S+VA  LGL    
Sbjct  121   ELPRGTIRYSSKIVSIEEDGNAKI--LHLSDGSTLRAKVLIGCDGINSVVARWLGLAKPS  178

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
             + G  ATRG   YP+ H     F +      R G++P +   V+WF T+ +     +   
Sbjct  179   DSGRTATRGRAKYPDGHGFEPRFLQLVGQGFRAGMVPCNDTDVYWFFTW-SPSPDDKDVD  237

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
             +   A+KQ V+  +    ++P +V E +  SE   +  + L++R P  L    + KG V 
Sbjct  238   KSSAAMKQFVLTKLRS-TNVPPQVLEAVERSEMNDVLAAPLRFRSPLSLPFASISKGNVC  296

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDA+H   P L QG C++LEDAVVLARCLG A  ++      E+  R   +E AL +Y
Sbjct  297   VAGDALHPTTPDLAQGACTALEDAVVLARCLGEALLLRTGDCAAEESHRV--VEAALRRY  354

Query  336   VKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                RR R AQL+  +Y +G    +   A   L      G +A   +      +YDCG L
Sbjct  355   ADARRWRSAQLTGASYAVGFVQQSDHPAVGFLRDKLLSGVLA---KTLLMMPDYDCGTL  410



>ref|NP_001049001.1| Os03g0154000 [Oryza sativa Japonica Group]
 gb|ABF94040.1| FAD binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10915.1| Os03g0154000 [Oryza sativa Japonica Group]
 gb|EAZ25625.1| hypothetical protein OsJ_09453 [Oryza sativa Japonica Group]
 dbj|BAG95880.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 220/419 (53%), Gaps = 21/419 (5%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  D + EIVI G G+ GLA AL LHRKGL+S+VLE S  LR+ G       N +RAL
Sbjct  2     QQEQADGR-EIVIAGAGLAGLAVALGLHRKGLRSVVLESSPTLRTSGLAFITWTNAFRAL  60

Query  1215  DQLGIGSHLRTVALPLQRGR-------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
             D LG+G  +R+    +QR         +I    D   + +  + + RC++R  L+ +L +
Sbjct  61    DALGVGDKMRSQHQQIQRLNVMSSATGEIVQEIDLRAQGKRGTHEARCVSRTALLLALEE  120

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIR+  ++ S++ D   K   L LS+GS + A++LIGCDG  S+VA  LGL    
Sbjct  121   ELPRGTIRYSSKIVSIEEDGNAKI--LHLSDGSTLRAKVLIGCDGINSVVARWLGLAKPS  178

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
             + G  ATRG   YP+ H     F +      R G++P +   V+WF T+ +     +   
Sbjct  179   DSGHTATRGRAKYPDGHGFEPRFLQLVGQGFRAGMVPCNDTDVYWFFTW-SPSPDDKDVD  237

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
             +   A KQ V+  + +  ++P +V E +  SE   +  + L++R P  L    + KG V 
Sbjct  238   KSSAATKQFVLTKL-RSTNVPPQVLEAVERSEMNDVLAAPLRFRSPLSLPFASISKGNVC  296

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDA+H   P L QG C++LEDAVVLARCLG A  ++      E+  R   +E AL +Y
Sbjct  297   VAGDALHPTTPDLAQGACTALEDAVVLARCLGEALLLRTGDCAAEESHRV--VEAALRRY  354

Query  336   VKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
                RR R AQL+  +Y +G    +   A   L      G +A   +      +YDCG L
Sbjct  355   ADARRWRSAQLTGASYAVGFVQQSDHPAVGFLRDKLLSGVLA---KTLLMMPDYDCGTL  410



>ref|XP_008236047.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Prunus mume]
Length=414

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 153/429 (36%), Positives = 226/429 (53%), Gaps = 45/429 (10%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +++ ++VIVG GI GLAT+L LHR G++S+VLE S  LR+ G  +    N W+ALD LG+
Sbjct  2     EAEADVVIVGAGISGLATSLGLHRLGIRSLVLESSDSLRTTGFALSTWTNAWKALDALGV  61

Query  1200  GSHLRTVALPLQ--------RGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPA  1045
                LR   + L          G   F    K  K ++   ++RC+ R  L+  LA+ LP+
Sbjct  62    ADSLRQQHVTLDGNVTSSRITGLQTFEMSFK-AKGKHGDHEIRCVKRKLLLDGLANELPS  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GT+R   +V SVD     K   L  ++G+ ++A++L+GCDG  S+VA+ LG K     G 
Sbjct  121   GTVRLSSKVVSVDESGYFKLVHL--ADGTILKAKVLVGCDGVNSVVAKWLGFKQPAFTGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
              A RG  T+  +H     F ++F   +R G +P     V+W++T+ P+ Q   ++   + 
Sbjct  179   SAIRGCATFKRSHGFDPMFMQYFGNGIRSGAVPCDDANVYWYITWTPSSQ--EKELEENP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               +KQ +     KL  +P +VK V+  +E ++   S L+YR P ELL G + KG   VAG
Sbjct  237   AQLKQYMSS---KLGKIPDEVKAVVENTELDAFISSPLRYRHPWELLWGNISKGNACVAG  293

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKE-------ERSARIEEA  349
             DA+H M P +GQGGC +LED+VVLARCLG   A+  N  G  K+       E   RIE  
Sbjct  294   DALHPMTPDIGQGGCCALEDSVVLARCLGE--ALLKNSGGETKDKEGEEGKEEYERIEMG  351

Query  348   LEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG----------AA  199
             L KY  ERR R   L   +Y++G    +  K            FFR+             
Sbjct  352   LNKYANERRWRSFDLISTSYVVGFLQESNGKFMN---------FFRDKFLSPILAGLRLK  402

Query  198   QNEYDCGQL  172
             + ++DCG+L
Sbjct  403   KADFDCGKL  411



>ref|XP_009769330.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Nicotiana sylvestris]
Length=423

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 220/427 (52%), Gaps = 28/427 (7%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  +   +IVIVG GI GLAT+LALHR GL+SIVLE S  LR+ G  + +  N WRAL
Sbjct  4     QKEQMEINEDIVIVGAGIAGLATSLALHRLGLRSIVLESSDSLRTSGFALALWTNAWRAL  63

Query  1215  DQLGIGSHLRTVALPLQR-------------GRDIFLGEDKEQKIEYVSGDVRCMARNDL  1075
             D LG+G  LR  +L   R               +I L  +K+ + +Y   D RCM R ++
Sbjct  64    DALGVGDSLRQRSLQFSRYAFEAFSAVSGKPTAEISLDANKKPR-DY---DSRCMKRQEI  119

Query  1074  IRSLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELL  895
             + +L   LP GTI++   V S+    +  F  L L++ + +  ++LIGCDG  S+VA+ +
Sbjct  120   VETLEKELPPGTIKYSSRVVSIQDSGL--FKLLHLADKTVLRTKVLIGCDGVNSVVAKWM  177

Query  894   GLKPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQ  718
             GL+   +    A RG   Y   H    +F  +F G VR+G LP     ++WF TF P+  
Sbjct  178   GLQKLVDANRSAIRGYVEYIEGHGFEPKFCAYFGGGVRIGFLPCDDKSLYWFCTFTPSAV  237

Query  717   LTGEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllg  541
                E        +KQ V   +    ++  +   ++  +  +SL  + LK R     L+  
Sbjct  238   NYDESIEGSPIKMKQFV---LSMASNVSKEAYNILQRTSLDSLYCAKLKLRSPLNILMRD  294

Query  540   rlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK---NNVDGIEKEER  370
              + K    + GDA+H M P +GQGGCS+LED+VVLARC+    + K     ++ +E +E 
Sbjct  295   NIVKRNTCLVGDALHPMTPDIGQGGCSALEDSVVLARCIAEPFSRKLPTGILEKLEDDEF  354

Query  369   SARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQN  193
               RI+  LEKY K RR R+  L   +YL+G +  +  K+        +A F         
Sbjct  355   YNRIKVGLEKYAKARRWRIFNLISTSYLVGLAQESNGKVISYLREKFLAQFTIETMLRMG  414

Query  192   EYDCGQL  172
             ++DCG+L
Sbjct  415   DFDCGKL  421



>gb|AFW89684.1| hypothetical protein ZEAMMB73_408646, partial [Zea mays]
Length=352

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 147/359 (41%), Positives = 208/359 (58%), Gaps = 20/359 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             D+  +IVI G G+ GLATAL LHRKG++ +VLE S  LR+ G       N +RALD LG+
Sbjct  3     DAVEDIVIAGAGLAGLATALGLHRKGVRCLVLESSPALRASGFAFTTWTNAFRALDALGV  62

Query  1200  GSHLRTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLADALPAG  1042
             G  +R   L  +R        GE   +   KI+  SG  ++RC+ R+ L+R+LAD LP G
Sbjct  63    GDKIREHHLLYERMIAFSAATGEAAAEVSLKIQSKSGPHEIRCVKRDFLLRTLADELPEG  122

Query  1041  TIRFGCEVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
             TIR+  +V +++ D V   K  +L L++GS I+A+++IGCDG  S+VA+ LGL      G
Sbjct  123   TIRYSAKVVAMEEDGVGGAKTLQLHLADGSTIKAKVVIGCDGVNSVVAQWLGLPKPILSG  182

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDE  688
               ATRGL  YP  H    E  +      R G+LP S   V+W  T+      G+     E
Sbjct  183   RSATRGLAEYPGGHGFGPEILQFIGHGFRSGVLPCSDTSVYWNYTWYPSPADGDA----E  238

Query  687   NAIKQMVIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
              ++ +M    + KL+   +PA+  EV+  SE   ++ S L++R P  L+ G + +G V V
Sbjct  239   ESVAKMRSHVVAKLRGAKVPAEALEVVERSEMSDVASSPLRFRSPLALVRGSISRGGVCV  298

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             AGDA+H M P LGQGGC++LED VVLARCLG A A+     G E++E    +  ALE+Y
Sbjct  299   AGDALHPMTPELGQGGCAALEDGVVLARCLGKAFALL----GQERDEGRV-VTAALEEY  352



>ref|XP_007041787.1| FAD/NAD(P)-binding oxidoreductase family protein, putative [Theobroma 
cacao]
 gb|EOX97618.1| FAD/NAD(P)-binding oxidoreductase family protein, putative [Theobroma 
cacao]
Length=404

 Score =   221 bits (562),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 221/406 (54%), Gaps = 13/406 (3%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              ++VIVG GI GL T+L LHR G++S+VLE S  LR+ G       N W+ALD +GIG  
Sbjct  5     EDVVIVGAGIAGLTTSLGLHRLGIRSLVLESSDRLRTTGFAFTTWENAWKALDAIGIGES  64

Query  1191  LRTVALPLQR--GRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEV  1018
             LR     +Q       FL +   + I ++  +VRC+ R  L+ +LA+ +P+GTIRF  +V
Sbjct  65    LRQHHSLMQSILVTSTFLVKPISE-ISFMGSEVRCLQRRLLLETLANEVPSGTIRFSSKV  123

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              S++      F R+ L++G+ ++ ++LIGCDG  S+VA+ LG +     G  A RG    
Sbjct  124   VSIEESGF--FKRVHLADGTILKTKVLIGCDGVNSVVAKWLGFEKPVFAGRSAIRGFANI  181

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
                H   ++F +     +R G+LP   ++V+WF+T+ T     E+   D   +KQ  +  
Sbjct  182   EGGHGFGLKFRQFVGKGIRSGLLPCDDEIVYWFMTW-TPASKEEELEEDPVKLKQFAMS-  239

