BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25767_g1_i3 len=1747 path=[4891:0-285 11031:286-286 5177:287-346
1035:347-349 5239:350-377 11074:378-385 11082:386-403 5292:404-479
5368:480-485 11152:486-528 11195:529-533 5422:534-633 5522:634-657
5546:658-690 5579:691-717 1520:718-773 1576:774-799 5685:800-805
11293:806-809 5694:810-843 1990:844-881 10358:882-977 11357:978-997
11377:998-1005 7043:1006-1030 7068:1031-1063 7101:1064-1111
6001:1112-1133 11452:1134-1135 11454:1136-1141 7590:1142-1142
7179:1143-1185 7221:1186-1198 6076:1199-1222 7257:1223-1252
6153:1253-1268 6169:1269-1334 11584:1335-1353 11603:1354-1403
11629:1404-1447 11674:1448-1460 74:1461-1482 11703:1483-1484
11705:1485-1512 11733:1513-1528 616:1529-1594 682:1595-1621
6511:1622-1677 8678:1678-1700 6589:1701-1746]

Length=1747
                                                                      Score     E

ref|XP_002264678.3|  PREDICTED: beta-glucosidase 46-like                614   0.0      Vitis vinifera
emb|CBI23186.3|  unnamed protein product                                612   0.0      
ref|XP_011037697.1|  PREDICTED: beta-glucosidase 46-like                604   0.0      
ref|XP_007026020.1|  Beta glucosidase 46, putative                      604   0.0      
ref|XP_007026017.1|  Beta glucosidase 46 isoform 1                      602   0.0      
ref|XP_002305597.2|  glycosyl hydrolase family 1 family protein         596   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006468004.1|  PREDICTED: beta-glucosidase 46-like                597   0.0      
ref|XP_002304950.2|  hypothetical protein POPTR_0004s01900g             594   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007211830.1|  hypothetical protein PRUPE_ppa004523mg             593   0.0      
ref|XP_009363745.1|  PREDICTED: beta-glucosidase 46-like isoform X1     593   0.0      
ref|XP_008364100.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    592   0.0      
gb|KHG29723.1|  Beta-glucosidase 46                                     592   0.0      
ref|XP_010057964.1|  PREDICTED: beta-glucosidase 46 isoform X3          592   0.0      
ref|XP_008384039.1|  PREDICTED: beta-glucosidase 47-like isoform X1     590   0.0      
ref|XP_008224797.1|  PREDICTED: beta-glucosidase 47-like                589   0.0      
gb|KHG29721.1|  Beta-glucosidase 46                                     590   0.0      
ref|XP_010057961.1|  PREDICTED: beta-glucosidase 46 isoform X1          587   0.0      
ref|XP_009363823.1|  PREDICTED: beta-glucosidase 45-like isoform X2     585   0.0      
gb|KCW75357.1|  hypothetical protein EUGRSUZ_E04103                     586   0.0      
ref|XP_004293271.1|  PREDICTED: beta-glucosidase 47-like                586   0.0      
ref|XP_002305594.1|  glycosyl hydrolase family 1 family protein         584   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008384043.1|  PREDICTED: beta-glucosidase 47-like                584   0.0      
ref|XP_011037693.1|  PREDICTED: beta-glucosidase 46-like                583   0.0      
ref|XP_008384040.1|  PREDICTED: beta-glucosidase 47-like isoform X2     582   0.0      
ref|XP_010267720.1|  PREDICTED: beta-glucosidase 46 isoform X3          583   0.0      
ref|XP_006468000.1|  PREDICTED: beta-glucosidase 47-like isoform X1     582   0.0      
ref|XP_002304951.2|  glycosyl hydrolase family 1 family protein         580   0.0      Populus trichocarpa [western balsam poplar]
emb|CDO99725.1|  unnamed protein product                                578   0.0      
ref|XP_004486131.1|  PREDICTED: beta-glucosidase 47-like                577   0.0      
ref|XP_011037696.1|  PREDICTED: beta-glucosidase 47-like                577   0.0      
ref|XP_008224799.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    575   0.0      
gb|KHG29722.1|  Beta-glucosidase 46                                     576   0.0      
ref|XP_006468001.1|  PREDICTED: beta-glucosidase 47-like isoform X2     566   0.0      
ref|XP_007026019.1|  Beta glucosidase 46 isoform 3                      567   0.0      
ref|XP_010267719.1|  PREDICTED: beta-glucosidase 46 isoform X2          566   0.0      
gb|KEH36806.1|  glycoside hydrolase family 1 protein                    566   0.0      
gb|KEH36817.1|  glycoside hydrolase family 1 protein                    563   0.0      
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            579   0.0      
ref|XP_007147744.1|  hypothetical protein PHAVU_006G151300g             561   0.0      
gb|KHN33045.1|  Beta-glucosidase 47                                     562   0.0      
ref|XP_002518516.1|  beta-glucosidase, putative                         561   0.0      Ricinus communis
ref|XP_008441244.1|  PREDICTED: beta-glucosidase 47                     561   0.0      
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         580   0.0      
ref|XP_004145176.1|  PREDICTED: beta-glucosidase 47-like                561   0.0      
ref|XP_003529622.1|  PREDICTED: beta-glucosidase 46                     560   0.0      
ref|XP_006383935.1|  hypothetical protein POPTR_0004s01890g             558   0.0      
ref|XP_006449069.1|  hypothetical protein CICLE_v10017801mg             558   0.0      
ref|XP_010665547.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    560   0.0      
ref|XP_003529623.1|  PREDICTED: beta-glucosidase 46                     558   0.0      
ref|XP_010267718.1|  PREDICTED: beta-glucosidase 46 isoform X1          568   0.0      
ref|XP_010430204.1|  PREDICTED: beta-glucosidase 46-like isoform X1     556   0.0      
ref|XP_007153925.1|  hypothetical protein PHAVU_003G076700g             556   0.0      
ref|XP_009770584.1|  PREDICTED: beta-glucosidase 18-like                556   0.0      
ref|XP_006301036.1|  hypothetical protein CARUB_v10021428mg             554   0.0      
ref|XP_003610400.1|  Beta-glucosidase                                   553   0.0      
ref|XP_002888064.1|  BGLU46                                             553   0.0      
ref|XP_010418157.1|  PREDICTED: beta-glucosidase 46                     553   0.0      
ref|XP_006343294.1|  PREDICTED: beta-glucosidase 47-like                552   0.0      
ref|XP_009617373.1|  PREDICTED: beta-glucosidase 18-like                553   0.0      
gb|AAC28502.1|  Similar to F4I1.26 putative beta-glucosidase gi|3...    552   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_850968.1|  beta glucosidase 46                                   551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                566   0.0      
ref|XP_010473402.1|  PREDICTED: beta-glucosidase 46                     551   0.0      
ref|XP_009105270.1|  PREDICTED: beta-glucosidase 46-like isoform X1     550   0.0      
gb|AFK44109.1|  unknown                                                 550   0.0      
ref|XP_006348092.1|  PREDICTED: beta-glucosidase 47-like                549   0.0      
ref|XP_006300409.1|  hypothetical protein CARUB_v10021331mg             549   0.0      
emb|CDY55219.1|  BnaA01g36270D                                          549   0.0      
gb|AFK46781.1|  unknown                                                 549   0.0      
ref|XP_006391959.1|  hypothetical protein EUTSA_v10023411mg             548   0.0      
ref|XP_006348091.1|  PREDICTED: probable inactive beta-glucosidas...    547   0.0      
ref|XP_004234482.1|  PREDICTED: beta-glucosidase 46-like                546   0.0      
ref|XP_010533827.1|  PREDICTED: beta-glucosidase 46-like isoform X1     546   0.0      
ref|XP_006391958.1|  hypothetical protein EUTSA_v10024134mg             545   0.0      
ref|XP_009105752.1|  PREDICTED: beta-glucosidase 45-like                545   0.0      
ref|XP_010430205.1|  PREDICTED: beta-glucosidase 46-like isoform X2     543   0.0      
ref|XP_006302139.1|  hypothetical protein CARUB_v10020143mg             543   0.0      
ref|XP_010316605.1|  PREDICTED: beta-glucosidase 18 isoform X1          543   0.0      
emb|CDY47163.1|  BnaA01g22890D                                          543   0.0      
ref|XP_009803936.1|  PREDICTED: beta-glucosidase 18-like                542   0.0      
gb|KFK40644.1|  hypothetical protein AALP_AA2G023300                    541   0.0      
ref|NP_176374.1|  beta-glucosidase 45                                   540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418158.1|  PREDICTED: beta-glucosidase 45-like                540   0.0      
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    558   0.0      
ref|XP_010430203.1|  PREDICTED: beta-glucosidase 45-like                539   0.0      
ref|XP_009774064.1|  PREDICTED: beta-glucosidase 18-like                539   0.0      
gb|KFK28775.1|  hypothetical protein AALP_AA7G045800                    538   0.0      
ref|XP_009608375.1|  PREDICTED: beta-glucosidase 18-like                538   0.0      
ref|XP_009137214.1|  PREDICTED: beta-glucosidase 47-like                536   0.0      
gb|KFK40645.1|  hypothetical protein AALP_AA2G023400                    536   0.0      
ref|XP_004976202.1|  PREDICTED: probable inactive beta-glucosidas...    535   0.0      
ref|XP_009794052.1|  PREDICTED: beta-glucosidase 18-like                535   0.0      
ref|XP_010316604.1|  PREDICTED: beta-glucosidase 18-like                534   0.0      
ref|XP_009624454.1|  PREDICTED: beta-glucosidase 18                     534   0.0      
emb|CAN68643.1|  hypothetical protein VITISV_030810                     531   0.0      Vitis vinifera
ref|XP_010449006.1|  PREDICTED: beta-glucosidase 47-like                534   0.0      
ref|XP_010273571.1|  PREDICTED: beta-glucosidase 18-like                533   0.0      
ref|XP_010316602.1|  PREDICTED: beta-glucosidase 18-like isoform X1     533   0.0      
ref|XP_007153927.1|  hypothetical protein PHAVU_003G076800g             533   0.0      
ref|XP_006285457.1|  hypothetical protein CARUB_v10006876mg             531   2e-180   
ref|XP_006348093.1|  PREDICTED: beta-glucosidase 18-like                531   4e-180   
ref|XP_006413734.1|  hypothetical protein EUTSA_v10024896mg             531   6e-180   
ref|XP_008669177.1|  PREDICTED: probable inactive beta-glucosidas...    529   2e-179   
ref|XP_010439426.1|  PREDICTED: beta-glucosidase 47-like                530   2e-179   
ref|XP_004976200.1|  PREDICTED: probable inactive beta-glucosidas...    530   3e-179   
gb|KDP39384.1|  hypothetical protein JCGZ_01141                         526   9e-179   
ref|XP_010434129.1|  PREDICTED: beta-glucosidase 47-like                528   1e-178   
ref|XP_009397666.1|  PREDICTED: beta-glucosidase 18-like                526   1e-178   
emb|CDX94055.1|  BnaC07g36890D                                          527   2e-178   
ref|XP_002869865.1|  beta-glucosidase 47                                526   4e-178   
ref|XP_008669175.1|  PREDICTED: probable inactive beta-glucosidas...    526   5e-178   
ref|XP_010473401.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    526   1e-177   
ref|XP_002448173.1|  hypothetical protein SORBIDRAFT_06g022450          525   1e-177   Sorghum bicolor [broomcorn]
ref|XP_006858057.1|  hypothetical protein AMTR_s00062p00043120          525   3e-177   
ref|NP_001185287.1|  beta-glucosidase 45                                524   5e-177   
ref|XP_002448169.1|  hypothetical protein SORBIDRAFT_06g022410          523   6e-177   Sorghum bicolor [broomcorn]
ref|XP_009135219.1|  PREDICTED: beta-glucosidase 47 isoform X2          521   3e-176   
ref|XP_008669176.1|  PREDICTED: probable inactive beta-glucosidas...    520   5e-176   
ref|XP_009137215.1|  PREDICTED: beta-glucosidase 47-like                520   1e-175   
ref|XP_006413735.1|  hypothetical protein EUTSA_v10024896mg             520   1e-175   
ref|XP_003581423.1|  PREDICTED: probable inactive beta-glucosidas...    520   1e-175   
gb|ABC55715.1|  beta-mannosidase 4                                      518   3e-175   
gb|KDO75512.1|  hypothetical protein CISIN_1g0095352mg                  514   7e-175   
ref|XP_009413739.1|  PREDICTED: beta-glucosidase 18-like isoform X1     517   9e-175   
ref|XP_010245701.1|  PREDICTED: beta-glucosidase 18-like                517   1e-174   
ref|XP_010920356.1|  PREDICTED: beta-glucosidase 18-like                516   2e-174   
ref|XP_009135212.1|  PREDICTED: beta-glucosidase 47 isoform X1          516   7e-174   
emb|CDX98704.1|  BnaA03g44890D                                          514   1e-173   
ref|XP_006449067.1|  hypothetical protein CICLE_v100148872mg            511   1e-173   
ref|XP_010069050.1|  PREDICTED: beta-glucosidase 18-like                513   4e-173   
ref|NP_193907.2|  beta-glucosidase 47                                   513   7e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384041.1|  PREDICTED: beta-glucosidase 46-like isoform X3     509   2e-172   
ref|NP_001053302.1|  Os04g0513100                                       510   5e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008384042.1|  PREDICTED: beta-glucosidase 46-like isoform X4     508   5e-172   
gb|KDO75513.1|  hypothetical protein CISIN_1g0095352mg                  506   8e-172   
ref|XP_010023759.1|  PREDICTED: beta-glucosidase 18-like isoform X1     509   9e-172   
gb|EMT09723.1|  Beta-glucosidase 6                                      508   2e-171   
ref|XP_006451937.1|  hypothetical protein CICLE_v10007996mg             507   9e-171   
ref|XP_010023758.1|  PREDICTED: beta-glucosidase 18-like                507   1e-170   
ref|XP_002448174.1|  hypothetical protein SORBIDRAFT_06g022460          505   9e-170   Sorghum bicolor [broomcorn]
ref|XP_007026015.1|  Beta-glucosidase 47 isoform 1                      500   3e-169   
gb|EMS59801.1|  putative inactive beta-glucosidase 14                   504   5e-169   
gb|KHG24858.1|  Beta-glucosidase 46 -like protein                       498   1e-168   
ref|XP_006464710.1|  PREDICTED: beta-glucosidase 18-like isoform X1     502   1e-168   
ref|XP_004976205.1|  PREDICTED: beta-glucosidase 18-like isoform X2     501   1e-168   
ref|XP_009605773.1|  PREDICTED: beta-glucosidase 18-like isoform X1     500   1e-167   
ref|XP_006370302.1|  hypothetical protein POPTR_0001s41440g             499   1e-167   
ref|XP_009382650.1|  PREDICTED: beta-glucosidase 18-like                498   2e-167   
ref|XP_003541851.2|  PREDICTED: beta-glucosidase 18-like isoform X1     499   2e-167   
ref|XP_006594785.1|  PREDICTED: beta-glucosidase 18-like isoform X2     499   3e-167   
ref|XP_007021332.1|  Beta-glucosidase 45, putative                      501   7e-167   
ref|XP_007026016.1|  Beta-glucosidase 47 isoform 2                      493   7e-167   
ref|XP_004976204.1|  PREDICTED: beta-glucosidase 18-like isoform X1     497   8e-167   
ref|XP_004487691.1|  PREDICTED: beta-glucosidase 18-like                497   2e-166   
ref|XP_009135228.1|  PREDICTED: beta-glucosidase 47 isoform X3          495   3e-166   
ref|XP_009768487.1|  PREDICTED: beta-glucosidase 18-like                496   3e-166   
gb|EMS46231.1|  Beta-glucosidase 16                                     495   3e-166   
ref|XP_007145856.1|  hypothetical protein PHAVU_007G273800g             496   4e-166   
gb|KHN28048.1|  Beta-glucosidase 18                                     496   5e-166   
emb|CDY25325.1|  BnaC01g29940D                                          493   1e-165   
gb|KEH36809.1|  glycoside hydrolase family 1 protein                    492   1e-165   
ref|XP_006593298.1|  PREDICTED: beta-glucosidase 18-like                494   2e-165   
ref|XP_002448178.1|  hypothetical protein SORBIDRAFT_06g022500          493   2e-165   Sorghum bicolor [broomcorn]
ref|XP_002448179.1|  hypothetical protein SORBIDRAFT_06g022510          493   2e-165   Sorghum bicolor [broomcorn]
gb|KFK40643.1|  hypothetical protein AALP_AA2G023200                    491   2e-165   
ref|XP_004976207.1|  PREDICTED: beta-glucosidase 18-like                496   4e-165   
ref|XP_007149593.1|  hypothetical protein PHAVU_005G082800g             493   4e-165   
gb|KEH36808.1|  glycoside hydrolase family 1 protein                    491   5e-165   
ref|XP_006652510.1|  PREDICTED: beta-glucosidase 16-like                492   6e-165   
ref|XP_007149591.1|  hypothetical protein PHAVU_005G082800g             493   8e-165   
ref|XP_006653596.1|  PREDICTED: beta-glucosidase 16-like                491   9e-165   
sp|Q7XSK2.2|BGL16_ORYSJ  RecName: Full=Beta-glucosidase 16; Short...    491   2e-164   Oryza sativa Japonica Group [Japonica rice]
gb|AID16401.1|  monolignol beta-glucosidase                             490   2e-164   
sp|Q7XSK0.2|BGL18_ORYSJ  RecName: Full=Beta-glucosidase 18; Short...    491   2e-164   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011042496.1|  PREDICTED: beta-glucosidase 18-like isoform X1     492   2e-164   
ref|XP_004141366.1|  PREDICTED: beta-glucosidase 18-like                491   2e-164   
ref|XP_010644219.1|  PREDICTED: beta-glucosidase 18 isoform X1          491   3e-164   
ref|XP_003580124.2|  PREDICTED: beta-glucosidase 16-like                492   4e-164   
ref|XP_006348229.1|  PREDICTED: beta-glucosidase 18-like                491   4e-164   
gb|KEH38756.1|  glycoside hydrolase family 1 protein                    490   7e-164   
ref|XP_007026018.1|  Beta glucosidase 46 isoform 2                      489   7e-164   
ref|XP_004154892.1|  PREDICTED: beta-glucosidase 18-like                488   1e-163   
dbj|BAJ93784.1|  predicted protein                                      488   2e-163   
ref|XP_007147745.1|  hypothetical protein PHAVU_006G151400g             486   2e-163   
gb|KEH38761.1|  glycoside hydrolase family 1 protein                    488   3e-163   
ref|XP_008454703.1|  PREDICTED: beta-glucosidase 18-like                486   4e-163   
ref|XP_010644221.1|  PREDICTED: beta-glucosidase 18-like                487   9e-163   
ref|XP_004147833.1|  PREDICTED: beta-glucosidase 18-like                486   1e-162   
gb|KGN59899.1|  hypothetical protein Csa_3G852480                       486   1e-162   
ref|XP_004158044.1|  PREDICTED: beta-glucosidase 47-like                484   2e-162   
ref|XP_004160619.1|  PREDICTED: beta-glucosidase 18-like                486   2e-162   
ref|XP_003541849.2|  PREDICTED: beta-glucosidase 18-like isoform X1     486   2e-162   
ref|XP_008454668.1|  PREDICTED: beta-glucosidase 18-like                485   3e-162   
dbj|BAJ92008.1|  predicted protein                                      484   5e-162   
ref|XP_004153110.1|  PREDICTED: beta-glucosidase 47-like                483   6e-162   
gb|KHN28049.1|  Beta-glucosidase 18                                     485   7e-162   
gb|KGN59900.1|  hypothetical protein Csa_3G852490                       485   1e-161   
gb|KEH36818.1|  glycoside hydrolase family 1 protein                    479   2e-161   
ref|XP_007212382.1|  hypothetical protein PRUPE_ppa005194mg             481   3e-161   
ref|XP_009630283.1|  PREDICTED: beta-glucosidase 18-like                483   3e-161   
ref|NP_001148165.1|  beta-glucosidase precursor                         482   4e-161   Zea mays [maize]
ref|XP_006594783.1|  PREDICTED: beta-glucosidase 18-like isoform X2     482   9e-161   
emb|CDP05879.1|  unnamed protein product                                483   9e-161   
ref|XP_007149594.1|  hypothetical protein PHAVU_005G082900g             481   3e-160   
ref|XP_009772387.1|  PREDICTED: beta-glucosidase 18-like                481   3e-160   
ref|XP_010274443.1|  PREDICTED: beta-glucosidase 18-like                480   4e-160   
dbj|BAO04172.1|  hypothetical protein                                   480   4e-160   
emb|CDX79092.1|  BnaA01g11590D                                          478   6e-160   
emb|CDY68226.1|  BnaCnng58130D                                          476   6e-160   
ref|XP_011098340.1|  PREDICTED: beta-glucosidase 18-like                479   2e-159   
ref|NP_001140717.1|  beta-glucosidase precursor                         478   3e-159   Zea mays [maize]
gb|KEH36812.1|  glycoside hydrolase family 1 protein                    474   3e-159   
gb|AAU05454.1|  At1g61820                                               474   6e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006348230.1|  PREDICTED: beta-glucosidase 18-like                477   6e-159   
emb|CDX94056.1|  BnaC07g36900D                                          477   7e-159   
emb|CDP05880.1|  unnamed protein product                                478   7e-159   
ref|XP_004244205.1|  PREDICTED: beta-glucosidase 18-like                478   8e-159   
gb|EYU26405.1|  hypothetical protein MIMGU_mgv1a004080mg                476   3e-158   
ref|XP_002448170.1|  hypothetical protein SORBIDRAFT_06g022420          484   8e-158   Sorghum bicolor [broomcorn]
gb|EMS60351.1|  Beta-glucosidase 16                                     474   1e-157   
ref|XP_009413740.1|  PREDICTED: beta-glucosidase 18-like isoform X2     472   2e-157   
ref|XP_009378508.1|  PREDICTED: beta-glucosidase 18-like                473   2e-157   
ref|XP_011098338.1|  PREDICTED: beta-glucosidase 18-like                474   3e-157   
ref|XP_009605771.1|  PREDICTED: beta-glucosidase 18-like isoform X1     473   4e-157   
ref|XP_009762322.1|  PREDICTED: beta-glucosidase 18-like                473   6e-157   
gb|KCW60131.1|  hypothetical protein EUGRSUZ_H02856                     471   8e-157   
gb|KEH36810.1|  glycoside hydrolase family 1 protein                    467   2e-156   
ref|XP_010675613.1|  PREDICTED: beta-glucosidase 18-like                471   2e-156   
ref|XP_004147832.1|  PREDICTED: beta-glucosidase 18-like                472   2e-156   
ref|XP_008453064.1|  PREDICTED: beta-glucosidase 18-like                471   4e-156   
ref|XP_010316607.1|  PREDICTED: beta-glucosidase 18 isoform X2          466   6e-156   
ref|XP_006594784.1|  PREDICTED: beta-glucosidase 18-like isoform X3     469   8e-156   
ref|XP_010324440.1|  PREDICTED: beta-glucosidase 18-like                466   1e-154   
ref|XP_008226673.1|  PREDICTED: beta-glucosidase 18-like isoform X2     466   1e-154   
ref|XP_002448177.1|  hypothetical protein SORBIDRAFT_06g022490          465   2e-154   Sorghum bicolor [broomcorn]
ref|XP_004976203.1|  PREDICTED: beta-glucosidase 16-like                464   1e-153   
ref|XP_010533828.1|  PREDICTED: beta-glucosidase 45-like isoform X2     459   2e-153   
gb|KHN36807.1|  Beta-glucosidase 18                                     463   2e-153   
ref|XP_008226671.1|  PREDICTED: beta-glucosidase 18-like                463   3e-153   
ref|XP_008226672.1|  PREDICTED: beta-glucosidase 18-like isoform X1     461   1e-152   
ref|XP_010675614.1|  PREDICTED: beta-glucosidase 18-like                461   2e-152   
ref|XP_011098339.1|  PREDICTED: beta-glucosidase 18-like                462   3e-152   
gb|AIP98403.1|  beta-glucosidase                                        458   1e-151   
ref|XP_008661459.1|  PREDICTED: hypothetical protein isoform X1         458   1e-151   
gb|KFK28774.1|  hypothetical protein AALP_AA7G045600                    457   1e-151   
ref|XP_010316603.1|  PREDICTED: beta-glucosidase 18-like isoform X2     454   2e-151   
gb|KEH36807.1|  glycoside hydrolase family 1 protein                    452   6e-151   
ref|NP_001167660.1|  beta-glucosidase precursor                         456   8e-151   Zea mays [maize]
ref|XP_006464711.1|  PREDICTED: beta-glucosidase 18-like isoform X2     455   8e-151   
ref|XP_010240132.1|  PREDICTED: probable inactive beta-glucosidas...    449   2e-149   
sp|Q9ZT64.1|CBG_PINCO  RecName: Full=Coniferin beta-glucosidase; ...    451   5e-149   Pinus contorta
ref|XP_009378490.1|  PREDICTED: beta-glucosidase 18-like isoform X1     451   1e-148   
gb|EMS66653.1|  Beta-glucosidase 16                                     451   2e-148   
ref|XP_011037698.1|  PREDICTED: beta-glucosidase 46-like                446   3e-148   
ref|XP_006348385.1|  PREDICTED: beta-glucosidase 18-like                449   3e-148   
ref|XP_010240133.1|  PREDICTED: probable inactive beta-glucosidas...    443   4e-147   
gb|KDP39385.1|  hypothetical protein JCGZ_01142                         442   6e-147   
ref|XP_008386133.1|  PREDICTED: beta-glucosidase 18-like isoform X2     447   7e-147   
emb|CDP05535.1|  unnamed protein product                                446   2e-146   
ref|XP_007214434.1|  hypothetical protein PRUPE_ppa025660mg             444   2e-146   
emb|CDP05539.1|  unnamed protein product                                446   2e-146   
ref|XP_004976201.1|  PREDICTED: probable inactive beta-glucosidas...    440   3e-145   
ref|XP_008386132.1|  PREDICTED: beta-glucosidase 18-like isoform X1     441   2e-144   
emb|CDP05536.1|  unnamed protein product                                441   4e-144   
tpg|DAA36952.1|  TPA: hypothetical protein ZEAMMB73_325029              437   7e-144   
ref|XP_010023760.1|  PREDICTED: beta-glucosidase 18-like isoform X2     437   2e-143   
ref|XP_009105279.1|  PREDICTED: beta-glucosidase 46-like isoform X2     433   3e-143   
ref|XP_010023761.1|  PREDICTED: beta-glucosidase 18-like isoform X3     432   1e-142   
gb|KEH36811.1|  glycoside hydrolase family 1 protein                    430   4e-142   
ref|XP_006464712.1|  PREDICTED: beta-glucosidase 18-like isoform X3     429   2e-141   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             431   2e-141   
ref|XP_009605774.1|  PREDICTED: probable inactive beta-glucosidas...    428   3e-141   
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 431   4e-141   
ref|XP_004976206.1|  PREDICTED: beta-glucosidase 18-like isoform X3     427   8e-141   
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                429   1e-140   
gb|KDO74143.1|  hypothetical protein CISIN_1g012716mg                   427   1e-140   
ref|XP_007153926.1|  hypothetical protein PHAVU_003G076700g             424   3e-140   
gb|EMT03996.1|  Beta-glucosidase 1                                      427   3e-140   
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             427   7e-140   
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             427   1e-139   
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      426   2e-139   
ref|XP_006592906.1|  PREDICTED: beta-glucosidase 18-like                424   4e-139   
dbj|BAO04176.1|  hypothetical protein                                   424   1e-138   
ref|XP_007161525.1|  hypothetical protein PHAVU_001G076700g             425   2e-138   
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                424   2e-138   
ref|NP_001064347.1|  Os10g0323500                                       423   3e-138   
ref|NP_001268161.1|  beta-glucosidase precursor                         422   7e-138   
gb|EEC66726.1|  hypothetical protein OsI_33062                          422   1e-137   
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 422   1e-137   
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             421   2e-137   
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          421   2e-137   
gb|EAZ31331.1|  hypothetical protein OsJ_15448                          419   3e-137   
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    421   3e-137   
gb|EEE58575.1|  hypothetical protein OsJ_09895                          421   3e-137   
emb|CBI27264.3|  unnamed protein product                                422   4e-137   
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    420   4e-137   
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    420   5e-137   
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             420   6e-137   
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          420   6e-137   
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    420   8e-137   
ref|XP_009599228.1|  PREDICTED: beta-glucosidase 18-like                416   8e-137   
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                420   9e-137   
gb|EEC80501.1|  hypothetical protein OsI_22753                          419   9e-137   
ref|NP_001049358.1|  Os03g0212800                                       420   1e-136   
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          419   1e-136   
emb|CAB36820.1|  beta-glucosidase-like protein                          420   1e-136   
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     419   1e-136   
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     419   1e-136   
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     419   2e-136   
gb|EEC74750.1|  hypothetical protein OsI_10506                          419   2e-136   
ref|XP_007131974.1|  hypothetical protein PHAVU_011G056100g             420   2e-136   
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    418   2e-136   
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    418   2e-136   
emb|CDY25326.1|  BnaC01g29950D                                          425   2e-136   
gb|KHN20526.1|  Beta-glucosidase 40                                     419   2e-136   
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             418   2e-136   
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     418   3e-136   
ref|XP_002888065.1|  hypothetical protein ARALYDRAFT_475148             418   4e-136   
ref|XP_009605772.1|  PREDICTED: beta-glucosidase 18-like isoform X2     415   5e-136   
sp|Q5Z9Z0.1|BGL24_ORYSJ  RecName: Full=Beta-glucosidase 24; Short...    417   5e-136   
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          417   6e-136   
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    417   6e-136   
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                417   8e-136   
ref|XP_010109366.1|  Beta-glucosidase 40                                417   1e-135   
emb|CBI27265.3|  unnamed protein product                                418   1e-135   
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     417   1e-135   
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           417   1e-135   
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           416   1e-135   
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         417   2e-135   
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             417   2e-135   
ref|NP_974067.1|  beta glucosidase 46                                   412   2e-135   
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     416   2e-135   
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     416   3e-135   
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         416   4e-135   
emb|CDX85027.1|  BnaC05g20280D                                          415   5e-135   
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             415   5e-135   
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    415   6e-135   
gb|AAM61600.1|  beta-glucosidase, putative                              415   6e-135   
ref|NP_173978.1|  beta glucosidase 40                                   415   6e-135   
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      415   7e-135   
ref|XP_002512097.1|  beta-glucosidase, putative                         415   7e-135   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             414   7e-135   
ref|XP_002960920.1|  hypothetical protein SELMODRAFT_163822             414   8e-135   
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                414   9e-135   
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    414   9e-135   
ref|XP_003607794.1|  Beta-glucosidase                                   414   1e-134   
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         414   1e-134   
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     414   1e-134   
ref|XP_003579958.1|  PREDICTED: beta-glucosidase 12-like                414   1e-134   
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             414   1e-134   
emb|CDY20561.1|  BnaC07g12280D                                          414   1e-134   
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                414   2e-134   
gb|AII20122.1|  beta-glucosidase                                        414   2e-134   
ref|XP_003563902.1|  PREDICTED: beta-glucosidase 24-like                413   3e-134   
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     413   3e-134   
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40-like isoform 2      413   3e-134   
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         413   3e-134   
ref|XP_006653597.1|  PREDICTED: beta-glucosidase 16-like                410   4e-134   
dbj|BAJ93012.1|  predicted protein                                      413   4e-134   
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             413   5e-134   
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     413   5e-134   
ref|XP_011042497.1|  PREDICTED: beta-glucosidase 18-like isoform X2     412   6e-134   
ref|XP_003597482.1|  Beta-glucosidase D4                                412   6e-134   
ref|XP_003597509.1|  Beta-glucosidase D2                                412   7e-134   
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     412   7e-134   
dbj|BAJ98823.1|  predicted protein                                      412   7e-134   
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     413   8e-134   
gb|AHC04401.1|  beta-glucosidase 1                                      412   1e-133   
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                412   1e-133   
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     412   1e-133   
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                411   2e-133   
ref|XP_004966955.1|  PREDICTED: beta-glucosidase 24-like                411   2e-133   
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                410   2e-133   
ref|XP_002967091.1|  hypothetical protein SELMODRAFT_169039             410   2e-133   
gb|AES76414.2|  glycoside hydrolase family 1 protein                    411   3e-133   
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              411   3e-133   
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                410   4e-133   
gb|AES67732.2|  glycoside hydrolase family 1 protein                    410   4e-133   
dbj|BAK01899.1|  predicted protein                                      410   5e-133   
gb|ACN41025.1|  unknown                                                 410   6e-133   
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 410   6e-133   
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             410   7e-133   
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                409   7e-133   
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                409   7e-133   
ref|XP_008661573.1|  PREDICTED: beta-glucosidase isoform X1             410   9e-133   
gb|KEH30294.1|  glycoside hydrolase family 1 protein                    410   1e-132   
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    409   1e-132   
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     409   1e-132   
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41-like...    409   2e-132   
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 409   2e-132   
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                409   2e-132   
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             407   2e-132   
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            408   3e-132   
ref|XP_009341391.1|  PREDICTED: beta-glucosidase 13-like                409   3e-132   
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                408   3e-132   
ref|XP_003539051.1|  PREDICTED: beta-glucosidase 12-like                409   3e-132   
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    408   3e-132   
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 408   3e-132   
ref|XP_003537944.1|  PREDICTED: beta-glucosidase 12-like isoform 1      409   3e-132   
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                408   3e-132   
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                408   4e-132   
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      407   4e-132   
emb|CDY61627.1|  BnaA08g19770D                                          407   4e-132   
gb|EMT15328.1|  Non-cyanogenic beta-glucosidase                         407   5e-132   
gb|AFZ78537.1|  beta-glucosidase                                        407   5e-132   
gb|EMS46293.1|  Beta-glucosidase 34                                     407   5e-132   
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           407   6e-132   
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                407   6e-132   
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     408   7e-132   
ref|XP_011037887.1|  PREDICTED: beta-glucosidase 24-like                408   7e-132   
ref|XP_006656039.1|  PREDICTED: beta-glucosidase 24-like                407   7e-132   
gb|AEB61486.1|  beta-glucosidase                                        407   7e-132   
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                407   7e-132   
ref|XP_007038935.1|  Vicianin hydrolase, putative                       407   7e-132   
gb|AAF04007.1|AF163097_1  dalcochinin 8'-O-beta-glucoside beta-gl...    408   8e-132   
ref|XP_004515054.1|  PREDICTED: beta-glucosidase 12-like isoform X2     407   8e-132   
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         409   1e-131   
ref|XP_003546992.2|  PREDICTED: cyanogenic beta-glucosidase-like ...    407   1e-131   
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                407   1e-131   
emb|CDY42461.1|  BnaA10g08370D                                          407   1e-131   
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                407   1e-131   
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         407   1e-131   
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                407   1e-131   
ref|XP_003620203.1|  Beta-glucosidase D4                                407   2e-131   
emb|CDY64930.1|  BnaCnng45520D                                          407   2e-131   
ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                406   2e-131   
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            407   2e-131   
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           405   2e-131   
ref|XP_004294321.1|  PREDICTED: putative beta-glucosidase 41-like...    406   2e-131   
ref|XP_002277732.1|  PREDICTED: beta-glucosidase 12-like                405   3e-131   
ref|XP_003620196.1|  Beta-glucosidase D2                                406   3e-131   
gb|ACD65511.1|  beta-glucosidase D7                                     405   3e-131   
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     405   3e-131   
ref|XP_003540006.1|  PREDICTED: beta-glucosidase 12-like                406   3e-131   
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       405   3e-131   
ref|XP_004151252.1|  PREDICTED: beta-glucosidase 24-like                405   4e-131   
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 405   4e-131   
ref|XP_003539050.1|  PREDICTED: beta-glucosidase 12-like                405   5e-131   
ref|XP_008384453.1|  PREDICTED: beta-glucosidase 12-like                405   5e-131   
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                405   6e-131   
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      405   6e-131   
ref|XP_002299251.1|  Cyanogenic beta-glucosidase precursor family...    405   6e-131   
ref|XP_003539053.1|  PREDICTED: beta-glucosidase 12-like                405   7e-131   
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  403   7e-131   
ref|XP_004154676.1|  PREDICTED: beta-glucosidase 24-like                405   7e-131   
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          405   7e-131   
ref|XP_010644220.1|  PREDICTED: beta-glucosidase 18 isoform X2          403   7e-131   
emb|CBI20471.3|  unnamed protein product                                407   7e-131   
ref|XP_009355663.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    405   8e-131   
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      404   1e-130   
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    404   1e-130   
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                404   1e-130   
ref|XP_006652406.1|  PREDICTED: beta-glucosidase 13-like                404   1e-130   
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                404   2e-130   
gb|KHN28382.1|  Putative beta-glucosidase 41                            403   2e-130   
gb|KEH33228.1|  glycoside hydrolase family 1 protein                    404   2e-130   
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          403   2e-130   
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    404   2e-130   
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             404   3e-130   
ref|XP_007033096.1|  B-S glucosidase 44                                 403   3e-130   
emb|CDP00417.1|  unnamed protein product                                404   3e-130   
emb|CDP11229.1|  unnamed protein product                                403   3e-130   
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             403   3e-130   
ref|XP_009395000.1|  PREDICTED: beta-glucosidase 12-like                403   3e-130   
gb|AEB61485.1|  beta-glucosidase                                        403   4e-130   
gb|KFK39133.1|  beta-glucosidase 44                                     402   4e-130   
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     402   4e-130   
ref|XP_003597481.1|  Beta-glucosidase D4                                402   5e-130   
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    403   5e-130   
gb|KEH30275.1|  cyanogenic beta-glucosidase, putative                   403   6e-130   
gb|KEH30287.1|  glycoside hydrolase family 1 protein                    402   6e-130   
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                402   7e-130   
ref|XP_003540705.1|  PREDICTED: beta-glucosidase 12-like                402   7e-130   
ref|XP_009355662.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    402   7e-130   
gb|KHN21873.1|  Beta-glucosidase 24                                     402   9e-130   
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     402   1e-129   
ref|XP_008450457.1|  PREDICTED: cyanogenic beta-glucosidase-like        402   1e-129   
ref|XP_008366162.1|  PREDICTED: beta-glucosidase 24-like                403   1e-129   
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             399   1e-129   
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            402   1e-129   
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 404   1e-129   
gb|KEH30282.1|  glycoside hydrolase family 1 protein                    401   1e-129   
ref|XP_004154617.1|  PREDICTED: beta-glucosidase 24-like                401   1e-129   
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                401   1e-129   
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    402   1e-129   
ref|XP_007131973.1|  hypothetical protein PHAVU_011G056000g             402   1e-129   
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            402   1e-129   
ref|XP_006850053.1|  hypothetical protein AMTR_s00022p00201150          401   1e-129   
ref|XP_010673860.1|  PREDICTED: beta-glucosidase 42 isoform X1          403   1e-129   
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             402   1e-129   
ref|XP_004295227.1|  PREDICTED: beta-glucosidase 13-like                402   1e-129   
ref|XP_010673861.1|  PREDICTED: beta-glucosidase 42 isoform X2          403   2e-129   
emb|CAH66811.1|  OSIGBa0135C13.6                                        402   2e-129   
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                401   2e-129   
ref|XP_009336228.1|  PREDICTED: beta-glucosidase 42-like                400   2e-129   
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                401   2e-129   
ref|XP_003539378.1|  PREDICTED: beta-glucosidase 12-like                401   2e-129   
ref|XP_004164648.1|  PREDICTED: beta-glucosidase 12-like                400   2e-129   
emb|CAN74265.1|  hypothetical protein VITISV_040977                     400   2e-129   
ref|XP_004505421.1|  PREDICTED: putative beta-glucosidase 41-like       400   3e-129   