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
               KL+D P ++K VI  +  + +  S L+YR P ELL G + KG V +AGDA+H M P L
Sbjct  240   --KLKDTPDEMKSVIEKTLLDGIVSSPLRYRRPWELLWGNISKGNVCLAGDALHPMTPDL  297

Query  477   GQGGCSSLEDAVVLARCLGSA---AAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQ  307
             GQGGCS++ED VVLARCL  A          + I++EE   RIE  L+K+ +ERR R   
Sbjct  298   GQGGCSAMEDGVVLARCLAEALLKVPRGEIKEKIDEEEEYKRIEMGLKKFAQERRWRSID  357

Query  306   LSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             L    Y++G       K+        ++ F      +   YD G L
Sbjct  358   LITTAYMVGFMQQHNGKIINFFRDKFLSRFLSGILLRKASYDSGNL  403



>ref|XP_010088731.1| 3-hydroxybenzoate 6-hydroxylase 1 [Morus notabilis]
 gb|EXB36912.1| 3-hydroxybenzoate 6-hydroxylase 1 [Morus notabilis]
Length=405

 Score =   221 bits (562),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 216/412 (52%), Gaps = 25/412 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL R G+K++VLER   LR+ G  + +LPN WRALD LG+ SH 
Sbjct  3     EVVIVGAGIAGLATAVALKRVGIKALVLERWDGLRATGAALSLLPNAWRALDALGV-SHK  61

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDV-------RCMARNDLIRSLADALPAGTIRF  1030
              T+  P ++     L     Q++ +   +        + + R  L+ +L + L A +IRF
Sbjct  62    LTIYSPPKKSYVTNLETGAIQEVPFGGTNAGGHQSGPKSVHRKALLEALGEELQADSIRF  121

Query  1029  GCEVSSVDYDSVT----KFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
               +++ +   S+T        L + +GS I+A++LIGCDG  S VA  LGL    + G  
Sbjct  122   SSKINGI--GSITHEGSSIAVLYMEDGSIIKAKVLIGCDGVHSAVATWLGLASPVDAGRT  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
               RGL  +P  H L  E  +      R G LP++   + WF    T     +   RD   
Sbjct  180   VVRGLAVFPQGHGLKHELQQFVGSGTRSGFLPVTDRDIFWFYGCSTPPKGADHVARDPKL  239

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             I++ +IEN  K  D P    +++  S+  ++ ++ L YR P  +  G L    VTVAGDA
Sbjct  240   IQREIIENYAK--DFPELYLDIVKHSDLSTVHWAQLVYRQPWNVAFGNLSNQNVTVAGDA  297

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             MH M P L QGGCS+LEDAVVL R +G+ + +KN   G+   E    + + L  YV+ERR
Sbjct  298   MHPMTPDLAQGGCSALEDAVVLGRHIGT-SFIKNG--GLVPSE----VPKVLANYVEERR  350

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAM--ALFFRNGAAQNEYDCGQL  172
              R   L + +Y  G      S  A   F  ++     FR  A+  +YDCG+L
Sbjct  351   WRAVLLIIGSYFSGWVQQGGSSWAVKFFRDSIFYRFLFRMLASVTQYDCGKL  402



>ref|XP_008808978.1| PREDICTED: uncharacterized protein LOC103720836 [Phoenix dactylifera]
Length=259

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 168/266 (63%), Gaps = 18/266 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M S +  H+IVIVGGGICGLATALALHRKG+ S+VLE+S  LR+ G  IG+  NGWRALD
Sbjct  1     MGSKEEHHDIVIVGGGICGLATALALHRKGINSLVLEKSDTLRAAGAAIGIYINGWRALD  60

Query  1212  QLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIR  1033
             QLG+G+ LRT A+P+   RD++L ++K Q       ++RC+ R+DLI +LA  LP  ++R
Sbjct  61    QLGLGTELRTKAIPITEIRDMWLHKNKMQVTSCRKEELRCLKRSDLIETLAKNLPTQSVR  120

Query  1032  FGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILI--------GCDGGRSIVAELLGLKPAK  877
             FGC++ +++ D +T F  L  ++G+ I+A++++         CDG  SIVA+ LGL+  K
Sbjct  121   FGCQIVAIESDPITSFPALYTNDGATIKAKVMLHPQQVFYFSCDGSNSIVAKSLGLQAPK  180

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGD-VRVGILPISHDLVHWFV--TFPTRQLTGE  706
              F +   RG T+Y + HS    F R  +GD V +G LP+   LV+WFV    P++     
Sbjct  181   VFPISVVRGFTSYSDGHSFDSHFIR-LRGDGVLLGRLPVDEKLVYWFVGRLSPSQDSDVR  239

Query  705   KFPRDENAIKQMVIENIEKLQDLPAK  628
             K P     IK+  +E    L++ P++
Sbjct  240   KVP---ELIKEFTLET---LREFPSR  259



>ref|XP_010057480.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW74676.1| hypothetical protein EUGRSUZ_E03410 [Eucalyptus grandis]
Length=417

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 230/420 (55%), Gaps = 41/420 (10%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G++++VLERSK LR+ G  +G+  N W ALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVRALVLERSKELRTTGAALGLFANAWVALDALGVSDKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
               +  P+++G    +     Q++ + S       R + R  L+  LA+ LP  +IRF  +
Sbjct  63    AALYTPMEKGYITNVKTKSIQEMHFPSTRNGAQQRAVHRKVLLEVLAEELPPNSIRFSSK  122

Query  1020  VSSVDYDSVTKFTR--LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
             ++S++       +   ++L +G+ I+++++IGCDG  SIVA  LGL+P    G  A RGL
Sbjct  123   ITSIETQVEHGLSTCIVMLDDGTIIKSKVVIGCDGVHSIVARWLGLRPPVYSGRSAVRGL  182

Query  846   TTYPNAHSL-PIEFHRHFKGDV--RVGILPISHDLVHWFVTFPTRQLTGEKFP-------  697
             + +P  H   P    + F  DV  R   + ++   V+WF+        G K P       
Sbjct  183   SVFPKGHGFDPGHAIQQFV-DVGKRAAFIALNDKEVYWFL--------GAKCPPKGMEKG  233

Query  696   RDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVT  517
              D   I++ V+EN+ K  D P    +V+  S+  SL+++ L +R P ++L G L + +VT
Sbjct  234   ADPEMIQREVMENLAK--DFPPVFLDVVKHSDLSSLTWAPLMFRYPWDILFGNLFRSSVT  291

Query  516   VAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKY  337
             VAGDAMH M P LGQGGCS+LEDAV L R LG++ A    +        +  I  A+EKY
Sbjct  292   VAGDAMHPMTPDLGQGGCSALEDAVALGRHLGNSIAKHGKL-------VTQDIGFAIEKY  344

Query  336   VKERRMRVAQLSMHTYLIGASMAATSK-----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
              KERR+RVA L+  +YL G      S      L  + F G +     NG    EYDCG+L
Sbjct  345   AKERRLRVATLTTASYLSGWVQQDGSSRFMRFLRDVIFYGLLWGRVVNGII--EYDCGKL  402



>ref|XP_004985657.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=414

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 226/418 (54%), Gaps = 20/418 (5%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + ++ ++  +IVI G G+ GLATAL LHRKG++S+VLE S +LR+ G       N +RAL
Sbjct  7     QAQAMEAVEDIVIAGAGLAGLATALGLHRKGVRSLVLESSPMLRASGFAFTTWTNAFRAL  66

Query  1215  DQLGIGSHLRTVALPLQR--GRDIFLGEDKEQ---KIEYVSG--DVRCMARNDLIRSLAD  1057
             D LG+G  +R   L  +R        GE   +   K++  SG  ++RC+ R+ L+++L +
Sbjct  67    DSLGVGDKIREHHLLYERMITFSAATGEPAAKVSLKMQAKSGPHEIRCVKRDFLLQTLEN  126

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIR+  ++ +++ D     T L L++GS I+ ++LIGCDG  S+VA+ LGL    
Sbjct  127   ELPKGTIRYSSKIVAIEEDG--NATVLHLADGSIIKTKVLIGCDGVNSVVAKWLGLPKPI  184

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
               G  ATRGL  YP  H    E  +      R G+LP S   V+W  T+      G+   
Sbjct  185   LSGRSATRGLAEYPAGHCFGPEILQFIGQGFRSGVLPCSDTSVYWNYTWYPSPADGDA--  242

Query  696   RDENAIKQMVIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
               E ++ +M    + KL+   +PA   + I  SE   +  S L++R P  LL G + +G 
Sbjct  243   --EESVAKMRSHVLGKLRAAKIPAAALDAIERSEMSDVVSSPLRFRSPLALLRGSISRGG  300

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
             V VAGDA+H M P LGQGGC++LED VVLARCLG A A   +            I  ALE
Sbjct  301   VCVAGDALHPMTPELGQGGCAALEDGVVLARCLGEAFAAAGS----GGGGHDGVIRAALE  356

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
             KY + RR R  QL    Y++G    + + + K      ++ L  +   A  +YDCG L
Sbjct  357   KYAEARRWRSIQLITAAYVVGFIQQSNNVVVKFLRDTFLSPLLAKTLVAMADYDCGTL  414



>ref|XP_007212261.1| hypothetical protein PRUPE_ppa006635mg [Prunus persica]
 gb|EMJ13460.1| hypothetical protein PRUPE_ppa006635mg [Prunus persica]
Length=402

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/408 (36%), Positives = 222/408 (54%), Gaps = 19/408 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++++VLERS+ LR+ G  + +  N W ALD LGI  +L
Sbjct  3     DVVIVGAGIAGLATAVALKRAGVEALVLERSEGLRATGAALTLSRNAWVALDALGISQNL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGD-----VRCMARNDLIRSLADALPAGTIRFGC  1024
               +  P+++G    L   + Q + +V+ +      R + R  L+ +LAD LP  +IRF  
Sbjct  63    APLYAPIKKGYITNLDTGEIQDVSFVASNGDPVGPRSVHRKALLNALADQLPINSIRFSS  122

Query  1023  EVSSVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRG  850
             ++++++      +  + + +++G+ I+A++LIGCDG  S+VA  LGL      G  A RG
Sbjct  123   KLTAIETQEHEGSSISIIHMADGTVIKAKVLIGCDGVHSVVARWLGLAEPVYSGRSAVRG  182

Query  849   LTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQM  670
             L  +P  H L     ++     R G +P++   ++WF T  T    G     +   IK+ 
Sbjct  183   LAVFPQGHGLDNNVQQYLGLGRRAGFVPLNDKEIYWFFTC-TSPAKGADMVDEPEVIKRE  241

Query  669   VIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVM  490
             VIEN  K  DLP    +V+  S+  +L+++ L +R P  ++ G L K  +TVAGDAMH M
Sbjct  242   VIENYAK--DLPPIYLDVVQHSDLSALTWAPLMFRYPWHVVFGNLSKQNITVAGDAMHPM  299

Query  489   GPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVA  310
              P L QGGCS+LEDAVVL R +G   +   N   + KE     +   + KYV+ERR RVA
Sbjct  300   TPDLAQGGCSALEDAVVLGRHIGK--SFIQNGQLVPKE-----MAVTIGKYVEERRWRVA  352

Query  309   QLSMHTYLIGASMAATSKLAKMAFGGAMA--LFFRNGAAQNEYDCGQL  172
              L   +YL G    A S         A+    F+        YDCG+L
Sbjct  353   LLIAGSYLSGWVQQAGSGWGMKFLRDAIFYRFFYLIIIKFTRYDCGKL  400