>ref|XP_002264678.3| PREDICTED: beta-glucosidase 46-like [Vitis vinifera]
Length=530

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/475 (60%), Positives = 359/475 (76%), Gaps = 9/475 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGL+NWDVFSH+PGNI DGS GD+A D Y  Y ED DL+
Sbjct  52    NFLFGTASSSYQFEGAFLNDGKGLNNWDVFSHEPGNIRDGSTGDIAVDHYHRYLEDIDLM  111

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LP+GR G +N  GI YY  LID+L+LKG+EPFVT+ H+D+PQE
Sbjct  112   VSLGVNSYRFSISWARILPEGRFGEVNAAGIDYYNKLIDALVLKGLEPFVTLTHFDIPQE  171

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+D + GWLSP++QEE+ Y+AD+CFK  GD+VKYW+TFNEPN+   A YR   +P     
Sbjct  172   LEDTFGGWLSPKLQEEFRYYADICFKTFGDRVKYWVTFNEPNIQVTAGYRSGSYPPSRCS  231

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
               +GNC+ G++ K+ F+ AHN+IL+HA  V+IYR+ YQ++QGG IGI +   W  P +NS
Sbjct  232   SSYGNCTYGDSEKEPFVAAHNIILSHATVVDIYRRQYQEKQGGSIGIVLHAKWIEPFSNS  291

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AA+RA SF  NWFLDPI++G YP+EM  ILGS LPEFS  D +KL     DFIGI
Sbjct  292   TADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLNK-ALDFIGI  350

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ YAQDC++S C+P   G +R EGF  Q+  K+G  IGE T L +L VYP GME++
Sbjct  351   NHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLHVYPQGMEKM  409

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++  IP+++TE GY D   PNS+IEE L+D KRV+++A YL A+ TA+RKGADV
Sbjct  410   VTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALSTAVRKGADV  469

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             RGYF WSL DNFEWT GYTKR GL+  D  T KRTPKLSA WYK FIA+   V +
Sbjct  470   RGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIARYSLVKT  524



>emb|CBI23186.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/469 (60%), Positives = 357/469 (76%), Gaps = 9/469 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGL+NWDVFSH+PGNI DGS GD+A D Y  Y ED DL+
Sbjct  52    NFLFGTASSSYQFEGAFLNDGKGLNNWDVFSHEPGNIRDGSTGDIAVDHYHRYLEDIDLM  111

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LP+GR G +N  GI YY  LID+L+LKG+EPFVT+ H+D+PQE
Sbjct  112   VSLGVNSYRFSISWARILPEGRFGEVNAAGIDYYNKLIDALVLKGLEPFVTLTHFDIPQE  171

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+D + GWLSP++QEE+ Y+AD+CFK  GD+VKYW+TFNEPN+   A YR   +P     
Sbjct  172   LEDTFGGWLSPKLQEEFRYYADICFKTFGDRVKYWVTFNEPNIQVTAGYRSGSYPPSRCS  231

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
               +GNC+ G++ K+ F+ AHN+IL+HA  V+IYR+ YQ++QGG IGI +   W  P +NS
Sbjct  232   SSYGNCTYGDSEKEPFVAAHNIILSHATVVDIYRRQYQEKQGGSIGIVLHAKWIEPFSNS  291

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AA+RA SF  NWFLDPI++G YP+EM  ILGS LPEFS  D +KL     DFIGI
Sbjct  292   TADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLNK-ALDFIGI  350

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ YAQDC++S C+P   G +R EGF  Q+  K+G  IGE T L +L VYP GME++
Sbjct  351   NHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLHVYPQGMEKM  409

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++  IP+++TE GY D   PNS+IEE L+D KRV+++A YL A+ TA+RKGADV
Sbjct  410   VTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALSTAVRKGADV  469

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAK  360
             RGYF WSL DNFEWT GYTKR GL+  D  T KRTPKLSA WYK FIA+
Sbjct  470   RGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIAR  518



>ref|XP_011037697.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=515

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 364/477 (76%), Gaps = 9/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLSDGKGLSNWDV SH+PGNI+DGSNGD+A DQY  Y+ED DL+
Sbjct  41    NFLFGTASSSYQFEGAYLSDGKGLSNWDVHSHKPGNIIDGSNGDIAVDQYHRYREDIDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVNS++FS+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQE
Sbjct  101   ASLGVNSYRFSMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY G+LSP+ QE++ Y+AD+CFK+ GD+VKYW TFNEPN  AI  YR   +      
Sbjct  161   LEDRYGGFLSPKSQEDFRYYADICFKYFGDRVKYWATFNEPNFQAIYGYRAGEYPPKRCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++  + FI AHN+ILAHA+AV+IYR  YQ++Q G IGI M   W+ P++NS
Sbjct  221   KPFGNCSHGDSETEPFIAAHNIILAHASAVDIYRTKYQREQRGSIGIVMHCMWYEPISNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T +K A ERA +FL  WFLDPI++G YP+EMK +LGS LPEFS  D+ KL+  G DFIG+
Sbjct  281   TANKLAVERAQAFLLRWFLDPIIFGRYPEEMKKVLGSTLPEFSRNDMNKLRK-GLDFIGM  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY QDC+ S C+P   G+TR EG    +  K+G  IG+ + + +L VYP GME++
Sbjct  340   NHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEKM  398

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ +IP+ +TE GY   +  N +IEE LHDT RV++++ YL A+ TA++KGADV
Sbjct  399   VTYVKERYHNIPMIITENGYSQVSNSNRNIEEFLHDTGRVEYMSGYLDALLTAMKKGADV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WS  DNFEWT GYT+R GLY  D  T KRTP+LSA WYK+FIA+ +   S+M
Sbjct  459   RGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  515



>ref|XP_007026020.1| Beta glucosidase 46, putative [Theobroma cacao]
 gb|EOY28642.1| Beta glucosidase 46, putative [Theobroma cacao]
Length=529

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 360/480 (75%), Gaps = 9/480 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEGGYLSDGKGL+NWDV++H+P N++DGSNGDVA D Y+ Y ED DL+
Sbjct  44    NFLFGTASSAYQYEGGYLSDGKGLNNWDVYTHKPENVIDGSNGDVAVDHYNRYMEDIDLM  103

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKG+ G +N  GI +Y  LID+LLLKGIEPFVT+ H DLPQE
Sbjct  104   VSLGVNSYRFSISWARILPKGKFGEVNPAGINFYNKLIDALLLKGIEPFVTLTHVDLPQE  163

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL-------  1227
             ++DRY  WLSPE QE++AYFA+VCF+  GD+VKYW+TFNEPN      YR          
Sbjct  164   IEDRYGSWLSPESQEDFAYFAEVCFRSFGDRVKYWVTFNEPNYQVKFGYRTGTFPPSRCS  223

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             WP GNC+ G++ K+ FI AHN+IL+HAAAV+IYR  YQ +QGG IGI +   WF P++NS
Sbjct  224   WPFGNCTIGDSDKEPFIAAHNIILSHAAAVHIYRTKYQAKQGGSIGIVLNCAWFEPISNS  283

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDPI++G YP EM++ILGS LPEFS T+ EKL+  G DFIGI
Sbjct  284   LADKLAAERAQSFSINWFLDPIIFGRYPIEMQNILGSILPEFSITEKEKLQK-GLDFIGI  342

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY++ Y QDC++S C+P  +G ++ EGF  Q+  KNG  IGE T L +L VYP GME++
Sbjct  343   NHYSSSYVQDCMFSACEPG-TGTSKTEGFWRQTSQKNGIPIGESTDLDWLYVYPGGMEKI  401

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ +IP+ +TE GY +    N++IE+ L D KR +++A YL A+ TAIRKGADV
Sbjct  402   VTYLKKRYHNIPMIITENGYGEEGKANATIEDFLQDVKRAEYMAGYLDALSTAIRKGADV  461

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQSR  327
             RGYF WSL DNFEW  GYT+R GL+  D  T KRTPK SA WYK+FIA   KV  +   R
Sbjct  462   RGYFAWSLLDNFEWQYGYTRRFGLHHVDYKTLKRTPKFSASWYKEFIAVQGKVKYQTTER  521



>ref|XP_007026017.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
 gb|EOY28639.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
Length=529

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/477 (60%), Positives = 360/477 (75%), Gaps = 10/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNIL-DGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEGG++SDGKGL+NWDV+SH+PGN++ DGSNGD+A D Y  Y ED DL
Sbjct  43    NFLFGTASSAYQYEGGFMSDGKGLNNWDVYSHKPGNMIADGSNGDIAVDHYHRYLEDIDL  102

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GI +Y  LID+LLLKGI+P VT+ H D PQ
Sbjct  103   MHSLGVNSYRFSISWARILPKGRFGKINEAGINFYNKLIDALLLKGIKPLVTLTHVDFPQ  162

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL------  1227
             EL+DRY  WLSPE QE++AYFAD+CFK  GD+V+YW+TFNEP+     AYR  +      
Sbjct  163   ELEDRYGSWLSPEWQEDFAYFADICFKSFGDRVQYWVTFNEPDFQVKFAYRTGIFPPSRC  222

Query  1226  -WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
              WP GNC+ G++ K+ FI AHN+ILAH AAV+IYR  YQ+ QGG IGI +   WF  ++N
Sbjct  223   SWPFGNCTYGDSEKEPFIAAHNIILAHIAAVHIYRTKYQETQGGSIGIVLHCFWFESISN  282

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF   WFLDPI++G YP EM++ILGS LPEFS+T+ EKL   G DFIG
Sbjct  283   SLADKLAAERAQSFTMKWFLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK-GLDFIG  341

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHY++YY +DC++S C+P  +G ++ EGF GQS  KNG  IGELT L +L VYP GME+
Sbjct  342   VNHYSSYYVKDCMFSVCEPG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEK  400

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE + +IP+ +TE GY + +  NS+ EE LHD KRV++LA YL  + TAIRKGAD
Sbjct  401   IVTYLKETYHNIPMIITENGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGAD  460

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             VRGYF+WSL DNFEW  GYT R GL+  D  T KRTPK SA WYK FI+++ +V  +
Sbjct  461   VRGYFVWSLLDNFEWNFGYTVRFGLHHVDFKTLKRTPKSSATWYKNFISEHGQVKDQ  517



>ref|XP_002305597.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86108.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/477 (58%), Positives = 359/477 (75%), Gaps = 9/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLSDGKGLSNWDV +H+PGNI+DGSNGD+A DQY  Y ED +L+
Sbjct  41    NFLFGTASSSYQFEGAYLSDGKGLSNWDVHTHKPGNIIDGSNGDIAVDQYHRYLEDIELM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVNS++FS+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQE
Sbjct  101   ASLGVNSYRFSMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY G+LSP+ QE++ Y+ D+CFK+ GD+VKYW TFNEPN  AI  YR          
Sbjct  161   LEDRYGGFLSPKSQEDFGYYVDICFKYFGDRVKYWATFNEPNFQAIYGYRVGECPPKRCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++  + FI AHN+ILAHA AV+IYR  YQ++Q G IGI M   W+ P++NS
Sbjct  221   KPFGNCSHGDSEAEPFIAAHNIILAHATAVDIYRTKYQREQRGSIGIVMNCMWYEPISNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T +K A ERAH+F   WFLDPI++G YP+EMK +LGS LPEFS  D+ KL+  G DFIG+
Sbjct  281   TANKLAVERAHAFFLRWFLDPIIFGRYPEEMKKVLGSTLPEFSRNDMNKLRK-GLDFIGM  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY QDC+ S C+P   G+TR EG    +  K+G  IG+ + + +L VYP GME++
Sbjct  340   NHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEKM  398

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+ +TE GY   +  N +IEE LHDT RV++++ YL A+ TA++KGADV
Sbjct  399   VTYVKERYNNTPMIITENGYAQVSNSNGNIEEFLHDTGRVEYMSGYLDALLTAMKKGADV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WS  DNFEWT GYT+R GLY  D  T KRTP+LSA WYK+FIA+ +   S+M
Sbjct  459   RGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  515



>ref|XP_006468004.1| PREDICTED: beta-glucosidase 46-like [Citrus sinensis]
Length=558

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/476 (59%), Positives = 358/476 (75%), Gaps = 9/476 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGTS+SSYQ EG Y+S+GKGLSNWDVF+H PGNI DGS+GDVA D Y  Y ED DL+
Sbjct  74    NFLFGTSTSSYQVEGAYVSEGKGLSNWDVFTHTPGNIDDGSSGDVAVDHYHRYLEDIDLM  133

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR G++N EGI +Y  LID+LLLKGI+PFVT+  +D PQE
Sbjct  134   ESLGVNSYRFSISWARILPKGRFGDVNSEGINHYNKLIDALLLKGIQPFVTLTQFDSPQE  193

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYR-------YRL  1227
             ++D+Y  WLSPE QE++ YFAD+CFK  GD+VKYW T NEPNM    +YR       +  
Sbjct  194   IEDKYGAWLSPESQEDFGYFADICFKSFGDRVKYWFTINEPNMQVTLSYRLGCHPPAHCS  253

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS+GN+ ++ FI AHN+IL+HA AV+IYR  YQ+ QGG IGI +   WF P+++S
Sbjct  254   QPFGNCSQGNSEEEPFIAAHNLILSHATAVDIYRTKYQKDQGGSIGIILNTLWFEPISSS  313

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAERA SF  NWFLDPI+YG YP EM +I+GS LP+FSS D EKLK  G DFIGI
Sbjct  314   TADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQ-GLDFIGI  372

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y QDC++S C P   G ++ EGF  Q+  K+G  +GE T L +L VYP GM ++
Sbjct  373   NHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYPQGMWKI  431

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y KE++ + P+++TE GY +   PNSS E++L+D KRV+++A YL A+ TA+R GADV
Sbjct  432   IKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAVRDGADV  491

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             RGYF+WSL D+FEWT GYT R GL+  D AT KRTPKLSA WYK FIAK++ + S+
Sbjct  492   RGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  547



>ref|XP_002304950.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
 gb|EEE85461.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
Length=501

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/477 (58%), Positives = 359/477 (75%), Gaps = 9/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLSDGKGLSNWDV +H+PGNI+DGSNGD+A DQY  Y ED DL+
Sbjct  27    NFLFGTASSSYQFEGAYLSDGKGLSNWDVHTHKPGNIIDGSNGDIAVDQYHRYLEDIDLM  86

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVNS++FS+SW+R+LPKGR G +N+ GI YY  LI++LLLKGI+PFV++ H+D+PQE
Sbjct  87    ASLGVNSYRFSMSWARILPKGRFGGVNMAGISYYNKLINALLLKGIQPFVSLTHFDVPQE  146

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY G+LSP+ QE++ Y+ D+CFK+ GD+VKYW TFNEPN  AI  YR          
Sbjct  147   LEDRYGGFLSPKSQEDFGYYVDICFKYFGDRVKYWATFNEPNFQAIYGYRVGECPPKRCS  206

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++  + FI AHN+ILAHA AV+IYR  YQ++Q G IGI M   W+ P++NS
Sbjct  207   KPFGNCSHGDSEAEPFIAAHNIILAHATAVDIYRTKYQREQRGSIGIVMNCMWYEPISNS  266

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T +K A ERA +F   WFLDPI++G YP+EMK++LGS LPEFS  D+ KL+  G DFIG+
Sbjct  267   TANKLAVERALAFFLRWFLDPIIFGRYPEEMKEVLGSTLPEFSRNDMNKLRK-GLDFIGM  325

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY QDC+ S C+P   G+TR EG    +  K+G  IG+ + + +L VYP GME++
Sbjct  326   NHYTSYYVQDCILSVCEPG-KGSTRTEGSSLLTQEKDGVPIGKPSEVDWLHVYPQGMEKM  384

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+ +TE GY   +  N +IEE LHDT RV++++ YL A+ TA++KGADV
Sbjct  385   VTYVKERYNNTPMIITENGYSQVSNSNGNIEEFLHDTGRVEYMSGYLDALLTAMKKGADV  444

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WS  DNFEWT GYT+R GLY  D  T KRTP+LSA WYK+FIA+ +   S+M
Sbjct  445   RGYFAWSFLDNFEWTFGYTRRFGLYHVDYTTMKRTPRLSATWYKEFIARYKVDKSQM  501



>ref|XP_007211830.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
 gb|EMJ13029.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
Length=505

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/470 (57%), Positives = 362/470 (77%), Gaps = 8/470 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGL+NWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  28    NFLFGTASSSYQFEGAFLTDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLM  87

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             + +GV+S++FSI+W+RVLPKGR G +N  GI +Y   ID+LL +GI+PFVT++HYD+PQE
Sbjct  88    SYIGVDSYRFSIAWARVLPKGRFGKVNRAGIDHYNKFIDALLSRGIQPFVTLSHYDIPQE  147

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP++QE++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  148   LEDRYGAWLSPKVQEDFKYYANTCFKLFGDRVKYWVTFNEPNVVVIRGYRSGIYPPSRCS  207

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ GN+ K+ FI AHN+IL+HAAAVNIYR  YQ++QGG IG+ M   W+ P++NS
Sbjct  208   SPFGNCTSGNSEKEPFIAAHNIILSHAAAVNIYRTQYQKKQGGSIGMIMNAVWYEPISNS  267

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDPI++G YP EM++ILG+ LP FS +D+E L+    DFIGI
Sbjct  268   LEDKLAAERAQSFYLNWFLDPIVHGKYPAEMREILGADLPIFSESDVEMLRKNRLDFIGI  327

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y +DC++S C+P   G +R EGF  ++  K+G F+GE T + +L VYP GM+++
Sbjct  328   NHYTSFYIKDCIFSECEPG-PGASRTEGFALRTAEKDGVFLGEPTTVDWLYVYPQGMDKI  386

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +T   N + EE+L+D KRVK++  YLHA+  A+RKGADV
Sbjct  387   VTYVKDRYNNTPIFITENGFGETEVSNFTNEELLNDVKRVKYMRSYLHALAEAMRKGADV  446

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF+WSL DNFEWTSGYT R GL+  D AT KRT +LS  WYKQFI+ +
Sbjct  447   RGYFVWSLLDNFEWTSGYTVRFGLHYVDYATLKRTQRLSVDWYKQFISNH  496



>ref|XP_009363745.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Pyrus x bretschneideri]
Length=518

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 363/479 (76%), Gaps = 9/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGLSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  41    NFLFGTASSSYQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLPKGR G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQE
Sbjct  101   NYIGVNTYRFSISWARVLPKGRFGKVNRAGINHYNKFIDALLRRGIHPFVTLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP++QE++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  161   LEDRYGAWLSPQLQEDFLYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGVYPPARCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAV++YR  YQ++QGG IGI M   W+ P++NS
Sbjct  221   RPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYQKKQGGSIGIVMNALWYEPISNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDP++ G YP EM++ILG+ LP FS +D+E LK  G DFIGI
Sbjct  281   LEDKLAAERAISFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKKSGLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T + +L VYP GME++
Sbjct  341   NHYTSFYSKDCMFSACEPG-PGTSRTEGFALRTAQKDGVFIGEPTAVDWLYVYPQGMEKI  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +   PNS  EE+L+D KRV+++  YL+A+   IRKGADV
Sbjct  400   VTYVKDRYNNTPIFITENGFGEVENPNSCNEELLNDVKRVEYMKSYLNALAEGIRKGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSG   R GL++ D AT KRT +LSA WYKQF++ NQ V + + +
Sbjct  460   RGYVVWSLLDNFEWTSGLRVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NQTVQTHLPT  517



>ref|XP_008364100.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 47-like [Malus 
domestica]
Length=518

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 362/479 (76%), Gaps = 9/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FG +SSSYQ+EG +L+DGKGLSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  41    NFLFGXASSSYQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLPKGR G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQE
Sbjct  101   NYIGVNTYRFSISWARVLPKGRFGKVNRAGINHYDKFIDALLRRGIHPFVTLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP++QE++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  161   LEDRYGAWLSPQLQEDFVYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGMYPPARCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAV++YR  YQ++Q G IGI M   W+ P++NS
Sbjct  221   RPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYQKKQRGSIGIVMNALWYEPISNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK+AAERA SF  NWFLDP++ G YP EM++ILG+ LP FS +D+E LK  G DFIGI
Sbjct  281   LEDKSAAERAMSFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKKNGLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
              HYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T + +L VYP GME++
Sbjct  341   KHYTSFYSKDCMFSACEPG-PGXSRTEGFALRTAQKDGVFIGEPTSVDWLYVYPQGMEKI  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +   PNS  EE+L+D KRV+++  YLHA+   IRKGADV
Sbjct  400   VTYVKDRYNNTPIFITENGFGEVGNPNSCNEELLNDVKRVEYMRSYLHALAEGIRKGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSGYT R GL++ D AT KRT +LSA WYKQF++ N  V + + +
Sbjct  460   RGYLVWSLLDNFEWTSGYTVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NHTVQTHLPT  517



>gb|KHG29723.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=529

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/483 (59%), Positives = 360/483 (75%), Gaps = 14/483 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGN-ILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEGGYL+DGKGL+NWDV+SH+PGN I+DGSNGD+A D Y  Y ED DL
Sbjct  47    NFLFGTASSAYQYEGGYLADGKGLNNWDVYSHKPGNNIVDGSNGDIAVDYYHRYLEDIDL  106

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GIK+Y N+ID LLLKGIEPF+T+ H D PQ
Sbjct  107   MHSLGVNSYRFSISWARILPKGRFGEINEAGIKFYNNVIDGLLLKGIEPFITLTHIDFPQ  166

Query  1388  ELQDRYQGWLSPEMQ----EEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP  1221
             EL+DRY  WLSPE Q    E++AY+AD+CFK  GD+VKYW+TFN+P+      Y    +P
Sbjct  167   ELEDRYGSWLSPESQLTTLEDFAYYADICFKSFGDRVKYWVTFNQPDSQVKFGYLTGTFP  226

Query  1220  -------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFL  1062
                     GNC+ G++ K+ FI +HN+ILAH AAV++YR  YQ+ QGG IGI +   W+ 
Sbjct  227   PSHCSKPFGNCTYGDSEKEPFIASHNIILAHIAAVHVYRTKYQETQGGSIGIVLNGAWYE  286

Query  1061  PMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGS  882
             P++NS VDK AAERA SF  NWFL+PI+YG YP++M++ILGS LPEFS+T+ +KLK G  
Sbjct  287   PISNSLVDKLAAERARSFTINWFLEPILYGRYPRQMQNILGSILPEFSATEKQKLKQG-L  345

Query  881   DFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPP  702
             DFIGINHYT+YY QDC++S C+P   G ++ EG+  QS  KNG  IGE T L    VYP 
Sbjct  346   DFIGINHYTSYYVQDCMFSACEPG-PGTSKMEGYCAQSSQKNGTPIGEPTELAGKNVYPE  404

Query  701   GMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             G+E++VTY K ++ +IP+ +TE GY D   PNS+ E  LHD KRV++ A YL A+ TAIR
Sbjct  405   GIEKIVTYLKNRYHNIPIIITENGYGDMNKPNSTTEARLHDEKRVEYFARYLDALSTAIR  464

Query  521   KGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             KGADVRGYFIWSL DNFEW +GYT R GL+  D  T KRTPK SA WYK FI+++   + 
Sbjct  465   KGADVRGYFIWSLLDNFEWNNGYTVRYGLHHVDYETLKRTPKSSATWYKNFISQHMVKEP  524

Query  341   KMQ  333
             K++
Sbjct  525   KVE  527



>ref|XP_010057964.1| PREDICTED: beta-glucosidase 46 isoform X3 [Eucalyptus grandis]
Length=523

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/470 (60%), Positives = 355/470 (76%), Gaps = 9/470 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG Y SDGKGL+NWDVF+H+PGNI+DGS GD+A D Y  Y ED  L+
Sbjct  39    NFLFGTASSSYQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLM  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQE
Sbjct  99    ESLGVNSYRFSISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY GWLSP+ QE++ YFAD+CF++ GD+VKYW+TFNEPN+ A  AYR+  +      
Sbjct  159   LEDRYGGWLSPKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFPPARCS  218

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++  + FIVAHNMIL+HA AVNIYR NYQ++QGG IGI +   WF P++NS
Sbjct  219   APFGNCTLGDSEMEPFIVAHNMILSHATAVNIYRTNYQKEQGGIIGIVIHAAWFEPISNS  278

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  +WFLDPI++G YP EM +ILGS LPEFS +D EKLK  G DFIGI
Sbjct  279   LADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK-GLDFIGI  337

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY QDC+ S C+P   G T+ EG+  QS  KNG  IG+ T L +L VYP GME +
Sbjct  338   NHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPTDLEWLNVYPQGMEYM  396

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+++TE GY +        E+ L D KRV+++A +L A+ +A+RKGADV
Sbjct  397   VTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGADV  456

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF WSL DNFEW  GYT+R GL+  +  T KRTPKLSA WYKQFIA++
Sbjct  457   RGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  506



>ref|XP_008384039.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Malus domestica]
Length=518

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 361/479 (75%), Gaps = 9/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YL+DGK LSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  41    NFLFGTASSSYQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQE
Sbjct  101   NYIGVNTYRFSISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLS ++Q+++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  161   LEDRYGAWLSSQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYPPARCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAV++YR  Y ++QGG IGI M   W+ P+++S
Sbjct  221   SPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYHKKQGGSIGIVMNAVWYEPISSS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  NWFLDPI+ G YP EM+++LGS LP FS +D+E LK  G DFIGI
Sbjct  281   LEDRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKMNGLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T +  L VYP GME++
Sbjct  341   NHYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKM  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +   PNSS EE+L+D KRV++L  YLHA+   IRKGADV
Sbjct  400   VTYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIRKGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSGYT R GL+  D AT KR  +LSA WYKQF++ N  V + + +
Sbjct  460   RGYLVWSLLDNFEWTSGYTVRFGLHHVDYATLKRNQRLSAAWYKQFVS-NHTVQTHLPT  517



>ref|XP_008224797.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
 ref|XP_008224798.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
Length=519

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/470 (56%), Positives = 359/470 (76%), Gaps = 8/470 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGL+NWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  42    NFLFGTASSSYQFEGAFLNDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             + +GVN+++FSISW+RVLPKGR G +N  GI +Y   I++LL +GI+PFVT+ HYD+PQE
Sbjct  102   SYIGVNTYRFSISWARVLPKGRFGEVNRAGIDHYNKFINTLLHRGIQPFVTLTHYDIPQE  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+D Y  WLSP++QE++ ++A++CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  162   LEDIYGAWLSPKVQEDFKHYANICFKFFGDRVKYWVTFNEPNVAVIHGYRSGIYPPSRCS  221

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ K+ FI AHN+IL+HAAAVNIYR  YQ++QGG IG+ M   WF P++NS
Sbjct  222   SPFGNCTRGDSEKEPFIAAHNIILSHAAAVNIYRTKYQKKQGGSIGMVMNAVWFEPISNS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NW LDPI++G YP EM +ILG+ LP FS +D+E L+    DFIGI
Sbjct  282   LEDKLAAERAQSFYMNWLLDPIVHGRYPAEMHEILGADLPIFSESDVEMLRKNRLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y +DC++S C+P   G +R EGF  Q+  K+G F+GE T + +L VYP GM+ +
Sbjct  342   NHYTSFYVKDCIFSACEPG-PGASRTEGFTLQTAEKDGVFLGEPTSVDWLYVYPQGMDNI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +T   NS+ EE+L+D KR +++  YLHA+  A+RKGADV
Sbjct  401   VTYVKDRYNNTPIFITENGFGETEISNSTHEELLNDAKRAEYMRSYLHALAEAMRKGADV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF+WSL DNFEWTSGYT R GL+  D AT KRT +LSA WYK+FI+ +
Sbjct  461   RGYFVWSLLDNFEWTSGYTVRFGLHHVDYATLKRTQRLSAAWYKKFISNH  510



>gb|KHG29721.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=536

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/481 (58%), Positives = 357/481 (74%), Gaps = 10/481 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGN-ILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEGGYL+DGKGL+NWDV+SH+PGN I+DGSN D+A D Y  Y ED DL
Sbjct  49    NFLFGTASSAYQYEGGYLADGKGLNNWDVYSHKPGNLIVDGSNADIAVDHYHRYLEDIDL  108

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPFVT+ H D PQ
Sbjct  109   MHSLGVNSYRFSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFVTLTHIDFPQ  168

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL+DRY  WLSPE QE++AYFAD+CFK  GD+VKYW+TFNEP+      YR   +     
Sbjct  169   ELEDRYGSWLSPESQEDFAYFADICFKSFGDRVKYWVTFNEPDFQVKYGYRLGTFPPSRC  228

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNC+ G++ K+ FI AHN+ILAH AAV++YR  YQ+ Q   IGI +   W+ P++N
Sbjct  229   SRPFGNCTYGDSEKEPFIAAHNIILAHIAAVHVYRTKYQESQRASIGIVLHCMWYEPISN  288

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF  NWFL+PI+YG YP+EM++ILGS LPEF++++ +KL   G DFIG
Sbjct  289   SVADKLAAERAQSFSINWFLEPIIYGRYPREMQNILGSILPEFTTSEKQKLNQ-GLDFIG  347

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHYT++Y +DC++S C+P  SG ++ EGF  QS  KNG  IGE T L +L VYP GM++
Sbjct  348   VNHYTSFYVKDCMFSACEPG-SGTSKTEGFWAQSSQKNGIPIGEPTELSWLNVYPQGMDK  406

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY K K+ +IP+ +TE GY D    +S+I+E+LHD KR+ F+  +L A+ TAI+KGA+
Sbjct  407   IVTYLKHKYHNIPMIITENGYGDVIKADSTIDELLHDEKRIDFMDRHLDALSTAIKKGAN  466

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             V+GYF WSL DNFEW SGYT R GL+  D  T  R PK+SA WYK  IA+++K     Q 
Sbjct  467   VKGYFAWSLLDNFEWNSGYTVRFGLHHVDHKTLMRRPKMSATWYKNLIAEHRKCKGPDQQ  526

Query  329   R  327
             +
Sbjct  527   Q  527



>ref|XP_010057961.1| PREDICTED: beta-glucosidase 46 isoform X1 [Eucalyptus grandis]
 ref|XP_010057963.1| PREDICTED: beta-glucosidase 46 isoform X2 [Eucalyptus grandis]
Length=524

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 355/471 (75%), Gaps = 10/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG Y SDGKGL+NWDVF+H+PGNI+DGS GD+A D Y  Y ED  L+
Sbjct  39    NFLFGTASSSYQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLM  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQE
Sbjct  99    ESLGVNSYRFSISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY GWLSP+ QE++ YFAD+CF++ GD+VKYW+TFNEPN+ A  AYR+  +      
Sbjct  159   LEDRYGGWLSPKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFPPARCS  218

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++  + FIVAHNMIL+HA AVNIYR NYQ++QGG IGI +   WF P++NS
Sbjct  219   APFGNCTLGDSEMEPFIVAHNMILSHATAVNIYRTNYQKEQGGIIGIVIHAAWFEPISNS  278

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  +WFLDPI++G YP EM +ILGS LPEFS +D EKLK  G DFIGI
Sbjct  279   LADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK-GLDFIGI  337

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGE-LTGLPYLAVYPPGMER  690
             NHYT+YY QDC+ S C+P   G T+ EG+  QS  KNG  IG+  T L +L VYP GME 
Sbjct  338   NHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPQTDLEWLNVYPQGMEY  396

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE++ + P+++TE GY +        E+ L D KRV+++A +L A+ +A+RKGAD
Sbjct  397   MVTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGAD  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             VRGYF WSL DNFEW  GYT+R GL+  +  T KRTPKLSA WYKQFIA++
Sbjct  457   VRGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  507



>ref|XP_009363823.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Pyrus x bretschneideri]
Length=497

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 362/479 (76%), Gaps = 10/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGLSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  21    NFLFGTASSSYQFEGAFLTDGKGLSNWDVFTHKPGHISDGTNGDIADDQYHLYLEDLDLM  80

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLP+ R G +N  GI +Y   ID+LL +GI PFVT+ HYD+PQE
Sbjct  81    NYIGVNTYRFSISWARVLPR-RFGKVNRAGINHYNKFIDALLRRGIHPFVTLTHYDIPQE  139

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLSP++QE++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++P     
Sbjct  140   LEDRYGAWLSPQLQEDFLYYANTCFKFFGDRVKYWVTFNEPNVVVIRGYRSGVYPPARCS  199

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ ++ FI AHN+IL+HAAAV++YR  YQ++QGG IGI M   W+ P++NS
Sbjct  200   RPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYQKKQGGSIGIVMNALWYEPISNS  259

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDP++ G YP EM++ILG+ LP FS +D+E LK  G DFIGI
Sbjct  260   LEDKLAAERAISFYMNWFLDPVLQGKYPAEMREILGADLPAFSKSDVEMLKKSGLDFIGI  319

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T + +L VYP GME++
Sbjct  320   NHYTSFYSKDCMFSACEPG-PGTSRTEGFALRTAQKDGVFIGEPTAVDWLYVYPQGMEKI  378