>ref|XP_010690341.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 148/381 (39%), Positives = 204/381 (54%), Gaps = 30/381 (8%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GLATALALHR G+KS+VLE S  LR+ G       N WRALD L IG  L
Sbjct  6     DIVIVGAGISGLATALALHRLGIKSLVLESSDTLRAAGIAFTTWTNAWRALDALKIGDTL  65

Query  1188  R-------------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALP  1048
             R             TV   L    DI   +   +  ++   +VRC+ R +L+ +LA  LP
Sbjct  66    RQQHGELSGISSLSTVTGDLNS--DITFTDKGNKGNDH---EVRCVRRKNLLEALAKELP  120

Query  1047  AGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFG  868
               TIR+  +V S++    +K   L  ++GS  + +IL+GCDG  S+VA+ LG K     G
Sbjct  121   KDTIRYSSKVVSIEEVGFSKLVHL--ADGSIFKTKILVGCDGVNSVVAKWLGFKQPALTG  178

Query  867   VVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRD  691
               A RG   Y   H    +F        R GI+P     V+WF T+ P+ Q +      D
Sbjct  179   RSAIRGCAYYKEGHGFEPKFQLFVGNSARYGIIPCDDTAVYWFFTWSPSAQESRTLQEAD  238

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
             +  +KQ V+    KL ++P ++  VI  +  E +  S L YRPP ++L G + K  V VA
Sbjct  239   QLKLKQFVLT---KLGNVPDQIMSVIEDTRVEEIVRSPLGYRPPLQILFGNISKDNVCVA  295

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA----AAVKNNVDGIEKEERSARIEEALE  343
             GDA H M P LGQGGCSSLED ++LA+CL  A    ++ +   DG + E +  RIE  L+
Sbjct  296   GDAFHAMTPDLGQGGCSSLEDGIILAKCLADALRENSSRQGENDGCKDEYK--RIESGLK  353

Query  342   KYVKERRMRVAQLSMHTYLIG  280
              Y K+R+ R   L    Y++G
Sbjct  354   NYAKKRKWRAIDLIYTGYVLG  374



>gb|KDP35312.1| hypothetical protein JCGZ_09471 [Jatropha curcas]
Length=412

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 223/406 (55%), Gaps = 20/406 (5%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GLATA+AL R G++S+VLERS+ LR+ G  + + PN W ALD LG+   L
Sbjct  3     DVVIVGAGIAGLATAVALKRVGVRSLVLERSEGLRATGAALTLFPNAWLALDALGVSQKL  62

Query  1188  RTVALPLQRG--RDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
              ++  P+QRG   ++  G      +  ++G  R + R  L+ +LA+ LPA +IRF    +
Sbjct  63    TSLYNPIQRGCTTNVVTGAVYNNVLTGINGP-RSVHRKALLEALAEELPADSIRFSSNFT  121

Query  1014  SVDYDSV--TKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTT  841
             +++      +    + L +G+ I++++LIGCDG  S+VA  LGL      G  A RGL  
Sbjct  122   AIEEQEQGGSSIVVVHLEDGTTIKSKVLIGCDGVHSVVANRLGLSAPIHSGRSAVRGLAI  181

Query  840   YPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIE  661
             +P  H    E  +      R G++P++   ++WF+T     L GE   R+   I++ +I 
Sbjct  182   FPQGHGFNDEAKQFLNAGKRAGLIPLNEKEIYWFLT----GLEGENMVREPEQIQKEIIN  237

Query  660   NIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPF  481
                K  D P+   +V+  S+  +LS++ L  R P  ++ G L KG +TVAGDAMH M P 
Sbjct  238   KYAK--DFPSIYLDVVQHSDLSTLSWAPLILRQPWNVIFGNLSKGNITVAGDAMHPMTPD  295

Query  480   LGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLS  301
             LGQGGCS+LEDAVVL R +G  + ++NN   +  +     +  A+  YV+ERR RVA L 
Sbjct  296   LGQGGCSALEDAVVLGRHIGE-SCIRNNGRLVSND-----MAGAINGYVRERRWRVAGLI  349

Query  300   MHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN---EYDCGQL  172
               +YL G      S+        A+ L F      N    YDCG L
Sbjct  350   TGSYLSGWIQQGGSQWWMKFLRDAVFLRFLLPKVFNLAHSYDCGTL  395



>ref|XP_006649421.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=405

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 159/420 (38%), Positives = 216/420 (51%), Gaps = 28/420 (7%)
 Frame = -2

Query  1392  MESTDSKHE-IVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             ME  D +   +VI G G+ GLATAL LHRKG++S+VLE S  LR+ G       N +RAL
Sbjct  1     MEGDDVEAAGVVIAGAGLAGLATALGLHRKGVRSLVLESSATLRASGYAFTTWTNAFRAL  60

Query  1215  DQLGIGSHLRTVALPLQRGRDIFLGEDKEQ-----KIEYVSG--DVRCMARNDLIRSLAD  1057
             D LG+G  +R   L  +R         K       +++  SG  ++RC+ RN L+ +L +
Sbjct  61    DALGVGDKIREHHLLYERMVTFSASTGKPAATVSLQMQGKSGPHEIRCVKRNFLLETLEN  120

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIRF  ++ S++ +   K   L L++GS I A++LIGCDG  S+VA+ LGL    
Sbjct  121   ELPEGTIRFSSKIVSIEEEGNAKL--LHLADGSTIRAKVLIGCDGVNSVVAKWLGLPKPI  178

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFP  697
               G  ATRGL  YP  H    E  +      R G+LP S   V+W  T+      G+   
Sbjct  179   ISGRSATRGLAEYPAGHGFGPEIMQFIGQGFRSGVLPCSDTSVYWNYTWYPSPDDGDA--  236

Query  696   RDENAIKQMVIENIEKLQ--DLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
               E ++ +M    + KL+   +PA+   VI  SE   +  S L++R P  L+ G + +G 
Sbjct  237   --EESVAKMRGYVLAKLRAAKIPAEALNVIERSEMSDVVSSPLRFRSPLALVRGSISRGN  294

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
             V VAGDA H M P LGQGGC++LED VVLARCL  A                     ALE
Sbjct  295   VCVAGDAFHPMTPELGQGGCAALEDGVVLARCLSDAFVGAG-------PXXXXXXXXALE  347

Query  342   KYVKERRMRVAQLSMHTYLIG---ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             KY +ERR R   L    YL+G    S  A  K  +  F     L  +   A  +YDCG+L
Sbjct  348   KYAEERRWRGIWLITAAYLVGFIQQSNNAVIKFLREKF--LSGLLAKTLVAMADYDCGKL  405



>ref|XP_010027723.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW54309.1| hypothetical protein EUGRSUZ_I00273 [Eucalyptus grandis]
Length=401

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 220/409 (54%), Gaps = 19/409 (5%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              E+VIVG GI GLATA+AL + G++++VLERS+ LR+ G  + + PN WRALD LG+   
Sbjct  2     EEVVIVGAGIAGLATAVALKKVGVQALVLERSEGLRATGAALSLFPNAWRALDALGVSER  61

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEYVS-----GDVRCMARNDLIRSLADALPAGTIRFG  1027
             L ++  P  +G    +     Q++ Y +     G+ R + R  L+ +LA+ LP  TIRF 
Sbjct  62    LTSLYPPFSKGYVTDVKTKAIQEVRYDASKGSGGEQRTVHRKILLEALAEELPPNTIRFS  121

Query  1026  CEVSSVD--YDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              +++S+D   +  +    L L +G+ I+++++IGCDG  S +A  LGL    + G  A R
Sbjct  122   SKLTSIDTLVEQGSSICILALEDGTIIKSKVVIGCDGVHSRIARWLGLSEPVDSGRSAIR  181

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQ  673
             G+  YP  H L  E  +      R G +P++   V+WF+        G     D N + +
Sbjct  182   GIAVYPQGHGLNHEVQQFVDVSKRGGFIPLNDKEVYWFLACKAPP-KGADMGGDPNLLVR  240

Query  672   MVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHV  493
              V +N+ K  D      +++  S+  +L+++   +R P +++LG L +   TVAGDAMH 
Sbjct  241   EVADNLAK--DFSPLYLDIVGHSDFSTLTWAPFMFRYPWDVVLGNLTRANFTVAGDAMHP  298

Query  492   MGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRV  313
             M P LGQGGC +LEDAVVL R +GS+ +      G E E R   +  ALE+YV+ERR R 
Sbjct  299   MTPDLGQGGCLALEDAVVLGRHIGSSVS-----QGGELETRD--VGFALERYVRERRWRA  351

Query  312   AQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAA--QNEYDCGQL  172
             A L   +YL G      S          +   F  G A     YDCG+L
Sbjct  352   AMLIAASYLSGWVQQDGSSWWMKFLRDVVFYKFLLGKAVSATRYDCGKL  400



>ref|XP_010028762.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW55578.1| hypothetical protein EUGRSUZ_I01449 [Eucalyptus grandis]
Length=405

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/417 (36%), Positives = 213/417 (51%), Gaps = 38/417 (9%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             +IVIVG GI GL TAL LHR G++S+VLE    LR  G  + +  N W+ALD +GI   L
Sbjct  6     DIVIVGAGIAGLTTALGLHRLGIRSLVLESHDSLRITGFALAIWTNAWKALDAVGISESL  65

Query  1188  R-------------TVA-LPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADAL  1051
             R             TV+ LP    +    G  ++        +VRC+ R  L+ +L + L
Sbjct  66    RRRHTRLLGVMTTSTVSGLPTAETQFSAAGTQRDH-------EVRCVQRKILMETLVNEL  118

Query  1050  PAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
             P+GTI+F  +V S++     K   L  S+GS ++A++L+GCDG  S VA+ LG K     
Sbjct  119   PSGTIKFSSKVVSIEQSGNLKLIHL--SDGSILKAKVLLGCDGVNSAVAKWLGFKAPAFV  176

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G  A RG     N H    +         R G +      ++WF TF T  ++ ++    
Sbjct  177   GRFAVRGSVYNENGHGFEPKLFEFIGEGFRSGFVACDDKTMYWFATFST-SMSSQEMEES  235

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
                +KQ V+  + K+ +     K V+  +E E+LS + L++R P ++L GR  K  V VA
Sbjct  236   PAKVKQFVLSKLGKVAE---DFKAVVRDTELENLSLAPLRFRHPWDILWGRTSKSNVCVA  292

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVK  331
             GDA H M P +GQGGC++LED V+LARCLG A   K    GI  EE   RIE  L+ Y K
Sbjct  293   GDAFHPMTPDIGQGGCAALEDGVILARCLGEALRDKQ---GIRSEEYR-RIEMGLKNYAK  348

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQN----EYDCGQL  172
             ERR R  +L    Y++G    +  K+        +  FF   A Q      +DCG+L
Sbjct  349   ERRWRAFELISTAYMVGYIQTSNGKILSFLRNKVLGGFF---AGQQLKLASFDCGKL  402



>gb|KCW70989.1| hypothetical protein EUGRSUZ_F04098 [Eucalyptus grandis]
Length=311

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/273 (42%), Positives = 170/273 (62%), Gaps = 11/273 (4%)
 Frame = -2

Query  1374  KHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGS  1195
             + +IV+VGGGICGLAT LALHRKG++S+VLERS+ LR+ G  I + PNGWRALDQLG+G 
Sbjct  4     ERDIVVVGGGICGLATGLALHRKGIQSLVLERSETLRATGSAIIMQPNGWRALDQLGVGP  63

Query  1194  HLRTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVS  1015
              LR  A+ ++ GR + + + K+  I  + G+VRC+ R DLI  LA+ LP+ T+RFGC V 
Sbjct  64    KLRKTAIAMEGGRIVSIPDGKQGPI-LLGGEVRCLRRMDLINVLAEGLPSNTVRFGCRVV  122

Query  1014  SVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             SV+ D  T    L L +G  I+A+++IGCDG  S+VA ++GL     +    TRG T Y 
Sbjct  123   SVELDPTTSRPLLHLDDGGTIKAKVVIGCDGVHSVVANIVGLNKTGLYPTYVTRGFTRYE  182

Query  834   NAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEK----FPRDENAIKQMV  667
             N H L  EF    K ++++G LPI   LV+WFV   TR  T  +      +D   ++  +
Sbjct  183   NGHGLANEFVVMRKDELQLGWLPIDDRLVYWFV---TRNWTSPESRATLSKDPMLLRSSI  239

Query  666   IENIEKLQDLPAKVKEVIHLSEPESLSFSHLKY  568
                ++ + D P +  +++  S+  ++ ++ L+Y
Sbjct  240   ---VKAMNDFPTEAIQMVSGSDLATVQYTELRY  269



>gb|KCW54307.1| hypothetical protein EUGRSUZ_I00271 [Eucalyptus grandis]
Length=400

 Score =   218 bits (554),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 149/410 (36%), Positives = 224/410 (55%), Gaps = 22/410 (5%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              E+VIVG GI GLATA+AL + GL+++VLERS+ LR+ G  + + PN W ALD LGI   
Sbjct  2     EEVVIVGAGIAGLATAVALKKVGLQALVLERSEGLRAVGAALTLFPNAWHALDALGISDK  61

Query  1191  LRTVALPLQRGRDIFLGEDKEQKIEY----VSGDVR-CMARNDLIRSLADALPAGTIRFG  1027
             L ++  P  +G    +     Q++ Y     SGD +  + R  L   LA+ LP  TIRF 
Sbjct  62    LTSIYTPFFKGYVTDVKTKAIQEVRYGASNGSGDQQIAVNRKVLSEVLAEELPPNTIRFS  121

Query  1026  CEVSSVD--YDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATR  853
              +++S++   +  +    L L +G+ I+++++IGCDG  S VA  LGL P  + G  A R
Sbjct  122   SKLTSIETQVEQGSSICILALEDGTIIKSKVVIGCDGVHSRVARWLGLGPPVDSGRSAIR  181

Query  852   GLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFV--TFPTRQLTGEKFPRDENAI  679
             GL  YP  H L  EF +      R G +P++   ++WF     P +         D ++I
Sbjct  182   GLAVYPRGHGLNQEFQQFVDVSKRAGFVPLNDKEIYWFFLCKVPPKD---ADHGGDPDSI  238

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             ++ VI+N+ K  D P    +V+  S+P +L++  L +R P +++LG L +  +TVAGDAM
Sbjct  239   QREVIDNLAK--DFPPLYLDVVGHSDPSTLTWGALLFRHPWDVVLGNLARANITVAGDAM  296

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H M P LGQG  S+LEDAVVL R +GS+    + +  +E +E    +  AL+ YV+ERR 
Sbjct  297   HPMTPDLGQGAGSALEDAVVLGRLIGSSI---SKLGKLETQE----VGLALKSYVRERRW  349

Query  318   RVAQLSMHTYLIG-ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             R A L   + L G  S   +S   +               + + YDCG+L
Sbjct  350   RAATLITASSLSGWVSQDGSSWWMRFLRDVFYKFVLGRAFSASRYDCGKL  399



>ref|XP_004985658.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Setaria italica]
Length=411

 Score =   218 bits (555),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 157/418 (38%), Positives = 225/418 (54%), Gaps = 20/418 (5%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M+  D+  ++VIVG G+ GLA AL LHRKG++S+VLE S  LR+ G       N +RALD
Sbjct  1     MQGKDAAEDVVIVGAGMAGLAAALGLHRKGVRSLVLESSPSLRTSGFAFTTWKNAFRALD  60

Query  1212  QLGIGSHLRTVALPLQRGR-------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
              LG+G  +R   L  QR R       +I    D  Q+ +    ++RC+ RN L+++L + 
Sbjct  61    ALGVGDKIREQHLQAQRLRVISSATGEIVREADLTQQGKRGPHEIRCVRRNVLLQALEEE  120

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP GTIR+  ++ S++ D   K   L L++GS + A++LIGCDG  S+VA+ LGL     
Sbjct  121   LPKGTIRYSSKIVSIEEDGDIKI--LQLADGSVLRAKVLIGCDGINSVVAKWLGLAKPSY  178

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPR  694
              G  A RG   YP+ H    EF +      R G+LP +   ++WF T+ TR    +    
Sbjct  179   SGRAAARGFAHYPDGHGFEPEFLQFIGHGFRSGMLPCNETDIYWFFTW-TRSEHDKGVDE  237

Query  693   DENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTV  514
                 +KQ V++ + +   +P +   VI  SE   +  + L++RPP  L+   + +G V V
Sbjct  238   SAAKMKQFVLDKL-RGSKVPEEALAVIDRSEMSDVLAAPLRFRPPLSLVTASISRGNVCV  296

Query  513   AGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYV  334
             AGDA+H M P LGQGGCS+LED V+LARCLG A A K+       E  + RIE  L +Y 
Sbjct  297   AGDALHPMTPDLGQGGCSALEDGVILARCLGEALAGKDAKGSGSAE--NGRIEAGLREYA  354

Query  333   KERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             + RR R  +L    Y +G    +  A  S L      G +A      A   +YDCG L
Sbjct  355   RIRRWRSVELVATAYTVGFIQQSDNAIVSFLRDKFLSGVLAGRLLKMA---DYDCGTL  409



>ref|XP_009624703.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Nicotiana tomentosiformis]
Length=423

 Score =   218 bits (556),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 218/424 (51%), Gaps = 25/424 (6%)
 Frame = -2

Query  1395  EMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRAL  1216
             + E  +   +IVIVG GI GLAT+LALHR GL+S+VLE S  LR+ G  + +  N WRAL
Sbjct  4     QKEQMEINEDIVIVGAGIAGLATSLALHRLGLRSLVLESSDSLRTSGFALTLWTNAWRAL  63

Query  1215  DQLGIGSHLRTVALPLQRGR-----------DIFLGEDKEQKIEYVSGDVRCMARNDLIR  1069
             D LG+G  LR  +L   R             +I L E   +  +Y   D RCM R +++ 
Sbjct  64    DALGVGDTLRQHSLQFSRFEAFSADSGMPTAEISL-EANNKPRDY---DSRCMKRQEIVE  119

Query  1068  SLADALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGL  889
             +L   LP GTI++   V S+    +  F  L L++ + +  ++LIGCDG  S+VA+ +GL
Sbjct  120   TLEKELPPGTIKYSSLVVSIQDSGL--FKLLHLADKTVLRTKVLIGCDGVNSVVAKWMGL  177

Query  888   KPAKEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLT  712
                 +    A RG   Y   H    +F  +F   VR+G LP     ++WF TF P+    
Sbjct  178   PKLVDANRSAIRGYVEYSEGHEFEPKFCAYFGRGVRIGFLPCDDKSLYWFCTFTPSALNY  237

Query  711   GEKFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrp-pgelllgrl  535
              E        +KQ V   +    ++  +V  ++  +  +SL  + LK R     L++  +
Sbjct  238   DESIEGSPVKMKQFV---LSMASNVSKEVYNILQRTSLDSLYCAKLKLRSPLNILMIYNI  294

Query  534   RKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVK--NNVDGIEKEERSAR  361
              K    + GDA+H M P +GQGGCS+LED VVLARC+    + K    ++ +E ++   R
Sbjct  295   VKRNTCLVGDALHPMTPDIGQGGCSALEDGVVLARCIAETFSKKLPTGMEKLEDDDFYNR  354

Query  360   IEEALEKYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALF-FRNGAAQNEYD  184
             I+  LEKY KERR R+  L   +YL+G +  +  K+        +A F         ++D
Sbjct  355   IKVGLEKYAKERRWRIFNLISTSYLVGLAQESNGKVISYLREKFLAQFTIETMLRMGDFD  414

Query  183   CGQL  172
             CG+L
Sbjct  415   CGKL  418



>ref|XP_002530077.1| monoxygenase, putative [Ricinus communis]
 gb|EEF32317.1| monoxygenase, putative [Ricinus communis]
Length=462

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 149/419 (36%), Positives = 223/419 (53%), Gaps = 19/419 (5%)
 Frame = -2

Query  1398  REMESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRA  1219
             R+ +  +   + VIVG GI GLATA+AL R G+++++LERS  LR+ G  + + PN W A
Sbjct  47    RDRDRMEMVQDAVIVGAGIAGLATAVALKRVGIQALILERSDGLRATGSALTLFPNAWLA  106

Query  1218  LDQLGIGSHLRTVALPLQRGRDIFLGEDKEQKIEYV--SGDVRCMARNDLIRSLADALPA  1045
             LD LG+   L +      RG    +     Q+I +V  +G  + + R  L+ +L   LPA
Sbjct  107   LDALGVSHMLTSFYSSALRGSVTNVATGAVQEISFVGNNGGPKSVHRKALLEALVQELPA  166

Query  1044  GTIRFGCEVSSVDY--DSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEF  871
              ++RF  + ++++      T    + L +G+ +++++LIGCDG  S+VA+ LGL      
Sbjct  167   DSVRFSSKFTAIEMVEQGGTSIPVVHLEDGTTVKSKVLIGCDGVHSVVAQWLGLSAPFHS  226

Query  870   GVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRD  691
             G  + RGL+ +P  H L     +      R G +P++   ++WF+T P  +       RD
Sbjct  227   GRSSVRGLSVFPQGHGLEQAIKQFVDVGKRAGFVPLNDKEIYWFLTCPEEK----NMQRD  282

Query  690   ENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVA  511
                I++ V+E     ++ P+   EV+  ++  +L+++ L  R P  ++ G L KG VTVA
Sbjct  283   PELIQKEVVEKYA--ENFPSLFLEVVRHADLSTLTWAPLMLRHPWNVIFGNLSKGNVTVA  340

Query  510   GDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVK  331
             GDAMH M P LGQGGCS+LEDAVVL R +G+ + +KN   G   EE  A    ALE YVK
Sbjct  341   GDAMHPMTPDLGQGGCSALEDAVVLGRHIGN-SFIKN---GRFVEEDMAL---ALEGYVK  393

Query  330   ERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAM--ALFFRNGAAQNEYDCGQL*PVP  160
             ERR R A L   +YL G    + S         A+     FR       YDCG L   P
Sbjct  394   ERRWRAAGLITGSYLSGWIQQSGSNWWMKFLRDAIFYGFLFRKVLNAVVYDCGTLPSAP  452



>ref|XP_009387320.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/393 (37%), Positives = 215/393 (55%), Gaps = 22/393 (6%)
 Frame = -2

Query  1314  HRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRT--------VALPLQRG  1159
             HR G++ +VLE S  LR+ G  +    N WRALD LG+G  LR         V+     G
Sbjct  24    HRLGVRCLVLESSDTLRAAGFALSTWANAWRALDALGVGDTLRKQHVRLEALVSFSASSG  83

Query  1158  RDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYDSVTKFTR  979
                     KE K +    +VRC+ RN L+ +LA  LP GTIR+  +V S++     +F  
Sbjct  84    SITSTLAIKESK-KRGDDEVRCVRRNLLVEALAKELPQGTIRYSSKVVSME--DAGRFKL  140