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +   PNS  EE+L+D KRV+++  YL+A+   IRKGADV
Sbjct  379   VTYVKDRYNNTPIFITENGFGEVENPNSCNEELLNDVKRVEYMKSYLNALAEGIRKGADV  438

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSG   R GL++ D AT KRT +LSA WYKQF++ NQ V + + +
Sbjct  439   RGYVVWSLLDNFEWTSGLRVRFGLHRVDYATLKRTQRLSAAWYKQFVS-NQTVQTHLPT  496



>gb|KCW75357.1| hypothetical protein EUGRSUZ_E04103 [Eucalyptus grandis]
Length=524

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 354/471 (75%), Gaps = 10/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG Y SDGKGL+NWDVF+H+PGNI+DGS GD+A D Y  Y ED  L+
Sbjct  39    NFLFGTASSSYQFEGAYKSDGKGLNNWDVFAHEPGNIIDGSTGDIAVDHYHRYLEDIRLM  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR   IN+ GI YY  LI+SLL KGI+PFVT+ H+D+PQE
Sbjct  99    ESLGVNSYRFSISWARILPKGRFAEINMAGIHYYNRLINSLLQKGIQPFVTLTHFDIPQE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY GWLSP+ QE++ YFAD+CF++ GD+VKYW+TFNEPN+ A  AYR+  +      
Sbjct  159   LEDRYGGWLSPKSQEDFGYFADICFRYFGDRVKYWVTFNEPNIQATLAYRWGEFPPARCS  218

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQ-QQQGGEIGIAMLFTWFLPMTN  1050
              P GNC+ G++  + FIVAHNMIL+HA AVNIYR NYQ  +QGG IGI +   WF P++N
Sbjct  219   APFGNCTLGDSEMEPFIVAHNMILSHATAVNIYRTNYQHHEQGGIIGIVIHAAWFEPISN  278

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  D+ AAERA SF  +WFLDPI++G YP EM +ILGS LPEFS +D EKLK  G DFIG
Sbjct  279   SLADELAAERAMSFFMSWFLDPIIFGKYPAEMIEILGSILPEFSRSDQEKLKK-GLDFIG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+YY QDC+ S C+P   G T+ EG+  QS  KNG  IG+ T L +L VYP GME 
Sbjct  338   INHYTSYYVQDCILSICEPG-KGITKTEGYYKQSSEKNGVPIGQPTDLEWLNVYPQGMEY  396

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE++ + P+++TE GY +        E+ L D KRV+++A +L A+ +A+RKGAD
Sbjct  397   MVTYVKERYNNTPMFITENGYGEKDDLKLKDEKPLEDLKRVEYMASHLSALLSAVRKGAD  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             VRGYF WSL DNFEW  GYT+R GL+  +  T KRTPKLSA WYKQFIA++
Sbjct  457   VRGYFAWSLLDNFEWQFGYTERFGLHHVNFTTLKRTPKLSASWYKQFIAEH  507



>ref|XP_004293271.1| PREDICTED: beta-glucosidase 47-like [Fragaria vesca subsp. vesca]
Length=514

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 356/471 (76%), Gaps = 10/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGK L+NWDVFSH+PGNILDG+NGD+A DQY LY+ED DL+
Sbjct  37    NFLFGTASSSYQFEGAFLNDGKSLNNWDVFSHKPGNILDGTNGDIAVDQYHLYQEDLDLM  96

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LPKGR G +N  GI +Y  LID+LLL+GI+PFVT+ HYD+PQE
Sbjct  97    DYIGVNSYRFSISWARILPKGRFGKVNRAGIDHYNKLIDALLLRGIQPFVTLTHYDIPQE  156

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP +QE++ Y+AD+CFK  GD+VKYW TFNEPN+ AI  YR  ++      
Sbjct  157   LEDRYGAWLSPLLQEDFRYYADICFKFFGDRVKYWSTFNEPNVLAIRGYRSGIYPPSHCS  216

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC  G++ ++ FI AHN+IL+HAAAVN+YR  YQ++Q G IGI M   W+ P+++S
Sbjct  217   LPFGNCISGDSEREPFIAAHNIILSHAAAVNVYRTKYQKKQEGSIGIVMNAVWYEPISSS  276

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDPI++G YP EM ++LG  LPEFS  D+E LK  G DFIGI
Sbjct  277   LEDKLAAERAQSFYINWFLDPIVHGRYPAEMHELLGDDLPEFSMFDMEMLK-NGLDFIGI  335

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC+ S C+P   G +R EG+  ++  K+G +IGE T + +L V+P GME++
Sbjct  336   NHYTSFYSKDCMISPCEPG-PGVSRTEGYALRTAQKDGIYIGEPTAVDWLYVHPQGMEKM  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR-KGAD  510
             VTY KE++ + P+++TE GY +    N++ EE  +D KRV+++  YL A+   +R KGAD
Sbjct  395   VTYIKERYNNTPMFITENGYAEEANSNTTNEEQFNDVKRVEYMRSYLQALADTMRTKGAD  454

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             VRGYF+WSL DNFEWTSGYT + GL+  D  T KRTP+LSA WY+QFI  N
Sbjct  455   VRGYFVWSLLDNFEWTSGYTVQFGLHHVDNVTLKRTPRLSADWYRQFIVNN  505



>ref|XP_002305594.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86105.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=504

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/477 (58%), Positives = 357/477 (75%), Gaps = 11/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FG +SSSYQ+EG YLSDGKGLSNWD+ +H PG I+DGSNGD+AADQY LY ED DL+
Sbjct  32    NFLFGMASSSYQFEGSYLSDGKGLSNWDMHTHTPGKIIDGSNGDIAADQYHLYPEDIDLM  91

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGV+S++FSISW+R+LP+GR G+IN  GI YY  LIDSLLLKGI+PFVT+ HYD+P+E
Sbjct  92    DSLGVSSYRFSISWARILPRGRFGDINKAGISYYNKLIDSLLLKGIQPFVTLVHYDIPEE  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L++RY GWLSP  QE++ Y+AD+CFK+ GD+VKYW TFNEPN+  I +YR   +      
Sbjct  152   LEERYGGWLSPRCQEDFGYYADICFKNFGDRVKYWTTFNEPNIQTIKSYRSGEYPPCHCS  211

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ K+ FI AHNMILAHA AV++YR  YQ++QGG IGI +   WF  ++NS
Sbjct  212   SPFGNCTHGDSEKEPFIAAHNMILAHATAVDVYRTKYQKEQGGNIGIVLDCIWFEQISNS  271

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AA+RA  F  NWFLDPI++G+YP EM  ILGS LP+FSS D EKLK  G DFIGI
Sbjct  272   TADKLAADRAQDFFLNWFLDPIIFGNYPAEMSKILGSTLPKFSSNDKEKLK-NGLDFIGI  330

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y QDC++S C+P  +G +R EG   +S  K+G  IG  T + +L  YP GME++
Sbjct  331   NHYTSEYVQDCIFSVCEPG-TGASRTEGLARRSQEKDGVPIGIPTDVDWLHFYPQGMEKM  389

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+ +TE GY     PN +I  V HD +RV+F+++Y  ++ TA+ KGADV
Sbjct  390   VTYIKKRYNNKPMIITENGYGQQNNPNLTI--VCHDIERVEFMSNYWDSLLTAMEKGADV  447

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WSL DNFEWT GYT+R GLY  D  T KRTPKLSA W+K+FIA+ +   S+M
Sbjct  448   RGYFAWSLLDNFEWTYGYTQRYGLYHVDFTTLKRTPKLSAAWFKEFIARYKVDKSQM  504



>ref|XP_008384043.1| PREDICTED: beta-glucosidase 47-like [Malus domestica]
Length=522

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 353/479 (74%), Gaps = 8/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SSSYQYEG YL+DGK L+NWDVF+H+P  I DG+NGD+A DQY LY ED DL+
Sbjct  45    DFLFGTASSSYQYEGAYLNDGKALNNWDVFTHEPDRISDGTNGDIAVDQYHLYMEDLDLM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISW+RVLPKGR G +N  GI +Y   ID LLL+GI+P+VT+ HYD+PQE
Sbjct  105   NYLGVNSYRFSISWARVLPKGRFGRVNRAGIAHYNKFIDELLLRGIQPYVTLTHYDIPQE  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP++Q ++ ++A+ CFK  GD+VKYW TFNEPN+     YR   +      
Sbjct  165   LEDRYGAWLSPQVQADFKHYANTCFKFFGDRVKYWATFNEPNVAVPNGYRLGTYPPARCS  224

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAVN+YR  YQ+ QGG IGI M   WF P++NS
Sbjct  225   IPFGNCTSGDSEREPFIAAHNIILSHAAAVNVYRTKYQKIQGGSIGIVMNAPWFEPISNS  284

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDPI+ G YP EM+++LG+ LP FS +D+E LK  G DFIG+
Sbjct  285   LEDKLAAERAISFYMNWFLDPIVLGRYPAEMQELLGADLPAFSKSDVEMLKKTGLDFIGL  344

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y++DC++S C+ S +G +R EG+  ++  K+G FIGE T + +L VYP GME++
Sbjct  345   NHYTSCYSKDCMFSVCE-SGTGASRTEGYALRTFEKDGVFIGEPTTIDWLYVYPQGMEKI  403

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+++TE G+ +    NSS  E+LHD KR++++  YL A+  A+RKGADV
Sbjct  404   VTYVKERYNNTPMFITENGFGEIENSNSSSAELLHDVKRLEYMGSYLQALAKAMRKGADV  463

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSGYT R GLY+ D  T KRT +LSA WYKQFI+ +    S   S
Sbjct  464   RGYLVWSLLDNFEWTSGYTIRFGLYRVDYTTLKRTQRLSAAWYKQFISNHTVQASSTSS  522



>ref|XP_011037693.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=516

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 356/477 (75%), Gaps = 11/477 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FG +SSSYQ+EG YLSDGKGLSNWD+ +H PG I+DGSNGD+AADQY LY ED DL+
Sbjct  44    NFLFGMASSSYQFEGSYLSDGKGLSNWDIHTHTPGKIIDGSNGDIAADQYHLYPEDTDLM  103

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGV+S++FSISW+R+LP+GR G+IN  GI YY  LIDSLLLKGI+PFVT+ HYD+P+E
Sbjct  104   DSLGVSSYRFSISWARILPRGRFGDINKVGISYYNKLIDSLLLKGIQPFVTLVHYDIPEE  163

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L++RY GWLSP  QE++ Y+AD+CFK+ GD+VKYW TFNEPN+  I +YR   +      
Sbjct  164   LEERYGGWLSPRCQEDFGYYADICFKNFGDRVKYWTTFNEPNIQTIKSYRSGEYPPCRCS  223

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ K+ FI AHNMILAHA AV++YR  YQ++QGG IGI +   WF  ++NS
Sbjct  224   SPFGNCTHGDSEKEPFIAAHNMILAHATAVDVYRTKYQKEQGGSIGIVLDCIWFEQISNS  283

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AA+RA  F  NWFLDPI++G+YP EM  ILGS LP+FSS D EKLK  G DFIGI
Sbjct  284   TADKLAADRAQDFFLNWFLDPIIFGNYPAEMSKILGSTLPKFSSNDKEKLK-NGLDFIGI  342

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y QDC++S C+P  +G +R EG   +S  K+G  IG  T + +L  YP GME++
Sbjct  343   NHYTSEYVQDCIFSVCEPG-TGASRTEGLARRSQEKDGAPIGIPTDVDWLHFYPQGMEKM  401

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+ +TE GY     PN +I  V HD +RV+F++ Y  ++ +A+ KGADV
Sbjct  402   VTYIKKRYNNKPMIITENGYGQLNNPNLTI--VCHDIERVEFMSSYWDSLLSAMEKGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WSL DNFEWT GYT+R GLY  D  T KRTPKLSA W+K+FIA+ +   S+M
Sbjct  460   RGYFSWSLLDNFEWTYGYTQRYGLYHVDFTTLKRTPKLSATWFKEFIARYKVDKSQM  516



>ref|XP_008384040.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Malus domestica]
Length=497

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 360/479 (75%), Gaps = 10/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YL+DGK LSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  21    NFLFGTASSSYQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLM  80

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLP+ R G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQE
Sbjct  81    NYIGVNTYRFSISWARVLPR-RFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQE  139

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLS ++Q+++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++P     
Sbjct  140   LEDRYGAWLSSQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYPPARCS  199

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ ++ FI AHN+IL+HAAAV++YR  Y ++QGG IGI M   W+ P+++S
Sbjct  200   SPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYHKKQGGSIGIVMNAVWYEPISSS  259

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  NWFLDPI+ G YP EM+++LGS LP FS +D+E LK  G DFIGI
Sbjct  260   LEDRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKMNGLDFIGI  319

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T +  L VYP GME++
Sbjct  320   NHYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKM  378

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +   PNSS EE+L+D KRV++L  YLHA+   IRKGADV
Sbjct  379   VTYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIRKGADV  438

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGY +WSL DNFEWTSGYT R GL+  D AT KR  +LSA WYKQF++ N  V + + +
Sbjct  439   RGYLVWSLLDNFEWTSGYTVRFGLHHVDYATLKRNQRLSAAWYKQFVS-NHTVQTHLPT  496



>ref|XP_010267720.1| PREDICTED: beta-glucosidase 46 isoform X3 [Nelumbo nucifera]
Length=522

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 351/475 (74%), Gaps = 9/475 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SSSYQ+EG +LSDGKGL+NWDVFSH+PGNI+DGSNGD+A D Y  Y ED +L+
Sbjct  40    DFLFGTASSSYQFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELM  99

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQE
Sbjct  100   QSLGVNSYRFSISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQE  159

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLSP++Q+++ Y ADVCF+  GD+VKYW TFNEPN+ A+  YR  + P     
Sbjct  160   LEDRYGAWLSPDIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHPPSRCS  219

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC  G++  + FIVAHN+IL+HA AVNIYR  YQ++QGG IGI M   WF P+TNS
Sbjct  220   ASFGNCLHGDSKTEPFIVAHNIILSHAIAVNIYRTRYQKKQGGSIGIVMNAIWFEPLTNS  279

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  NWFLDPI++G YP EM +ILGS LPEFS  + E L+  G DFIGI
Sbjct  280   PADRLAAERAQSFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT-GLDFIGI  338

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y +DC+ S C P  +G ++ EG   ++  K+G  IGE TG+ +  V+P GME++
Sbjct  339   NHYTSLYVKDCISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKI  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y KE++ + P+++TE GY +    + S E   +D KRV +L  YL A+  A+RKGADV
Sbjct  398   IIYVKERYNNTPIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             RGYFIWSL DNFEW  GYTKR GLY  D  T +RTPKLSA WYKQFIA+ + + +
Sbjct  458   RGYFIWSLLDNFEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKA  512



>ref|XP_006468000.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Citrus sinensis]
Length=519

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/471 (57%), Positives = 358/471 (76%), Gaps = 9/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SSSYQYEG +L+DGKGL+NWD F+H+PGNI+DGSNGDVA D Y  Y +D DL+
Sbjct  42    SFLFGTASSSYQYEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISW+RVLPKGR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQE
Sbjct  102   DYLGVNSYRFSISWARVLPKGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQE  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L DRY  WLS E+QE++ Y+AD+CFK+ GD+VKYW TFNEPN+  I  Y+  ++P     
Sbjct  162   LADRYGPWLSREVQEDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYPPSRCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ K+ FI AHN+IL+HAAAV IYR  YQ++Q G IGI M   W  PM+NS
Sbjct  222   SLFGNCTNGDSEKEPFIAAHNIILSHAAAVKIYRTKYQKEQEGNIGIVMNTLWLEPMSNS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA +F  NWFLDPI++G YPKEM +ILGS LP  S  DLEKLK  G DFIGI
Sbjct  282   LGDKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSLSKYDLEKLK-NGLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+Y+++Y +DC++S C+P   GN++ EG + ++  +NG  IGE T + +L VYP GM  +
Sbjct  341   NYYSSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGEPTDVDWLFVYPQGMSEI  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ +IP+Y+TE G+ +   P++SIE++L+DT+RV++++++L ++  A+R GADV
Sbjct  400   VTYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW  GYT R GL+  D AT KRT +LSA WYKQ+IAK+ 
Sbjct  460   RGYFAWSLLDNFEWNDGYTIRFGLHHVDYATLKRTKRLSANWYKQYIAKHM  510



>ref|XP_002304951.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE85462.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 351/473 (74%), Gaps = 9/473 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLS GKGLSNWDVF+H+PG I+DG+NGD+A D Y  Y ED DL+
Sbjct  41    NFLFGTASSSYQFEGAYLSHGKGLSNWDVFTHKPGTIMDGTNGDIAVDHYHRYPEDLDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++ SISW+R+LPKGR G  N  GI +Y   I+ LL +GI+PFVT+ HYD+PQE
Sbjct  101   EYIGVNSYRVSISWARILPKGRFGTANRAGINHYNKFINELLRRGIQPFVTLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLSPE+QE++ Y+AD+CFK  GD+VKYW TFNEPN+ AI  YR  ++P     
Sbjct  161   LEDRYGAWLSPEIQEDFKYYADICFKSFGDRVKYWTTFNEPNVAAIRGYRSGIFPPSRCS  220

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                G CS G++ ++ FI AHNMIL+HAAAVN+YR  YQ++QGG IGI M   W  P+++S
Sbjct  221   GTFGYCSSGDSEREPFIAAHNMILSHAAAVNVYRTKYQKKQGGSIGIVMNAIWHEPISDS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK A ERA++F  NWFLDPI+ G YP EM++ LGS LP FS  +LEKLK+ G DFIGI
Sbjct  281   LEDKLAVERANAFYMNWFLDPIILGKYPTEMRETLGSDLPVFSKYELEKLKS-GVDFIGI  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT++Y +DC++STC+    G ++ EG   ++  K+G FIG+ T L +L VYP GME++
Sbjct  340   NQYTSFYVKDCMFSTCEQG-PGVSKTEGLYLRTAQKDGFFIGQPTALDWLHVYPQGMEKL  398

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ +IP+Y+TE GYCD    N + + VL D +RV++++ YL A+ TA+RKGADV
Sbjct  399   VTYFKDRYNNIPMYITENGYCDEENVNVTTKAVLKDVQRVEYMSSYLDALETAVRKGADV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             RGYF WSL DNFEWTSGYT R GLY  D +T KRT KLSA WYK +IA  + V
Sbjct  459   RGYFAWSLLDNFEWTSGYTIRFGLYHVDFSTLKRTRKLSATWYKDYIANYKAV  511



>emb|CDO99725.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 356/475 (75%), Gaps = 9/475 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF +GT+SSSYQ+EG +LSDGKGLSNWD+FSH+ GNILDGSNGD+A D Y  Y ED DL+
Sbjct  24    NFLYGTASSSYQFEGAFLSDGKGLSNWDIFSHEAGNILDGSNGDIAVDHYHRYLEDLDLM  83

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISW+RVLPKGR GN+N+ GIK+Y  LID+LL KGI PF ++ HYD+PQE
Sbjct  84    EDLGVNSYRFSISWARVLPKGRFGNVNMAGIKHYNKLIDALLDKGISPFASLTHYDIPQE  143

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY  WLSP++Q+++ Y+AD+CFK+ GD+VKYW+TFNEPN+ AI  YR  ++P     
Sbjct  144   LEERYGAWLSPKVQDDFRYYADICFKYFGDRVKYWVTFNEPNVVAIRGYRSGIYPPSRCS  203

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI AHNMIL+HAAAV  YR  Y+++QGG IGI M   WF P TNS
Sbjct  204   ASFGNCSTGNSEEEPFIAAHNMILSHAAAVRTYRTKYKEKQGGSIGIVMNAIWFEPFTNS  263

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + DK AAERA SF  NWFLDPI+ G YP EM+ ILGS LP F   ++ ++K  G DFIGI
Sbjct  264   SEDKLAAERAQSFFLNWFLDPIICGRYPAEMQQILGSQLPNFQRQEVSEIKL-GLDFIGI  322

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++YA+DC+YSTC+    G +R EG+  ++  K+G  IGE T + +L V+P GM ++
Sbjct  323   NHYTSFYAKDCIYSTCEQG-PGVSRSEGYYLRTAFKDGVPIGETTAVDWLYVHPQGMYKI  381

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K+++ + P+++TE GY +    NSS+++ + D +RV+++  YL ++  AIR GA+V
Sbjct  382   VMYIKDRYNNTPMFITENGYGELNKLNSSVKDFIKDYRRVEYMNSYLASLALAIRNGANV  441

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             RGYF WSL DNFEWTSGYT R GL+  D AT +RTPKLSA W+KQ I+ ++ + S
Sbjct  442   RGYFAWSLLDNFEWTSGYTIRFGLHHVDFATLERTPKLSADWFKQLISYHRSLSS  496



>ref|XP_004486131.1| PREDICTED: beta-glucosidase 47-like [Cicer arietinum]
Length=496

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 355/471 (75%), Gaps = 9/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG + SDGKGLSNWDVF+H+PG I+DG+NGDVA D Y  YKED DL+
Sbjct  21    NFLFGTASSSYQFEGAFSSDGKGLSNWDVFTHKPGTIIDGTNGDVAVDHYHRYKEDVDLM  80

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FS+SW+R+LPKGR G++N  GI YY  LID+LL +GIEPFVTI HYD+PQ 
Sbjct  81    EYIGVNSYRFSLSWARILPKGRFGHLNRAGIDYYNRLIDALLNRGIEPFVTITHYDIPQA  140

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLSP++QEE+ Y+AD+CFK+ GD+VK+W+TFNEPN+  I  YR  ++P     
Sbjct  141   LEDRYGGWLSPKIQEEFRYYADICFKYFGDRVKHWVTFNEPNVAVICGYRTGVYPPSHCS  200

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI A N+IL+H +AV++YR  YQ+ QGG+IGI M   W+ P +NS
Sbjct  201   GSFGNCSYGDSEREPFIAASNLILSHVSAVDVYRNKYQKNQGGKIGIVMNAVWYEPFSNS  260

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + DK AAERA SF  NWFLDPI+ G YPKEM DILG  L  FS  DLEKLK+ G DF+GI
Sbjct  261   SEDKLAAERAQSFNMNWFLDPIILGKYPKEMHDILGPDLLPFSKYDLEKLKS-GLDFVGI  319

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++STC+    G+++ EGF   S   NG  IGE T L +L V+P GME++
Sbjct  320   NHYTSYYVKDCIFSTCEQG-KGSSKTEGFALTSPQMNGLNIGEPTALAWLYVHPQGMEKI  378

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ +IP+++TE G+  T     + ++VL+D KRV++L+ YL ++ TAIRKGADV
Sbjct  379   VTYIKDRYNNIPMFITENGFGMTENSYPTSKDVLNDVKRVEYLSGYLDSLATAIRKGADV  438

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF+WSL DNFEW  GY+ R GL+  D  T  RTP++SA WYK FI +++
Sbjct  439   RGYFLWSLLDNFEWNHGYSIRFGLHHVDFETLNRTPRVSAFWYKNFIVEHK  489



>ref|XP_011037696.1| PREDICTED: beta-glucosidase 47-like [Populus euphratica]
Length=535

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/475 (57%), Positives = 352/475 (74%), Gaps = 9/475 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLS GKGLSNWDVF+H+PG I+DG+NGDVA D Y  Y ED DL 
Sbjct  61    NFLFGTASSSYQFEGAYLSHGKGLSNWDVFTHKPGTIMDGTNGDVAVDHYHRYPEDLDLT  120

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LPKGR G  N  GI +Y   I+ LL +GI+PFVT+ HYD+PQE
Sbjct  121   EYIGVNSYRFSISWARILPKGRFGTANRAGINHYNKFINELLRRGIQPFVTLTHYDIPQE  180

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLSPE+QE++ Y+AD+CFK  GD+VKYW TFNEPN+ A   YR  ++P     
Sbjct  181   LEDRYGAWLSPEIQEDFKYYADICFKSFGDRVKYWTTFNEPNVAASRGYRSGIFPPSRCS  240

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                G CS G++ ++ FI AHNMIL+HAAAVN+YR  YQ++QGG IGI M   W  P+++S
Sbjct  241   GTFGYCSSGDSEREPFIAAHNMILSHAAAVNVYRTKYQKKQGGSIGIVMNAIWHEPISDS  300

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK A ERA++F  NWFLDPI+ G YP +M++ILGS LP FS  +LEKLK+ G+DFIGI
Sbjct  301   LEDKLAVERANAFYMNWFLDPIILGKYPTQMREILGSDLPVFSKYELEKLKS-GADFIGI  359

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT +Y +DC +STC+    G ++ EG   ++  K+G FIG+ T L +L VYP GME++
Sbjct  360   NQYTGFYVKDCAFSTCEQG-PGVSKTEGLYLRTAQKDGFFIGQPTALDWLHVYPQGMEKL  418

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ +IP+Y+TE GYC+    N + + VL D +RV++++ YL A+ TA+RKGADV
Sbjct  419   VTYFKDRYNNIPMYITENGYCEEENVNVTTKAVLKDIQRVEYMSSYLDALETAVRKGADV  478

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             RGYF WSL DNFEWTSGYT R GLY  D +T KRT KLSA WYK +IA ++ V +
Sbjct  479   RGYFAWSLLDNFEWTSGYTIRFGLYHVDFSTLKRTRKLSATWYKDYIAHHKVVRT  533



>ref|XP_008224799.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Prunus 
mume]
Length=513

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/470 (56%), Positives = 357/470 (76%), Gaps = 14/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +L+DGKGL+NWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  42    NFLFGTASSSYQFEGAFLTDGKGLNNWDVFTHKPGHISDGTNGDIAVDQYHLYLEDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             + +GV+S++FSISW+RVLPKGR G +N    + + N  D  L   I+PFVT++HYD+PQE
Sbjct  102   SYIGVHSYRFSISWARVLPKGRFGKVN----RAFLNKYDKXLR--IQPFVTLSHYDIPQE  155

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY  WLSP++QE++ Y+A+ CF+  GD+VKYW+TFNEPN+  I  YR  ++P     
Sbjct  156   LEDRYGAWLSPKVQEDFKYYANTCFEFYGDRVKYWVTFNEPNVVVIRGYRSGVYPPSRCS  215

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ GN+ K+ FI AHN+IL+HAAAVNIYR  YQ++QGG IG+ M   W+ P++NS
Sbjct  216   SPFGNCTSGNSEKEPFIAAHNIILSHAAAVNIYRTQYQKKQGGSIGMIMNAVWYEPISNS  275

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NWFLDPI++G YP EM++ILG+ LP FS +D+E L+    DFIGI
Sbjct  276   LEDKLAAERAQSFYMNWFLDPIVHGKYPAEMQEILGADLPIFSESDVEMLRKNRLDFIGI  335

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y +DC++S C+P   G +R EGF  ++  K+G F+GE T + +L VYP GM+++
Sbjct  336   NHYTSFYIKDCIFSECEPG-PGASRTEGFALRTAEKDGVFLGEPTSVDWLYVYPQGMDKI  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+  T   NS+ EE+L+D KRVK++  YLHA+  A+RKGADV
Sbjct  395   VTYVKDRYNNTPIFITENGFGKTDNSNSTNEELLNDVKRVKYMRSYLHALAEAMRKGADV  454

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF+WSL DNFEWTSGYT R GL+  D AT KRT +LSA WYKQFI+ +
Sbjct  455   RGYFVWSLLDNFEWTSGYTVRFGLHHVDYATLKRTKRLSADWYKQFISNH  504



>gb|KHG29722.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=561

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 357/506 (71%), Gaps = 35/506 (7%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGN-ILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEGGYL+DGKGL+NWDV+SH+PGN I+DGSN D+A D Y  Y ED DL
Sbjct  49    NFLFGTASSAYQYEGGYLADGKGLNNWDVYSHKPGNLIVDGSNADIAVDHYHRYLEDIDL  108

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GIK+Y NLID LLLKGIEPFVT+ H D PQ
Sbjct  109   MHSLGVNSYRFSISWARILPKGRFGEINEAGIKFYNNLIDGLLLKGIEPFVTLTHIDFPQ  168

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL+DRY  WLSPE QE++AYFAD+CFK  GD+VKYW+TFNEP+      YR   +     
Sbjct  169   ELEDRYGSWLSPESQEDFAYFADICFKSFGDRVKYWVTFNEPDFQVKYGYRLGTFPPSRC  228

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNC+ G++ K+ FI AHN+ILAH AAV++YR  YQ+ Q   IGI +   W+ P++N
Sbjct  229   SRPFGNCTYGDSEKEPFIAAHNIILAHIAAVHVYRTKYQESQRASIGIVLHCMWYEPISN  288

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF  NWFL+PI+YG YP+EM++ILGS LPEF++++ +KL   G DFIG
Sbjct  289   SVADKLAAERAQSFSINWFLEPIIYGRYPREMQNILGSILPEFTTSEKQKLNQ-GLDFIG  347

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHYT++Y +DC++S C+P  SG ++ EGF  QS  KNG  IGE T L +L VYP GM++
Sbjct  348   VNHYTSFYVKDCMFSACEPG-SGTSKTEGFWAQSSQKNGIPIGEPTELSWLNVYPQGMDK  406

Query  689   VVTYAKEKFPDIPLYVTET-------------------------GYCDTTTPNSSIEEVL  585
             +VTY K K+ +IP+ +TE                          GY D    +S+I+E+L
Sbjct  407   IVTYLKHKYHNIPMIITENGRRKTEALMHKETYLYTHNVSCFYIGYGDVIKADSTIDELL  466

Query  584   HDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKR  405
             HD KR+ F+  +L A+ TAI+KGA+V+GYF WSL DNFEW SGYT R GL+  D  T  R
Sbjct  467   HDEKRIDFMDRHLDALSTAIKKGANVKGYFAWSLLDNFEWNSGYTVRFGLHHVDHKTLMR  526

Query  404   TPKLSAKWYKQFIAKNQKVDSKMQSR  327
              PK+SA WYK  IA+++K     Q +
Sbjct  527   RPKMSATWYKNLIAEHRKCKGPDQQQ  552



>ref|XP_006468001.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Citrus sinensis]
Length=509

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/471 (56%), Positives = 351/471 (75%), Gaps = 19/471 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SSSYQYEG +L+DGKGL+NWD F+H+PGNI+DGSNGDVA D Y  Y +D DL+
Sbjct  42    SFLFGTASSSYQYEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISW+RVLPKGR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQE
Sbjct  102   DYLGVNSYRFSISWARVLPKGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQE  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L DRY  WLS E+QE++ Y+AD+CFK+ GD+VKYW TFNEPN+  I  Y+  ++P     
Sbjct  162   LADRYGPWLSREVQEDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYPPSRCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ K+ FI AHN+IL+HAAAV IYR  YQ++Q G IGI M   W  PM+NS
Sbjct  222   SLFGNCTNGDSEKEPFIAAHNIILSHAAAVKIYRTKYQKEQEGNIGIVMNTLWLEPMSNS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA +F  NWFLDPI++G YPKEM +ILGS LP  S  DLEKLK  G DFIGI
Sbjct  282   LGDKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSLSKYDLEKLK-NGLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+Y+++Y +DC++S C+P   GN++ EG + ++  +NG  IGE          P  M  +
Sbjct  341   NYYSSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGE----------PVRMSEI  389

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ +IP+Y+TE G+ +   P++SIE++L+DT+RV++++++L ++  A+R GADV
Sbjct  390   VTYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADV  449

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW  GYT R GL+  D AT KRT +LSA WYKQ+IAK+ 
Sbjct  450   RGYFAWSLLDNFEWNDGYTIRFGLHHVDYATLKRTKRLSANWYKQYIAKHM  500



>ref|XP_007026019.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
 gb|EOY28641.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
Length=540

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/442 (61%), Positives = 337/442 (76%), Gaps = 10/442 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNIL-DGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEGG++SDGKGL+NWDV+SH+PGN++ DGSNGD+A D Y  Y ED DL
Sbjct  43    NFLFGTASSAYQYEGGFMSDGKGLNNWDVYSHKPGNMIADGSNGDIAVDHYHRYLEDIDL  102

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GI +Y  LID+LLLKGI+P VT+ H D PQ
Sbjct  103   MHSLGVNSYRFSISWARILPKGRFGKINEAGINFYNKLIDALLLKGIKPLVTLTHVDFPQ  162

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL------  1227
             EL+DRY  WLSPE QE++AYFAD+CFK  GD+V+YW+TFNEP+     AYR  +      
Sbjct  163   ELEDRYGSWLSPEWQEDFAYFADICFKSFGDRVQYWVTFNEPDFQVKFAYRTGIFPPSRC  222

Query  1226  -WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
              WP GNC+ G++ K+ FI AHN+ILAH AAV+IYR  YQ+ QGG IGI +   WF  ++N
Sbjct  223   SWPFGNCTYGDSEKEPFIAAHNIILAHIAAVHIYRTKYQETQGGSIGIVLHCFWFESISN  282

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF   WFLDPI++G YP EM++ILGS LPEFS+T+ EKL   G DFIG
Sbjct  283   SLADKLAAERAQSFTMKWFLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK-GLDFIG  341

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHY++YY +DC++S C+P  +G ++ EGF GQS  KNG  IGELT L +L VYP GME+
Sbjct  342   VNHYSSYYVKDCMFSVCEPG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEK  400

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE + +IP+ +TE GY + +  NS+ EE LHD KRV++LA YL  + TAIRKGAD
Sbjct  401   IVTYLKETYHNIPMIITENGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGAD  460

Query  509   VRGYFIWSLFDNFEWTSGYTKR  444
             VRGYF+WSL DNFEW  GYT +
Sbjct  461   VRGYFVWSLLDNFEWNFGYTVK  482



>ref|XP_010267719.1| PREDICTED: beta-glucosidase 46 isoform X2 [Nelumbo nucifera]
Length=544

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 341/464 (73%), Gaps = 9/464 (2%)
 Frame = -3

Query  1712  QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  1533
             Q+EG +LSDGKGL+NWDVFSH+PGNI+DGSNGD+A D Y  Y ED +L+ SLGVNS++FS
Sbjct  73    QFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELMQSLGVNSYRFS  132

Query  1532  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSP  1353
             ISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQEL+DRY  WLSP
Sbjct  133   ISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQELEDRYGAWLSP  192

Query  1352  EMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------HGNCSEGNA  1194
             ++Q+++ Y ADVCF+  GD+VKYW TFNEPN+ A+  YR  + P        GNC  G++
Sbjct  193   DIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHPPSRCSASFGNCLHGDS  252

Query  1193  TKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAH  1014
               + FIVAHN+IL+HA AVNIYR  YQ++QGG IGI M   WF P+TNS  D+ AAERA 
Sbjct  253   KTEPFIVAHNIILSHAIAVNIYRTRYQKKQGGSIGIVMNAIWFEPLTNSPADRLAAERAQ  312

Query  1013  SFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDC  834
             SF  NWFLDPI++G YP EM +ILGS LPEFS  + E L+  G DFIGINHYT+ Y +DC
Sbjct  313   SFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT-GLDFIGINHYTSLYVKDC  371

Query  833   LYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDI  654
             + S C P  +G ++ EG   ++  K+G  IGE TG+ +  V+P GME+++ Y KE++ + 
Sbjct  372   ISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKIIIYVKERYNNT  430

Query  653   PLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDN  474
             P+++TE GY +    + S E   +D KRV +L  YL A+  A+RKGADVRGYFIWSL DN
Sbjct  431   PIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADVRGYFIWSLLDN  490

Query  473   FEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             FEW  GYTKR GLY  D  T +RTPKLSA WYKQFIA+ + + +
Sbjct  491   FEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKA  534



>gb|KEH36806.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 347/473 (73%), Gaps = 9/473 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G ILDG+NGDVA D Y  Y+ED DL+
Sbjct  43    NFLFGTASSSYQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLM  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
                GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQE
Sbjct  103   EHTGVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P     
Sbjct  163   LEERYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCS  222

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NS
Sbjct  223   DSFGNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNS  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGI
Sbjct  283   TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +
Sbjct  342   NHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ +IP+++TE G+  + +   + E  L+D KRV++L+ YL ++ TAIRKGADV
Sbjct  401   VTYIKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIRKGADV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             +GYF+WS+ DNFEW  GY+ R GL+  D AT  RTP+ SA WYK FI++++ +
Sbjct  461   KGYFVWSILDNFEWNHGYSIRFGLHHVDFATLNRTPRGSAFWYKNFISEHKNL  513



>gb|KEH36817.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/472 (57%), Positives = 346/472 (73%), Gaps = 10/472 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEG YLSDGKGLS+WDV +H+ P  I DG+NGD+A DQY  Y ED DL
Sbjct  44    NFLFGTASSAYQYEGAYLSDGKGLSDWDVVTHKTPDKIKDGTNGDIAVDQYHRYLEDIDL  103

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + ++ VNS++FSISW+RVLPKGR G +N  GI YY  LID+LLLKGIEPFVT++H+DLPQ
Sbjct  104   MEAMKVNSYRFSISWARVLPKGRFGEVNSGGISYYNRLIDALLLKGIEPFVTLSHFDLPQ  163

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL DRY+GWLSPE QE++ Y AD+CFK  GD+VKYW TFNEP+      YR  +      
Sbjct  164   ELGDRYEGWLSPESQEDFVYLADLCFKSFGDRVKYWATFNEPDYLITYGYRKGIAPPFRC  223

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCSEG++ K+ ++  HN+IL+HAAA  IYR  YQ +QGG+IGI + F W+ P++N
Sbjct  224   SKPFGNCSEGDSEKEPYLAVHNIILSHAAAAYIYRTKYQAEQGGKIGIVLHFDWYEPISN  283

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK A ERA SF +NW LDPI++G YP  M+ ILG  LP+FS+ + EKLK+ G DFIG
Sbjct  284   SMADKLATERARSFTNNWLLDPIIFGEYPPVMQKILGDILPKFSNNNKEKLKS-GLDFIG  342

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHY +YY +DC+YS C+P   G TR EG   QS  K+G  IG+ T + +  VYP GME+
Sbjct  343   INHYASYYIKDCIYSKCEPG-PGITRTEGLFQQSAEKDGVPIGKPTSIDWQYVYPQGMEK  401

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY K ++ + P+++TE GY +   PN++ E+ L+D  R  ++A +L ++  AIRKGAD
Sbjct  402   IVTYVKTRYNNTPMFITENGYGELDNPNNTEEQYLNDFDRKNYMAGHLLSLLEAIRKGAD  461

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             VRGYF WSL DNFEW  GYT R GL+  D AT KRTP+LSA WYK+FIAK++
Sbjct  462   VRGYFAWSLLDNFEWLQGYTVRFGLHHVDYATLKRTPRLSANWYKEFIAKHK  513



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/471 (58%), Positives = 344/471 (73%), Gaps = 9/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG YLSDGKGLSNWDVF+H+PG+  DGSNGDV  DQY  Y ED DL+
Sbjct  524   NFLFGTASSSYQYEGAYLSDGKGLSNWDVFTHKPGSTHDGSNGDVTVDQYHRYLEDVDLM  583

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              ++ VNS++FSISW+R+LPKGR G +NL GI YY  LI +LLL+GI+PFVT+ H D PQE
Sbjct  584   EAIKVNSYRFSISWARILPKGRFGEVNLAGIDYYNRLIHALLLRGIQPFVTLFHLDFPQE  643

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLSP+ QE++  FAD+CFK  GD+VKYW TFNEPN+     YR    P     
Sbjct  644   LEDRYGGWLSPQSQEDFVLFADICFKSFGDRVKYWTTFNEPNLQVSLGYRKGKHPPCRCS  703

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCSEG++ KD F+ AHN+IL+HAAAV+IYR  YQ +QGG+IGI +   WF P +NS
Sbjct  704   GKFGNCSEGDSEKDPFVAAHNIILSHAAAVDIYRNRYQAEQGGQIGIVVHVDWFEPYSNS  763

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NW LDPI +G YPKEM+ ILGS LP+FSS D  KL   G DFIGI
Sbjct  764   VADKLAAERAQSFSMNWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNR-GLDFIGI  822

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY  YY +DC+ S C+ S  G +  EG   Q+  K+G  IGELT   +L VYP GM++ 
Sbjct  823   NHYAGYYVKDCISSVCE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKKT  881

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             +TY K+++ + P+++TE GY +   PN++ EE L+D KR+ +++ +L+ +G +IR+GADV
Sbjct  882   LTYVKDRYNNTPMFITENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGADV  941

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW  G+T R GLY  D ATQKRTPKLSA WYK FI K++
Sbjct  942   RGYFAWSLLDNFEWLYGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKHK  992



>ref|XP_007147744.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
 gb|ESW19738.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
Length=521

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 346/469 (74%), Gaps = 11/469 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ EG YLSDGKGL+NWDVF+H+PG ++DGSNGDVA D Y  YKED DL+
Sbjct  41    NFLFGTASSSYQIEGAYLSDGKGLNNWDVFTHKPGAVIDGSNGDVADDHYHRYKEDVDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+LL +GIEPFVTI+HYD+PQE
Sbjct  101   DYIGVNSYRFSLSWARILPKGRFGKVNRAGIDYYNRLIDTLLSRGIEPFVTISHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L DRY GWLSP++ E++ Y+AD+CFK+ GD+VKYWITFNEPN+  I  YR  +WP G CS
Sbjct  161   LVDRYDGWLSPKIAEDFKYYADICFKNFGDRVKYWITFNEPNVAFIRGYRIGIWPPGRCS  220

Query  1205  --------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                      GN+ K+ FIV  N +LAHA+ V +YR  YQ++QGG+IG+A+   WF P++N
Sbjct  221   GSFGNCSVGGNSEKEPFIVGSNFLLAHASIVGLYRTKYQKKQGGKIGLAVHTMWFEPISN  280

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S+ DK AAERA +F  NWFLDP + G YP+EM++ILG  LP     +LEKLK    DFIG
Sbjct  281   SSEDKIAAERAQAFYMNWFLDPAIRGEYPREMREILGKDLPPV-PYELEKLKP-SIDFIG  338

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHYT+Y+ +DC++S C+P + G+TR EG+       NG  IG+ T L +L +YP G+E+
Sbjct  339   VNHYTSYFVKDCIHSECEPGL-GSTRTEGYALTWAHINGMTIGKPTSLEWLFIYPEGLEK  397

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE+F +IP+Y+TE G       N + +E+++D  R+ +L  YL ++  AIRKGAD
Sbjct  398   IVTYIKERFNNIPIYLTENGVGGKENANMTTKEIINDVDRIDYLRAYLDSLARAIRKGAD  457

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             VRGYF+WSL DNFEWT G + R GL++ D  T +RTP++SA WYK FIA
Sbjct  458   VRGYFLWSLLDNFEWTDGSSIRFGLHRVDYDTLQRTPRMSASWYKNFIA  506



>gb|KHN33045.1| Beta-glucosidase 47 [Glycine soja]
Length=525

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 351/467 (75%), Gaps = 10/467 (2%)
 Frame = -3

Query  1739  FFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLAS  1560
              FGT+SSSYQ+EG YL+DGKGL+NWDVF+H+PG I+DG+NGDVA D Y  Y+ED DL+  
Sbjct  46    LFGTASSSYQFEGAYLTDGKGLNNWDVFTHKPGTIMDGTNGDVAVDHYHRYQEDVDLMDY  105

Query  1559  LGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQ  1380
             +GVNS++FS+SW+R+LPKGR G +N  GI YY  L+D+++ K IEPFVT++HYD+P EL+
Sbjct  106   IGVNSYRFSLSWARILPKGRFGKVNWAGIDYYNQLVDTIVSKEIEPFVTMSHYDIPLELE  165

Query  1379  DRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------  1221
             +RY GWLSPE+QE++ Y+A++CFK+ GD+VKYW+TFNEPN+  I  YR  +WP       
Sbjct  166   ERYGGWLSPEIQEDFKYYANICFKNFGDRVKYWVTFNEPNVATIRGYRTGMWPPSRCSGS  225

Query  1220  HGNCS-EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
              GNCS  G++ ++ FI A N++L+HA AV++YR  YQ++QGG+IG+ M   WF P++NS 
Sbjct  226   FGNCSYGGDSEREPFIAASNLLLSHAVAVDLYRTKYQKKQGGKIGVVMNAIWFEPVSNSW  285

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK AAERA SF  NWFLDPI+ G YP EM +ILG  LP FS  D+EKLK+ G DFIG+N
Sbjct  286   KDKLAAERAQSFYMNWFLDPIIIGEYPAEMHEILGQDLPTFSRYDVEKLKS-GLDFIGVN  344

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HYT+ +A+DC++S C+    G++R EGF  +S   NG  IGE T L +L V+P GME+++
Sbjct  345   HYTSAFAKDCIFSACEQG-RGSSRTEGFTLRSPQMNGISIGEPTALDWLYVHPQGMEKIL  403

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
             TY K ++ +IP+++TE G       N + +E+++D +RV++L  YL ++ TAIRKGADVR
Sbjct  404   TYLKHRYNNIPMFITENGIGMRENSNHATKEIINDVERVEYLRGYLDSLATAIRKGADVR  463

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             GYF+WSL DNFEWT GY+ R GL+  D AT  RTP++SA WYK FIA
Sbjct  464   GYFVWSLLDNFEWTDGYSIRFGLHHVDYATLNRTPRMSAFWYKNFIA  510



>ref|XP_002518516.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF43903.1| beta-glucosidase, putative [Ricinus communis]
Length=511

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/475 (55%), Positives = 353/475 (74%), Gaps = 9/475 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SSSYQ+EG YLSDGKGL+NWD F+H+PGNILDG+NGD++AD Y  Y ED +L+
Sbjct  37    SFLFGTASSSYQFEGAYLSDGKGLNNWDNFTHEPGNILDGTNGDISADHYHRYLEDMNLM  96

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+RVLPKGR G+IN  GI +Y   ID+LL KGI+PFV++ H+D+PQE
Sbjct  97    EDIGVNSYRFSISWARVLPKGRFGHINQAGIHHYNKFIDALLRKGIQPFVSLTHFDIPQE  156

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L DRY  WLSPE+ E++ Y+ADVCF+  G++VKYW TFNEPN+  I  YR  ++P     
Sbjct  157   LADRYGSWLSPEVLEDFKYYADVCFRSFGNRVKYWTTFNEPNVAVIRGYRSGIFPPAHCS  216

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV++YR  YQ++QGG IGI M   W+ P++NS
Sbjct  217   GSFGNCSSGDSDREPFIAAHNMILSHAAAVDVYRTKYQKEQGGCIGIVMNAIWYEPISNS  276

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK A ERA +F   WFLDPI+ G YP EM +ILG  LP FS+ +LEKLK+   DFIGI
Sbjct  277   LEDKLAVERAQAFYLYWFLDPIILGKYPSEMHEILGVDLPAFSNHELEKLKS-ALDFIGI  335

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+++Y +DC++S C+    G T+ EGF  ++  K+  FIGE T + +L +YP GME +
Sbjct  336   NHYSSFYIKDCIFSVCNQG-PGITKAEGFALRTAEKDSFFIGEPTSIDWLYIYPKGMENI  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ +IP+++TE G+ +    ++S+  +L+D KRV++L+ YL ++ TA+RKGAD+
Sbjct  395   VTYIKERYNNIPMFITENGFGEKENHSTSMNFLLNDVKRVEYLSSYLESLETAVRKGADI  454

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             RGYF WSL DNFEW  GYT R GLY  D +T KRT KLSA WYK +I+ ++  +S
Sbjct  455   RGYFAWSLLDNFEWRDGYTVRFGLYHVDFSTLKRTQKLSATWYKDYISTHRANNS  509



>ref|XP_008441244.1| PREDICTED: beta-glucosidase 47 [Cucumis melo]
Length=522

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/469 (56%), Positives = 352/469 (75%), Gaps = 10/469 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQ+EG +LSDGKGL+NWD+F+H+PGNI DG+NGDVA DQY  Y+ED DL+
Sbjct  42    DFLFGTASSAYQFEGAFLSDGKGLNNWDIFTHKPGNIKDGTNGDVAVDQYHRYQEDVDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LP+GR G +N  GI +Y  LID+LL +GIEPFVT+ HYD+PQ+
Sbjct  102   EFIGVNSYRFSISWARILPQGRFGEVNNAGIDHYNKLIDALLERGIEPFVTLAHYDIPQK  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+D+Y  WLSP +QE++ Y+AD+CFK  G++VKYW+TFNEPN+  I +YR   +      
Sbjct  162   LEDKYGAWLSPLVQEDFTYYADICFKSFGNRVKYWVTFNEPNVQVIRSYRKGTFPPSRCS  221

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++ ++ F+ AHN+IL+HAAAVN YR  YQ +QGG IGI +   WF P+++S
Sbjct  222   SPFGNCSSGDSEREPFVAAHNIILSHAAAVNTYRSKYQAKQGGLIGIVINAVWFEPISDS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A ERA SF  NWFLDPI++G+YP  M++ILG  LP FS+ D +KLK  G+DFIGI
Sbjct  282   FEDILATERAFSFYMNWFLDPIVFGNYPAVMEEILGLDLPHFSTEDQKKLK-NGADFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YYA+DCL+S C+P   G+++ EGF   + +K    IGE T + ++ VYP GM ++
Sbjct  341   NHYTSYYAKDCLHSFCEPG-QGSSKIEGFTFWTPTKEETSIGEPTEISWIYVYPQGMNKM  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ ++P++VTE GY     PN+  E++L DT+RV ++  YL A+ T++R+GADV
Sbjct  400   VTYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTRRVDYMRSYLGALETSMREGADV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAK  360
             RGYF WSL DNFEW +GYT+R GL   D  T KRTPKLS  WYK FIA+
Sbjct  459   RGYFAWSLLDNFEWMNGYTERFGLCHVDYTTLKRTPKLSTFWYKNFIAQ  507



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/471 (58%), Positives = 344/471 (73%), Gaps = 9/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG YLSDGKGLSNWDVF+H+PG+  DGSNGDV  DQY  Y ED DL+
Sbjct  546   NFLFGTASSSYQYEGAYLSDGKGLSNWDVFTHKPGSTHDGSNGDVTVDQYHRYLEDVDLM  605

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              ++ VNS++FSISW+R+LPKGR G +NL GI YY  LI +LLL+GI+PFVT+ H D PQE
Sbjct  606   EAIKVNSYRFSISWARILPKGRFGEVNLAGIDYYNRLIHALLLRGIQPFVTLFHLDFPQE  665

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLSP+ QE++  FAD+CFK  GD+VKYW TFNEPN+     YR    P     
Sbjct  666   LEDRYGGWLSPQSQEDFVLFADICFKSFGDRVKYWTTFNEPNLQVSLGYRKGKHPPCRCS  725

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCSEG++ KD F+ AHN+IL+HAAAV+IYR  YQ +QGG+IGI +   WF P +NS
Sbjct  726   GKFGNCSEGDSEKDPFVAAHNIILSHAAAVDIYRNRYQAEQGGQIGIVVHVDWFEPYSNS  785

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NW LDPI +G YPKEM+ ILGS LP+FSS D  KL   G DFIGI
Sbjct  786   VADKLAAERAQSFSMNWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNR-GLDFIGI  844

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY  YY +DC+ S C+ S  G +  EG   Q+  K+G  IGELT   +L VYP GM++ 
Sbjct  845   NHYAGYYVKDCISSVCE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKKT  903

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             +TY K+++ + P+++TE GY +   PN++ EE L+D KR+ +++ +L+ +G +IR+GADV
Sbjct  904   LTYVKDRYNNTPMFITENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGADV  963

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW  G+T R GLY  D ATQKRTPKLSA WYK FI K++
Sbjct  964   RGYFAWSLLDNFEWLYGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKHK  1014



>ref|XP_004145176.1| PREDICTED: beta-glucosidase 47-like [Cucumis sativus]
 gb|KGN64542.1| hypothetical protein Csa_1G064150 [Cucumis sativus]
Length=523

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 351/469 (75%), Gaps = 10/469 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQ+EG +LSDGKGLSNWDVF+H+PG I DG+NGDVA DQY LY+ED DL+
Sbjct  42    DFLFGTASSAYQFEGAFLSDGKGLSNWDVFTHEPGTIKDGTNGDVAVDQYHLYQEDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LP+GR G +N  GI +Y  LIDSLL +GIEPFVT+ HYD+PQ+
Sbjct  102   EFIGVNSYRFSISWARILPEGRFGEVNRAGIDHYNKLIDSLLKRGIEPFVTLTHYDIPQK  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+D+Y  WLSP +QE++ Y+AD+CFK  G++VKYW+TFNEPN+  I  YR   +P     
Sbjct  162   LEDKYGAWLSPLVQEDFRYYADICFKSFGNRVKYWVTFNEPNVQVIRGYRKGTFPPSRCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ F+ AHN+IL+HAAAVN YR  YQ +QGG IGI +   WF P+++S
Sbjct  222   SSFGNCSSGDSEREPFVAAHNIILSHAAAVNTYRSKYQAKQGGLIGIVINAVWFEPISDS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A+ERA SF  NWFLDPI++G+YP  M++ILG  LP FS+ D +KLK  G+DFIGI
Sbjct  282   FKDILASERALSFYMNWFLDPIVFGNYPAVMEEILGLDLPNFSTEDQKKLK-NGADFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YYA+DCL+S+C+P   G+++ EGFV  +  K    IGE T + ++ V P GM ++
Sbjct  341   NHYTSYYAKDCLHSSCEPG-QGSSKIEGFVFWTPMKEEILIGEPTEISWIYVNPQGMNKM  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ ++P++VTE GY     PN+  E++L DT R+ ++  YL A+ T++R+GADV
Sbjct  400   VTYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTGRIDYMRSYLGALETSMREGADV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAK  360
             RGYF WSL DNFEW +GYT+R GL   D  T KRTPKLS  WYK FIA+
Sbjct  459   RGYFAWSLLDNFEWMNGYTERFGLCHVDYTTLKRTPKLSTFWYKNFIAQ  507



>ref|XP_003529622.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03066.1| Beta-glucosidase 46 [Glycine soja]
Length=524

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/477 (55%), Positives = 346/477 (73%), Gaps = 13/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGN--ILDGSNGDVAADQYDLYKEDAD  1572
             +F FG +SSSYQYEG Y SDGKGLSNWD ++H PG   I+DGSNGD+A D Y  Y ED D
Sbjct  33    DFLFGIASSSYQYEGAYKSDGKGLSNWDNYTHGPGRSVIMDGSNGDIAIDHYHRYLEDID  92

Query  1571  LLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLP  1392
             L+ +LGVNS++ S+SW+R+LPKGR G  N  GI++Y  LID LLLKGI+PFVT++HYD+P
Sbjct  93    LMETLGVNSYRLSLSWARILPKGRFGEPNHAGIEFYNRLIDVLLLKGIQPFVTLSHYDIP  152

Query  1391  QELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP---  1221
             QEL+DRY  WLSP++QE++A++AD+CFK  GD+VKYW+TFNEPN      YR  L+P   
Sbjct  153   QELEDRYGSWLSPQLQEDFAFYADLCFKTFGDRVKYWVTFNEPNFLVSLGYRSGLYPPCR  212

Query  1220  ------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLP  1059
                      CSEG++ K+ F+ AHN+IL+HAAAV+IYR  YQ +Q G IGI +   WF P
Sbjct  213   CSGQLAMAKCSEGDSEKEPFVAAHNVILSHAAAVDIYRTKYQTEQKGSIGIVLQHEWFEP  272

Query  1058  MTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSD  879
             M+NST DK A+ERA +F  NWFLDPI++G YP EM+++LGS LP+FSS + EKLK  G D
Sbjct  273   MSNSTADKLASERARAFNFNWFLDPIIFGKYPTEMENVLGSLLPKFSSYEKEKLKR-GLD  331

Query  878   FIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             FIG+N+YT +Y QDC+YS C P   G +R EG   +S  KNG  IGE T   +  +YP G
Sbjct  332   FIGVNYYTAFYVQDCMYSACKPG-PGISRTEGSYKKSGEKNGVPIGEPTPFSWFNIYPDG  390

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME+ VTY ++++ + P+++TE GY +   PN + EE L+D KR+K++ D++ A+  AIRK
Sbjct  391   MEKTVTYVRDRYNNTPIFLTENGYAEEVDPNFTSEEHLNDFKRIKYMVDHIEALLAAIRK  450

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             GADVRGYF W+L D+FEW  GYT R G +  D AT KRTP+LSA WYKQ + + +K 
Sbjct  451   GADVRGYFAWTLIDSFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQLLVQYKKT  507



>ref|XP_006383935.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
 gb|ERP61732.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
Length=503

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 340/477 (71%), Gaps = 21/477 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YLSDGKGLSNWD+F+H  G I+DGSNGD+A DQY  + ED DL+
Sbjct  41    NFLFGTASSSYQFEGAYLSDGKGLSNWDIFTHTSGKIIDGSNGDIAVDQYHRFLEDIDLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISW+R+LPKGR G+IN  GI YY  LI++LLLKGI+PFVT+ HYD+PQE
Sbjct  101   ETLGVNSYRFSISWARILPKGRFGDINRAGISYYNKLINALLLKGIQPFVTLTHYDMPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYR-------L  1227
             L++RY GWLSP+ QE++ Y+ D+CFK+ GD+V YW+TFNEPN+  I  YR          
Sbjct  161   LEERYGGWLSPKCQEDFGYYVDICFKYFGDRVNYWVTFNEPNLQVINGYRTGESPPSRCS  220

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ K+ F+ AHN+ILAHA AV+IYR  YQ+QQGG IGI +   WF P +NS
Sbjct  221   SPFGNCTHGDSEKETFLAAHNIILAHANAVHIYRTKYQKQQGGSIGIVIHCPWFEPYSNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A +RA  FL NWFLDPI++G YP EM  ILGS +P+FSS D EKL   G DFIGI
Sbjct  281   TADNLATDRAQDFLMNWFLDPIIFGKYPAEMTKILGSAIPKFSSNDREKLNK-GLDFIGI  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT +Y QDC +  C P   G +R EG   QS             + ++ VYP GME++
Sbjct  340   NHYTGFYIQDCSFVVCKPG-QGGSRTEGLAQQS------------EVDWIHVYPQGMEKI  386

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             +TY KE++ + P+ +TE G+   +  N +IEE L D  RV++++ YL ++ TA+ KGADV
Sbjct  387   ITYLKERYNNTPMIITENGFGQESYLNRTIEEYLQDRDRVEYMSGYLDSLMTAMLKGADV  446

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             RGYF WSL DNFEW  GYT+R GL+  D  T KR P+LSA W+K+FIA+ +   S+M
Sbjct  447   RGYFAWSLLDNFEWGRGYTRRFGLHHVDYTTLKRIPRLSATWFKEFIARYKVDKSQM  503



>ref|XP_006449069.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
 gb|ESR62309.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
Length=523

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/470 (55%), Positives = 347/470 (74%), Gaps = 21/470 (4%)
 Frame = -3

Query  1709  YEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSI  1530
             YEG +L+DGKGL+NWD F+H+PGNI+DGSNGDVA D Y  Y +D DL+  LGVNS++FSI
Sbjct  46    YEGAFLTDGKGLNNWDNFTHKPGNIMDGSNGDVAVDHYHRYLQDLDLMDYLGVNSYRFSI  105

Query  1529  SWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSPE  1350
             SW+RVLP GR G++N  GI +Y  LI++LLLKGI+PFVT+ HYD+PQEL+DRY  WLS E
Sbjct  106   SWARVLPNGRFGDVNWAGIDHYNKLINALLLKGIQPFVTLTHYDIPQELEDRYGAWLSRE  165

Query  1349  M------------QEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
                          +E++ Y+AD+CFK+ GD+VKYW TFNEPN+  I  Y+  ++P     
Sbjct  166   TLRFPTNADRKFSREDFEYYADICFKYFGDRVKYWATFNEPNVVVIRGYQSGIYPPSRCS  225

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ K+ FI AHN+IL+HAAAV IYR  YQ++Q G IGI M   W  PM+NS
Sbjct  226   GLFGNCTNGDSEKEPFIAAHNIILSHAAAVKIYRTKYQKEQEGNIGIVMNVLWLEPMSNS  285

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA +F  NWFLDPI++G YPKEM +ILGS LP FS  DLEKLK  G DF+GI
Sbjct  286   LEDKLAAERAQAFYLNWFLDPIIFGKYPKEMYEILGSSLPSFSKYDLEKLK-NGLDFVGI  344

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y +DC++S C+P   GN++ EG + ++  +NG  IGE T + +L VYP GM  +
Sbjct  345   NHYTSFYVKDCIFSVCEPG-PGNSKTEGSILRTAKRNGVLIGEPTDVDWLFVYPQGMSEI  403

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ +IP+Y+TE G+ +   P++SIE++L+DT+RV++++++L ++  A+R GADV
Sbjct  404   VTYIKERYNNIPMYITENGFGERDNPHTSIEDLLNDTRRVRYMSNHLDSLAIAVRNGADV  463

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF WSL DNFEW  GYT R GL+  D AT +RT +LSA WYKQ+IAK+
Sbjct  464   RGYFAWSLLDNFEWNDGYTIRFGLHHVDYATLERTKRLSANWYKQYIAKH  513



>ref|XP_010665547.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 46-like [Beta 
vulgaris subsp. vulgaris]
Length=573

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/481 (56%), Positives = 349/481 (73%), Gaps = 11/481 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEG-GYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SS+YQYEG  YL DGKGL+NWD F+H+ G I D SNGDVA D Y  Y ED +L
Sbjct  84    NFLFGTASSAYQYEGRAYLVDGKGLNNWDTFTHKSGMIADKSNGDVATDHYHRYLEDVEL  143

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  L +NS++FSISW+R+LPKGR+GNINL GIK+Y  LID+LL KGI+PFVT++H+D+PQ
Sbjct  144   MEDLQLNSYRFSISWARILPKGRYGNINLAGIKFYIKLIDTLLAKGIQPFVTLSHFDIPQ  203

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP----  1221
             EL+DRY G LS E+QE++AY+ADVCFK+LGD+VKYW TFNEPN+     YR  L+P    
Sbjct  204   ELEDRYGGLLSHEIQEDFAYYADVCFKYLGDRVKYWATFNEPNVNIHQGYRTGLYPPNRC  263

Query  1220  ---HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                 G CS+G++ K+ FI AHN+ILAHA AVN+YR  YQ++Q G IGI     WF P++N
Sbjct  264   SGLFGKCSKGDSEKEPFIAAHNVILAHATAVNLYRTKYQEKQRGSIGIVQNAIWFEPISN  323

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S +DK AAERA SF  NW LDPIM+G YP+EM+ ILG +LP FS  + +K+     DFIG
Sbjct  324   SPLDKLAAERAQSFFLNWILDPIMFGEYPEEMRKILGPNLPRFSKKE-KKILNNALDFIG  382

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHY++YYAQDC++S C     G +  EG   ++ SKNG  IGE T + +L + P GME+
Sbjct  383   INHYSSYYAQDCMFSRCKAG-PGVSWTEGLYLRTPSKNGILIGEPTAMDWLYISPQGMEK  441

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY KE++ + P+++TE GY   +  N  + E+L DTKRV+++A YL ++  AI++GAD
Sbjct  442   MVTYVKERYNNTPMFITENGYAQESNQNCVLNELLSDTKRVEYMAGYLDSLLRAIKQGAD  501

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             VRGYF WSL DNFEW  GYTKR GLY  D  T KR+PKLS  WY+ FIA N    + ++ 
Sbjct  502   VRGYFAWSLLDNFEWLYGYTKRFGLYHVDYHTLKRSPKLSVAWYRNFIA-NHITQTTLKQ  560

Query  329   R  327
             R
Sbjct  561   R  561



>ref|XP_003529623.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03065.1| Beta-glucosidase 46 [Glycine soja]
Length=554

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/474 (56%), Positives = 347/474 (73%), Gaps = 15/474 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTSSSSYQYEG YLSDGKG+SNWDVF+H+PG+I D SNGDVA DQY  Y ED DL+ 
Sbjct  56    FLFGTSSSSYQYEGAYLSDGKGISNWDVFTHKPGSISDESNGDVAVDQYHRYLEDIDLME  115

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             ++ VNS++FSISW+R+LPKGR G +NL GI YY  LI++LLLKGI+PFVT+ H+D+PQEL
Sbjct  116   AIKVNSYRFSISWARILPKGRFGEVNLAGINYYNRLIEALLLKGIQPFVTLFHFDIPQEL  175

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP------  1221
             +DRY GWLSP+ QE++  FAD+CFK  GD+VKYW+TFNEPN     AYR  ++P      
Sbjct  176   EDRYGGWLSPQSQEDFQLFADICFKSFGDRVKYWVTFNEPNYLVPLAYRLGIFPPLRCSS  235

Query  1220  -HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
               GNCSEG++ K+ F+ AHNMIL+HAAAV++YR  YQ +QGGEIGI +    F P++NST
Sbjct  236   KFGNCSEGDSEKEPFVAAHNMILSHAAAVDLYRNKYQTEQGGEIGIVLHCDSFEPLSNST  295

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK A ERA SF  NW LDPI++G YPKEM+ ILG+ LP+FSS D  KL+  G DFIGIN
Sbjct  296   ADKLATERAQSFSINWILDPILFGKYPKEMEMILGTTLPKFSSNDKAKLRQ-GLDFIGIN  354

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY +YY +DC+ S C+ S  G +  EG   ++       IGELT   +L+VYP GM+ ++
Sbjct  355   HYASYYVRDCISSVCE-SGPGVSTTEGLYQRTT------IGELTPFDWLSVYPLGMKSIL  407

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K+++ + P+++TE GY +   P+ + EE L+D KR++F++ +L  +  AIR+GADVR
Sbjct  408   MYLKDRYNNTPMFITENGYGNLYDPDLTEEEYLNDFKRIEFMSGHLDNLMAAIREGADVR  467

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             GYF WSL DNFEW  G++ R GL+  D +T KRTPKLSA WY+ FI   +  DS
Sbjct  468   GYFAWSLLDNFEWLYGFSVRFGLHHVDFSTLKRTPKLSAIWYEHFIENYKLTDS  521



>ref|XP_010267718.1| PREDICTED: beta-glucosidase 46 isoform X1 [Nelumbo nucifera]
Length=857

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 341/464 (73%), Gaps = 9/464 (2%)
 Frame = -3

Query  1712  QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  1533
             Q+EG +LSDGKGL+NWDVFSH+PGNI+DGSNGD+A D Y  Y ED +L+ SLGVNS++FS
Sbjct  386   QFEGAFLSDGKGLNNWDVFSHKPGNIVDGSNGDIAVDHYHRYLEDIELMQSLGVNSYRFS  445

Query  1532  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSP  1353
             ISW+R+LPKGR G  N +GI +Y NLI++LL KGIEPFVT+NHYD+PQEL+DRY  WLSP
Sbjct  446   ISWARILPKGRFGERNRQGIDHYNNLINALLRKGIEPFVTLNHYDIPQELEDRYGAWLSP  505

Query  1352  EMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------HGNCSEGNA  1194
             ++Q+++ Y ADVCF+  GD+VKYW TFNEPN+ A+  YR  + P        GNC  G++
Sbjct  506   DIQDDFGYLADVCFEAFGDRVKYWTTFNEPNVVAVRGYRSGIHPPSRCSASFGNCLHGDS  565

Query  1193  TKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAH  1014
               + FIVAHN+IL+HA AVNIYR  YQ++QGG IGI M   WF P+TNS  D+ AAERA 
Sbjct  566   KTEPFIVAHNIILSHAIAVNIYRTRYQKKQGGSIGIVMNAIWFEPLTNSPADRLAAERAQ  625

Query  1013  SFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDC  834
             SF  NWFLDPI++G YP EM +ILGS LPEFS  + E L+  G DFIGINHYT+ Y +DC
Sbjct  626   SFYLNWFLDPIIFGKYPPEMHEILGSILPEFSRNEWEILQT-GLDFIGINHYTSLYVKDC  684

Query  833   LYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDI  654
             + S C P  +G ++ EG   ++  K+G  IGE TG+ +  V+P GME+++ Y KE++ + 
Sbjct  685   ISSMCKPG-TGGSKTEGLAIRTGRKDGVPIGEPTGMDWFYVHPQGMEKIIIYVKERYNNT  743

Query  653   PLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDN  474
             P+++TE GY +    + S E   +D KRV +L  YL A+  A+RKGADVRGYFIWSL DN
Sbjct  744   PIFITENGYGEENNASFSTENFQYDIKRVNYLNGYLSALQRAMRKGADVRGYFIWSLLDN  803

Query  473   FEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             FEW  GYTKR GLY  D  T +RTPKLSA WYKQFIA+ + + +
Sbjct  804   FEWICGYTKRFGLYHVDYKTMERTPKLSATWYKQFIARQKPIKA  847



>ref|XP_010430204.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Camelina sativa]
Length=518

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 353/479 (74%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS++QYEG YL+DGKGL+NWDVF+H+ P  I+DGSNGD+AADQY  Y ED   
Sbjct  38    DFFFGTASSAFQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSRVLPKGR G IN +GI+YY NLI +L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRVLPKGRFGGINYKGIRYYDNLIKALIGKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EM +++ Y AD+CFKH GD+VK+W+T NEPN     AYR  L+     
Sbjct  158   ELENRFKSWLSSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRKGLFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCSEGN+  + FI AHNMILAH+ AV IYR  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCSEGNSETEPFIAAHNMILAHSKAVQIYRTKYQKEQRGSIGIVVQTSWFEPVSD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP+++G YP+EM  ILGS LPEFSS ++  LK   SDF+G
Sbjct  278   SIADKKAAERAQSFYSNWILDPVVFGKYPEEMVKILGSALPEFSSNEMNNLKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL + C+ S  G ++ EGF  + L + GN  IGELT + +  + P G +
Sbjct  338   INHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFK  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P ++++E++HDTKR+++L++YL A+  A+R GA
Sbjct  396   KMLNYLKNRYHNIPMYITENGFGQLQKPETTVKELMHDTKRIQYLSEYLDALKAAMRDGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             +V+GYF WSL DNFEW  GY  R GL+  D AT KRTPK SA WYK FI ++  +++ +
Sbjct  456   NVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYATLKRTPKQSASWYKNFIEQHVNIENHI  514



>ref|XP_007153925.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
 gb|ESW25919.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
Length=517

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 345/466 (74%), Gaps = 9/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT+SS+YQYEG Y SDGKGL+NWDVFSH+ G+I DGSNGDVA DQY  Y+ED DL+ 
Sbjct  25    FLFGTASSAYQYEGAYSSDGKGLNNWDVFSHRIGSISDGSNGDVAVDQYHRYQEDIDLME  84

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             ++ VNS++FS+SW+R+LP+GR G +NL GI YY  LID+LLLKGI+PFVT+ H+D+PQEL
Sbjct  85    AMKVNSYRFSVSWARILPEGRFGEVNLAGINYYNRLIDALLLKGIQPFVTLFHFDIPQEL  144

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP------  1221
             +DRY  WLSP+ QE++ + AD+CFK  GD+VKYW+TFNEPN     AYR   +P      
Sbjct  145   EDRYGAWLSPQSQEDFQFLADICFKSFGDRVKYWVTFNEPNYIIPLAYRVGQFPPCRCSR  204

Query  1220  -HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
               G+C EG++ K+ F+VAHNMIL+HAAAV+IYR  YQ +QGG+IGI +    F P++NST
Sbjct  205   KFGDCREGDSEKEPFVVAHNMILSHAAAVDIYRNKYQNEQGGKIGIVLHCDSFEPLSNST  264

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK A ERA SF +NW LDPI++G YPKEM+ ILG+ LP+FSS D  KL+  G DFIGIN
Sbjct  265   ADKLATERAQSFSTNWILDPILFGKYPKEMEMILGTILPKFSSNDKAKLRR-GLDFIGIN  323

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y +YY +DC+ S C     G T+ EG   Q++ KNG  IGELT   +L VYP GM+ V+
Sbjct  324   YYASYYVRDCISSVCGYG-KGVTKTEGSYEQTVLKNGVPIGELTPFDWLNVYPQGMKNVL  382

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K+++ + P+++TE GY     P+ + EE L+D KR++F++ +L  +  AI++GADVR
Sbjct  383   IYLKDRYNNTPMFITENGYATLYDPDVTEEEYLNDYKRIEFMSGHLDNLMAAIKEGADVR  442

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GYF+WSL DNFEW  G++ + GL+  D  T KRTPKLSA WYK+FI
Sbjct  443   GYFVWSLLDNFEWKYGFSAKFGLHHIDHVTLKRTPKLSASWYKRFI  488



>ref|XP_009770584.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/470 (55%), Positives = 353/470 (75%), Gaps = 11/470 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G+I DGSNGD+A D Y+ Y+ED  L+ 
Sbjct  65    FLFGTASSSYQFEGAFLSDGKGLNNWDVFTHEVGHIADGSNGDIALDHYNRYREDIKLME  124