Query  978   LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSLPIEFHRH  799
             L L++GS ++A++LIGCDG  S VA+ LGLK     G  A RG   +   H    EF ++
Sbjct  141   LHLADGSTLKAKVLIGCDGINSTVAKWLGLKEPTFSGRYAARGFAVFEEGHGFKPEFAQY  200

Query  798   FKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIENIEKLQDLPAKVKE  619
             F    R G+LP   + ++WF T+       E++ +D   +K+ V+  + K + +P +V +
Sbjct  201   FGRGYRAGLLPCDDNSMYWFFTWAA-GANDEEWNKDVIKVKEFVLSKL-KSEKVPQEVLQ  258

Query  618   VIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVV  439
             VI  SE  SL+ +HL+YR P  LL G + +G V V GDA H M P LGQGGCS+LED VV
Sbjct  259   VIGRSELSSLASAHLRYRSPFNLLWGDISRGNVCVTGDAFHPMTPDLGQGGCSALEDGVV  318

Query  438   LARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTYLIGASMAATS  259
             LA+CLG   A+    +G  +E+  +R+E AL+KY   RR R  +L    Y++G      S
Sbjct  319   LAKCLGE--ALIGGREGGGEEDEGSRVEAALKKYADARRWRGFELVATGYVVGIVQQGGS  376

Query  258   KLAKM----AFGGAMALFFRNGAAQNEYDCGQL  172
               A++       GA+   + + A   ++DCG+L
Sbjct  377   WAARLLRDQVLAGALTKKYMSMA---DFDCGKL  406



>ref|XP_010030377.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW54310.1| hypothetical protein EUGRSUZ_I00274 [Eucalyptus grandis]
Length=401

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/413 (36%), Positives = 221/413 (54%), Gaps = 29/413 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G+ ++VLERS+ LR+ G  + + PN WRALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVHALVLERSEGLRATGAALSLFPNAWRALDALGVSEKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDV--------RCMARNDLIRSLADALPAGTIR  1033
              ++  P  +G   ++ + K + I+ V  D         R + R  L+ +LA+ LP  TIR
Sbjct  63    TSLYPPFSKG---YVTDVKTKAIQEVRYDASKGSGSEQRTVHRKILLEALAEELPPNTIR  119

Query  1032  FGCEVSSVD--YDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             F  +++S+D   +  +    L L +G+ I+++++IGCDG  S +A  LGL    + G   
Sbjct  120   FSSKLTSIDTLVEQGSSICVLALEDGTIIKSKVVIGCDGVHSRIARWLGLGEPVDSGRSG  179

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVT--FPTRQLTGEKFPRDEN  685
              RG+  YP  H L  E  +      R G +P+    V+WF+    P +   G     D N
Sbjct  180   IRGIAVYPQGHGLNHEVQQFVDVSKRGGFIPLDDKEVYWFLACKVPPK---GSDMGGDPN  236

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              + + V EN+ K  D P    +++  S+  +L+++   +R P +++LG L +   TVAGD
Sbjct  237   LLIREVAENLAK--DFPPLYLDIVGHSDFSTLTWAPFMFRYPWDVVLGNLTRANFTVAGD  294

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P LGQGGC +LEDAVVL R +GS+ +      G E E R   +  ALE+YV+ER
Sbjct  295   AMHPMTPDLGQGGCLALEDAVVLGRHIGSSVS-----QGGELETRD--VGFALERYVRER  347

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAA--QNEYDCGQL  172
             R R A L   ++L G      S          +   F  G A     YDCG+L
Sbjct  348   RWRAAMLITASFLSGWVQQDGSSWWMKFLRDVVFYKFLLGKAVSATRYDCGKL  400



>gb|ACL52795.1| unknown [Zea mays]
 gb|AFW89679.1| monooxygenase [Zea mays]
Length=417

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/421 (35%), Positives = 216/421 (51%), Gaps = 21/421 (5%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M   ++  ++VIVG G+ GLA AL LHRKG++S+VLE S  LR+ G       N +RALD
Sbjct  1     MPPMEAAEDVVIVGAGLAGLAVALGLHRKGVRSLVLESSPSLRASGFAFTTWTNAFRALD  60

Query  1212  QLGIGSHLRTVALPLQRGR-------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
              LG+G  +R      Q  R       +I    D  Q+ +    ++RC+ R+ L+++L + 
Sbjct  61    ALGVGDKIRRQHQQAQALRVMASSTGEIVQEVDLTQQGKRGPNEIRCVRRDLLLQALEEE  120

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP G IR+   + S++ +       L L++GS I A++L+GCDG  S+VA+ LGL     
Sbjct  121   LPRGAIRYSSRIVSIEEEDGNGDKVLQLTDGSVIRAKVLVGCDGVNSVVAKWLGLATPSY  180

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFP  697
              G  A RG   YP+ H    +F +      R G+LP +   ++WF T+ P+    G    
Sbjct  181   SGRSAARGFARYPDGHGFEPKFLQFVGHGFRSGMLPCNDTDIYWFFTWTPSENDKGV---  237

Query  696   RDENA--IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
              DE+A  +KQ V+  +     +PA+    I  SE   +  + L++R P  L    + +G+
Sbjct  238   -DESAAKMKQFVLAKLRGSNKVPAEALAAIDRSEMSDVLAAPLRFRSPLSLATASIARGS  296

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALE  343
               VAGDA+H M P LGQGGCS+LED VVLARCLG A              +  R++ AL 
Sbjct  297   ACVAGDALHPMTPDLGQGGCSALEDGVVLARCLGDALLPPPGSGSGSGRGKEDRVQAALR  356

Query  342   KYVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQ  175
             +Y   RR R  +L   +Y +G    +  A  S L      G +A   R      +YDCG 
Sbjct  357   EYAWIRRWRSVELVATSYTVGFVQQSDSAVVSFLRDRLLSGVLA---RRLLKMADYDCGT  413

Query  174   L  172
             L
Sbjct  414   L  414



>gb|KDP29688.1| hypothetical protein JCGZ_18850 [Jatropha curcas]
Length=411

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/416 (36%), Positives = 225/416 (54%), Gaps = 30/416 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG GI GL T+L LHR G++S+VLE S  LR  G  +    N W+ALD +G+G  L
Sbjct  6     DVVIVGAGIAGLTTSLGLHRLGIESLVLESSANLRVTGFALTTWTNAWKALDAIGVGDFL  65

Query  1188  R-----------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAG  1042
             R           T  +  QRG +I      + K ++   +VRC+ R  L+ +L   LP  
Sbjct  66    REKHVGIDGVVATSTITGQRGAEICF----KAKGKHGDHEVRCVKRKLLLETLVQELPND  121

Query  1041  TIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVV  862
             TI++  +V S++     K   L+  +GS I+ ++LIGCDG  S+VA  LGLK     G  
Sbjct  122   TIKYSSKVVSIEESGYFKLVHLI--DGSIIKTKVLIGCDGVNSVVANWLGLKKPAFTGRS  179

Query  861   ATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA  682
             A RG   +  +H    +F + F   +R G+LP     ++WF T+ T   + +    + + 
Sbjct  180   AIRGYAKFKGSHGYGPKFLQFFGNGIRSGLLPCDDTTIYWFFTW-TPSNSDKNQDDNPDK  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +KQ V+  +E        ++ V+  +  + +S S L+YR P EL+   + KG V+VAGDA
Sbjct  239   MKQFVLSGLENAA--SDHLRAVVEATNLDDISSSPLRYRHPWELIWANISKGNVSVAGDA  296

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERS-ARIEEALEKYVKER  325
             +H M P +GQGGC++LED VVLARCLG A   + NV+  EKE+    RIE  L+KY +ER
Sbjct  297   LHPMTPDIGQGGCAALEDGVVLARCLGEALMKQVNVENEEKEKEEYKRIEIGLKKYAQER  356

Query  324   RMRVAQLSMHTYLIGASMAATSKLAKMAFGGAM-----ALFFRNGAAQNEYDCGQL  172
               R  QL   +YL+G    +  K+        M      LF +    ++++DCG+L
Sbjct  357   GWRSFQLIATSYLVGFIQESDGKILNFLRDRIMVKYLAGLFLK----RSDFDCGKL  408



>gb|KCW54311.1| hypothetical protein EUGRSUZ_I00275 [Eucalyptus grandis]
Length=401

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 145/411 (35%), Positives = 225/411 (55%), Gaps = 25/411 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G+ ++VLERS+ LR+ G  + + PN WRALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVHALVLERSEGLRATGAALSLFPNAWRALDALGVSEKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYV--------SGDVRCMARNDLIRSLADALPAGTIR  1033
              ++  P  +G   ++ + K + I+ V         G+ R + R  L+ +LA+ LP  TIR
Sbjct  63    TSLYPPFSKG---YVTDVKTKAIQEVRFDASKGGGGEQRTVHRRILLEALAEELPPNTIR  119

Query  1032  FGCEVSSVD--YDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVA  859
             F  +++S+D   +  +    L L +G+ I+++++IGCDG  S +A  LGL    + G  A
Sbjct  120   FSSKLTSIDTLVEQGSSICILALEDGTIIKSKVVIGCDGVHSRIACWLGLGEPVDSGRSA  179

Query  858   TRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAI  679
              RG+  YP  H L  E  +      R G LP++   V+WF+        G     D N +
Sbjct  180   IRGIAVYPQGHGLNHEAQQFVDVSKRGGFLPLNDKEVYWFLACKAPP-KGADMGGDPNLL  238

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
              + V +N+ K  D P    +++  S+  +++++ + +R P +++LG L +  +TVAGDAM
Sbjct  239   VREVADNLAK--DFPPLYLDIVGHSDFSTVTWAPIIFRYPWDVVLGNLIRANITVAGDAM  296

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H M P LGQGGC +LEDAVVL R +GS+ + +  ++       +  +  ALE+YV+ERR 
Sbjct  297   HPMTPDLGQGGCLALEDAVVLGRHIGSSVSQRGQLE-------TRDVGFALERYVRERRW  349

Query  318   RVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAA--QNEYDCGQL  172
             R A L   +YL G      S          +   F  G A   + YDCG+L
Sbjct  350   RAAMLIAASYLSGWVQQDGSSWWMKFLRDVVFYKFLLGKAVSASRYDCGKL  400



>ref|XP_004497187.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cicer arietinum]
Length=407

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 158/417 (38%), Positives = 226/417 (54%), Gaps = 23/417 (6%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ME+T     +VIVG GI GL TAL LHR G++S++LE S  LR  G  + +  NGW+ALD
Sbjct  1     METTKIVENVVIVGAGIAGLTTALGLHRLGVQSLILESSDSLRVTGFALAIWENGWKALD  60

Query  1212  QLGIGSHLR--------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLAD  1057
              L +G  LR         V   L  G+ +     K++       +VRC+ R  L+ +LA+
Sbjct  61    ALRVGDILRQKHIHLHGNVTTSLMTGQQLANMSFKDKG----KPEVRCVRRKLLLEALAN  116

Query  1056  ALPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAK  877
              LP GTIR+  +V +++     K   L+  +G+ I+ ++LIGCDG  S+VA+ LG K A 
Sbjct  117   ELPRGTIRYLSKVVAIEESGFFKILHLI--DGTTIKTKVLIGCDGINSVVAKWLGFKEAT  174

Query  876   EFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKF  700
                  A RG       HS      ++F    R G++P    +V+WF T+ P  Q   ++ 
Sbjct  175   YTERFAIRGCLELETNHSFEPILKQYFGKGFRAGVVPCDEKVVYWFFTWTPNSQ--DKEL  232