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
              +GV+S +FSISW+R+LP G +G+IN+ GI++Y  LI++L+ KGIEPFVT+ HYD+PQEL
Sbjct  125   DMGVDSFRFSISWARILPNGMYGDINIAGIQHYSKLINALIQKGIEPFVTLTHYDIPQEL  184

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP------  1221
             +DRY GWLSP++Q +++Y+AD+CFK+ GD+VKYW+T NEPN+ A+  YR   +P      
Sbjct  185   EDRYGGWLSPKIQSDFSYYADICFKYFGDRVKYWVTMNEPNVMAVRGYRLGTFPPARCSR  244

Query  1220  -HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
               GNCS GN+ K+ FI AHNMIL+HAAAV+IYR  YQ++QGG IGI++   W+ P +NS+
Sbjct  245   SFGNCSAGNSEKEPFIAAHNMILSHAAAVSIYRTKYQERQGGMIGISLNTQWYEPFSNSS  304

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK AA+RA SF+ NWFLDPI++G YP+EM+ ILG++LP FSS DL+KL   G DFIGIN
Sbjct  305   EDKYAAQRARSFVYNWFLDPIIFGRYPEEMQQILGNNLPVFSSNDLKKLN-NGLDFIGIN  363

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HYT  Y +DCLYS C+    G +  EG   ++  K+G +IG+ T + +L VYP GME++V
Sbjct  364   HYTAAYIKDCLYSACE---HGTSWSEGSYFRTTEKDGVYIGQPTTMDWLFVYPQGMEKLV  420

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K++F + P+ +TE G  ++  PNSS+ + L+DT RV+++  +L+++  AIR+GADVR
Sbjct  421   MYMKDRFNNTPIIITENGIAESDNPNSSLADSLNDTPRVEYMHSHLNSLANAIREGADVR  480

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             GYF WSL DNFEW  GYTKR GL+  +    +RTPKLSA   K+ ++  Q
Sbjct  481   GYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRCKELMSNFQ  530



>ref|XP_006301036.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
 gb|EOA33934.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
Length=520

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 353/475 (74%), Gaps = 12/475 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +LS+GKGL+NWD+F+H+ PG I D +NGD+A DQY  + ED DL
Sbjct  44    DFLFGTASSAYQYEGAFLSEGKGLNNWDIFTHEYPGKIRDENNGDMAVDQYHRFMEDIDL  103

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH+D PQ
Sbjct  104   MTSLGVNSYRFSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHFDYPQ  163

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL++R+Q WLSPEMQ+E+ Y AD CFKH GD+VK WIT NEPN    ++Y        R 
Sbjct  164   ELENRFQSWLSPEMQKEFMYLADTCFKHFGDRVKLWITLNEPNQQITSSYLKGSFPPSRC  223

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+  + FI AHN ILAHA AV++YR  YQ++Q G IGI +  +WF P++
Sbjct  224   SL-PYGNCSQGNSETEPFIAAHNSILAHAKAVHLYRTKYQEEQKGIIGIVVQTSWFEPIS  282

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S  DK AAERA +F SNW LDP+++G YPKEM ++LGS LP FS  ++E LK   SDF+
Sbjct  283   DSIADKEAAERAQAFYSNWILDPVIHGKYPKEMVNLLGSALPRFSKKEVENLKESRSDFV  342

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL S+C+ + +G ++ EG+  + L++ GN  IGELT + +  ++P G 
Sbjct  343   GINHYTSYFIQDCLLSSCNNTGNGGSKVEGYALK-LNRKGNVTIGELTDVVWQHIHPEGF  401

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
              +++ Y K+++ +IP+++TE G+ D   P ++++E+L D+KRV++++ YL A+ +A+R G
Sbjct  402   RKMLNYLKDRYHNIPMFITENGFGDLQKPETTVKELLDDSKRVQYMSGYLDALQSAMRDG  461

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQK  351
             A+V+GYF WSL DNFEW  GY  R GLY  D  T KRTPK SA WY+ +I +N +
Sbjct  462   ANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDNVTLKRTPKRSASWYRNYIGENLR  516



>ref|XP_003610400.1| Beta-glucosidase [Medicago truncatula]
 gb|AES92597.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 345/477 (72%), Gaps = 12/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SSSYQYEG Y SDGKG SNWD F+H   G I+DGSNGD+A D Y  Y+ED +L
Sbjct  36    NFLFGTASSSYQYEGAYNSDGKGQSNWDNFTHGGRGIIVDGSNGDIAVDHYHRYQEDINL  95

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             L  L VNSH+ SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQ
Sbjct  96    LEDLEVNSHRLSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQ  155

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             EL+DRY G LSP+ Q+++A++AD+CFK  GD+VK+WITFNEPN  A   YR  L+P   C
Sbjct  156   ELEDRYGGLLSPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFPPRRC  215

Query  1208  S---------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
             S         EG++ K+ F+ AHN+IL+HAAAV+IYR  YQ +Q G IGI +   W+ PM
Sbjct  216   SGSLAIVTCNEGDSEKEPFVAAHNIILSHAAAVDIYRTKYQAEQKGRIGIVISHEWYEPM  275

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
             +NS  DK AAERA SF  NW LDPI++G YPKEM+++LGS LP+FSS + +KL   G DF
Sbjct  276   SNSNADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSNEKKKLMK-GLDF  334

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             IGIN+YT++Y QDC+Y+ CD S SG +R EG    S  +NG  IGE T   +  +YP GM
Sbjct  335   IGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGM  393

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+ VTY K+++ + P+++TE GY      N ++E+ L+D KR+K++  ++ A+ TAIRKG
Sbjct  394   EKTVTYVKDRYNNTPMFITENGYGQQDDQNLTLEDQLNDFKRIKYMKSHIEALSTAIRKG  453

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             ADVRGYF WSL DNFEW  GYT R G +  D AT KRTP+LSA WYKQFI   ++ +
Sbjct  454   ADVRGYFAWSLLDNFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIVNYKQTE  510



>ref|XP_002888064.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64323.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/476 (54%), Positives = 352/476 (74%), Gaps = 11/476 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS++QYEG +L+DGKGL+NWDVF+H+ PG I+DGSNGD+A DQY  Y ED   
Sbjct  38    DFFFGTASSAFQYEGAFLNDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRVLPNGRFGGINYKGIKYYNNLIDALIRKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EMQ+++AY AD+CFKH GD+VK+WIT NEPN   I AYR  L+     
Sbjct  158   ELENRFKSWLSSEMQKDFAYLADICFKHFGDRVKHWITINEPNQQIILAYRSGLFPPSRC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC++GN+  + FI AHNMILAHA A+ IYR  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCTQGNSETEPFIAAHNMILAHAKAIQIYRTKYQKEQRGIIGIVVQTSWFEPISD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S VDK AAERA SF SNW LDP++YG YP+EM +ILGS LP FSS ++  +K   SDF+G
Sbjct  278   SIVDKNAAERAQSFYSNWILDPVVYGKYPEEMVNILGSALPRFSSNEMNSIKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDP-SMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             INHYT+Y+ QDCL + C+  S +G ++ EGF  + L + GN  IGELT + +  + P G 
Sbjct  338   INHYTSYFIQDCLITACNSGSGNGASKSEGFALK-LDRKGNVSIGELTDVNWQHIDPDGF  396

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             ++++ Y K ++ ++P+++TE G+     P ++++E+L DTKR+++++ YL A+  A+R G
Sbjct  397   KKMLNYLKNRYHNMPMFITENGFGTLQKPETTVKELLDDTKRIQYMSGYLDALKEAMRDG  456

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             A+V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI ++  +
Sbjct  457   ANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKNFIEQHGNI  512



>ref|XP_010418157.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/478 (54%), Positives = 350/478 (73%), Gaps = 9/478 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS++QYEG YL+DGKGL+NWDVF+H+ P  I+DGSNGD+AADQY  Y ED   
Sbjct  38    DFFFGTASSAFQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDVQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSRVLPKGR G IN +GIKYY NLI++L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRVLPKGRFGGINYKGIKYYNNLINALIGKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EM +++ Y AD+CFKH GD+VK+W+T NEPN     AYR  L+     
Sbjct  158   ELENRFKSWLSSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRSGLFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS+GN+  + FI AHNMILAH+ AV IY+  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCSQGNSETEPFIAAHNMILAHSKAVQIYQTKYQKEQRGSIGIVVQTSWFEPVSD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP+++G YP+EM +ILGS LPEFSS ++  LK   SDF+G
Sbjct  278   SIADKKAAERAQSFYSNWILDPVVFGKYPEEMVNILGSALPEFSSNEMINLKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+Y+ QDCL + C+ S  G ++ EGF  +   K    IGELT + +  + P G ++
Sbjct  338   INHYTSYFIQDCLITACN-SGDGASKTEGFALKLDLKGNVSIGELTDVNWQHIDPDGFKK  396

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             ++ Y K ++ +IP+Y+TE G+     P ++++E+LHDTKR+++L+ YL A+  A+R GA+
Sbjct  397   MLNYLKNRYHNIPMYITENGFGQLQKPETTVKELLHDTKRIQYLSGYLDALKAAMRDGAN  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             V+GYF WSL DNFEW  GY  R GL+  D AT KRTPK SA WYK FI ++  ++  +
Sbjct  457   VKGYFAWSLLDNFEWLYGYKLRFGLFHVDYATLKRTPKQSASWYKNFIEQHVNIEDHI  514



>ref|XP_006343294.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=499

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 349/467 (75%), Gaps = 9/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQ+EG +LSDGKGL+NWDVF+H+ G+I DGSNGD+A D Y+ Y+ED  L+
Sbjct  22    NFLFGTASSCYQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYQEDIKLM  81

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS +FSISW+R+LPKG +G +N+ GI++Y  LID+LL K I+P VT+ HYD+PQE
Sbjct  82    EDMGVNSFRFSISWARILPKGMYGGVNMAGIQHYNKLIDALLQKDIQPLVTLAHYDIPQE  141

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLSP++Q+++ Y+ D+CFK+ GD+VKYW+T NEPN+ A+ AYR   +P     
Sbjct  142   LEERYGGWLSPKIQDDFGYYGDICFKYFGDRVKYWVTINEPNVVAVRAYRLGTFPPVRCS  201

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ K+ FI AHNMIL+HAAAV IYR  YQ++QGG IGI++   W+ P +NS
Sbjct  202   GSFGNCSFGNSEKEPFIAAHNMILSHAAAVTIYRTKYQKRQGGMIGISLNTQWYEPFSNS  261

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D  A +RA SF+ NWFLDPI+YG YP+EM+ ILG +LP FS  D++KLK  G DFIG+
Sbjct  262   SQDNYATQRARSFVYNWFLDPIIYGKYPEEMQKILGKNLPIFSRNDIKKLK-NGLDFIGL  320

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT  Y +DCLYS C+     ++  EG   ++  K+G +IGE T + +L VYP GME++
Sbjct  321   NHYTAAYIKDCLYSVCEHGQY-SSWSEGSYFRATEKDGVYIGEPTAVDWLFVYPQGMEKL  379

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  ++  PNSS+E+ L+DT+RV+++ +YL+++  A+R+GADV
Sbjct  380   VMYMKDRFNNTPVIITENGIAESDHPNSSLEDALNDTQRVEYMHNYLNSLANAMREGADV  439

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW  GYTKR GL+  +    +RTPKLSA  YK+ I
Sbjct  440   RGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELI  486



>ref|XP_009617373.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=531

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/470 (54%), Positives = 350/470 (74%), Gaps = 11/470 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G+I DGSNGD+A D Y+ Y+ED  L+ 
Sbjct  57    FLFGTASSSYQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYREDIKLME  116

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
              +GVNS +FSISW+R+LP G +G++NL GI++Y  LI++L+  GIEPFVT+ HYD+PQEL
Sbjct  117   DMGVNSFRFSISWARILPNGMYGDVNLAGIQHYNKLINALIQNGIEPFVTLTHYDIPQEL  176

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP------  1221
             +DRY GWLSP++Q E++ +AD+CFK+ GD+VKYW+T NEPN+ A+  YR   +P      
Sbjct  177   EDRYGGWLSPKIQSEFSCYADICFKYFGDRVKYWVTMNEPNVMAVRGYRLGTFPPARCSR  236

Query  1220  -HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
               GNCS GN+ K+ FI AHNMIL+HAAAV+IYR  YQ++QGG IGI++   W+ P ++S+
Sbjct  237   SFGNCSAGNSEKEPFIAAHNMILSHAAAVSIYRTKYQERQGGMIGISLNTQWYEPFSDSS  296

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK+AA+RA SF+ NWFLDPI++G YP+EM+ ILG++LP FSS DL+KL   G DFIGIN
Sbjct  297   EDKSAAQRARSFVYNWFLDPIIFGRYPEEMQQILGTNLPAFSSNDLKKLN-NGLDFIGIN  355

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
              YT  Y +DCLYS C+   +G +  EG   ++  K+G +IG+ T + +L VYP GME++V
Sbjct  356   LYTAAYIKDCLYSACE---NGTSWSEGSYFRTTEKDGVYIGKPTTMDWLFVYPQGMEKIV  412

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K++F + P+ +TE G  ++  PNSS+ + L DT+RV+++  +L  +  A+R+GADVR
Sbjct  413   MYMKDRFNNTPIIITENGIAESDNPNSSLADALIDTQRVEYMHSHLKFLANAMREGADVR  472

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             GYF WSL DNFEW  GYTKR GL+  +    +RTPKLSA  YK+  +  Q
Sbjct  473   GYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELTSNFQ  522



>gb|AAC28502.1| Similar to F4I1.26 putative beta-glucosidase gi|3128187 from 
A. thaliana BAC gb|AC004521. ESTs gb|N97083, gb|F19868 and gb|F15482 
come from this gene [Arabidopsis thaliana]
Length=527

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 348/479 (73%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS++QYEG +L+DGKGL+NWDVF+H+ PG I+DGSNGD+A DQY  Y ED   
Sbjct  49    DFLFGTASSAFQYEGAFLTDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQS  108

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++ SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQ
Sbjct  109   MNFLGVNSYRLSISWSRVLPNGRFGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQ  168

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EMQ+++ Y AD+CFKH GD+VK+WIT NEPN     AYR  L+     
Sbjct  169   ELENRFKSWLSSEMQKDFGYLADICFKHFGDRVKHWITINEPNQHISLAYRSGLFPPARC  228

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC+ GN+  + FI AHNMILAHA A+ IYR  YQ++Q G IGI +  +WF P+++
Sbjct  229   SMPYGNCTHGNSETEPFIAAHNMILAHAKAIQIYRTKYQREQKGIIGIVVQTSWFEPISD  288

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YP+EM ++LGS LP+FSS ++  L +  SDF+G
Sbjct  289   SIADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKSDFLG  348

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL + C+ S  G ++ EG +   L + GN  IGELT + +  + P G  
Sbjct  349   INHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFR  406

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P +++EE+LHDTKR+++L+ YL A+  A+R GA
Sbjct  407   KMLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGA  466

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI +N  ++ ++
Sbjct  467   NVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  525



>ref|NP_850968.1| beta glucosidase 46 [Arabidopsis thaliana]
 sp|O80690.2|BGL46_ARATH RecName: Full=Beta-glucosidase 46; Short=AtBGLU46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33892.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=516

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 348/479 (73%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS++QYEG +L+DGKGL+NWDVF+H+ PG I+DGSNGD+A DQY  Y ED   
Sbjct  38    DFLFGTASSAFQYEGAFLTDGKGLNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++ SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH+D PQ
Sbjct  98    MNFLGVNSYRLSISWSRVLPNGRFGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EMQ+++ Y AD+CFKH GD+VK+WIT NEPN     AYR  L+     
Sbjct  158   ELENRFKSWLSSEMQKDFGYLADICFKHFGDRVKHWITINEPNQHISLAYRSGLFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC+ GN+  + FI AHNMILAHA A+ IYR  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCTHGNSETEPFIAAHNMILAHAKAIQIYRTKYQREQKGIIGIVVQTSWFEPISD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YP+EM ++LGS LP+FSS ++  L +  SDF+G
Sbjct  278   SIADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL + C+ S  G ++ EG +   L + GN  IGELT + +  + P G  
Sbjct  338   INHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHIDPNGFR  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P +++EE+LHDTKR+++L+ YL A+  A+R GA
Sbjct  396   KMLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI +N  ++ ++
Sbjct  456   NVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQI  514



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 351/467 (75%), Gaps = 10/467 (2%)
 Frame = -3

Query  1739  FFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLAS  1560
              FGT+SSSYQ+EG YL+DGKGL+NWDVF+H+PG I+DG+NGDVA D Y  Y+ED DL+  
Sbjct  450   LFGTASSSYQFEGAYLTDGKGLNNWDVFTHKPGTIMDGTNGDVAVDHYHRYQEDVDLMDY  509

Query  1559  LGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQ  1380
             +GVNS++FS+SW+R+LPKGR G +N  GI YY  L+D+++ K IEPFVT++HYD+P EL+
Sbjct  510   IGVNSYRFSLSWARILPKGRFGKVNWAGIDYYNQLVDTIVSKEIEPFVTMSHYDIPLELE  569

Query  1379  DRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------  1221
             +RY GWLSPE+QE++ Y+A++CFK+ GD+VKYW+TFNEPN+  I  YR  +WP       
Sbjct  570   ERYGGWLSPEIQEDFKYYANICFKNFGDRVKYWVTFNEPNVATIRGYRTGMWPPSRCSGS  629

Query  1220  HGNCS-EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
              GNCS  G++ ++ FI A N++L+HA AV++YR  YQ++QGG+IG+ M   WF P++NS 
Sbjct  630   FGNCSYGGDSEREPFIAASNLLLSHAVAVDLYRTKYQKKQGGKIGVVMNAIWFEPVSNSW  689

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK AAERA SF  NWFLDPI+ G YP EM +ILG  LP FS  D+EKLK+ G DFIG+N
Sbjct  690   KDKLAAERAQSFYMNWFLDPIIIGEYPAEMHEILGQDLPTFSRYDVEKLKS-GLDFIGVN  748

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HYT+ +A+DC++S C+    G++R EGF  +S   NG  IGE T L +L V+P GME+++
Sbjct  749   HYTSAFAKDCIFSACEQG-RGSSRTEGFTLRSPQMNGISIGEPTALDWLYVHPQGMEKIL  807

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
             TY K ++ +IP+++TE G       N + +E+++D +RV++L  YL ++ TAIRKGADVR
Sbjct  808   TYLKHRYNNIPMFITENGIGMRENSNHATKEIINDVERVEYLRGYLDSLATAIRKGADVR  867

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             GYF+WSL DNFEWT GY+ R GL+  D AT  RTP++SA WYK FIA
Sbjct  868   GYFVWSLLDNFEWTDGYSIRFGLHHVDYATLNRTPRMSAFWYKNFIA  914



>ref|XP_010473402.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 351/479 (73%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS++QYEG YL+DGKGL+NWDVF H+ P  I+DGSNGD+AADQY  Y ED   
Sbjct  38    DFFFGTASSAFQYEGAYLTDGKGLNNWDVFVHENPEKIVDGSNGDIAADQYHRYMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSRVLPKGR G IN +GI+YY NLI++L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRVLPKGRFGGINYKGIRYYDNLINALIRKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EM +++ Y AD CFKH GD+VK+W+T NEPN     AYR  L+     
Sbjct  158   ELENRFKSWLSSEMVKDFGYLADTCFKHFGDRVKHWMTLNEPNQQITLAYRAGLFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS+GN+  + FI AHNMILAH+ AV IY+  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCSQGNSETEPFIAAHNMILAHSKAVQIYQTKYQKEQRGSIGIVVQTSWFEPVSD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP+++G YP+EM +ILGS LPEFSS ++  LK   SDF+G
Sbjct  278   SIADKKAAERAQSFYSNWILDPVVFGKYPEEMVNILGSALPEFSSNEMNNLKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL + C+ S  G ++ EGF  + L + GN  IGELT + +  + P G +
Sbjct  338   INHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFK  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P ++I+E++HDTKR+++L++YL A+  A+R GA
Sbjct  396   KMLNYLKNRYHNIPMYITENGFGQLQKPETTIKELMHDTKRIQYLSEYLDALKAAMRDGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI ++  ++  +
Sbjct  456   NVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYTTLKRTPKKSASWYKNFIEQHVNIEDHI  514



>ref|XP_009105270.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Brassica rapa]
Length=517

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/468 (55%), Positives = 345/468 (74%), Gaps = 9/468 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGTSSS+YQYEG YL+DGKGL+NWDVFSH+ PG+ILDG NGD+A DQY+ + ED   
Sbjct  38    DFLFGTSSSAYQYEGAYLTDGKGLNNWDVFSHENPGDILDGGNGDIAVDQYNRFMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLPKGR G+IN  GIK+Y  LID+L+  GI PFVT+NH+D PQ
Sbjct  98    MNYLGVNSYRFSISWSRVLPKGRLGSINHLGIKHYNRLIDALIRNGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLSPEMQ+E+ Y AD CFK+ GD+VK+WIT NEPN   I +Y   ++     
Sbjct  158   ELENRFKSWLSPEMQKEFGYLADTCFKYFGDRVKHWITINEPNQQIILSYLKGIFPPNRC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCS+GN+  + FI AHN ILAHA AV IY+  Y+++Q G IGI +  +WF P+++
Sbjct  218   SMPFGNCSQGNSETEPFIAAHNTILAHAKAVQIYQTKYKKEQKGSIGIVVQTSWFEPISD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             ST DK AAERA SF SNW LDP++YG YP+EM ++LGS LP+FS  +++ LK   SDF+G
Sbjct  278   STADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSIKEMKNLKRYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+Y+ QDCL S C+ S  G +R EGF  + + K    +GE+T + +L + P G  +
Sbjct  338   INHYTSYFIQDCLISACN-SGDGASRSEGFALKLIQKGNVSVGEVTDVSWLNIDPEGFRK  396

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             ++ Y  +++P+IP+++TE G  +   P ++++E+L+DTKRV++L+ YL A+ TA+R GA+
Sbjct  397   MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALQTAMRDGAN  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             V+GYF WSL DNFEW  GY  R G++  D  T KRTPK SA WYK FI
Sbjct  457   VKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTTLKRTPKQSAYWYKNFI  504



>gb|AFK44109.1| unknown [Medicago truncatula]
Length=521

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/477 (55%), Positives = 343/477 (72%), Gaps = 12/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SSSYQYEG Y SDGKG SNWD F+H   G I+DGSNGD+A D Y  Y+ED +L
Sbjct  36    NFLFGTASSSYQYEGAYNSDGKGQSNWDNFTHGGRGIIVDGSNGDIAVDHYHRYQEDINL  95

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             L  L VNSH+ SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQ
Sbjct  96    LEDLEVNSHRLSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQ  155

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             EL+DRY G LSP+ Q+++A++AD+CFK  GD+VK+WITFNEPN  A   YR  L+P   C
Sbjct  156   ELEDRYGGLLSPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFPPRRC  215

Query  1208  S---------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
             S         EG++ K+ F+ AHN+IL+HAAAV+IYR  YQ +Q G IGI +   W+ PM
Sbjct  216   SGSLAIVTCNEGDSEKEPFVAAHNIILSHAAAVDIYRTKYQAEQKGRIGIVISHEWYEPM  275

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
             +NS  DK AAERA SF  NW LDPI++G YPKEM+++LGS LP+FSS + +KL   G DF
Sbjct  276   SNSNADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSNEKKKLMK-GLDF  334

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             IGIN+YT++Y QDC+Y+ CD S SG +R EG    S  +NG  IGE T   +  +YP GM
Sbjct  335   IGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGM  393

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+ VTY K+++ + P+++TE GY      N + E+ L+D KR+K++  ++ A+ TAIRKG
Sbjct  394   EKTVTYVKDRYNNTPMFITENGYGQQDDQNLTSEDQLNDFKRIKYMKSHIEALSTAIRKG  453

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             ADVRGYF WSL DN EW  GYT R G +  D AT KRTP+LSA WYKQFI   ++ +
Sbjct  454   ADVRGYFAWSLLDNLEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIVNYKQTE  510



>ref|XP_006348092.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=517

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 340/467 (73%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG  LSDGKGL+NWDVF+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  41    NFLFGTASSSYQYEGAILSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+PF+T+ HYD+PQE
Sbjct  101   EDMGVNSYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPFITLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLS  +Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   +P     
Sbjct  161   LEERYGGWLSSRIQDDFSYYADICFKYFGDRVKYWTTINEPNVMALFGYRLGTYPPARCS  220

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV IYR  YQ++QGG IGIA+   W+ P +NS
Sbjct  221   GIFGNCSAGDSEREPFIAAHNMILSHAAAVRIYRTRYQKRQGGMIGIALDIQWYEPFSNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AA ERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL   G DFIGI
Sbjct  281   SEDIAATERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY-GLDFIGI  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    GNT  EG    ++ K+G FIG+ TG+ +L +YP GM+++
Sbjct  340   NYYTANYIKDCLYSACE---HGNTWSEGSYFATIEKDGVFIGQPTGVEWLFLYPQGMKKI  396

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K+KF + P+ +TE G  +    N SI + L+D  RV ++  YL+++  AIR+GADV
Sbjct  397   VMYMKDKFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAIREGADV  456

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  457   RGYFVWSLLDNFEWLDGYKLRFGLHFVNYTNLQRTPKLSATRYKQLM  503



>ref|XP_006300409.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
 gb|EOA33307.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
Length=516

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 355/479 (74%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS+YQYEG YL+DGKGL+NWD+F+H+ P  ILDGSNGDVAADQY  Y ED + 
Sbjct  38    DFFFGTASSAYQYEGAYLTDGKGLNNWDIFAHENPEKILDGSNGDVAADQYHRYMEDIES  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSR+LPKGR G IN +GIKYY NLI++L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRILPKGRFGGINYKGIKYYNNLINALISKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
              L+++++ WLS EM +++ Y AD+CFKH GD+VK+W+T NEPN   I AY+  ++     
Sbjct  158   NLENQFKSWLSSEMGKDFGYLADICFKHFGDRVKHWMTINEPNQQIILAYQKGIFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC++GN+  + FI AHNMILAHA AV IYR  YQ++Q G IGI +  +WF P+++
Sbjct  218   SKPYGNCTQGNSETEPFIAAHNMILAHAKAVQIYRTKYQKEQRGSIGIVVQTSWFEPVSD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA +F SNW LDP+++G YP+EM +ILGS LP+FSS+++  LK   SDF+G
Sbjct  278   SIADKKAAERAQAFYSNWILDPVVFGKYPEEMVNILGSDLPQFSSSEMNNLKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDC+ + C+ S  G ++ EGF  + L + GN  IGELT + +  + P G +
Sbjct  338   INHYTSYFIQDCMITACN-SGEGASKSEGFALK-LDRKGNVSIGELTDVNWQHIDPDGFK  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P +++EE+LHDTKR+ +L+ YL A+  A+R GA
Sbjct  396   KMLHYLKIRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIHYLSGYLDALKAAMRDGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKM  336
             +V+GYF WSL DN+EW  GY  R GL+  D  T KRTPK SA WYK FI ++  +++++
Sbjct  456   NVKGYFEWSLLDNYEWLYGYKVRFGLFHVDYTTLKRTPKQSASWYKNFIEQHVNIENQI  514



>emb|CDY55219.1| BnaA01g36270D [Brassica napus]
Length=517

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/468 (54%), Positives = 343/468 (73%), Gaps = 9/468 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGTSSS+YQYEG YL+DGKGL+NWDVFSH+ PG+ILDG NGD+A DQY+ + ED   
Sbjct  38    DFLFGTSSSAYQYEGAYLTDGKGLNNWDVFSHENPGDILDGGNGDIAVDQYNRFMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLPKGR G+IN  GIK+Y  LID+L+  GI P VT+NH+D PQ
Sbjct  98    MNYLGVNSYRFSISWSRVLPKGRLGSINHLGIKHYNRLIDALIRNGITPLVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLSPEMQ+E+ Y AD CFKH GD+VK+WIT NEPN   I +Y   ++     
Sbjct  158   ELENRFKSWLSPEMQKEFGYLADTCFKHFGDRVKHWITINEPNQQIILSYLKGIFPPNRC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCS+GN+  + FI AHN ILAHA AV IY+  Y+++Q G IGI +  +WF P+++
Sbjct  218   SMPFGNCSQGNSETEPFIAAHNTILAHAKAVQIYQTKYKKEQKGSIGIVVQTSWFEPISD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             ST DK AAERA SF SNW LDP++YG YP+EM ++LGS LP+FS  +++ LK   SDF+G
Sbjct  278   STADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSIKEMKNLKRYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+Y+ QDCL S C+ S  G +R EGF  + + K    +GE+T + +L + P G  +
Sbjct  338   INHYTSYFIQDCLISACN-SGDGASRSEGFALKLIQKGNVSVGEVTDVSWLNIDPEGFRK  396

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             ++ Y  +++P+IP+++TE G  +   P ++++E+L+DTKRV++L+ YL A+  A+R GA+
Sbjct  397   MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALQRAMRDGAN  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             V+GYF WSL DNFEW  GY  R G++  D  T KRTPK SA WYK FI
Sbjct  457   VKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTTLKRTPKQSAYWYKNFI  504



>gb|AFK46781.1| unknown [Medicago truncatula]
Length=521

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 343/477 (72%), Gaps = 12/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNIL-DGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SSSYQYEG Y SDGKG SNWD F+H    I+ DGSNGD+A D Y  Y+ED +L
Sbjct  36    NFLFGTASSSYQYEGAYNSDGKGQSNWDNFTHGGRCIIVDGSNGDIAVDHYHRYQEDINL  95

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             L  L VNSH+ SISW+R+LPKGR G +N  GI +Y  L+D+L+LKGI+PFVT++HYD+PQ
Sbjct  96    LEDLEVNSHRLSISWARILPKGRFGEVNWAGIDFYNKLLDALMLKGIQPFVTLSHYDIPQ  155

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             EL+DRY G LSP+ Q+++A++AD+CFK  GD+VK+WITFNEPN  A   YR  L+P   C
Sbjct  156   ELEDRYGGLLSPQSQDDFAFYADLCFKTFGDRVKFWITFNEPNYLASLGYRSGLFPPRRC  215

Query  1208  S---------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
             S         E ++ K+ F+ AHN+IL+HAAAV+IYR  YQ +Q G IGI +   W+ PM
Sbjct  216   SGSLAIVTCNERDSEKEPFVAAHNIILSHAAAVDIYRTKYQAEQKGRIGIVISHEWYEPM  275

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
             +NS  DK AAERA SF  NW LDPI++G YPKEM+++LGS LP+FSS + +KL   G DF
Sbjct  276   SNSNADKLAAERARSFTFNWILDPIIFGKYPKEMENVLGSLLPKFSSNEKKKLMK-GLDF  334

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             IGIN+YT++Y QDC+Y+ CD S SG +R EG    S  +NG  IGE T   +  +YP GM
Sbjct  335   IGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYMTSGYRNGVSIGEATPFTWFNIYPQGM  393

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+ VTY K+++ + P+++TE GY      N ++E+ L+D KR+K++  ++ A+ TAIRKG
Sbjct  394   EKTVTYVKDRYNNTPMFITENGYGQQDDQNLTLEDQLNDFKRIKYMKSHIEALSTAIRKG  453

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             ADVRGYF WSL DNFEW  GYT R G +  D AT KRTP+LSA WYKQFI   ++ +
Sbjct  454   ADVRGYFAWSLLDNFEWIYGYTVRYGFHHVDYATLKRTPRLSASWYKQFIVNYKQTE  510



>ref|XP_006391959.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
 gb|ESQ29245.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
Length=520

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/472 (55%), Positives = 345/472 (73%), Gaps = 11/472 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS+YQYEG + +DGKGL+NWDVF+H+ P  I+   NGD+A DQY L+ +D   
Sbjct  40    DFFFGTASSAYQYEGAFSTDGKGLNNWDVFTHENPEKIIKEGNGDIAVDQYHLFMKDIQS  99

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++ SISWSRVLPKGR+G IN  GIK+Y  LID+L+  GI PFVT+NH+D PQ
Sbjct  100   MTYLGVNSYRLSISWSRVLPKGRNGGINHLGIKHYNRLIDALIRNGITPFVTLNHFDYPQ  159

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EMQ+E+ Y AD+CFKH GD+VK+WIT NEPN   I +Y   ++     
Sbjct  160   ELENRFKSWLSSEMQKEFGYLADLCFKHFGDRVKHWITINEPNQQIILSYLKGIFPPSRC  219

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS+GN+  + FI AHN ILAHA AV IYR  YQ++Q G IGI +  +WF P++N
Sbjct  220   SMPYGNCSQGNSNTEPFIAAHNTILAHAKAVQIYRTKYQKEQKGIIGIVVQTSWFEPVSN  279

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YP+EM DILGS LP FSS ++  LK   SDF+G
Sbjct  280   SIADKKAAERAQSFYSNWILDPVVYGRYPQEMVDILGSALPRFSSNEMMNLKRYKSDFLG  339

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDC+ S C+ S  G ++ EGF  + L +NGN  IGELT + +L + P G  
Sbjct  340   INHYTSYFIQDCMTSACN-SGDGASKSEGFALK-LDRNGNVSIGELTDVSWLHIDPEGFR  397

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K+++P+IP+++TE GY D   P ++++E+L+DT+R+ +++ YL A+  A+R GA
Sbjct  398   KMLNYLKDRYPNIPMFITENGYGDLQKPETTVKELLNDTRRIHYMSGYLDALKDAMRDGA  457

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             +V+GYF WSL DNFEW  GYT R GLY  D  T KRTPK SA WYK FI ++
Sbjct  458   NVKGYFAWSLLDNFEWLYGYTLRFGLYHVDYTTLKRTPKQSALWYKNFIEQH  509



>ref|XP_006348091.1| PREDICTED: probable inactive beta-glucosidase 14-like [Solanum 
tuberosum]
Length=517

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/467 (55%), Positives = 343/467 (73%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG  +SDGKGL+NWDVF+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  41    NFLFGTASSSYQYEGAIVSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LPKG  G++N+ GI++Y NLID+LL KGI+PF+T+ HYD+PQE
Sbjct  101   EDMGVNSYRFSISWARILPKGTFGDVNMAGIEHYNNLIDALLQKGIQPFITLTHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPH----  1218
             L++RY GWLS ++Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR    P     
Sbjct  161   LEERYGGWLSSQIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTHPPGRCS  220

Query  1217  ---GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV+IYR  YQ++QGG IGI++   W+ P +NS
Sbjct  221   GILGNCSAGDSEREPFIAAHNMILSHAAAVSIYRTRYQKRQGGMIGISLDTQWYEPFSNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AAAERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL   G DFIGI
Sbjct  281   SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY-GLDFIGI  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCL+S C+    GNT  EG    +  K+G +IG+ TG P++ +YP GM+++
Sbjct  340   NYYTAKYIKDCLFSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYPQGMKKI  396

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y +++F + PL +TE G  +    N SI + L+D  RV +L  YL+++  AIR+GADV
Sbjct  397   VMYMRDRFNNTPLVITENGVSENDNLNPSITDTLNDIHRVNYLHSYLNSLANAIREGADV  456

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW +GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  457   RGYFVWSLLDNFEWLNGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  503



>ref|XP_004234482.1| PREDICTED: beta-glucosidase 46-like [Solanum lycopersicum]
Length=517

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/467 (53%), Positives = 348/467 (75%), Gaps = 9/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQ+EG +LSDGKGL+NWDVF+H+ G+I DGSNGD+A D Y+ Y+ED  L+
Sbjct  41    NFLFGTASSCYQFEGAFLSDGKGLNNWDVFTHEAGHIADGSNGDIALDHYNRYQEDIKLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS +FSISW+R+LP G +G +N+ GI++Y  LID LL KGI+PFVT+ HYD+PQE
Sbjct  101   EDMGVNSFRFSISWARILPNGMYGGVNMAGIQHYNKLIDVLLQKGIQPFVTLAHYDIPQE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLSP++Q+++ Y+ D CFK+ GD+VKYW+T NEPN+ A+  YR+  +P     
Sbjct  161   LEERYGGWLSPKIQDDFCYYGDTCFKYFGDRVKYWVTINEPNVMAVRGYRFGTFPPVRCS  220

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ GN+ K+ FI AHNMIL+HAA V IY+  YQ +QGG IGI++   W+ P +NS
Sbjct  221   GSFGNCNFGNSEKEPFIAAHNMILSHAALVTIYKTKYQVRQGGMIGISLNTQWYEPFSNS  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D  A +RA SF+ NWFLDPI++G YP+EM+ ILG++LP+FS  D++KLK  G DFIG+
Sbjct  281   SEDNYATQRARSFVYNWFLDPIIFGKYPEEMQKILGNNLPKFSRNDIKKLK-NGLDFIGL  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT  Y +DCL+S C+     ++  EG   ++  K+G +IGE T + +L VYP GME++
Sbjct  340   NHYTAAYIKDCLFSVCEHGQY-SSWSEGSYFRATEKDGVYIGEPTTMDWLFVYPQGMEKL  398

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  ++  PNSS+E+ L+DT+RV+++ +YL+++  A+R+GA+V
Sbjct  399   VMYMKDRFNNTPIIITENGIAESDNPNSSLEDALNDTQRVEYMHNYLNSLANAMREGANV  458

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW  GYTKR GL+  +    +RTPKLSA  YK+ I
Sbjct  459   RGYFAWSLLDNFEWLEGYTKRFGLHYVNFTNLQRTPKLSATRYKELI  505



>ref|XP_010533827.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/476 (54%), Positives = 339/476 (71%), Gaps = 9/476 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FGT+SS+YQYEG YL++GKGL+NWDVF+H QPG ILDGSNGD+A DQY  + ED +L+
Sbjct  39    FLFGTASSAYQYEGAYLTEGKGLNNWDVFTHHQPGKILDGSNGDIAVDQYHRFLEDIELM  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVNS++FSISW+R+LPKGR G IN  GIKYY  LID+LL KGI+PFVT+NH D PQE
Sbjct  99    ASLGVNSYRFSISWARILPKGRFGGINYSGIKYYNRLIDALLSKGIQPFVTLNHLDYPQE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRYQ WLSPE++E++ Y AD CF++ G +VK+WIT NEPN   + +YR  ++      
Sbjct  159   LEDRYQSWLSPEIREDFGYLADTCFRYFGHRVKHWITVNEPNQQIVLSYRKGIFPPCRCS  218

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P+GNC +GN+  + F  AHNMILAHA AV IYR  YQ++Q G IGI +  +WF P++ S
Sbjct  219   SPYGNCGKGNSETEPFTAAHNMILAHAEAVRIYRTKYQKEQSGSIGIVVQTSWFEPISES  278

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAERA SF SNW LDP +YG YP EM ++LG  LPEFS    + LK  G DF+GI
Sbjct  279   TADKLAAERAQSFYSNWILDPAIYGKYPDEMVELLGPALPEFSVDQAKDLKKLGVDFVGI  338

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+Y+ +DC +S+C     G++R EGF  +   K    IGELT + +  VYP G  +V
Sbjct  339   NHYTSYFVKDCYFSSCQRG-DGSSRTEGFALKFDRKGNVSIGELTDVDWQHVYPRGFRKV  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K ++ + P++VTE GY D    ++++EE+++D KR +++  +L+A+  A+R GA+V
Sbjct  398   LDYIKNRYHNTPIFVTENGYGDLEKQDTTVEELVNDIKRREYMRGHLNALQAAMRNGANV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             +GYF WSL DN+EW  GY  R GL+  D  T  RTPKLSA WYK FI  +    S+
Sbjct  458   KGYFAWSLLDNYEWLYGYRLRFGLFHVDFTTLNRTPKLSASWYKYFINYHTNTSSR  513



>ref|XP_006391958.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
 gb|ESQ29244.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
Length=518

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 348/473 (74%), Gaps = 13/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L++GKGL+NWD+F+H+ PG I D +NGD+A DQY  + ED  L
Sbjct  43    DFLFGTASSAYQYEGAFLAEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFMEDIQL  102

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQ
Sbjct  103   MTSLGVNSYRFSISWSRVLPRGRFGGINYSGIKYYDRLIDALISRGIKPFVTLNHLDYPQ  162

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             E ++R+Q WLS EMQ+++ Y AD+CFKH GD+VK+W TFNEPN   I ++        R 
Sbjct  163   EFENRFQSWLSREMQDDFGYLADLCFKHFGDRVKHWTTFNEPNQQIILSHLKGTFPPSRC  222

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+  + FI AHNMILAHA AV+IYR  YQ++Q G IGI +  +WF P++
Sbjct  223   SL-PYGNCSQGNSETEPFIAAHNMILAHAKAVHIYRIKYQEKQRGIIGIVVQTSWFEPIS  281

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S  D+ AAERA SF SNW LDPI+YG YPKEM  ILGS+LP FS  ++E ++  G DF+
Sbjct  282   DSIEDREAAERAQSFYSNWILDPIIYGKYPKEMVTILGSNLPRFSRMEMENIRKSGLDFV  341

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL+STC+    G  + EGF    L + GN  IGELT + +  ++P G 
Sbjct  342   GINHYTSYFVQDCLFSTCNAG-DGAFKAEGF-ALKLDRKGNVSIGELTDVNWQHIHPEGF  399

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             ++++ Y K ++ +I +++TE G+ D   P ++++E+L+DTKR+++++ YL A+ +AIR G
Sbjct  400   QKMLNYLKNRYHNITMFITENGFGDLQKPETTVKELLNDTKRIQYMSGYLDALQSAIRDG  459

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             A+V+GYF WSL DNFEW  GY  R GL+  D  T +RTPKLSA WYK +I ++
Sbjct  460   ANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLERTPKLSASWYKNYIEEH  512



>ref|XP_009105752.1| PREDICTED: beta-glucosidase 45-like [Brassica rapa]
Length=516

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 344/473 (73%), Gaps = 13/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L++GKGL+NWD+F+H+ PG I D +NGD+A DQY  +KED  L
Sbjct  41    DFLFGTASSAYQYEGAFLTEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFKEDIQL  100

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVN ++FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQ
Sbjct  101   MTSLGVNGYRFSISWSRVLPRGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQ  160

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL++R+Q WLSPEMQ ++ Y AD+CFKH GD+VK+W T NEPN   I  +        R 
Sbjct  161   ELENRFQSWLSPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFPPSRC  220

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+ ++ FI AHN ILAHA AV+IYR  YQ +Q G IGI +  +WF P++
Sbjct  221   SL-PYGNCSQGNSEREPFIAAHNTILAHAKAVHIYRSKYQVKQRGIIGIVVQTSWFEPIS  279

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S  D+ AAERA SF SNW LDPI+YG YPKEM ++LGS LP FS  ++E LK    DFI
Sbjct  280   DSIADREAAERAQSFYSNWILDPIIYGKYPKEMVNVLGSALPRFSRKEMENLKQLRLDFI  339

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL+STC+    G ++ +GF    L + GN  IGELT + +  ++P G 
Sbjct  340   GINHYTSYFIQDCLFSTCNAG-DGASKAQGF-ALKLDRKGNVSIGELTDVNWQHIHPEGF  397

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
              + + Y K ++ +IP+++TE G+ D   P +++ E+L+DTKR+++++ YL A+ +A+R G
Sbjct  398   RKTLNYLKNRYHNIPMFITENGFGDLQKPETTLTELLNDTKRIQYMSGYLDALQSAMRDG  457

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             A+V+GYF WSL DNFEW  GY  R GL+  D  + KRTPKLSA WYK +I ++
Sbjct  458   ANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTSLKRTPKLSASWYKNYIGEH  510



>ref|XP_010430205.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Camelina sativa]
Length=498

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 342/462 (74%), Gaps = 11/462 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFGT+SS++QYEG YL+DGKGL+NWDVF+H+ P  I+DGSNGD+AADQY  Y ED   
Sbjct  38    DFFFGTASSAFQYEGAYLTDGKGLNNWDVFAHENPEKIVDGSNGDIAADQYHRYMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++ SISWSRVLPKGR G IN +GI+YY NLI +L+ KGI PFVT+NH+D PQ
Sbjct  98    MSFLGVNSYRLSISWSRVLPKGRFGGINYKGIRYYDNLIKALIGKGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLS EM +++ Y AD+CFKH GD+VK+W+T NEPN     AYR  L+     
Sbjct  158   ELENRFKSWLSSEMVKDFGYLADICFKHFGDRVKHWMTLNEPNQQITLAYRKGLFPPARC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCSEGN+  + FI AHNMILAH+ AV IYR  YQ++Q G IGI +  +WF P+++
Sbjct  218   SMPYGNCSEGNSETEPFIAAHNMILAHSKAVQIYRTKYQKEQRGSIGIVVQTSWFEPVSD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP+++G YP+EM  ILGS LPEFSS ++  LK   SDF+G
Sbjct  278   SIADKKAAERAQSFYSNWILDPVVFGKYPEEMVKILGSALPEFSSNEMNNLKNYKSDFLG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL + C+ S  G ++ EGF  + L + GN  IGELT + +  + P G +
Sbjct  338   INHYTSYFIQDCLITACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVDWQHIDPDGFK  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++ +IP+Y+TE G+     P ++++E++HDTKR+++L++YL A+  A+R GA
Sbjct  396   KMLNYLKNRYHNIPMYITENGFGQLQKPETTVKELMHDTKRIQYLSEYLDALKAAMRDGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSA  387
             +V+GYF WSL DNFEW  GY  R GL+  D AT KRTPK SA
Sbjct  456   NVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYATLKRTPKQSA  497



>ref|XP_006302139.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
 gb|EOA35037.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
Length=522

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 340/469 (72%), Gaps = 11/469 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG + +DGK L+NWDVF+H+ PG ILD +NGD+A DQY  + ED   
Sbjct  45    DFLFGTASSAYQYEGAFSTDGKSLNNWDVFTHENPGKILDENNGDIAVDQYHRFMEDIQS  104

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH+D P 
Sbjct  105   MNFLGVNSYRFSISWSRVLPRGRFGEINYSGIKYYNILIDALISRGIKPFVTLNHFDYPH  164

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R+Q WL PEMQ E+ Y AD+CFKH G++VKYW T NEPN   I  Y   L+     
Sbjct  165   ELENRFQSWLEPEMQIEFGYLADLCFKHFGNRVKYWTTLNEPNQQVILGYVTGLFPPSRC  224

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC+ GN+  + FI AHNMILAHA AVNIY+  YQ++Q G IGI +  +WF P+++
Sbjct  225   SSPYGNCTRGNSENEPFIAAHNMILAHAKAVNIYQTKYQKEQKGSIGIVVQTSWFEPISD  284

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP +YG YPKEM +ILG+ LP+FSS +++ LK   +DFIG
Sbjct  285   SNADKEAAERAQSFYSNWILDPAIYGKYPKEMVNILGAALPQFSSNEVKNLKNSRADFIG  344

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             +NHYT+Y+ QDCL STC+ + +G  + EGF  + L + GN  IGELT + +  + P G  
Sbjct  345   VNHYTSYFIQDCLISTCN-TGNGAYKAEGFALK-LDRKGNVSIGELTDVVWQHIDPEGFH  402

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y  +++P+IP+++TE G+ D   P ++ +E+LHDTKR+++++ YL A+  A+R GA
Sbjct  403   KMLNYLTDRYPNIPMFITENGFGDLQKPETTDKELLHDTKRIQYMSGYLEALQAAMRDGA  462

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI
Sbjct  463   NVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKNFI  511



>ref|XP_010316605.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
 ref|XP_010316606.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
Length=520

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/467 (54%), Positives = 340/467 (73%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQ+EG +LSDGK L+NWD+F+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  44    NFLFGTASSCYQFEGAFLSDGKSLNNWDIFTHEAGHIEDGSNGDVAVDHYNRYLEDIKLM  103

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGIEPF+T+ HYD+PQE
Sbjct  104   EDMGVNSYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIEPFITLTHYDVPQE  163

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLS  +Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   +P     
Sbjct  164   LEERYGGWLSSRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTYPPARCS  223

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAA++IYR  YQ++QGG IGI++   WF P +NS
Sbjct  224   GIFGNCSAGDSEREPFIAAHNMILSHAAAISIYRTRYQKRQGGMIGISLDTQWFEPFSNS  283

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AAAERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL   G DFIGI
Sbjct  284   SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY-GLDFIGI  342

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    GNT  EG    +  K+G +IG+ TG P++ +YP GM+++
Sbjct  343   NYYTAKYIKDCLYSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYPQGMKKI  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y +E+F + P+ +TE G  +    N SI + L+D+ RV +L   L+++  AIR+GADV
Sbjct  400   VMYMRERFNNTPVVITENGIAENDNLNPSITDTLNDSHRVNYLYSCLNSLANAIREGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  460   RGYFVWSLLDNFEWLHGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  506



>emb|CDY47163.1| BnaA01g22890D [Brassica napus]
Length=516

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 343/473 (73%), Gaps = 13/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L++GKGL+NWD+F+H+ PG I D +NGD+A DQY  +KED  L
Sbjct  41    DFLFGTASSAYQYEGAFLTEGKGLNNWDIFTHENPGKIRDENNGDMAVDQYHRFKEDIQL  100

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLG+N ++FSISWSRVLP+GR G IN  GIKYY  LID+L+ +GI+PFVT+NH D PQ
Sbjct  101   MTSLGLNGYRFSISWSRVLPRGRFGGINYSGIKYYNRLIDALISRGIKPFVTLNHLDYPQ  160

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL++R+Q WLSPEMQ ++ Y AD+CFKH GD+VK+W T NEPN   I  +        R 
Sbjct  161   ELENRFQSWLSPEMQNDFGYLADICFKHFGDRVKHWTTLNEPNQQIILTHLKGTFPPSRC  220

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+ ++ FI AHN ILAHA AV+IYR  YQ +Q G IGI +  +WF P++
Sbjct  221   SL-PYGNCSQGNSEREPFIAAHNTILAHAKAVHIYRSKYQVKQRGIIGIVVQTSWFEPIS  279

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S  D+ AAERA SF SNW LDPI+YG YPKEM ++LGS LP FS  ++E LK    DFI
Sbjct  280   DSIADREAAERAQSFYSNWILDPIIYGKYPKEMVNVLGSALPRFSRKEMENLKQLRLDFI  339

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL+STC+    G +  +GF    L + GN  IGELT + +  ++P G 
Sbjct  340   GINHYTSYFIQDCLFSTCNAG-DGASEAQGF-ALKLDRKGNVSIGELTDVNWQHIHPEGF  397

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
              + + Y K ++ +IP+++TE G+ D   P +++ E+L+DTKR+++++ YL A+ +A+R G
Sbjct  398   RKTLNYLKNRYHNIPMFITENGFGDLQKPETTLTELLNDTKRIQYMSGYLDALQSAMRDG  457

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             A+V+GYF WSL DNFEW  GY  R GL+  D  + KRTPKLSA WYK +I ++
Sbjct  458   ANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTSLKRTPKLSASWYKNYIGEH  510



>ref|XP_009803936.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=517

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/467 (56%), Positives = 340/467 (73%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQYEG YLSDGKGLSNWDVF+H+ G+I +GSNGDVA D Y  Y ED  L+
Sbjct  44    NFLFGTASSYYQYEGAYLSDGKGLSNWDVFTHEAGHIKEGSNGDVAVDHYHRYLEDIKLM  103

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             A +GVNS++FSISW+R+LPKG  G +N+ GI++Y  LID+LL KGI+PFVT+ H+D+PQE
Sbjct  104   ADIGVNSYRFSISWARILPKGIFGEVNMAGIEFYSKLIDALLQKGIQPFVTLTHFDIPQE  163

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             LQDRY GWLS +++++++YFA++CFK+ GD+VKYW+T NE N  AIA YR   +P     
Sbjct  164   LQDRYGGWLSSQIRDDFSYFANICFKYFGDRVKYWVTMNEANFMAIAGYRDGTYPPTRCS  223

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HA AV+IYR  YQ+ QGG IGI M F WF P++NS
Sbjct  224   GIFGNCSAGDSEREPFIAAHNMILSHANAVSIYRTRYQKSQGGMIGITMGFEWFEPLSNS  283

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AA  RA SF  +WFLDPI+ G YPKEM  ILGS+LPE S  DL KL   G DFIGI
Sbjct  284   SEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGSNLPELSMNDLSKLSY-GLDFIGI  342

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+  Y +DCLYS C+    GN+  EG   ++  ++G +IGE   + +  VYP G+E+V
Sbjct  343   NHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQGIEKV  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K+KF + P+++TE G+   +   SSIE+ L+D +RVK+L   L+++  AIRKGADV
Sbjct  400   VMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDVRRVKYLHSNLNSLANAIRKGADV  456

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY+ R GLY  +    +RTPKLSA  Y++ +
Sbjct  457   RGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPKLSATKYQELM  503



>gb|KFK40644.1| hypothetical protein AALP_AA2G023300 [Arabis alpina]
Length=518

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/476 (53%), Positives = 344/476 (72%), Gaps = 11/476 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +FFFG +SS+YQYEG YL+DGKGL+NWDVF+H+ PG I DG NGD+AADQY  + ED   
Sbjct  40    DFFFGAASSAYQYEGAYLTDGKGLNNWDVFTHENPGKIGDGKNGDIAADQYHRFMEDIKS  99

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LG+NS++ SISWSRVLPKGR G +N  GIK+Y +LID+L+  GI+PFVT+NH+D PQ
Sbjct  100   MTYLGLNSYRLSISWSRVLPKGRFGGVNYLGIKHYNSLIDALIKNGIKPFVTLNHFDYPQ  159

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
               +D++Q WLSPE+Q E+ Y AD+CFKH GD+VK+W+T NEPN   I +Y   ++     
Sbjct  160   VFEDKFQSWLSPEIQIEFGYLADICFKHFGDRVKHWMTINEPNQQIILSYTKGIFPPSRC  219

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS GN+  + F+ AHNMILAHA AV IYR  YQ+ Q G IGI +  +WF P+++
Sbjct  220   STPYGNCSHGNSETEPFVAAHNMILAHAKAVQIYRTKYQKAQRGIIGIVVQTSWFEPISD  279

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YP+EM +ILG  LP+FS+ ++  L    SDF+G
Sbjct  280   SIADKKAAERAQSFYSNWILDPVVYGRYPEEMVNILGPDLPQFSNNEINNLMNSKSDFLG  339

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL S C+ S  G ++ EGF  + L + GN  IGELT + +  ++P G +
Sbjct  340   INHYTSYFIQDCLSSACN-SGDGASKSEGFALK-LDRKGNVSIGELTDVSWQHIHPEGFQ  397

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y   ++P+IP+++TE GY     P ++I+E+L+DTKR++F++ YL A+  A+R GA
Sbjct  398   KMLNYLTVRYPNIPMFITENGYGQLQKPETTIKELLNDTKRIQFMSGYLDALQGAMRDGA  457

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK+FI ++ K +
Sbjct  458   NVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKKFIEQHVKTE  513



>ref|NP_176374.1| beta-glucosidase 45 [Arabidopsis thaliana]
 sp|O80689.1|BGL45_ARATH RecName: Full=Beta-glucosidase 45; Short=AtBGLU45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28501.1| Similar to beta-glucosidase BGQ60 precursor gb|L41869 from Hordeum 
vulgare [Arabidopsis thaliana]
 gb|AEE33890.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=520

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/472 (53%), Positives = 343/472 (73%), Gaps = 11/472 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L+DGK L+NWDVF+H+ PG ILD +N D A DQY+ + ED  L
Sbjct  41    DFLFGTASSAYQYEGAFLTDGKSLNNWDVFTHKNPGKILDKNNADRAVDQYNRFLEDIQL  100

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++FSISW R+LP+GR G IN  GIKYY   ID+L+ +GI+PFVT+NH D PQ
Sbjct  101   MSFLGVNSYRFSISWCRILPRGRFGEINYLGIKYYNIFIDALISRGIKPFVTLNHVDYPQ  160

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL+DR+Q WL+PEMQ+E+ Y AD+CFKH G++VKYW T NEPN   I  Y    +     
Sbjct  161   ELEDRFQSWLNPEMQKEFGYLADICFKHFGNRVKYWTTLNEPNQQLILGYLTGKFPPSRC  220

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS+GN+  + FI AHNMILAHA AVNIY+  YQ++Q G IGI +  +WF P+++
Sbjct  221   SSPYGNCSQGNSETEPFIAAHNMILAHAKAVNIYKTKYQKEQKGSIGIVVQTSWFEPISD  280

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YPKEM DILG  LP+FSS +++ L+   +DF+G
Sbjct  281   SNADKEAAERAQSFYSNWILDPVIYGKYPKEMVDILGPALPQFSSNEVKNLEKSRADFVG  340

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL S C+ +  G  + EG+    L + GN  IGELT + +  + P G  
Sbjct  341   INHYTSYFIQDCLTSACN-TGHGAFKAEGY-ALKLDRKGNVTIGELTDVNWQHIDPTGFH  398

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K+++P++P+++TE G+ D   P ++ +E+L+DTKR+++++ YL A+  A+R GA
Sbjct  399   KMLNYLKDRYPNMPMFITENGFGDLQKPETTDKELLNDTKRIQYMSGYLEALQAAMRDGA  458

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             +V+GYF+WSL DNFEW  GY  R GL+  D  T KR+PK SA WYK +I ++
Sbjct  459   NVKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTTLKRSPKQSASWYKNYIEEH  510



>ref|XP_010418158.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/475 (52%), Positives = 348/475 (73%), Gaps = 13/475 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L++GKGL+NWD+F+H+ PG I D +NGD+A DQY  + ED  L
Sbjct  43    DFLFGTASSAYQYEGAFLAEGKGLNNWDIFTHEYPGKIRDANNGDMAVDQYHRFMEDIQL  102

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH D PQ
Sbjct  103   MTSLGVNSYRFSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHLDYPQ  162

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL++R+Q WLSPEMQ+++ Y A++CFKH GD+VK W T NEPN   I ++        R 
Sbjct  163   ELENRFQSWLSPEMQKDFLYLANICFKHFGDRVKLWTTLNEPNNQIILSHLRGTFPPSRC  222

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+  + FI AHN+ILAHA AV +YR  Y+++Q G IGI +  +WF P++
Sbjct  223   SL-PYGNCSQGNSETEPFIAAHNVILAHAKAVQLYRTKYKEEQKGIIGIVVQTSWFEPIS  281

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S  DKAAAERA +F SNW LDP++YG YPKEM +ILGS LP FS  ++E LK   SDF+
Sbjct  282   DSIADKAAAERAQAFYSNWILDPVIYGKYPKEMVNILGSALPRFSRKEVECLKESQSDFV  341

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL S+C+  + G ++ EG+    L + GN  IGE T + +  ++P G 
Sbjct  342   GINHYTSYFIQDCLLSSCNIGV-GASKVEGY-ALKLDRKGNLTIGEPTDINWQHIHPEGF  399

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
              +++ Y K+++ +IP+++TE G+ D   P ++++E+L+D KR+++++ YL A+ +A+R G
Sbjct  400   RKMLNYLKDRYHNIPMFITENGFGDLQKPETTVKELLNDAKRIQYMSGYLDALQSAMRDG  459

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQK  351
             A+V+GYF WSL DNFEW  GY  R GLY  D  T KRTPK SA WY+ +I +N +
Sbjct  460   ANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVTLKRTPKRSASWYRNYIGENIR  514



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/471 (56%), Positives = 343/471 (73%), Gaps = 12/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             NF FGT+SSSYQYEG Y  DGKG SNWD F+H      +DGSNGD+A D Y  Y+ED DL
Sbjct  46    NFLFGTASSSYQYEGAYNVDGKGQSNWDNFTHGGRSRTVDGSNGDIAVDHYHRYQEDIDL  105

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             L +L +NSH+ SISW+R+LPKG  G +NL GI +Y  L+D+LLLKGI+PFVT++HYD PQ
Sbjct  106   LEALKINSHRLSISWARILPKGIFGEVNLAGIDFYNKLLDALLLKGIQPFVTLSHYDSPQ  165

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP----  1221
             EL++RY GWLSP+ Q++++++AD+CFK  GD+VKYW+TFNEPN      YR  ++P    
Sbjct  166   ELEERYGGWLSPQSQDDFSFYADLCFKTFGDRVKYWVTFNEPNYLVPLGYRSGIYPPIRC  225

Query  1220  -----HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
                    NC+EG++ K+ F+ AHN+IL+HAAAV+IYR  YQ +QGG IGI +   W+ P+
Sbjct  226   SGSLAMSNCNEGDSEKEPFLAAHNIILSHAAAVHIYRTKYQAEQGGRIGIVLQHEWYEPI  285

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
             +NST DK A ERA SF  NWFLDPI++G YPKEM++ILG  LP+FS+ + +KL   G DF
Sbjct  286   SNSTADKLATERARSFTFNWFLDPIIFGKYPKEMENILGCLLPKFSTNEKKKLNK-GLDF  344

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             IGIN+YT  Y QDC+Y+TCD S  G +R EG   +S  KNG  IGE T   +  +YP GM
Sbjct  345   IGINYYTASYVQDCIYTTCD-SRFGISRTEGSYMKSGGKNGVSIGEQTAFSWFNIYPQGM  403

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+ VTY K+++ + P+++TE GY     PN ++E+ LHD  R+K+++++L A+ TAIRKG
Sbjct  404   EKTVTYVKDRYNNTPMFITENGYAQQDDPNFTLEDQLHDFTRIKYMSNHLEALSTAIRKG  463

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             ADVRGYF WSL DNFEW  GYT R G +  D AT KRTP+LSA WYKQFIA
Sbjct  464   ADVRGYFAWSLLDNFEWIYGYTVRYGFHYVDFATLKRTPRLSASWYKQFIA  514



>ref|XP_010430203.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 345/473 (73%), Gaps = 13/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L++GKGL+NWD+F+H+ PG I D +NGD+A DQY  + ED  L
Sbjct  43    DFLFGTASSAYQYEGAFLTEGKGLNNWDIFTHEYPGKIRDENNGDMAVDQYHRFMEDIQL  102

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISWSRVLP+GR G+IN  GI YY  LID+L+ +GI+PFVT+NH D PQ
Sbjct  103   MTSLGVNSYRFSISWSRVLPRGRFGSINYSGITYYNRLIDALISRGIKPFVTLNHLDYPQ  162

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL+ R+Q WLSPEMQ+++ Y  ++CFKH GD+VK W T NEPN   I ++        R 
Sbjct  163   ELEYRFQSWLSPEMQKDFLYLTNICFKHFGDRVKLWTTLNEPNNQIILSHLKGTFPPSRC  222

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              L P+GNCS+GN+  + FI AHN ILAHA AV +YR  Y+++Q G IGI +  +WF P++
Sbjct  223   SL-PYGNCSQGNSETEPFIAAHNAILAHAKAVQLYRTKYKEEQKGIIGIVVQTSWFEPIS  281

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +ST DKAAAERA +F SNW LDP++YG YPKEM +ILGS LP FS  ++E LK   SDF+
Sbjct  282   DSTADKAAAERAQAFYSNWILDPVIYGKYPKEMVNILGSALPRFSKKEVEYLKESQSDFV  341

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGM  696
             GINHYT+Y+ QDCL S+C+    G ++ EG+    L + GN  IGELT + +  ++P G 
Sbjct  342   GINHYTSYFIQDCLLSSCNIGF-GASKVEGY-ALKLDRKGNLTIGELTDVNWQHIHPEGF  399

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
              +++ Y K+++ +IP+++TE G+ D   P ++++E+L+D KR+++++ YL A+ +A+R G
Sbjct  400   RKMLNYLKDRYHNIPMFITENGFGDLQKPETTVKELLNDAKRIQYMSGYLDALQSAMRDG  459

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             A+V+GYF WSL DNFEW  GY  R GLY  D  T KRTPK SA WY+ +I +N
Sbjct  460   ANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVTLKRTPKRSASWYRNYIGEN  512



>ref|XP_009774064.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=509

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/469 (56%), Positives = 339/469 (72%), Gaps = 15/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG +LSDGKGLSNWDVF+H+ G++ DGSNGDVA D Y  Y ED  L+
Sbjct  35    NFLFGTASSSYQYEGAFLSDGKGLSNWDVFTHEAGHVKDGSNGDVAVDHYHRYLEDIKLM  94

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             A +GVNS +FSISW+R+LPKGR G +N+ GI+YY  LID+LLLKGI+PFVT+ HYD+PQE
Sbjct  95    ADMGVNSFRFSISWARILPKGRFGKVNMAGIEYYSKLIDALLLKGIQPFVTLTHYDIPQE  154

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWL+ ++Q +++YFA++CFK+ GD+VKYWIT NE +  AI+ YR   +P     
Sbjct  155   LEDRYGGWLNSQIQYDFSYFANICFKYFGDRVKYWITMNEASFVAISGYRDGSYPPARCS  214

Query  1220  --HGNCSE-GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                GNCS  G++ ++ FI AHNMIL+HAAAV IYR  YQ+ QGG IGI M   W+ P +N
Sbjct  215   GIFGNCSAGGDSEREPFIAAHNMILSHAAAVRIYRTRYQKCQGGMIGITMGVEWYEPFSN  274

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S+ D AA +RA SF +NWFLDPI+ G YP+EM  ILGS+LPEFS +DL  L   G DFIG
Sbjct  275   SSEDIAATQRARSFYTNWFLDPIILGRYPEEMVQILGSNLPEFSVSDLRMLSY-GLDFIG  333

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHY+  Y +DCLYS C+    GN+  EG    +  ++G +IGE   + +  VYP G+E+
Sbjct  334   INHYSAVYIKDCLYSACE---HGNSWSEGSYLTTTQRDGVYIGEPGEVDWQFVYPQGIEK  390

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VV Y K++F + P+++TE G+   +   SSIE+ L+D  RVK++  YL+++  AIRKGAD
Sbjct  391   VVMYIKDRFNNTPMFITENGFAGNS---SSIEDALNDVHRVKYMHSYLNSLANAIRKGAD  447

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             VRGYF WSL DNFEW  GYT R GLY  +    +RTPKLSA  Y + + 
Sbjct  448   VRGYFAWSLLDNFEWLDGYTIRFGLYYVNYTNLQRTPKLSATKYPELMC  496



>gb|KFK28775.1| hypothetical protein AALP_AA7G045800 [Arabis alpina]
Length=492

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/471 (54%), Positives = 343/471 (73%), Gaps = 14/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQYEG YL+DGK LSNWDVF+  PG I DGS+G VA D Y  Y ED DL+
Sbjct  20    NFLFGTASSSYQYEGAYLTDGKTLSNWDVFTSIPGKIADGSHGKVAVDHYHRYPEDLDLM  79

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+++L +GIEPFVT+ HYD+PQE
Sbjct  80    EDLGVNSYRLSLSWARILPKGRFGDVNMAGIHHYNRMINNILKRGIEPFVTLTHYDIPQE  139

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL+P+++E++ ++A++CF++ G++VK+W TFNEPN+  I  YR   +P     
Sbjct  140   LEFRYGSWLNPQIREDFEHYAEICFQYFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  199

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAVNIYRKNYQ++Q G+IGI M   WF P++ S
Sbjct  200   KSFGNCTHGDSYIEPLVAAHNIIRSHLAAVNIYRKNYQEEQRGKIGIVMNTIWFEPVSES  259

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A ERA +F   WFLDPI++G YP+EM+DILG  LP+F+  DL+  K+ G DFIGI
Sbjct  260   LADRLAVERAQAFYLTWFLDPIVFGRYPREMQDILGKDLPKFTKDDLKSSKS-GLDFIGI  318

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G TR EGFV  +  K+G  +GE TG+ +  +YP GME++
Sbjct  319   NQYTSRYAKDCLHSKCEPG-KGGTRVEGFVYANAHKDGLPLGEPTGVDWFNIYPQGMEKM  377

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +L+D +RV F++ YL A+  A+RKGADV
Sbjct  378   LMYATERYKNIPLYVTENGFGENNTG-----VLLNDYRRVNFMSSYLDALKRAMRKGADV  432

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW SGYT R GLY  D  TQ+RTP+LSA WYK FI +++
Sbjct  433   RGYFTWSLLDNFEWISGYTIRFGLYHVDFDTQERTPRLSASWYKNFIFQHR  483



>ref|XP_009608375.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=512

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/469 (56%), Positives = 338/469 (72%), Gaps = 15/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQYEG +LSDGKGLSNWDVF+H+ G++ DGSNGDVA D Y  Y ED  L+
Sbjct  38    NFLFGTASSYYQYEGAFLSDGKGLSNWDVFTHEAGHVKDGSNGDVAVDHYHRYLEDIKLM  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             A +GVNS +FSISW+R+LPKG  G +N+ GI++Y  LID+LL KGI+PFVT+ HYD+PQE
Sbjct  98    ADMGVNSFRFSISWARILPKGIFGEVNMAGIEHYSKLIDALLQKGIQPFVTLTHYDIPQE  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLS +++++++YFA++CFK+LGD+VKYW+T NEP+  AI+ YR   +P     
Sbjct  158   LEDRYGGWLSSQIRDDFSYFANICFKYLGDRVKYWVTMNEPSFVAISGYRDGTYPPARCS  217

Query  1220  --HGNCSE-GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                GNCS  G++ ++ F  AHNMIL+HAAAV IYR  YQ+ QGG IGI M   W+ P +N
Sbjct  218   GIFGNCSAGGDSEREPFTAAHNMILSHAAAVRIYRTRYQKCQGGMIGITMGIEWYEPFSN  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S+ D AA  RA SF  NWFLDPI+ G YPKEM  ILGS+LPEFS +DL  L   G DFIG
Sbjct  278   SSEDIAATHRARSFYGNWFLDPIILGRYPKEMVQILGSNLPEFSMSDLSLLSY-GLDFIG  336

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHY+  Y +DCLYS C+    GN+  EG    +  ++G +IGE   + +  VYP G+E+
Sbjct  337   INHYSAVYIKDCLYSACE---HGNSWSEGSYLTTTQRDGIYIGEPGEVDWQFVYPQGIEK  393

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VV Y KE+F + P+++TE G+   +   SSIE+ L+D  RVK+L  YL+++  AI+KGAD
Sbjct  394   VVMYMKERFNNTPMFITENGFAGNS---SSIEDTLNDVHRVKYLHSYLYSLANAIKKGAD  450

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             VRGYFIWSL DNFEW  GYT R GLY  +    +RTPKLSA  Y+Q I 
Sbjct  451   VRGYFIWSLLDNFEWLDGYTIRFGLYYVNYTNLQRTPKLSATKYQQLIC  499



>ref|XP_009137214.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=520

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/470 (53%), Positives = 342/470 (73%), Gaps = 14/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DG++G VA D Y  Y ED DL+
Sbjct  48    DFLFGTASSAYQYEGAYLTDGKTLSNWDVFTSIPGKISDGTHGKVAVDHYHRYPEDLDLM  107

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  108   QDLGVNSYRFSLSWARILPKGRLGDVNMEGIDHYNRMINAVLKRGMEPFVTLTHYDIPQE  167

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY+ WLSP+++E++ ++A +CF+H G++VK+W TFNEPN+  I  YR   +P     
Sbjct  168   LEHRYKSWLSPQIREDFEHYAAICFRHFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  227

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAVN+YR  +Q+ Q G+IGI M   WF P+++S
Sbjct  228   KTFANCTRGGSDIEPLVAAHNIIRSHLAAVNLYRTKFQEDQRGKIGIVMNTIWFEPVSDS  287

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WFLDP+++G YP+EMKDILG  LPEF+  DL++ K  G DFIGI
Sbjct  288   LADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKRSK-NGLDFIGI  346

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL++ C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  347   NQYTSRYAKDCLHTACEPG-QGGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  405

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +L+D +RV+F+++YL A+ TA+RKGADV
Sbjct  406   LMYATERYRNIPLYVTENGFGENNT-----GVLLNDYRRVEFMSNYLDALKTAMRKGADV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI KN
Sbjct  461   RGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFIFKN  510



>gb|KFK40645.1| hypothetical protein AALP_AA2G023400 [Arabis alpina]
Length=523

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/471 (54%), Positives = 337/471 (72%), Gaps = 13/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L+DGK L+NWDVF+H+  G I DGSNGD + DQY  + ED  L
Sbjct  41    DFLFGTASSAYQYEGAFLTDGKSLNNWDVFTHEHSGEIHDGSNGDTSVDQYHRFMEDIQL  100

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLP+GR G IN  GIKYY  LID+L+   I+PFVT+NH D PQ
Sbjct  101   MNFLGVNSYRFSISWSRVLPRGRFGGINYSGIKYYNILIDTLI--RIKPFVTLNHVDYPQ  158