Query  699   PRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTV  520
              ++   +KQ V+    KL+++P+ VK  I  +E +S   + L+YR P +L++G + KG V
Sbjct  233   IQNPAKLKQYVLN---KLENVPSYVKSFIEKTELDSFHLAPLRYRQPWKLIMGNISKGNV  289

Query  519   TVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEK  340
              VAGDA+H M P LGQGGC +LED VVLARCL  A A  N     EKEE   RIEE L++
Sbjct  290   CVAGDALHPMTPDLGQGGCCALEDGVVLARCL--AEAFSNKSKKEEKEEEYKRIEEGLKR  347

Query  339   YVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
             Y  ERR R   L    Y++G      SKL         A L F     ++ ++CG+L
Sbjct  348   YANERRWRCIDLITTAYIVGFVQQGNSKLVTFLRDKLFAPLLFGQLLKKSNFNCGKL  404



>ref|XP_010057477.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=408

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 228/417 (55%), Gaps = 36/417 (9%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G++++VLERS+ LR+ G  +G+  N W ALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVRALVLERSEELRTTGAALGLFANAWVALDALGVSDKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYV----SGDVRCMARNDLIRSLADALPAGTIRFGCE  1021
               +  PL+RG    +     Q++ Y         R + R  L+  LA+ LP  +IRF  +
Sbjct  63    AALYAPLKRGYITDVKTKSIQEVHYPGNRNGAQPRAVHRKVLLEVLAEELPPNSIRFSSK  122

Query  1020  VSSVD--YDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
             ++S++   +       ++L +G+ I+++++IGCDG  SIVA  LGL      G  A RGL
Sbjct  123   ITSIETQVEHGLSICIVMLDDGTIIKSKVVIGCDGVHSIVARWLGLPAPVYSGRSAVRGL  182

Query  846   TTYPNAHSLPIEFHRHFKG---DV--RVGILPISHDLVHWF--VTFPTRQLTGEKFPRDE  688
             + +PN H      H H      DV  R G + ++   ++WF  VT P +   G +   D 
Sbjct  183   SVFPNGHGFD---HGHVIQQFVDVGKRAGFVALNDKELYWFFLVTCPPK---GMEKGADP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
               I++ V+EN+ K  D P    +V+  S+  SL+++ L +R P ++L G L + +VTVAG
Sbjct  237   EMIQREVMENLAK--DFPPVFLDVVKNSDLSSLTWAPLMFRYPWDILFGNLVQSSVTVAG  294

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKE  328
             DAMH M P LGQGGCS+LEDAV L R LG++    N +        +  I  A+E+Y KE
Sbjct  295   DAMHPMTPDLGQGGCSALEDAVALGRHLGNSIVEHNKL-------VTEDIGFAIERYAKE  347

Query  327   RRMRVAQLSMHTYLIGASMAATSK-----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             RR+RVA L   +YL G      S      L  + +G    L  R      EYDCG+L
Sbjct  348   RRLRVATLITASYLSGWVQQDGSNRFMRSLRDVFYG---LLLGRVVKGITEYDCGKL  401



>dbj|BAJ98283.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 153/411 (37%), Positives = 222/411 (54%), Gaps = 23/411 (6%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             ++VIVG G+ GL  AL LHRKG++S+VLE S  LR+ G       N +RALD LG+G  +
Sbjct  12    DVVIVGAGLAGLGVALGLHRKGVRSVVLESSPALRTSGFAFMTWTNAFRALDALGVGDKM  71

Query  1188  RTVALPLQ--RGRDIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADALPAGTIRF  1030
             R+  L +Q  R      GE   +    V G     + RC+ RN L+++L + LP GTIR+
Sbjct  72    RSHHLQVQGVRVMSPTTGEVVRELDLRVQGKLGPHEARCVQRNVLLQALEEELPTGTIRY  131

Query  1029  GCEVSSVDYDSVTKFTR--LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
                + S+D D         L L++GS + A++LIGCDG  S+VA+ LGL    + G  AT
Sbjct  132   SSRIVSIDDDDEDGGDGKTLHLADGSTLRAKVLIGCDGINSVVAKWLGLAKVLDSGRRAT  191

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENA--  682
             RG   YP+ H    +F +      R G++P     V+WF+T+      G++   DE+   
Sbjct  192   RGHARYPDGHGFQPKFMQFSGNGFRAGLVPCGDMDVYWFLTWSPSIPAGKEEDVDESPAE  251

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +K+ V+  +  ++  PA+V E +  SE   +  + L+YRPP  LL G + KG V VAGDA
Sbjct  252   MKEFVLAKLRSIK-APAEVLEAVERSEMNDVLVAPLRYRPPLSLLFGSISKGNVCVAGDA  310

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERR  322
             +H   P L QG C +LEDAVVLARCLG A      + G E+E     +E AL +Y   RR
Sbjct  311   LHPTTPDLAQGACIALEDAVVLARCLGDA------IVGRERET----VEAALRRYAGIRR  360

Query  321   MRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNG-AAQNEYDCGQL  172
              R AQ+   +Y++G    +   + + A    ++     G     +YDCG L
Sbjct  361   WRSAQVIGASYMVGLVQQSEHAVVRFARDRLLSGVLAKGLLMMPDYDCGTL  411



>dbj|BAJ99546.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 155/426 (36%), Positives = 219/426 (51%), Gaps = 29/426 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             ++  D+  +IVI G G+ GLA AL LHRKG++S+VLE S   R+ G       N +RALD
Sbjct  5     IQQQDAAEDIVIAGAGLAGLAVALGLHRKGVRSVVLESSPDRRTSGFAFFTWTNAFRALD  64

Query  1212  QLGIGSHLRTVALPL--QRGRDIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADA  1054
              LG+G  +R   L L   R      GE   +    V+G     +VRC+ RN L+++L D 
Sbjct  65    ALGVGDKMRGRHLQLLGLRVMSSSTGEIAREMDLRVNGKLGPHEVRCVQRNVLLQALEDE  124

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTR--LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPA  880
             LP  TIR+  ++ S+D           L L++GS + A++LIGCDG  S+VA+ LGL   
Sbjct  125   LPPDTIRYSSKIVSIDDQDGDGDGAKILHLADGSTLRAKVLIGCDGINSVVAKWLGLAKP  184

Query  879   KEFGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF---PTRQLTG  709
              E G  ATRG   YP  H    +  +      R G++P S   V+WF T+   P+    G
Sbjct  185   SESGRTATRGHARYPEGHGFEPKILQFVGEGFRAGLVPWSDTDVYWFFTWSPAPSPDANG  244

Query  708   E---KFPRDENAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgr  538
             +      R   A+KQ V+  +   +  P +V E +  SE   +  + L+YR P  LL   
Sbjct  245   KDDSSVDRSAAAMKQFVLTKMRGAKVSP-EVLEAVERSEMNDVLAAPLRYRSPLSLLFAS  303

Query  537   lRKGTVTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARI  358
             + KG V VAGDA+H   P L QG C++LED VVLARCLG A      + G    E+  R+
Sbjct  304   ISKGNVCVAGDALHPTTPDLAQGACTALEDGVVLARCLGDA------IVGAGSGEQRERV  357

Query  357   EEALEKYVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNE  190
              EAL +Y   RR R AQ+   +Y +G    +  A  S +      G +A   +      +
Sbjct  358   VEALRRYAGIRRWRSAQVIAMSYTVGFFQESDHAVVSFVRDKLLSGVLA---KTLLMMPD  414

Query  189   YDCGQL  172
             YDCG+L
Sbjct  415   YDCGKL  420



>ref|XP_004290734.1| PREDICTED: FAD-dependent urate hydroxylase-like [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 224/418 (54%), Gaps = 30/418 (7%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              ++VIVG GI GL T+L LHR G++S+VLE S  LR+ G       N WRALD +GIG +
Sbjct  5     QDVVIVGAGISGLTTSLGLHRLGIRSLVLESSDSLRATGFAFTTWTNAWRALDAIGIGDY  64

Query  1191  LR--------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTI  1036
             LR         V      G  +F    KE K ++   ++RC+ R  L+ SLA  LP+GTI
Sbjct  65    LRQQHETILGNVVSSRISGLQMFEMSFKE-KGKHGDHEIRCVKRKLLLESLASELPSGTI  123

Query  1035  RFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             RF  +V  ++     K   L  ++G+ ++ ++L+GCDG  S+VA+ LG KP    G  A 
Sbjct  124   RFSSKVVLIEESGCLKLVHL--ADGTILKVKVLVGCDGVNSVVAKWLGFKPPVFTGRSAI  181

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAI  679
             RG   + ++H     F ++F   VR G++P     V+W+ T+ P+ Q    +  ++   +
Sbjct  182   RGSAEFKSSHQFDPMFIQYFGNGVRSGVVPCDDKNVYWYFTWSPSSQ--ERELEKNPVQL  239

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             KQ ++    KL  +P +V+ V+  +  ++   S L+YR P E+L G + KG V VAGDA+
Sbjct  240   KQYMLT---KLGKVPDEVRAVMENTVLDAFISSPLRYRHPWEILWGNISKGNVCVAGDAL  296

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKE-----ERSARIEEALEKYV  334
             H M P LGQGGC++LED VVLARCLG  A +KN    I  E     +   RIE  L KY 
Sbjct  297   HPMTPDLGQGGCAALEDGVVLARCLGE-ALLKNRRQEIRNESEEGKDEYKRIEIGLNKYA  355

Query  333   KERRMRVAQLSMHTYLIGASMAATSKLAKMA----FGGAMALFFRNGAAQNEYDCGQL  172
              ER+ R   L    Y++G+   A  K+        F   +A      A   +YDCG L
Sbjct  356   SERKWRSFDLISTAYVVGSIQEADGKIMTFLRDKFFSPILAGLLLKKA---DYDCGNL  410



>ref|XP_002306191.2| hypothetical protein POPTR_0004s18290g [Populus trichocarpa]
 gb|EEE86702.2| hypothetical protein POPTR_0004s18290g [Populus trichocarpa]
Length=408

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 155/400 (39%), Positives = 216/400 (54%), Gaps = 14/400 (4%)
 Frame = -2

Query  1353  GGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVAL  1174
             G GI GL T+L LHR G++S+VLE S  LR  G       N WRALD +GIG  LR    
Sbjct  14    GAGIAGLTTSLGLHRLGIRSLVLESSAGLRVTGFAFTTWTNAWRALDAVGIGHSLRQQHG  73

Query  1173  PLQRGRDIFLGEDKEQKIEYVS-GD--VRCMARNDLIRSLADALPAGTIRFGCEVSSVDY  1003
              L+ G            I  V+ GD  VRC+ R  L+ +L   LP GTIR+  +V S++ 
Sbjct  74    FLE-GYITSRLTSCHHPISLVTFGDHEVRCVRRKLLLEALEKELPDGTIRYSSKVVSIEE  132

Query  1002  DSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHS  823
                 K   L  ++ + I+ ++LIGCDG  S+VA  +G K     G  A RG   +   H 
Sbjct  133   SGYLKLVHL--ADDTIIKTKVLIGCDGVNSVVARFIGFKKPAFAGRSAIRGYADFKVNHG  190

Query  822   LPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDENAIKQMVIENIEKL  646
                +F   F   VR G LP     ++WF T+ PT Q   ++   +   +KQ V+    KL
Sbjct  191   FGSKFLLLFGKGVRSGFLPCDDTTIYWFFTYIPTGQ--DKELEDNPTEMKQFVLS---KL  245

Query  645   QDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQGG  466
               +P   +  + ++E +S++ S L++RPP E+L G + KG V+VAGDA+H M P LGQGG
Sbjct  246   GIVPDHARTSVEITELDSITSSPLRFRPPWEVLWGNISKGNVSVAGDALHPMTPDLGQGG  305