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP----  1221
             EL+ R+Q WLSPEMQ+E+ + AD+CFKH GD+VKYW T NEPN   I +Y + ++P    
Sbjct  159   ELEMRFQSWLSPEMQKEFTHLADICFKHFGDRVKYWTTINEPNQQLILSYLWGIFPPSRC  218

Query  1220  ---HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                +GNCS+GN+  + FI AHNMILAHA AV IY   YQ++Q G IGI +  +WF P+++
Sbjct  219   SSPYGNCSQGNSESEPFIAAHNMILAHAKAVTIYGTKYQKEQNGSIGIVVQTSWFEPISD  278

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDPI+YG YPKEM  ILG  LP+FSS +++ LK   +DFIG
Sbjct  279   SFEDKEAAERAQSFYSNWILDPIIYGEYPKEMATILGPALPQFSSNEVKNLKNYRADFIG  338

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL STC     G ++ EGF    L + GN  IGELT + +  + P G  
Sbjct  339   INHYTSYFIQDCLISTCTTGY-GASKAEGF-ALKLDRKGNVSIGELTDVDWQHIDPKGFR  396

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K ++P+IP+++TE G+     P ++++E+LHDTKR+++++ YL A+  A+R GA
Sbjct  397   KMLNYLKHRYPNIPMFITENGFGHLQKPETTVKELLHDTKRIQYMSGYLEALQAAMRDGA  456

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAK  360
             +V+GYF WSL DNFEW  G+  R GL+  D  T KRTPK SA WYK FI +
Sbjct  457   NVKGYFAWSLLDNFEWLYGHKLRFGLFHVDYTTLKRTPKQSASWYKNFIEE  507



>ref|XP_004976202.1| PREDICTED: probable inactive beta-glucosidase 14-like [Setaria 
italica]
Length=521

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/477 (52%), Positives = 343/477 (72%), Gaps = 13/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++S+YQ EG  L   +GLSNWDVF+H PG I DGSNGD A D Y  Y ED +L+ 
Sbjct  35    FLFGTTTSAYQIEGANLEGNRGLSNWDVFAHTPGKIEDGSNGDTADDHYHRYMEDIELMH  94

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             S+GVNS++FSI+W+R+LP+GR G++N +G+ +Y NLID+LL KGI+PFVTI+HYD+PQEL
Sbjct  95    SMGVNSYRFSIAWTRILPRGRFGHVNPDGVAFYNNLIDALLQKGIQPFVTISHYDIPQEL  154

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCSE  1203
             + +Y GWLSPE+Q+++ Y A+VCF   GD+VK+WITFN+PN+W   +Y   L+P G CS+
Sbjct  155   ETQYGGWLSPEIQKDFGYLAEVCFMMFGDRVKFWITFNQPNLWLKFSYMDGLYPPGRCSQ  214

Query  1202  -------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
                    GN++ + +I  HNMIL+HA AV+IYRK YQ +QGG IGI+M   W+ P +N+T
Sbjct  215   PFGNCAFGNSSIEPYIAGHNMILSHANAVSIYRKKYQGKQGGHIGISMCSRWYEPFSNTT  274

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
             VD  A ERA +F   WFLDPI++G YP +M++ILG +LPEF+S   +KLKA   DFIG++
Sbjct  275   VDILAVERALAFDGPWFLDPIIFGDYPTKMREILGPNLPEFTSQQKKKLKATKLDFIGLS  334

Query  863   HYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             HYTT Y +DC++S C  DP + G+ R        + ++G  IGE+TG P+    P GME+
Sbjct  335   HYTTLYTKDCIFSPCEIDP-IDGDAR---VFSSGVGEDGVLIGEVTGSPFFYSVPEGMEK  390

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VV Y  +++ +IP Y+TE GY   +  + + ++  +DT RV ++ DYL  + +AIRKGAD
Sbjct  391   VVMYYMQRYNNIPTYITENGYAQASNSSMTAKDFTNDTGRVDYIRDYLTFLASAIRKGAD  450

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             VRGYF+WSL D FEWTSGYT+R+GLY  D  T +RTPKLSAKW+ +F+     V ++
Sbjct  451   VRGYFVWSLLDCFEWTSGYTQRLGLYHVDLKTLERTPKLSAKWFSEFLKGGSLVGTR  507



>ref|XP_009794052.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=521

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 340/467 (73%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQYEG +L+DGK L+NWD+F+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  45    NFLFGTASSCYQYEGAFLTDGKSLNNWDLFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             A +GVNS++FSISW+R+LP+G  G+IN+ GI++Y  LID+LL KGI+PFVT+ HYD+PQE
Sbjct  105   ADMGVNSYRFSISWARILPRGIFGDINMAGIEHYNKLIDALLQKGIQPFVTLTHYDIPQE  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLS ++Q++++YFAD+CFK+ GD+VK+W+T NEPN+ A   YR  ++P     
Sbjct  165   LEDRYGGWLSSQIQDDFSYFADICFKYFGDRVKHWVTMNEPNLMADRGYRTGIYPPARCS  224

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV+IYR  YQ++QGG IGI++   W+ P +NS
Sbjct  225   GIFGNCSAGDSEREPFIAAHNMILSHAAAVSIYRTRYQKRQGGMIGISLDIQWYEPYSNS  284

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AA +RA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL + G DFIGI
Sbjct  285   SEDIAATQRARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSVNDLSKL-SYGLDFIGI  343

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    G T  EG    +  K+G +IG+ T + +L +YP GM+++
Sbjct  344   NYYTAKYIKDCLYSACE---HGKTWSEGSYFVTTEKDGVYIGQPTEVDWLFLYPQGMKKI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL ++  AIR+GADV
Sbjct  401   VMYMKDRFNNTPMVITENGIAENENLNPSITDTLNDVHRVNYMHSYLDSLANAIREGADV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YK+ +
Sbjct  461   RGYFVWSLLDNFEWLDGYRLRFGLHYVNFTNLERTPKLSATRYKELM  507



>ref|XP_010316604.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=516

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/467 (54%), Positives = 335/467 (72%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGTSSS YQYEG  LSDGKGL+NWDVF+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  40    NFLFGTSSSCYQYEGAILSDGKGLNNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLM  99

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVN ++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQE
Sbjct  100   EDLGVNGYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPLITLTHYDIPQE  159

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLS  +Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   +P     
Sbjct  160   LEERYGGWLSSRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTYPPSRCS  219

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAA++IYR  YQ++QGG IGI++   WF P +NS
Sbjct  220   GIFGNCSAGDSEREPFIAAHNMILSHAAAISIYRTRYQKRQGGMIGISLDTQWFEPFSNS  279

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AAAERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL + G DFIGI
Sbjct  280   SEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKL-SYGLDFIGI  338

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    G T  EG    +  K+G +IG+ T + +L +YP GM+++
Sbjct  339   NYYTAAYIKDCLYSACE---HGRTWSEGSFLDTREKDGVYIGQPTEVDWLFLYPQGMKKI  395

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL+++  AI  GADV
Sbjct  396   VMYMKDRFNNTPMVITENGIAENDNLNPSIIDTLNDFHRVDYMRSYLNSLANAITDGADV  455

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  456   RGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  502



>ref|XP_009624454.1| PREDICTED: beta-glucosidase 18 [Nicotiana tomentosiformis]
Length=521

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 338/467 (72%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS YQYEG +LSDGKGL+NWD+F+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  45    NFLFGTASSCYQYEGAFLSDGKGLNNWDLFTHEAGHIKDGSNGDVAVDHYNRYLEDVKLM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             A +GVNS++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+PFVT+ HYD+PQE
Sbjct  105   ADMGVNSYRFSISWARILPKGIFGDVNMAGIEHYNKLIDALLQKGIQPFVTLTHYDIPQE  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+DRY GWLS  +Q++++YFAD+CFK+ GD+VK+W+T NEPN+ A   YR  ++P     
Sbjct  165   LEDRYGGWLSSRIQDDFSYFADICFKYFGDRVKHWVTMNEPNLMADRGYRTGIYPPARCS  224

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV+IYR  YQ++QGG +GI++   W+ P +NS
Sbjct  225   GIFGNCSAGDSEREPFIAAHNMILSHAAAVSIYRTRYQKRQGGMVGISLDIQWYEPYSNS  284

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AA +RA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL   G DFIGI
Sbjct  285   SEDIAATQRARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSVNDLRKLSY-GLDFIGI  343

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    GNT  EG    +  K+G  IG+ T + +L +YP GM+++
Sbjct  344   NYYTAKYIKDCLYSACE---HGNTWSEGSYFVTTQKDGVDIGQPTEVDWLFLYPQGMKKI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL ++  AIR+GADV
Sbjct  401   VIYMKDRFNNTPMVITENGIAENENLNPSITDTLNDVHRVNYMHSYLTSLANAIREGADV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY+ R GL+  +    +R PKLSA  YK  +
Sbjct  461   RGYFVWSLLDNFEWLDGYSLRFGLHYVNFTNLQRIPKLSATSYKGLM  507



>emb|CAN68643.1| hypothetical protein VITISV_030810 [Vitis vinifera]
Length=444

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 316/424 (75%), Gaps = 9/424 (2%)
 Frame = -3

Query  1592  LYKEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVT  1413
             + +ED DL+ SLGVNS++FSISW+R+LP+GR G +N  GI YY  LID+L+LKG+EPFVT
Sbjct  17    MRQEDIDLMVSLGVNSYRFSISWARILPEGRFGEVNAAGIDYYNKLIDALVLKGLEPFVT  76

Query  1412  INHYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRY  1233
             + H+D+PQEL+D + GWLSP++QEE+ Y+AD+CFK  GD+VKYW+TFNEPN+   A YR 
Sbjct  77    LTHFDIPQELEDTFGGWLSPKLQEEFRYYADICFKTFGDRVKYWVTFNEPNIQVTAGYRS  136

Query  1232  RLWP-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLF  1074
               +P       +GNC+ G++ K+ F+ AHN+IL+HA  V+IYR+ YQ++QGG IGI +  
Sbjct  137   GSYPPSRCSSSYGNCTYGDSEKEPFVAAHNIILSHATVVDIYRRQYQEKQGGSIGIVLHA  196

Query  1073  TWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLK  894
              W  P +NST DK AA+RA SF  NWFLDPI++G YP+EM  ILGS LPEFS  D +KL 
Sbjct  197   KWIEPFSNSTADKLAADRAQSFFMNWFLDPIIFGRYPEEMNTILGSILPEFSCNDRKKLN  256

Query  893   AGGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLA  714
                 DFIGINHYT+ YAQDC++S C+P   G +R EGF  Q+  K+G  IGE T L +L 
Sbjct  257   KA-LDFIGINHYTSLYAQDCIFSLCEPG-KGASRTEGFCRQTPEKDGVSIGESTALAWLH  314

Query  713   VYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVG  534
             VYP GME++VTY KE++  IP+++TE GY D   PNS+IEE L+D KRV+++A YL A+ 
Sbjct  315   VYPQGMEKMVTYVKERYSGIPMFITENGYVDENDPNSTIEEFLYDVKRVEYMAAYLDALS  374

Query  533   TAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             TA+RKGADVRGYF WSL DNFEWT GYTKR GL+  D  T KRTPKLSA WYK FIA+  
Sbjct  375   TAVRKGADVRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGTLKRTPKLSATWYKLFIARYS  434

Query  353   KVDS  342
              V +
Sbjct  435   LVKT  438



>ref|XP_010449006.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/467 (53%), Positives = 335/467 (72%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DGS G VA D Y  Y ED DL+
Sbjct  54    NFLFGTASSAYQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLM  113

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  114   EDLGVNSYRLSLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMEPFVTLTHYDIPQE  173

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L  RY  WL P+++E++ ++A++CF+H GD+VK+W TFNEPN+  I  YR   +P     
Sbjct  174   LVVRYGSWLDPQIREDFEHYAEICFRHFGDRVKFWTTFNEPNVQVILGYRTGTYPPSRCS  233

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAV++YR  +Q+QQ G+IGI M   WF P+++S
Sbjct  234   KTFGNCTHGDSDIEPVVAAHNIIRSHLAAVSLYRTKFQEQQRGKIGIVMNTIWFEPVSDS  293

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK A ERA +F   WFLDP+++G YPKEM++IL   LPEF+  DL K  +   DFIGI
Sbjct  294   LADKLATERAQAFFVTWFLDPVVFGRYPKEMQEILNEDLPEFTKDDL-KSSSNKLDFIGI  352

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+STC+P   G +R EG+V  +  K+G  +GE TG+ + + YP GME +
Sbjct  353   NQYTSRYAKDCLHSTCEPG-KGGSRAEGYVNANALKDGLHLGEPTGVNWFSTYPQGMEEM  411

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ DIPLYVTE G+ +  T       +L+D +RVKF+++YL AV  A+RKGADV
Sbjct  412   LMYATERYKDIPLYVTENGFGENNTG-----VLLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW SGYT R G+Y  D  TQ+RTP+LSA WYK FI
Sbjct  467   RGYFAWSLLDNFEWISGYTIRFGMYHVDFITQERTPRLSAFWYKNFI  513



>ref|XP_010273571.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=513

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/479 (53%), Positives = 336/479 (70%), Gaps = 11/479 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PG I DGSNGDVA D Y  Y +D +L+
Sbjct  29    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHIPGKIKDGSNGDVADDHYHRYMQDIELM  88

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISWSRVLP+GR G +N EGI++Y  LI++LLLKGI+PFVT+NHYD+PQE
Sbjct  89    HQLGVNSYRFSISWSRVLPRGRFGEVNSEGIEFYDKLINALLLKGIQPFVTLNHYDIPQE  148

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WL+ ++Q+++ YFA+VCFK  GD+VKYW TFNEPN+     Y +  +      
Sbjct  149   LEDRYGAWLNAQIQQDFGYFAEVCFKAFGDRVKYWSTFNEPNIMVTYGYLFGKYPPSHCS  208

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G+C  G++  + FI  HN+IL+HA A  IYRK YQ +QGG+IGI M  +W+ P+ ++
Sbjct  209   NPFGDCRSGDSALEPFIATHNVILSHATAAEIYRKKYQVKQGGKIGIVMCSSWYEPLRDT  268

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A +RA +F + WFLDPI+YG YP EM+ ILGS LP FS  D +KL     DFIG+
Sbjct  269   PTDNFAVQRALAFDTAWFLDPIIYGEYPPEMRQILGSRLPTFSLEDKKKL-GNKLDFIGV  327

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT Y +DC++S C+ S S         G+   K+G+ IG  T +P L V P GME++
Sbjct  328   NHYTTLYVKDCMFSQCESSTSLGEASVYITGE---KDGHPIGHPTAMPSLYVVPYGMEKI  384

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y KE++ +IP+++TE GY   + PN+S  ++L+D  RV++L  YL +V  A++ GADV
Sbjct  385   IMYFKERYNNIPMFITENGYAQASNPNTSKRDILNDNGRVEYLKSYLASVNLAMKHGADV  444

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGYFIWSL DNFEW  GYT R G+Y  D  T +RTPKLSA WYKQF+A  +K+ ++  S
Sbjct  445   RGYFIWSLIDNFEWLYGYTLRFGIYYVDYNTLERTPKLSAMWYKQFLAGREKILTQKGS  503



>ref|XP_010316602.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Solanum lycopersicum]
Length=520

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 334/466 (72%), Gaps = 11/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTSSS YQYEG  LSDGKGL+NWDVF+HQ G+I DGSNGDVA D Y+ Y ED  L+ 
Sbjct  45    FLFGTSSSCYQYEGAILSDGKGLNNWDVFTHQAGHIKDGSNGDVAVDHYNRYLEDIKLME  104

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
              +GVN ++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQEL
Sbjct  105   DMGVNGYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPLITLTHYDIPQEL  164

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPH-----  1218
             ++RY GWLS ++Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   +P      
Sbjct  165   EERYGGWLSSQIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYRLGTYPPSRCSG  224

Query  1217  --GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
               GNCS G++ ++ FI AHNMIL+HAAAV+ YR  YQ++QGG IGI++   W+ P +NS 
Sbjct  225   IVGNCSAGDSEREPFIAAHNMILSHAAAVSTYRTRYQKRQGGMIGISLDTQWYEPFSNSP  284

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D AA ERA SF  NWFLDPI+ G YPKEM +ILGS+LP+FS  DL KL   G DFIGIN
Sbjct  285   EDIAATERARSFYVNWFLDPIILGRYPKEMVEILGSNLPDFSKNDLSKLSY-GLDFIGIN  343

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +YT  Y +DCLYS C+    GNT  EG   ++  K+G +IG+ T + +L +YP GM+++V
Sbjct  344   YYTAKYIKDCLYSACE---HGNTWSEGSFFETREKDGVYIGQPTEVDWLFLYPQGMKKIV  400

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL+++  AI  GADVR
Sbjct  401   MYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAITDGADVR  460

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  461   GYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATMYKQLM  506



>ref|XP_007153927.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
 gb|ESW25921.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
Length=528

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/478 (55%), Positives = 341/478 (71%), Gaps = 13/478 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGN--ILDGSNGDVAADQYDLYKEDADL  1569
             F FGT+SSSYQYEG Y SDGKG+SNWD F+H  G   I+ G NGD+A D Y+ Y ED DL
Sbjct  38    FLFGTASSSYQYEGAYQSDGKGMSNWDNFTHGTGRYVIIGGGNGDIANDHYNRYLEDIDL  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + +LGVNS++ SISW+R+LPKGR G  N  GI +Y  LID L+LKGI+PFVT++HY+ PQ
Sbjct  98    MEALGVNSYRLSISWARILPKGRFGEANHAGIAFYNRLIDVLILKGIQPFVTLSHYESPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP----  1221
             EL+DRY  WLSP+ QE++A++AD+CFK  GD+VKYW TFNEPN      YR  L+P    
Sbjct  158   ELEDRYGSWLSPQSQEDFAFYADLCFKTFGDRVKYWATFNEPNFQVPLGYRSGLYPPCRC  217

Query  1220  -----HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
                     CSEG++ K+ F+ AHN+ILAHAAAV+IYR  YQ +Q G IGI +   W+ P+
Sbjct  218   SGPLAFAQCSEGDSEKEPFVAAHNIILAHAAAVDIYRTKYQTEQKGSIGIVLQHEWYEPL  277

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
             +NST DK AAERA SF  NWFLDPI+ G YP EM+++LGS LP+ SS + EKLK  G DF
Sbjct  278   SNSTADKLAAERARSFTFNWFLDPIILGKYPTEMENLLGSLLPKISSKEKEKLKK-GLDF  336

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             IG+N+YT +Y QDC+YS C  +  GN+R EG   +S  +NG  IGE T   +  +YP GM
Sbjct  337   IGVNYYTAFYVQDCMYSRCK-TGQGNSRTEGLYMKSGVRNGFPIGEPTTFSWFNIYPDGM  395

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+ VTY K+++ + P+++TE GY     PN ++EE L+D+KR+K++ D++ A+  AIRKG
Sbjct  396   EKAVTYVKDRYNNTPMFITENGYGQEDDPNFTLEEHLNDSKRIKYMVDHIEAMVAAIRKG  455

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS  342
             ADVRGY  WSL D+FEW  GYT R G +  D AT KRTP+LSA W+KQF+ K ++  S
Sbjct  456   ADVRGYLAWSLLDSFEWIYGYTVRYGFHHVDFATLKRTPRLSASWFKQFLVKYKETFS  513



>ref|XP_006285457.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
 gb|EOA18355.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
Length=514

 Score =   531 bits (1369),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 248/467 (53%), Positives = 336/467 (72%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DGS+G VA D Y  Y ED DL+
Sbjct  45    NFLFGTASSAYQYEGAYLTDGKNLSNWDVFTSIPGKIADGSHGKVAVDHYHRYPEDLDLM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S SW+R+LPKGR G++N+ GI +Y  +I+++L +GIEPFVT+ HYDLPQE
Sbjct  105   EDLGVNSYRLSFSWARILPKGRFGDVNMGGIDHYNRMINAILKRGIEPFVTLTHYDLPQE  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L  RY  WL P+++E++  +A++CF+H GD+VK+W TFNEPN+  +  YR   +P     
Sbjct  165   LVVRYGSWLDPQIREDFENYAEICFRHFGDRVKFWATFNEPNVQVVLGYRTGTYPPSRCS  224

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  + F+ AHN+I +H AAVN+YR  +Q+QQ G+IGI M   WF P+++S
Sbjct  225   KTFGNCTHGDSEIEPFLAAHNIIRSHLAAVNLYRTKFQEQQRGKIGIVMNTIWFEPVSDS  284

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A ERA +F   WFLDP+++G YP+EM++ILG  L EF+  DL++ K  G DFIGI
Sbjct  285   LADILAVERAQAFYLTWFLDPVVFGRYPREMQEILGEDLLEFTKDDLKRSK-NGLDFIGI  343

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G+ +GE TG+ + + YP GME +
Sbjct  344   NQYTSRYAKDCLHSACEPG-KGGSRAEGFVYANALKDGSHLGEPTGVNWFSTYPQGMEEM  402

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA +++ DIPLYVTE G+ +  T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  403   LMYAAKRYKDIPLYVTENGFGENNTG-----VLLNDHRRVKFMSNYLDALKRAMRKGADV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW SGYT R G+Y  D  TQ+RTP+LSA WYK FI
Sbjct  458   RGYFAWSLLDNFEWISGYTIRFGMYHVDFKTQERTPRLSAFWYKNFI  504



>ref|XP_006348093.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=518

 Score =   531 bits (1368),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 331/467 (71%), Gaps = 11/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGTSSS YQYEG  LSDGKGLSNWDVF+H+ G+I DGSNGDVA D Y+ Y ED  L+
Sbjct  42    NFLFGTSSSCYQYEGAILSDGKGLSNWDVFTHEAGHIKDGSNGDVAVDHYNRYLEDIKLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN ++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ HYD+PQE
Sbjct  102   EDMGVNGYRFSISWARILPKGTFGDVNMAGIEHYSKLIDALLQKGIQPLITLTHYDIPQE  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY GWLS  +Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A   YR   +P     
Sbjct  162   LEERYGGWLSSRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAGRGYREGTYPPARCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ FI AHNMIL+HAAAV IYR  YQ++QGG IGI++   W+ P +NS
Sbjct  222   SVFGNCSAGDSEREPFIAAHNMILSHAAAVGIYRTRYQKRQGGMIGISLDTQWYEPFSNS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D AA ERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL   G DFIGI
Sbjct  282   SEDIAATERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKLSY-GLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N+YT  Y +DCLYS C+    GNT  EG    +  K+G +IG+ T + +L +YP GM+++
Sbjct  341   NYYTAKYIKDCLYSACE---HGNTWSEGSYFVTTEKDGVYIGQSTEVEWLFLYPQGMKKI  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL+++  AI  GADV
Sbjct  398   VMYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANAITDGADV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GY  R GL+  +    +R PKLSA  YKQ +
Sbjct  458   RGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRIPKLSATMYKQLM  504



>ref|XP_006413734.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 ref|XP_006413736.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55187.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55189.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=524

 Score =   531 bits (1367),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 246/471 (52%), Positives = 342/471 (73%), Gaps = 14/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YLSDGK LSNWDVF++  G I DGS+G VA D Y  Y ED DL+
Sbjct  53    NFLFGTASSAYQYEGAYLSDGKTLSNWDVFTNITGKIADGSHGKVAVDHYHRYPEDLDLM  112

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +ID++L +GIEPFVT+ HYD+PQE
Sbjct  113   EDLGVNSYRFSLSWARILPKGRFGDMNMEGIYHYNRVIDAILKRGIEPFVTLTHYDIPQE  172

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPH----  1218
             L+ RY  WL+P+++E++ ++A++CF++ G++VK+W TFNEPN+  I  YR   +P     
Sbjct  173   LEYRYGSWLNPQIREDFEHYAEICFRYFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  232

Query  1217  ---GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAV+IYR  YQ+QQ G+IGI M   WF P++++
Sbjct  233   KTVGNCTRGDSEIEPLVAAHNIIRSHLAAVSIYRTKYQEQQRGKIGIVMNAIWFEPVSDA  292

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WFLDP+++G YP+EM++I G  LP+F+  DL+  K  G DFIGI
Sbjct  293   LADRLAAERAQAFYLTWFLDPVVFGRYPREMQEIFGEDLPQFTKDDLKSSK-NGLDFIGI  351

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  352   NQYTSRYAKDCLHSACEPGQGG-SRAEGFVNANALKDGLALGEPTGVDWFNVYPQGMEEM  410

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +++D +RVK+++ YL A+  A+RKGAD+
Sbjct  411   LMYATERYKNIPLYVTENGFGENNTG-----VLVNDYRRVKYMSSYLDALKRAMRKGADI  465

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW SGYT R GLY  D  T +RTP+LSA WYK FI +++
Sbjct  466   RGYFTWSLLDNFEWISGYTIRFGLYHVDFNTLERTPRLSASWYKNFIFQHR  516



>ref|XP_008669177.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Zea 
mays]
 tpg|DAA36953.1| TPA: hypothetical protein ZEAMMB73_881817 [Zea mays]
Length=509

 Score =   529 bits (1363),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 336/476 (71%), Gaps = 15/476 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG  SSSYQ EG YL D KGLSNWDVF+H  GNI DGSNGD+A D Y  YK+D +++
Sbjct  28    SFLFGAGSSSYQIEGAYLEDNKGLSNWDVFTHIKGNIDDGSNGDMATDHYHRYKDDIEMM  87

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+ S+KFS+SWSR+LPKGR G IN  GIK+Y NLI+ LL KGI+P VTINHYD+P+E
Sbjct  88    HSIGLTSYKFSLSWSRILPKGRFGGINQAGIKFYNNLINGLLEKGIQPLVTINHYDIPEE  147

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             LQ+RY  WL+PE+QE++ YFA++CFK  GD+VK+W+TFNEPN+ A   Y    +P   CS
Sbjct  148   LQERYNSWLNPEIQEDFTYFAELCFKMFGDRVKHWVTFNEPNLLAKLEYFIGGFPPNRCS  207

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       GN++ + +I AHNMILAHA   NIYRKNY+ +QGG +GI +   W+ P+ N 
Sbjct  208   EPNGKCDYGNSSTEPYIAAHNMILAHAKTNNIYRKNYKSKQGGSVGITIHMRWYEPLRNI  267

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A  RA SF + WFLDP+ +G YP +M+ ILG +LP+F++ + EKL     DFIG+
Sbjct  268   TEDHLAVSRALSFEAPWFLDPLFFGDYPHQMRQILGPNLPKFTAGE-EKLLKNQIDFIGV  326

Query  866   NHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             NHY T+Y +DC+YS C  DP  S     E  V +S  +NG  IG+LT      V P  ME
Sbjct  327   NHYQTFYVKDCIYSLCDIDPYTS-----EALVSESTERNGIPIGKLTQDANTYVVPSSME  381

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             ++V Y KE++ +IPLY+TE GY      ++++EE+++DT+R+ ++ DYL  +  AIRKGA
Sbjct  382   KLVMYLKERYNNIPLYITENGYAQIPNISTTVEEIINDTERINYIRDYLTYLSFAIRKGA  441

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             DVRGYF+WSL D+FEW SGYT + GL+  +  + KRTPKLSAKWY +FI   ++++
Sbjct  442   DVRGYFVWSLMDSFEWISGYTIKYGLFHVNFKSLKRTPKLSAKWYNKFIKGYEQIE  497



>ref|XP_010439426.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   530 bits (1364),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 243/467 (52%), Positives = 335/467 (72%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DGS G VA D Y  Y ED DL+
Sbjct  54    NFLFGTASSAYQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLM  113

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  114   EDLGVNSYRLSLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMEPFVTLTHYDIPQE  173

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L  RY  WL P+++E++ ++A++CF++ GD+VK+W TFNEPN+  +  YR   +P     
Sbjct  174   LVVRYGSWLDPQIREDFEHYAEICFRYFGDRVKFWATFNEPNVQVVLGYRTGTYPPSRCS  233

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAV++YR  +++QQ G+IGI M   WF P+++S
Sbjct  234   KTFGNCTHGDSDVEPVVAAHNIIRSHLAAVSLYRTKFKEQQRGKIGIVMNTIWFEPVSDS  293

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK A ERA +F   WFLDP+++G YP+EM++ILG  LP+F+  DL+   +   DFIGI
Sbjct  294   LADKLATERAQAFFVTWFLDPVVFGRYPREMQEILGEDLPQFTKDDLKSF-SNKLDFIGI  352

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EG+V  +  K+G  +GE TG+ + A YP GME +
Sbjct  353   NQYTSRYAKDCLHSACEPG-KGGSRAEGYVNANALKDGLHLGEPTGVNWFATYPQGMEEM  411

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ DIPLYVTE G+ +  T       +L+D +RVKF+++YL AV  A+RKGADV
Sbjct  412   LMYATERYKDIPLYVTENGFGENNTG-----ALLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW SGYT R G+Y  D  TQ+RTP+LSA WYK FI
Sbjct  467   RGYFAWSLLDNFEWISGYTVRFGMYHVDFITQERTPRLSAFWYKNFI  513



>ref|XP_004976200.1| PREDICTED: probable inactive beta-glucosidase 14-like isoform 
X1 [Setaria italica]
Length=533

 Score =   530 bits (1364),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 251/469 (54%), Positives = 331/469 (71%), Gaps = 14/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGTS+S+YQ EGGYL   KGLSNWDVF+H+ G I DGSNGD A D Y  Y ED +L+
Sbjct  41    NFLFGTSTSAYQIEGGYLEGNKGLSNWDVFTHKQGTIKDGSNGDSADDHYHRYMEDINLM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSI+W+R+LP+GR G +N +G+ +Y  +ID+LL KG++PFVTI H+D+P E
Sbjct  101   HSLGVNSYRFSIAWTRILPRGRFGKVNPDGVAFYNAIIDALLQKGMQPFVTIYHFDIPHE  160

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L  RY GWLS E+Q+++ YFAD+CFK  GD+VK+WIT NEPN++   +Y Y  +      
Sbjct  161   LDKRYGGWLSSEIQKDFGYFADICFKMFGDRVKFWITINEPNLFTKLSYMYGRYAPGHCS  220

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ GN++ + +IV HN+IL+HA AV+IYRK YQ +QGG IGI +   W+ P  N+
Sbjct  221   KPFGNCAFGNSSVETYIVGHNIILSHANAVHIYRKKYQVKQGGHIGINVCSRWYEPFHNT  280

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A ER  SF   WFLDP++ G YP EM+ ILGS+LPEF+S   +KL+A   DFIG+
Sbjct  281   TADILAVERVLSFNGPWFLDPLILGEYPLEMRKILGSNLPEFTSKQKKKLQATKLDFIGL  340

Query  866   NHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             NHYTT Y +DC++S C  DP        E  V  S  ++G FIG+ TG P     P GME
Sbjct  341   NHYTTSYLKDCIFSPCELDP-----VEGEAQVLTSAERDGIFIGKRTGSPIFYSVPYGME  395

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             ++V Y K+++ + P+Y+TE GY   +  +   ++  +DT RV +L  YL  + +AIRKGA
Sbjct  396   KLVMYYKQRYNNTPIYITENGYAQASNSSMITKDFTNDTGRVDYLQGYLTFLASAIRKGA  455

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             DVRGYF+WSL DNFEW SGYT+R GLY  D  TQKRTPKLSAKWY++F+
Sbjct  456   DVRGYFVWSLLDNFEWNSGYTQRFGLYHVDFKTQKRTPKLSAKWYREFL  504



>gb|KDP39384.1| hypothetical protein JCGZ_01141 [Jatropha curcas]
Length=488

 Score =   526 bits (1356),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 337/471 (72%), Gaps = 13/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   KGLSNWDVFSH PG I DGSNGDVA D Y LY ED +L+
Sbjct  15    SFLFGTATSSYQVEGAYLEANKGLSNWDVFSHLPGKIKDGSNGDVADDHYHLYLEDIELM  74

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISWSRVLPKGR GN+N  GI+YY NL D+LLLKGI+PFVT+NHYD+PQE
Sbjct  75    HSLGVNSYRFSISWSRVLPKGRFGNVNAAGIEYYNNLTDALLLKGIQPFVTLNHYDVPQE  134

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+DRY  WLSP++QE++ +FA+VCF+  GD+VKYWIT NEPN+ A A+Y           
Sbjct  135   LEDRYGSWLSPQIQEDFGHFAEVCFQAFGDRVKYWITLNEPNVMAQASYYSGQYPPSRCS  194

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             +P G C  G++  + ++ AHNMIL+HA A  IY+  YQ++QGG+IGI +   WF P+ + 
Sbjct  195   YPIGKCKAGDSELEPYVAAHNMILSHATATQIYKNKYQEKQGGQIGIVLHVYWFEPLRDI  254

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              VD  A +RA +F + WF+DPIMYG YP EM+ I+G  LP+FS  D +KL++   DFIGI
Sbjct  255   PVDFFATQRALAFYAAWFMDPIMYGEYPPEMQQIVGLRLPKFSVEDRKKLES-KLDFIGI  313

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T YA+DCL S+C+  ++ +   + F   +  ++G  IG+ T +P   V P  ME+ 
Sbjct  314   NHYSTLYAKDCLVSSCN--ITTDIIADSFAYITGERDGVLIGQPTAMPTFYVVPNSMEKT  371

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K ++ + P+++TE GY   ++   +IE++L+DT R++++  YL ++  A+RKGADV
Sbjct  372   IMYFKNRYNNTPMFITENGYAQPSS--KAIEDMLNDTSRIEYMQSYLTSLAAALRKGADV  429

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW  GYT   GLY  DR T +RTPK SAKW+ QF+ KN+
Sbjct  430   RGYFHWSLIDNFEWRYGYTICFGLYYVDRTTLQRTPKQSAKWFHQFL-KNE  479



>ref|XP_010434129.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 242/467 (52%), Positives = 334/467 (72%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DGS G VA D Y  Y ED DL+
Sbjct  54    NFLFGTASSAYQYEGAYLTDGKNLSNWDVFTSIPGKIADGSQGKVAVDHYHRYPEDLDLM  113

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+++L +G++PFVT+ HYD+PQE
Sbjct  114   EDLGVNSYRLSLSWARILPKGRFGDVNMGGIDHYNRMINAILKRGMDPFVTLTHYDIPQE  173

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L  RY  WL P+++E++ ++A++CF+H GD+VK+W TFNEPN+  I  YR   +P     
Sbjct  174   LVVRYGSWLDPQIREDFEHYAEICFRHFGDRVKFWTTFNEPNVQVILGYRTGTYPPSRCS  233

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAV++YR  +Q++Q G+IGI M   WF P+++S
Sbjct  234   KTFGNCTHGDSDIEPVVAAHNIIRSHLAAVSLYRTKFQERQRGKIGIVMNTIWFEPVSDS  293

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A ERA +F   WFLDP+++G YP+EM++ILG  LPEF+  DL+   +   DFIGI
Sbjct  294   LADRLATERAQAFFMTWFLDPVVFGRYPREMQEILGEDLPEFTKDDLKSF-SNKLDFIGI  352

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EG+V  +  K+G  +GE TG+ + + YP GME +
Sbjct  353   NQYTSRYAKDCLHSACEPG-KGGSRAEGYVNANALKDGLRLGEPTGVNWFSTYPQGMEEM  411

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ DIPLYVTE G+ +  T       +L+D +RVKF+++YL AV  A+RKGADV
Sbjct  412   LMYATERYKDIPLYVTENGFGENNTG-----VLLNDYRRVKFMSNYLDAVKRAMRKGADV  466

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW SGYT R G+Y  D  TQ+RTP+LS  WYK FI
Sbjct  467   RGYFAWSLLDNFEWISGYTIRFGMYHVDFKTQERTPRLSVFWYKNFI  513



>ref|XP_009397666.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   526 bits (1356),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 252/476 (53%), Positives = 343/476 (72%), Gaps = 11/476 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+SSYQ EG YL D K LSNWDVF+H PG+I DGSNGD+A D Y  Y ED +L+
Sbjct  30    SFLFGTSTSSYQIEGAYLEDNKSLSNWDVFTHIPGHIKDGSNGDIADDHYHRYMEDIELM  89

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISWSR+LP+GR G IN +G+ +Y  LID+LLLKGI+PFVT+NHYD+PQE
Sbjct  90    HSLGVNSYRFSISWSRILPRGRFGGINPQGVAFYNKLIDALLLKGIQPFVTLNHYDIPQE  149