Query  465   CSSLEDAVVLARCLGSAAAVKNNVDGIEKE-ERSARIEEALEKYVKERRMRVAQLSMHTY  289
             C++LED VVLARCL  A   + NV+G EKE E   R+E  L+KY  ERR R  +L    Y
Sbjct  306   CAALEDGVVLARCLAEALKKELNVEGKEKEREEYKRVEMGLKKYAAERRWRSFELISTAY  365

Query  288   LIGASMAATSKLAKMAFGGAMALFFRNGAAQN-EYDCGQL  172
             ++GA      K+ K+     MA F      +  ++DCG+L
Sbjct  366   IVGAIQQGDGKIMKILRDAIMAKFLAGLLLKKADFDCGKL  405



>ref|XP_006422564.1| hypothetical protein CICLE_v10028549mg [Citrus clementina]
 gb|ESR35804.1| hypothetical protein CICLE_v10028549mg [Citrus clementina]
Length=409

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 223/417 (53%), Gaps = 26/417 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +   +IVIVG GI GL T+LALHR G++S+VLE S+ LR  G  I +  N WRALD +GI
Sbjct  2     EEDEDIVIVGAGIAGLTTSLALHRLGIRSLVLESSESLRVTGFAITLWTNAWRALDAVGI  61

Query  1200  GSHLRTVALPLQRGRDIF--LGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPA  1045
                LR   + LQ G  +   +      +I + +       +VR + R+ L+ +L   LP+
Sbjct  62    SDSLRQQHIQLQ-GMVVASSVSCQPASEISFKTKGNRGGHEVRSVKRSLLMEALERELPS  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIR+  +V SV+   +  F  + L++G+  + ++LIGCDG  S+VA+ LG K     G 
Sbjct  121   GTIRYSSKVVSVEESGL--FKLVYLADGAVFKTKVLIGCDGVNSVVAKWLGFKKPAFAGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
                RG T +   H L  +F +      R G LP +   V+WF  + P+ Q   ++   + 
Sbjct  179   SDIRGCTDFKLRHGLEPKFQQFLGKGFRYGFLPCNDQTVYWFFNWCPSNQ--DKELEGNP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
             +  KQ V+    K  DLP +VK ++  +  +S+  S L+YR P E+L G + KG V VAG
Sbjct  237   DKTKQFVLS---KCHDLPEQVKAIVENTPLDSILVSPLRYRYPWEVLWGNISKGNVCVAG  293

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAA-----VKNNVDGIEKEERSARIEEALE  343
             DA H M P +GQGGC++LED ++LARC+  A+      V  +  G +KEE   R E  L+
Sbjct  294   DAFHPMTPDIGQGGCAALEDGIILARCIAEASTEKPSGVTKDKAGEDKEE-FKRNEIGLK  352

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +Y  ERR R  +L    Y++G      + L    F     L  R      E+DCG+L
Sbjct  353   RYATERRWRSCELISMAYIVGYDGKIINFLRDKIFS---VLLGRLMMKILEFDCGKL  406



>ref|XP_010041421.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW44357.1| hypothetical protein EUGRSUZ_L02174 [Eucalyptus grandis]
Length=408

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 153/413 (37%), Positives = 226/413 (55%), Gaps = 28/413 (7%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G++++VLERS+ LR+ G  +G+  N W ALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVQALVLERSEELRTTGAALGLFANAWVALDALGVSDKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVS----GDVRCMARNDLIRSLADALPAGTIRFGCE  1021
               +  P+++G    +     Q++ Y S       R + R  L+  LA+ LP  +IRF  +
Sbjct  63    AALYTPMEKGYITDVKTKSIQEVHYPSSRNGAQPRAVHRKVLLEVLAEELPPNSIRFSSK  122

Query  1020  VSSVDYDSVTKFTRLL--LSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGL  847
             ++S++       +  +  L +G+ I+++++IGCDG  SIVA  LGL+P    G  A RGL
Sbjct  123   ITSIETQVEHGLSTCIVTLDDGTIIKSKVVIGCDGVHSIVARWLGLRPPVYSGRSAVRGL  182

Query  846   TTYPNAHSLPIEFHRHFKGDV--RVGILPISHDLVHWF--VTFPTRQLTGEKFPRDENAI  679
             + +P  H            DV  R G + ++   V+WF   T P +   G +   D   I
Sbjct  183   SVFPKGHGFDHGHAIQQFVDVGKRAGFIALNDKEVYWFFAATCPPK---GVEKGADPEMI  239

Query  678   KQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAM  499
             ++ V EN+ K  D P    +VI  S+  SL+++ L +R P ++L G L + +VTVAGDAM
Sbjct  240   QREVTENLAK--DFPPVYLDVIKHSDLSSLTWAPLMFRYPWDILFGNLFRSSVTVAGDAM  297

Query  498   HVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRM  319
             H M P LGQGGCS+LEDAV L R LG++ A    +        +  I  A+E+Y KERR+
Sbjct  298   HPMTPDLGQGGCSALEDAVALGRHLGNSIAEHGKL-------VTGDIGFAIERYAKERRL  350

Query  318   RVAQLSMHTYLIGASMAATS----KLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             RVA L   +YL G      S    +  +  F G +      G A+  YDCG+L
Sbjct  351   RVATLITASYLSGWVQQDGSNRFMRFLRDVFYGFLLGRVVKGIAK--YDCGKL  401



>gb|KDO68119.1| hypothetical protein CISIN_1g015331mg [Citrus sinensis]
Length=409

 Score =   215 bits (548),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 222/417 (53%), Gaps = 26/417 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +   +IVIVG GI GL T+LALHR G++S+VLE S+ LR  G  I +  N WRALD +GI
Sbjct  2     EEDEDIVIVGAGIAGLTTSLALHRLGIRSLVLESSESLRVTGFAITLWTNAWRALDAVGI  61

Query  1200  GSHLRTVALPLQRGRDIF--LGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPA  1045
                LR   + LQ G  +   +      +I + +       +VR + R+ L+ +L   LP+
Sbjct  62    SDSLRQQHIQLQ-GMVVASSVSCQPASEISFKTKGNRGGHEVRSVKRSLLMEALERELPS  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIR+  +V SV+   + K   L  ++G+  + ++LIGCDG  S+VA+ LG K     G 
Sbjct  121   GTIRYSSKVVSVEESGLFKLVNL--ADGAVFKTKVLIGCDGVNSVVAKWLGFKKPAFAGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
                RG T +   H L  +F +      R G LP +   V+WF  + P+ Q   ++   + 
Sbjct  179   SDIRGCTDFKLRHGLEPKFQQFLGKGFRYGFLPCNDQTVYWFFNWCPSNQ--DKELEGNP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
             +  KQ V+    K  DLP +VK ++  +  +S+  S L+YR P E+L G + KG V VAG
Sbjct  237   DKTKQFVLS---KCHDLPEQVKAIVENTPLDSILVSPLRYRYPWEVLWGNISKGNVCVAG  293

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAA-----VKNNVDGIEKEERSARIEEALE  343
             DA H M P +GQGGC++LED ++LARC+  A+      V  +  G +KEE   R E  L+
Sbjct  294   DAFHPMTPDIGQGGCAALEDGIILARCIAEASTEKPSGVTKDKAGEDKEE-FKRNEIGLK  352

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +Y  ERR R  +L    Y++G      + L    F     L  R      E+DCG+L
Sbjct  353   RYATERRWRSCELISMAYIVGYDGKIINFLRDKIFS---VLLGRLMMKILEFDCGKL  406



>ref|XP_004290735.1| PREDICTED: FAD-dependent urate hydroxylase-like [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   215 bits (548),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 228/419 (54%), Gaps = 32/419 (8%)
 Frame = -2

Query  1371  HEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSH  1192
              ++VIVG GI GL T+L LHR G++S+VLE S  LR+ G  + +  N WRALD +G+G  
Sbjct  5     QDVVIVGAGIAGLTTSLGLHRLGIRSLVLESSDSLRTTGFALAIWTNAWRALDAIGVGDR  64

Query  1191  LR--------TVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTI  1036
             LR         V      G  +F    KE K ++   ++RC+ R  L+ +LA  LP+GTI
Sbjct  65    LRQQHDSLLGNVVSSRISGLQLFEMSFKE-KGKHGDHEIRCVRRKLLLEALASELPSGTI  123

Query  1035  RFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVAT  856
             RF  +V S++     K     L++G+ ++A++L+GCDG  S+VA+ LG KP    G  A 
Sbjct  124   RFSSKVVSIEESGYYKLVH--LADGTILKAKVLVGCDGVNSVVAKWLGFKPLVFTGRSAI  181

Query  855   RGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF--PTRQLTGEKFPRDENA  682
             RG   Y  +H    +  ++F   VR G++P     V+WF T+  P+++   EK P     
Sbjct  182   RGSAEYTTSHQFDPKMMQYFGNGVRSGVVPCDSKNVYWFFTWSPPSQEKELEKNPPQ---  238

Query  681   IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDA  502
             +KQ +   + KL  LP +V+ V+  +  ++   S L+YR P E+L G + KG V VAGDA
Sbjct  239   LKQYM---LTKLGKLPDEVRAVMENTVLDAFISSPLRYRHPWEILWGNISKGNVCVAGDA  295

Query  501   MHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSA-----RIEEALEKY  337
             +H M P +GQGGC++LED +VLARCLG  A +KN  + I +E         RIE  L KY
Sbjct  296   LHPMTPDIGQGGCAALEDGIVLARCLGE-ALLKNWREEIREEGEEGKEEFKRIEIGLNKY  354

Query  336   VKERRMRVAQLSMHTYLIGASMAATSK----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
               ER+ R   L    Y++G    A  K    L    +   ++      A   ++DCG+L
Sbjct  355   ASERKWRSFDLISTAYVVGVIQEADGKVMTFLRDKVYSSILSGLLLKKA---DFDCGKL  410



>gb|ACG30427.1| monooxygenase [Zea mays]
Length=418

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 151/425 (36%), Positives = 221/425 (52%), Gaps = 28/425 (7%)
 Frame = -2

Query  1392  MESTDSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALD  1213
             M   ++  ++VIVG G+ GLA AL LHRKG++S+VLE S  LR+ G       N +RALD
Sbjct  1     MPPMEAAEDVVIVGAGLAGLAVALGLHRKGVRSLVLESSPSLRASGFAFTTWTNAFRALD  60

Query  1212  QLGIGSHLRTVALPLQRGR-------DIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADA  1054
              LG+G  +R      Q  R       +I    D  Q+ +    ++RC+ R+ L+++L + 
Sbjct  61    ALGVGDKIRRQHQQAQALRVMASSTGEIVQEVDLTQQGKRGPNEIRCVRRDLLLQALEEE  120

Query  1053  LPAGTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKE  874
             LP G IR+   + S++ +       L L++GS I A++L+GCDG  S+VA+ LGL     
Sbjct  121   LPRGAIRYSSRIVSIEEEDGNGDKVLQLTDGSVIRAKVLVGCDGVNSVVAKWLGLATPSY  180

Query  873   FGVVATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFP  697
              G  A RG   YP+ H    +F +      R G+LP +   ++WF T+ P+    G    
Sbjct  181   SGRSAARGFARYPDGHGFEPKFLQFVGHGFRSGMLPCNDTDIYWFFTWTPSENDKGV---  237

Query  696   RDENA--IKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGT  523
              DE+A  +KQ V+  +     +PA+    I  SE   +  + L++R P  L    + +G+
Sbjct  238   -DESAAKMKQFVLAKLRGSNKVPAEALAAIDRSEMSDVLAAPLRFRSPLSLATASIARGS  296

Query  522   VTVAGDAMHVMGPFLGQGGCSSLEDAVVLARCLGSA----AAVKNNVDGIEKEERSARIE  355
               VAGDA+H M P LGQGGCS+LED VVLARCLG A     A   +  G  KE+   R++
Sbjct  297   ACVAGDALHPMTPDLGQGGCSALEDGVVLARCLGDALLPPPAGSGSGSGRGKED---RVQ  353

Query  354   EALEKYVKERRMRVAQLSMHTYLIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEY  187
              AL +Y   RR R  +L   +Y +G    +  A  S L      G +A   R      +Y
Sbjct  354   AALREYAWIRRWRSVELVATSYTVGFVQQSDSAVVSFLRDRLLSGVLA---RRLLKMADY  410

Query  186   DCGQL  172
             DCG L
Sbjct  411   DCGTL  415



>gb|EAY88586.1| hypothetical protein OsI_10060 [Oryza sativa Indica Group]
Length=411

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 153/403 (38%), Positives = 218/403 (54%), Gaps = 34/403 (8%)
 Frame = -2

Query  1335  LATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRTVALPLQRGR  1156
             LA AL LHRKG+K  VLE S  LR+ G  I    N  +ALD LG+G  +R   L LQ   
Sbjct  28    LAVALGLHRKGVKCRVLESSPELRASGFAIATWRNALQALDALGVGDKIRKCHLHLQE-L  86

Query  1155  DIF---LGEDKEQKIEYVSG-----DVRCMARNDLIRSLADALPAGTIRFGCEVSSVDYD  1000
              +F    GE        V G     ++ C+ R+ L+R+L + LP+GTIR+  ++  ++ D
Sbjct  87    QVFSSSTGEMSHTTSLNVQGKRGPNEMLCVRRDWLLRALEEGLPSGTIRYSSKIVEIEED  146

Query  999   SVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYPNAHSL  820
                K   L L++G+ + A++LIGCDG  S+VA+ LGL      G +ATRGL  YP  H  
Sbjct  147   GDAKI--LHLADGAILRAKVLIGCDGVNSVVAKWLGLPKPSYSGRLATRGLACYPGGHGF  204

Query  819   PIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAI---KQMVIENIEK  649
               +F   F    R+G++P +   V+WF T+   +        D++A+   KQ V+  +  
Sbjct  205   DPKFKMFFGHGFRLGVIPCNDFDVYWFFTWSPSE-------HDDDALAQKKQFVLTKLRS  257

Query  648   LQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFLGQG  469
               ++PA+V EV+  S+ + +  + L++RPP  LLL  + KG V VAGDA+H M P LGQG
Sbjct  258   -AEIPAEVMEVVERSDAKHVLTAPLRFRPPLSLLLASISKGNVCVAGDALHPMTPDLGQG  316

Query  468   GCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSMHTY  289
             GC++LED VVLARCLG A      + G      S RIE  L +Y + RR R A+L    Y
Sbjct  317   GCAALEDGVVLARCLGDAI-----LGGGGGGAESERIEAGLREYARIRRWRSAELIGTAY  371

Query  288   LIG----ASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             ++G    +S A  S L      GA+    R      +Y CG+L
Sbjct  372   VVGFMQESSNAVISFLRDNWLAGALV---RKLLKMADYYCGKL  411



>ref|XP_006486711.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Citrus sinensis]
Length=409

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 150/417 (36%), Positives = 222/417 (53%), Gaps = 26/417 (6%)
 Frame = -2

Query  1380  DSKHEIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGI  1201
             +   +IVIVG GI GL T+LALHR G++S+VLE S+ LR  G  I +  N WRALD +GI
Sbjct  2     EEDEDIVIVGAGIAGLTTSLALHRLGIRSLVLESSESLRVTGFAITLWTNAWRALDAVGI  61

Query  1200  GSHLRTVALPLQRGRDIF--LGEDKEQKIEYVSG------DVRCMARNDLIRSLADALPA  1045
                LR   + LQ G  +   +      +I + +       +VR + R+ L+ +L   LP+
Sbjct  62    SDSLRQQHIQLQ-GMVVASSVSCQPASEISFKTKGNRGGHEVRSVKRSLLMEALERELPS  120

Query  1044  GTIRFGCEVSSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGV  865
             GTIR+  +V SV+   + K   L  ++G+  + ++LIGCDG  S+VA+ LG K     G 
Sbjct  121   GTIRYSSKVVSVEESGLFKLVNL--ADGAVFKTKVLIGCDGVNSVVAKWLGFKKPAFAGR  178

Query  864   VATRGLTTYPNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTF-PTRQLTGEKFPRDE  688
                RG   +   H L  +F +      R G LP +   V+WF  + P+ Q   ++   + 
Sbjct  179   SDIRGCADFKLRHGLEPKFQQFLGKGFRYGFLPCNDQTVYWFFNWCPSNQ--DKELEGNP  236

Query  687   NAIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAG  508
             +  KQ V+    K  DLP +VK ++  +  +S+  S L+YR P E+L G + KG V VAG
Sbjct  237   DKTKQFVLS---KCHDLPEQVKAIVENTPLDSILVSPLRYRYPWEVLWGNISKGNVCVAG  293

Query  507   DAMHVMGPFLGQGGCSSLEDAVVLARCLGSAAA-----VKNNVDGIEKEERSARIEEALE  343
             DA H M P +GQGGC++LED ++LARC+  A+      V  +  G +KEE   R E  L+
Sbjct  294   DAFHPMTPDIGQGGCAALEDGIILARCIAEASTEKPSGVTKDKAGEDKEE-FKRNEIGLK  352

Query  342   KYVKERRMRVAQLSMHTYLIGASMAATSKLAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             +Y  ERR R  +L    Y++G      + L +  F     L  R      E+DCG+L
Sbjct  353   RYATERRWRSCELISMAYIVGYDGKIINFLREKIFS---VLLGRLMMKILEFDCGKL  406



>gb|KCW55567.1| hypothetical protein EUGRSUZ_I01437, partial [Eucalyptus grandis]
Length=382

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 147/403 (36%), Positives = 206/403 (51%), Gaps = 30/403 (7%)
 Frame = -2

Query  1362  VIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHLRT  1183
             VIVG GI  LATAL LHR G+KS+VLE S  LR+ G         WRALD +GIG     
Sbjct  1     VIVGAGIAALATALGLHRPGIKSLVLESSGGLRTTGIAFTTWKYTWRALDGVGIGK----  56

Query  1182  VALPLQRGRDIFLGEDKEQKIEYVSG-----DVRCMARNDLIRSLADALPAGTIRFGCEV  1018
                P         G    ++    +G     ++R + R  L+ +LA+ LP+GTIR+  +V
Sbjct  57    ---PTFWLTSTISGISTAERQFDATGARRDHEIRGVQRRTLLETLANELPSGTIRYSSKV  113

Query  1017  SSVDYDSVTKFTRLLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTY  838
              S++     K   L         +++LIGCDG  S VA+ LG K     G  A RG   Y
Sbjct  114   VSIEESGFLKLVHL---------SDVLIGCDGVNSAVAKWLGFKKPAFAGRSAIRGCVYY  164

Query  837   PNAHSLPIEFHRHFKGDVRVGILPISHDLVHWFVTFPTRQLTGEKFPRDENAIKQMVIEN  658
              ++HS   +F + F   VR G +P     ++WF TF +     EK       +KQ ++  
Sbjct  165   DHSHSFEPKFFQFFGEGVRFGFIPCDDKTIYWFFTFYSSS-KNEKMEESPAKMKQFML--  221

Query  657   IEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGDAMHVMGPFL  478
               KL+ +P  V+ V   +E +++  S LK+RPP E+L G + K  V V  DA H M P +
Sbjct  222   --KLRKIPDHVRAVFEKTELDNIILSPLKFRPPWEILWGNISKTNVCVTEDAFHPMTPDI  279

Query  477   GQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKERRMRVAQLSM  298
             GQGGCS+LED VVLARCLG   A+++N   +  EE   RIE  L++Y KERR R  +L  
Sbjct  280   GQGGCSALEDGVVLARCLGE--ALRDN-QSMSSEEEYKRIEMGLQRYAKERRWRAFELIS  336

Query  297   HTYLIGASMAATSKLAKMAFGGAMA-LFFRNGAAQNEYDCGQL  172
               Y++G       K+        +A +  R       +DCG+L
Sbjct  337   TVYMVGYIQQGNGKVLNFLRDRVLATVLARQLLKMASFDCGKL  379



>gb|KCW74677.1| hypothetical protein EUGRSUZ_E03410 [Eucalyptus grandis]
Length=397

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 153/416 (37%), Positives = 223/416 (54%), Gaps = 53/416 (13%)
 Frame = -2

Query  1368  EIVIVGGGICGLATALALHRKGLKSIVLERSKILRSEGGGIGVLPNGWRALDQLGIGSHL  1189
             E+VIVG GI GLATA+AL + G++++VLERSK LR+ G  +G+  N W ALD LG+   L
Sbjct  3     EVVIVGAGIAGLATAVALKKVGVRALVLERSKELRTTGAALGLFANAWVALDALGVSDKL  62

Query  1188  RTVALPLQRGRDIFLGEDKEQKIEYVSGDVRCMARNDLIRSLADALPAGTIRFGCEVSSV  1009
               +  P+++                     R + R  L+  LA+ LP  +IRF  +++S+
Sbjct  63    AALYTPMEKN----------------GAQQRAVHRKVLLEVLAEELPPNSIRFSSKITSI  106

Query  1008  DYDSVTKFTR--LLLSNGSYIEAEILIGCDGGRSIVAELLGLKPAKEFGVVATRGLTTYP  835
             +       +   ++L +G+ I+++++IGCDG  SIVA  LGL+P    G  A RGL+ +P
Sbjct  107   ETQVEHGLSTCIVMLDDGTIIKSKVVIGCDGVHSIVARWLGLRPPVYSGRSAVRGLSVFP  166

Query  834   NAHSL-PIEFHRHFKGDV--RVGILPISHDLVHWFVTFPTRQLTGEKFP-------RDEN  685
               H   P    + F  DV  R   + ++   V+WF+        G K P        D  
Sbjct  167   KGHGFDPGHAIQQFV-DVGKRAAFIALNDKEVYWFL--------GAKCPPKGMEKGADPE  217

Query  684   AIKQMVIENIEKLQDLPAKVKEVIHLSEPESLSFSHLKYrppgelllgrlRKGTVTVAGD  505
              I++ V+EN+ K  D P    +V+  S+  SL+++ L +R P ++L G L + +VTVAGD
Sbjct  218   MIQREVMENLAK--DFPPVFLDVVKHSDLSSLTWAPLMFRYPWDILFGNLFRSSVTVAGD  275

Query  504   AMHVMGPFLGQGGCSSLEDAVVLARCLGSAAAVKNNVDGIEKEERSARIEEALEKYVKER  325
             AMH M P LGQGGCS+LEDAV L R LG++ A    +        +  I  A+EKY KER
Sbjct  276   AMHPMTPDLGQGGCSALEDAVALGRHLGNSIAKHGKL-------VTQDIGFAIEKYAKER  328

Query  324   RMRVAQLSMHTYLIGASMAATSK-----LAKMAFGGAMALFFRNGAAQNEYDCGQL  172
             R+RVA L+  +YL G      S      L  + F G +     NG    EYDCG+L
Sbjct  329   RLRVATLTTASYLSGWVQQDGSSRFMRFLRDVIFYGLLWGRVVNGII--EYDCGKL  382



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3756859799544