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+DRY  WLS ++Q+++ YFA+VCF+  GD+VKYW TFNEPN+     Y        +  
Sbjct  150   LEDRYGAWLSAQIQKDFGYFAEVCFEEFGDRVKYWTTFNEPNVMVKFGYGNGKYPPNHCS  209

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G+++ + ++ AHN+IL+HA AV +Y+  YQ +QGG IGI M  TWF P+ + 
Sbjct  210   QPFGNCSSGDSSTEPYVAAHNVILSHATAVEVYKTKYQAKQGGSIGIVMATTWFEPLRDV  269

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+AAA RA SF   WFLDPI+YG YP  M+ ILGS LP FS++D +KL+   SDFIG+
Sbjct  270   PADRAAARRAQSFYVPWFLDPIIYGDYPPAMRQILGSRLPRFSTSDKKKLQH-KSDFIGV  328

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ YA+DC++S C+    G +  +  V  +  +NG  IG+ T +P   V P GME++
Sbjct  329   NHYTSSYAKDCMFSPCE---GGGSEGDASVLTTGERNGLAIGKPTAMPNFYVVPRGMEKI  385

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y K+++ +IP+++TE GY   +  N+S++++L+D  RV++L  YL ++  A+R+GADV
Sbjct  386   VMYIKKRYKNIPMFITENGYPQGSDHNTSVKDLLNDKDRVEYLRSYLSSLHKAMRQGADV  445

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             RGYF+WSL DNFEW  GYT R GLY  +  TQ+RTPKLSA WY++F+  +Q +  K
Sbjct  446   RGYFVWSLIDNFEWLYGYTLRFGLYHVNYETQERTPKLSATWYQEFLEDSQVLIQK  501



>emb|CDX94055.1| BnaC07g36890D [Brassica napus]
Length=519

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 337/470 (72%), Gaps = 15/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DG++G VA D Y  Y ED DL+
Sbjct  48    DFLFGTASSAYQYEGAYLTDGKTLSNWDVFTSIPGKIADGTHGKVAVDHYHRYPEDLDLM  107

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LP+ R G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  108   QDLGVNSYRFSLSWARILPR-RLGDVNMEGIDHYNRMINAILKRGMEPFVTLTHYDIPQE  166

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY+ WLSP+++E++ ++A +CF+H G++VK+W TFNEPN+  I  YR   +P     
Sbjct  167   LELRYKSWLSPQIREDFEHYAAICFRHFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  226

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAVN+YR  +Q+ Q G+IGI M   WF P+++S
Sbjct  227   KTFANCTRGGSDIEPLVAAHNIIRSHLAAVNLYRTKFQEDQRGKIGIVMNTIWFEPVSDS  286

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AAERA +F   WFLDP+++G YP+EMKDILG  LPEF+  DL+  K  G DFIGI
Sbjct  287   VADSLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKSSK-NGLDFIGI  345

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL++ C+P   G +R EGFV  +  KNG  +GE T + +  VYP GME +
Sbjct  346   NQYTSRYAKDCLHTACEPG-QGGSRAEGFVYSNALKNGLPLGERTRVNWFNVYPQGMEEM  404

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  405   LMYATERYRNIPLYVTENGFGENNTG-----VLLNDYRRVKFMSNYLDALKRAMRKGADV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI KN
Sbjct  460   RGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFIFKN  509



>ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46124.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   526 bits (1355),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 340/471 (72%), Gaps = 14/471 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF++  G I DGS+G VA D Y  Y  D DL+
Sbjct  54    NFLFGTASSAYQYEGAYLTDGKTLSNWDVFTNISGKIADGSHGKVAVDHYHRYPGDLDLM  113

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+ +L++GIEPFVT+ HYD+PQE
Sbjct  114   EDLGVNSYRLSLSWARILPKGRFGDVNMGGIDHYNRMINDILMRGIEPFVTLTHYDIPQE  173

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL+P+++E++ ++A++CF++ GD+VK+W TFNEPN+  I  YR   +P     
Sbjct  174   LESRYGSWLNPQIREDFEHYANICFRYFGDRVKFWATFNEPNVQVILGYRTGTYPPSRCS  233

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++  +  + AHN+I +H AAV +YR  +Q+QQ G+IGI M   WF P+++S
Sbjct  234   NTFGNCSCGDSYIEPLVAAHNIIRSHVAAVTLYRTKFQEQQSGKIGIVMNTIWFEPVSDS  293

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WFLDP+++G YP+EM++ILG  LPEF++ DL+  K    DFIGI
Sbjct  294   LADRLAAERAQAFYLTWFLDPVVFGRYPREMREILGEDLPEFTTDDLKSSK-NTLDFIGI  352

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL S C+P   G +R EGFV     K+G  +GE TG+ + +VYP GME +
Sbjct  353   NQYTSRYAEDCLDSVCEPG-KGGSRAEGFVYAKALKDGLPLGEPTGVNWFSVYPQGMEEM  411

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA +++ +IPLYVTE G+ +  T       +L+D +R+KF+++YL A+  A+RKGADV
Sbjct  412   LMYATKRYKNIPLYVTENGFGENNTG-----VLLNDYRRLKFMSNYLDALKRAMRKGADV  466

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYF WSL DNFEW SGYT R G+Y  D  TQ+RTP+LSA WYK FI +++
Sbjct  467   RGYFAWSLLDNFEWISGYTIRFGMYHVDFNTQERTPRLSASWYKNFIFQHR  517



>ref|XP_008669175.1| PREDICTED: probable inactive beta-glucosidase 14 [Zea mays]
Length=517

 Score =   526 bits (1354),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 248/478 (52%), Positives = 334/478 (70%), Gaps = 19/478 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG S+SSYQ EG YL D KGLSNWDVFSH PGNI DGSNGDVAAD Y  YK+D +++
Sbjct  36    SFLFGASTSSYQVEGAYLDDSKGLSNWDVFSHVPGNIDDGSNGDVAADHYHRYKDDIEMM  95

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G++S++FS+SWSR+LPKGR G +N  G+K+Y +LI+ LL KGI+PFVTINHYD+P+E
Sbjct  96    HSIGLSSYRFSLSWSRILPKGRFGGVNQAGVKFYNSLINGLLEKGIQPFVTINHYDIPEE  155

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             LQ+RY  WL+PE+QE++ YF ++CFK  GD+VK+W+TFNEPN+    AY    +P   CS
Sbjct  156   LQERYNSWLNPEIQEDFTYFVELCFKMFGDRVKHWVTFNEPNLIVKLAYSIGAFPPNRCS  215

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       GN++ + +I AHNMILAHA  VNIYRKNY+ +QGG +GI++   W+ P+ N 
Sbjct  216   EPYGKCDSGNSSTEPYIAAHNMILAHAKTVNIYRKNYKSKQGGFVGISLHLRWYEPLRNI  275

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A  RA SF + W LDP+ +G YP +M+ ILG +LP+F+  + +KL     DFIG+
Sbjct  276   TEDHLAVSRALSFDAPWILDPLFFGDYPHQMRQILGPNLPKFTEGE-KKLLKNQIDFIGV  334

Query  866   NHYTTYYAQDCLYSTCD----PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             NHY T+Y +DC+YS CD    PS       E  V  S  +NG  IG+ T +    V P  
Sbjct  335   NHYQTFYVKDCIYSLCDMDAYPS-------EALVSISTERNGIPIGKPTPVANTYVVPSS  387

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME++V Y K+++  IPLY+TE GY      +++ EE+++D +R  ++ DYL  +  AIRK
Sbjct  388   MEKLVMYLKQRYKSIPLYITENGYAQIANISTTAEEIINDIERSTYIRDYLTYLSFAIRK  447

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             GADVRGYF+WSL DNFEW SGYT + GL   +  + KRTPKLSAKWY +FI   ++++
Sbjct  448   GADVRGYFVWSLMDNFEWISGYTVKYGLCHVNFKSLKRTPKLSAKWYSKFIKGYEQIE  505



>ref|XP_010473401.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45 [Camelina 
sativa]
Length=552

 Score =   526 bits (1355),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 253/490 (52%), Positives = 339/490 (69%), Gaps = 19/490 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG + +DGK L+NWDVF+H+ PG I D  NGD+A DQY  + ED  L
Sbjct  42    DFLFGTASSAYQYEGAFSTDGKSLNNWDVFTHENPGKIHDEINGDIAVDQYHRFMEDIQL  101

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLP+G+ G IN  GIKYY  LIDSL+ +GI+PFVT+NH D PQ
Sbjct  102   MTFLGVNSYRFSISWSRVLPRGKVGGINYSGIKYYNILIDSLISRGIKPFVTLNHMDYPQ  161

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP----  1221
             EL++R+Q WL+P+MQ E+ Y AD+CFKH G++VKYW T NEPN   I  Y    +P    
Sbjct  162   ELENRFQSWLNPKMQNEFGYLADICFKHFGNRVKYWTTLNEPNQQVILGYITGRFPPSRC  221

Query  1220  ---HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                +GNCS GN+  + FI AHNMILAHA AVNIY+  YQ +Q G IGI +  + F P+++
Sbjct  222   SSSYGNCSRGNSETEPFIAAHNMILAHAKAVNIYKTKYQNEQKGSIGIVVQTSXFEPISD  281

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YPKEM +ILG+ LP+FSS +++ L     DFIG
Sbjct  282   SIADKEAAERAQSFYSNWILDPVIYGKYPKEMVNILGTALPQFSSNEVKNLNNSRVDFIG  341

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL S+C+    G  + EGF  + L + GN  IGELT + +  + P G  
Sbjct  342   INHYTSYFIQDCLTSSCNAGY-GAFKAEGFALK-LDRIGNVSIGELTDVDWQHIDPEGFH  399

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y  +++P+IP+++TE G+ D   P ++ +E+LHDTKR+++++ YL A+  A+R GA
Sbjct  400   KMLNYLTDRYPNIPMFITENGFGDLQKPETTYKELLHDTKRIQYISGYLEALQAAMRDGA  459

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYK--------QFIAKN  357
             +V+GYF+WSL DNFEW  GY  R GL+  D  T KRTPK SA   K         + AK 
Sbjct  460   NVKGYFVWSLLDNFEWLDGYKLRFGLFHVDYTTLKRTPKESASXSKLRYETSDDSYEAKG  519

Query  356   QKVDSKMQSR  327
               V + + SR
Sbjct  520   SHVTNPIHSR  529



>ref|XP_002448173.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
 gb|EES12501.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
Length=515

 Score =   525 bits (1352),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 334/470 (71%), Gaps = 15/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+S+YQ EGGYL   KGLSNWD+F+H+ G + DG+NGD A D Y  Y ED +L+
Sbjct  32    DFLFGTSTSAYQIEGGYLEGNKGLSNWDIFTHKQGTVEDGTNGDTADDHYHRYMEDIELI  91

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSI+W+R+LPKGR G++N +G+ +Y  LID+LL +GIEPFVTI+HYD+P E
Sbjct  92    HSLGVNSYRFSIAWARILPKGRFGHVNPDGVAFYNALIDALLQRGIEPFVTISHYDIPYE  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY GWLSP+++ ++ Y ADVCF+  GD+VK+WITFNEPN++A  +Y Y  +      
Sbjct  152   LEKRYGGWLSPKIRRDFGYLADVCFRMFGDRVKFWITFNEPNIFAKLSYIYGRYPPGHCS  211

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ GN++ + +IV HNM+L+HA  V+IY++ YQ +QGG IGI +L  W+ P  N 
Sbjct  212   RPFGNCTSGNSSTEPYIVGHNMVLSHANVVSIYKEKYQGKQGGYIGITVLSRWYEPFRNI  271

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A +R  SF + WFLDPI+ G YP  M+ +LG +LPEF+S   + L+    DFIG+
Sbjct  272   PTDILAVDRGLSFGAPWFLDPIILGDYPSPMRKMLGPNLPEFTSKQKKILQPSKLDFIGL  331

Query  866   NHYTTYYAQDCLYST---CDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             NHY+T Y +DC+YS+    DP   G+ +    +  S+ ++G  IGE TG PYL V P GM
Sbjct  332   NHYSTSYLKDCIYSSPCELDP-FDGDAQ----ISTSIDRDGILIGERTGSPYLNVVPYGM  386

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E+VV Y K ++ + P+Y+TE GY   +  N S ++  +DT RV +L  YL  + +AIRKG
Sbjct  387   EKVVMYFKRRYNNTPMYITENGYAQASNSNMSAKDFTNDTGRVDYLQGYLTFLASAIRKG  446

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             ADVRGYF+WSL DNFEW SGYT+R GLY  D  TQKRTPKLSAKWY +F+
Sbjct  447   ADVRGYFVWSLLDNFEWNSGYTQRFGLYHVDFKTQKRTPKLSAKWYSEFL  496



>ref|XP_006858057.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
 gb|ERN19524.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
Length=537

 Score =   525 bits (1351),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/490 (51%), Positives = 338/490 (69%), Gaps = 30/490 (6%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++S+YQYEG +L+DGKG SNWDVFSH PG I++G NGD A D+Y  Y+ED +L+ 
Sbjct  33    FLFGTAASAYQYEGAFLTDGKGPSNWDVFSHIPGRIVNGDNGDFAVDEYHRYQEDIELMH  92

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISW+RVLP+G+ G IN  GIKYY  LID+L+ KGI+PFVTINHYD+PQE+
Sbjct  93    SLGVNTYRFSISWARVLPRGKFGGINPAGIKYYNKLIDALVKKGIQPFVTINHYDIPQEI  152

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY  WLSP ++ ++ +FA++CF+  GD+VKYW T NEPN+     Y    +       
Sbjct  153   ENRYGSWLSPLIRLDFGHFAELCFREFGDRVKYWATLNEPNIVVRFGYMSGSYPPAHCSV  212

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P+GNC++G++  + ++ +HN+IL+HA AV+IYR+ YQ++QGG IGI +   WF P+ ++ 
Sbjct  213   PYGNCTDGDSDFEPYMASHNVILSHATAVDIYRRKYQEKQGGSIGIVICSYWFEPLKDTP  272

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
             VD+ AA+RA +F S WFLDPI++G YP EM+ ILGS LP FS  +  KL+  G DFIGIN
Sbjct  273   VDRIAAQRALAFESAWFLDPIVFGDYPPEMRQILGSRLPRFSKEERRKLQ-NGLDFIGIN  331

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HYT+ Y +DCL+S C   MS     EGF    L + G  IGE T +    VYP GME++V
Sbjct  332   HYTSLYVKDCLFSECTYGMSSI---EGFYSMILEREGIPIGEPTAMTTFYVYPQGMEKIV  388

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR------  522
              Y KE++ ++P+++TE GY   +TP +  EE + D +RVK+L  YL ++  AIR      
Sbjct  389   MYMKERYNNLPMFITENGYAQGSTPKAKAEEFVDDAERVKYLGSYLESLANAIRSLSLSL  448

Query  521   -------------KGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKW  381
                          KGA+V+GY +WSL DNFEW +GY  R GLY  D +T KRTPKLSA W
Sbjct  449   SQQRDLPCACVRMKGANVKGYMVWSLLDNFEWLNGYNMRFGLYHVDFSTFKRTPKLSADW  508

Query  380   YKQFIAKNQK  351
             YK FI   +K
Sbjct  509   YKGFIQNYKK  518



>ref|NP_001185287.1| beta-glucosidase 45 [Arabidopsis thaliana]
 gb|AEE33891.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=543

 Score =   524 bits (1350),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 245/482 (51%), Positives = 342/482 (71%), Gaps = 11/482 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGT+SS+YQYEG +L+DGK L+NWDVF+H+ PG ILD +N D A DQY+ + ED  L
Sbjct  41    DFLFGTASSAYQYEGAFLTDGKSLNNWDVFTHKNPGKILDKNNADRAVDQYNRFLEDIQL  100

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             ++ LGVNS++FSISW R+LP+GR G IN  GIKYY   ID+L+ +GI+PFVT+NH D PQ
Sbjct  101   MSFLGVNSYRFSISWCRILPRGRFGEINYLGIKYYNIFIDALISRGIKPFVTLNHVDYPQ  160

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL+DR+Q WL+PEMQ+E+ Y AD+CFKH G++VKYW T NEPN   I  Y    +     
Sbjct  161   ELEDRFQSWLNPEMQKEFGYLADICFKHFGNRVKYWTTLNEPNQQLILGYLTGKFPPSRC  220

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNCS+GN+  + FI AHNMILAHA AVNIY+  YQ++Q G IGI +  +WF P+++
Sbjct  221   SSPYGNCSQGNSETEPFIAAHNMILAHAKAVNIYKTKYQKEQKGSIGIVVQTSWFEPISD  280

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK AAERA SF SNW LDP++YG YPKEM DILG  LP+FSS +++ L+   +DF+G
Sbjct  281   SNADKEAAERAQSFYSNWILDPVIYGKYPKEMVDILGPALPQFSSNEVKNLEKSRADFVG  340

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVYPPGME  693
             INHYT+Y+ QDCL S C+ +  G  + EG+  + L + GN  IGELT + +  + P G  
Sbjct  341   INHYTSYFIQDCLTSACN-TGHGAFKAEGYALK-LDRKGNVTIGELTDVNWQHIDPTGFH  398

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K+++P++P+++TE G+ D   P ++ +E+L+DTKR+++++ YL A+  A+R GA
Sbjct  399   KMLNYLKDRYPNMPMFITENGFGDLQKPETTDKELLNDTKRIQYMSGYLEALQAAMRDGA  458

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             +V+GYF+WSL DNFEW  GY  R GL+  D  T KR+          + A++  V + + 
Sbjct  459   NVKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTTLKRSKLRYETSDDSYEARSSHVTNHIL  518

Query  332   SR  327
             SR
Sbjct  519   SR  520



>ref|XP_002448169.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
 gb|EES12497.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
Length=510

 Score =   523 bits (1346),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 330/474 (70%), Gaps = 11/474 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG  +SSYQ EG Y  D KGLSNWDVF+H  G I+DGSNGDVAAD Y  YKED +++
Sbjct  29    SFLFGAGTSSYQIEGAYREDNKGLSNWDVFTHIQGKIVDGSNGDVAADHYHRYKEDIEMM  88

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G++S++FS+SWSR+LPKGR G++N  G+K+Y +LI+ +L KGIEPFVTINHYD+P+E
Sbjct  89    HSVGLDSYRFSLSWSRILPKGRFGDVNPAGVKFYNSLINGMLQKGIEPFVTINHYDIPEE  148

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             LQ RY  WLSPE+QE++ YFA++CFK  GD+VK+W TFNEPN+ A  AY        +  
Sbjct  149   LQQRYGSWLSPEIQEDFTYFAEICFKMFGDRVKHWATFNEPNLMAKLAYFNGKFPPSHCS  208

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G C+ GN++ + +I AHNMILAHA  VNIY+KNY+ +QGG +GI +   W+ P+ N 
Sbjct  209   KPFGKCNSGNSSTEPYIAAHNMILAHAKTVNIYKKNYKTKQGGSVGITVYMRWYEPLRNI  268

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A  RA SF + WFLDP+ +G YP +M+ ILG +LPEF+  + ++L     DFIG+
Sbjct  269   TDDHLAVSRAQSFEAPWFLDPLFFGDYPHQMRQILGPNLPEFTEGE-KQLMKNQIDFIGV  327

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY T Y +DC+YS CD         +  V +S  +NG  IG+ T +    V P  ME++
Sbjct  328   NHYKTLYVKDCVYSLCDLDTYAG---DALVSESAERNGIPIGKPTPVANNYVVPSSMEKL  384

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y  +++  IPLY+TE GY      +++ EE+++DT+R  ++ DYL  +  AIRKGADV
Sbjct  385   VMYLTQRYKSIPLYITENGYAQIGNSSTTTEELINDTERSSYIRDYLTYLSFAIRKGADV  444

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             RGYF+WSL DNFEW SGYT + GLY  D  + KRTPKLSAKWY  FI   ++++
Sbjct  445   RGYFVWSLMDNFEWLSGYTIKYGLYHVDFKSLKRTPKLSAKWYSNFIKGYEQIE  498



>ref|XP_009135219.1| PREDICTED: beta-glucosidase 47 isoform X2 [Brassica rapa]
Length=522

 Score =   521 bits (1343),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 341/476 (72%), Gaps = 15/476 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+   G I DGS+G V+ D Y  Y  D DL 
Sbjct  52    DFLFGTASSAYQYEGAYLTDGKALSNWDVFTSISGKIADGSHGKVSVDHYHRYPGDLDLK  111

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  112   KDLGVNSYRFSLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQE  171

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL+P+++E++ ++A++CF+H G++VK+W TFNEPN+  I  YR   +P     
Sbjct  172   LECRYGSWLNPQIREDFEHYAEICFRHFGNRVKFWTTFNEPNVQVILGYRKGTYPPSRCS  231

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAV++YR+ + Q+QGG+IGI M   WF P+++S
Sbjct  232   KTFANCTRGGSDIEPLVAAHNIIRSHFAAVSLYRERF-QEQGGKIGIVMNAIWFEPVSDS  290

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AAERA +F   WFLDPI++G YP+EM++ILG  LP+F+  DL+  K  G DFIGI
Sbjct  291   LADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK-NGLDFIGI  349

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  350   NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYPQGMEEM  408

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ + +T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  409   LMYATEQYKNIPLYVTENGFGENSTG-----VLLNDYRRVKFMSNYLDALKRAMRKGADV  463

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
              GYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI+K+    SK
Sbjct  464   GGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQSK  519



>ref|XP_008669176.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Zea 
mays]
Length=510

 Score =   520 bits (1340),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 250/477 (52%), Positives = 335/477 (70%), Gaps = 16/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG  SSSYQ EG YL D KGLSNWDVF+H  GNI DGSNGD+A D Y  YK+D +++
Sbjct  28    SFLFGAGSSSYQIEGAYLEDNKGLSNWDVFTHIKGNIDDGSNGDMATDHYHRYKDDIEMM  87

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+ S+KFS+SWSR+LPKGR G IN  GIK+Y NLI+ LL KGI+P VTINHYD+P+E
Sbjct  88    HSIGLTSYKFSLSWSRILPKGRFGGINQAGIKFYNNLINGLLEKGIQPLVTINHYDIPEE  147

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             LQ+RY  WL+PE+QE++ YFA++CFK  GD+VK+W+TFNEPN+ A   Y    +P   CS
Sbjct  148   LQERYNSWLNPEIQEDFTYFAELCFKMFGDRVKHWVTFNEPNLLAKLEYFIGGFPPNRCS  207

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       GN++ + +I AHNMILAHA   NIYRKNY+ +QGG +GI +   W+ P+ N 
Sbjct  208   EPNGKCDYGNSSTEPYIAAHNMILAHAKTNNIYRKNYKSKQGGSVGITIHMRWYEPLRNI  267

Query  1046  TVDKAAAERAHSFLSNW-FLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             T D  A  RA SF +   FLDP+ +G YP +M+ ILG +LP+F++ + EKL     DFIG
Sbjct  268   TEDHLAVSRALSFEAPCRFLDPLFFGDYPHQMRQILGPNLPKFTAGE-EKLLKNQIDFIG  326

Query  869   INHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGM  696
             +NHY T+Y +DC+YS C  DP  S     E  V +S  +NG  IG+LT      V P  M
Sbjct  327   VNHYQTFYVKDCIYSLCDIDPYTS-----EALVSESTERNGIPIGKLTQDANTYVVPSSM  381

Query  695   ERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             E++V Y KE++ +IPLY+TE GY      ++++EE+++DT+R+ ++ DYL  +  AIRKG
Sbjct  382   EKLVMYLKERYNNIPLYITENGYAQIPNISTTVEEIINDTERINYIRDYLTYLSFAIRKG  441

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             ADVRGYF+WSL D+FEW SGYT + GL+  +  + KRTPKLSAKWY +FI   ++++
Sbjct  442   ADVRGYFVWSLMDSFEWISGYTIKYGLFHVNFKSLKRTPKLSAKWYNKFIKGYEQIE  498



>ref|XP_009137215.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=521

 Score =   520 bits (1339),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/467 (52%), Positives = 336/467 (72%), Gaps = 14/467 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DGS+G VA D Y LY ED DL+
Sbjct  49    DFLFGTASSAYQYEGAYLADGKTLSNWDVFTSIPGKIADGSHGKVAVDHYHLYPEDLDLM  108

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+L  GR G++N+EGI +Y  +I+++L KG+EPF+T+ HYD+PQE
Sbjct  109   KDLGVNSYRFSLSWARILLHGRFGDVNMEGIDHYNRMINAILKKGMEPFITLTHYDIPQE  168

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+  Y  WL P+++E++ ++A++CF+H G++VK+W TFNEPN+  I  Y+   +P     
Sbjct  169   LELIYGSWLDPQVREDFVHYAEICFRHFGNRVKFWTTFNEPNVQVILGYQKGTYPPSRCS  228

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAVN+Y+K +Q+ Q G+IGI M   WF P+++S
Sbjct  229   MTFANCTRGGSDIEPLVAAHNIIRSHLAAVNLYQKKFQEDQRGKIGIVMNTIWFEPVSDS  288

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WFLDP+++G YP+EMKDILG  LP+F+  DL+  K  G DFIGI
Sbjct  289   LADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPKFTKDDLKSSK-NGLDFIGI  347

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL++TC+    G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  348   NQYTSRYAKDCLHTTCELG-QGGSRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  406

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  407   LMYATERYRNIPLYVTENGFGENNTG-----VLLNDYRRVKFMSNYLDALKRAMRKGADV  461

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI
Sbjct  462   RGYFTWSLLDNFEWISGYTIRFGMYHVDFDTLERTPRLSASWYKNFI  508



>ref|XP_006413735.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55188.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=528

 Score =   520 bits (1339),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 342/475 (72%), Gaps = 18/475 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YLSDGK LSNWDVF++  G I DGS+G VA D Y  Y ED DL+
Sbjct  53    NFLFGTASSAYQYEGAYLSDGKTLSNWDVFTNITGKIADGSHGKVAVDHYHRYPEDLDLM  112

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +ID++L +GIEPFVT+ HYD+PQE
Sbjct  113   EDLGVNSYRFSLSWARILPKGRFGDMNMEGIYHYNRVIDAILKRGIEPFVTLTHYDIPQE  172

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPH----  1218
             L+ RY  WL+P+++E++ ++A++CF++ G++VK+W TFNEPN+  I  YR   +P     
Sbjct  173   LEYRYGSWLNPQIREDFEHYAEICFRYFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  232

Query  1217  ---GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++  +  + AHN+I +H AAV+IYR  YQ+QQ G+IGI M   WF P++++
Sbjct  233   KTVGNCTRGDSEIEPLVAAHNIIRSHLAAVSIYRTKYQEQQRGKIGIVMNAIWFEPVSDA  292

Query  1046  TVDKAAAERAHSFL----SNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSD  879
               D+ AAERA +F     +  FLDP+++G YP+EM++I G  LP+F+  DL+  K  G D
Sbjct  293   LADRLAAERAQAFYLTCENCRFLDPVVFGRYPREMQEIFGEDLPQFTKDDLKSSK-NGLD  351

Query  878   FIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             FIGIN YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP G
Sbjct  352   FIGINQYTSRYAKDCLHSACEPGQGG-SRAEGFVNANALKDGLALGEPTGVDWFNVYPQG  410

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME ++ YA E++ +IPLYVTE G+ +  T       +++D +RVK+++ YL A+  A+RK
Sbjct  411   MEEMLMYATERYKNIPLYVTENGFGENNTG-----VLVNDYRRVKYMSSYLDALKRAMRK  465

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             GAD+RGYF WSL DNFEW SGYT R GLY  D  T +RTP+LSA WYK FI +++
Sbjct  466   GADIRGYFTWSLLDNFEWISGYTIRFGLYHVDFNTLERTPRLSASWYKNFIFQHR  520



>ref|XP_003581423.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Brachypodium 
distachyon]
Length=518

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/469 (52%), Positives = 334/469 (71%), Gaps = 14/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGTS+S+YQ EGGYL   KG SNWDV++H+ G I  GSNGD AAD Y  Y ED +L+
Sbjct  35    NFLFGTSTSAYQIEGGYLEGNKGTSNWDVYTHKQGTIRGGSNGDTAADHYHRYMEDIELM  94

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSI+W+R+LP+GR G++N +G+ +Y  +ID+L  KGI+PFVTI HYD+P E
Sbjct  95    HSLGVNSYRFSIAWTRILPRGRFGDVNPDGVAFYNAIIDALWQKGIQPFVTIFHYDIPHE  154

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L +RY GWLSPE+Q+++ YFA+VCFK  GD+VK+W T NEPN+    +Y    +      
Sbjct  155   LDERYGGWLSPEIQKDFGYFAEVCFKMFGDRVKFWTTINEPNLLTKFSYMDGWYPPCRCS  214

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ GN++ + +IVAHNMIL+HA AV+IYR NYQ +QGG+IGI +   W+ P  N+
Sbjct  215   KPFGNCAFGNSSIEPYIVAHNMILSHANAVSIYRNNYQGKQGGQIGITVSARWYEPFRNT  274

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             TVD  A +RA SF + WFLDPI+ G YP EM+ +LG++LP F+S +  KL+A   DFIG+
Sbjct  275   TVDLLAVQRAISFNAPWFLDPIILGDYPPEMRQMLGANLPNFTSKEKRKLQATKLDFIGL  334

Query  866   NHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             NHYTT Y +DC++S C  DP + G+ R    V     ++G  IGE TG PY    P GME
Sbjct  335   NHYTTVYLKDCIFSPCAVDP-IDGDAR----VVSLAERDGVLIGEPTGTPYFYDVPHGME  389

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +VV + K+++ + P Y+TE GY   +  + +  + ++D  R+ ++  YL  + +AIRKGA
Sbjct  390   KVVMHYKQRYNNTPTYITENGYAQASNHSMAANDFINDAGRIHYIRGYLTFLASAIRKGA  449

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             D+RGYF+WSL D+FEWTSGYT+R GLY  D  TQKRTPKLSA WY++F+
Sbjct  450   DIRGYFVWSLLDDFEWTSGYTQRYGLYHVDFKTQKRTPKLSAGWYRKFL  498



>gb|ABC55715.1| beta-mannosidase 4 [Oncidium hybrid cultivar]
Length=498

 Score =   518 bits (1334),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 257/471 (55%), Positives = 332/471 (70%), Gaps = 11/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+++SYQ EGGYL   KGLSNWDVFSH PG I DGSNGD+A D Y  YK D DL+
Sbjct  29    DFLFGTATASYQIEGGYLDGNKGLSNWDVFSHIPGKIEDGSNGDIADDHYHRYKSDIDLM  88

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SL VNS++FSISWSR+LP+GR G +N +GI +Y  LID LLLKGI+PFVT+ HYD+PQE
Sbjct  89    HSLEVNSYRFSISWSRILPRGRFGEVNSKGISFYNELIDYLLLKGIQPFVTLCHYDIPQE  148

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L+DRY  WL+ ++QE++ Y+AD+CFK  G+KVKYW TFNEP +     YR  ++P G CS
Sbjct  149   LEDRYGAWLNSQIQEDFGYYADICFKEFGEKVKYWSTFNEPAVLVNKGYRLGIYPPGRCS  208

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       G++  + FI AHN+IL+HA AV+IYRK YQ +QGG IGI    TWF P  ++
Sbjct  209   EPYGHCSSGDSNTEPFIAAHNVILSHATAVDIYRKKYQIRQGGWIGIVASTTWFEPYEDT  268

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              +D  AA RA +F   WFLDPI+YGSYP +M  +LGS LP FS +D  KL++   DFIG+
Sbjct  269   PMDAMAAARALAFEVGWFLDPIIYGSYPPDMIQLLGSVLPTFSGSDKRKLRS-SLDFIGV  327

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY++ Y +DCL+S+C     G     G V     KNG  IG  TG+P L V P G E++
Sbjct  328   NHYSSLYPKDCLFSSC---YLGPFVSNGSVLGLGYKNGVPIGPKTGMPNLFVTPNGTEKI  384

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y KE++ + P+++TE GY   ++ N   +++L+D  RV+FL  YL ++  AIRKGADV
Sbjct  385   VLYVKERYKNKPMFLTENGYGQNSSDNLLTKDILNDEVRVEFLKSYLTSLSNAIRKGADV  444

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             RGYFIWSL DNFEW  GY++R GLY  D  TQKRTPK SAKWYK+F+ + +
Sbjct  445   RGYFIWSLLDNFEWVHGYSERFGLYYVDYLTQKRTPKQSAKWYKKFLIEKK  495



>gb|KDO75512.1| hypothetical protein CISIN_1g0095352mg, partial [Citrus sinensis]
Length=431

 Score =   514 bits (1325),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 243/422 (58%), Positives = 314/422 (74%), Gaps = 9/422 (2%)
 Frame = -3

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
             ED DL+ SLGVNS++FSISW+R+LPKGR G++N EGI +Y  LID+LLLKGI+PFVT+  
Sbjct  1     EDIDLMESLGVNSYRFSISWARILPKGRFGDVNSEGINHYNKLIDALLLKGIQPFVTLTQ  60

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYR----  1236
             +D PQE++D+Y  WLSPE QE++ YFAD+CFK  GD+VKYW T NEPNM    +YR    
Sbjct  61    FDSPQEIEDKYGAWLSPESQEDFGYFADICFKSFGDRVKYWFTINEPNMQVTLSYRLGCH  120

Query  1235  ---YRLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
                +   P GNCS+GN+ ++ FI AHN+IL+HA AV+IYR  YQ+ QGG IGI +   WF
Sbjct  121   PPAHCSQPFGNCSQGNSEEEPFIAAHNLILSHATAVDIYRTKYQKDQGGSIGIILNTLWF  180

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P+++ST DK AAERA SF  NWFLDPI+YG YP EM +I+GS LP+FSS D EKLK  G
Sbjct  181   EPISSSTADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQ-G  239

Query  884   SDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYP  705
              DFIGINHYT+ Y QDC++S C P   G ++ EGF  Q+  K+G  +GE T L +L VYP
Sbjct  240   LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYP  298

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GM +++ Y KE++ + P+++TE GY +   PNSS E++L+D KRV+++A YL A+ TA+
Sbjct  299   QGMWKIIKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAV  358

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             R GADVRGYF+WSL D+FEWT GYT R GL+  D AT KRTPKLSA WYK FIAK++ + 
Sbjct  359   RDGADVRGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIK  418

Query  344   SK  339
             S+
Sbjct  419   SQ  420



>ref|XP_009413739.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   517 bits (1332),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 244/468 (52%), Positives = 330/468 (71%), Gaps = 12/468 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
              F FGT++SSYQ EG YL   K LSNWDVF+H PG I DG  GD+A D Y  Y ED  L+
Sbjct  31    TFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHLPGKIKDGRTGDIADDHYHRYMEDISLM  90

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FS+SWSR+LP+GR G++N  GIK+Y  +IDSLL+KGI+PFVT+NH+D+PQE
Sbjct  91    HSLGVNSYRFSMSWSRILPRGRFGDVNPVGIKFYNRIIDSLLIKGIQPFVTLNHFDVPQE  150

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L+DRY  WLSP+++E++ + A+VCFK  GD+VK+W TFNEPN++   +Y +  +P G CS
Sbjct  151   LEDRYGSWLSPQIREDFGHLAEVCFKEFGDRVKFWTTFNEPNLFVKFSYAFGKYPPGRCS  210

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       G++  + +I AHN+IL+HA AV+IYRKNYQ +QGG IGI +   W+ P+TNS
Sbjct  211   EPYANCTTGDSEVEPYIAAHNIILSHATAVDIYRKNYQVKQGGSIGIVITSKWYEPLTNS  270

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A +RA SF   W LDPI+ G YP EM ++LGS LP F+  + +KL     DFIGI
Sbjct  271   TADCLATQRALSFEGPWILDPILLGDYPSEMHEVLGSRLPIFTYEE-KKLLLNKLDFIGI  329

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y  DC+ S+CD  + G  R +  +  +  K+G  IGE T LP     P G+E++
Sbjct  330   NHYSTNYVMDCMLSSCD--LDGYMR-DALIATTGYKDGVLIGEPTALPTYYAVPYGIEKM  386

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y  E++ ++P+Y+TE GY   ++  +  +E+++DT+R+KF+  YL  +  AI +GADV
Sbjct  387   VRYIMERYNNVPMYITENGYAQGSS-GAFTKELINDTERIKFMHSYLTFLSAAISQGADV  445

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             RGYF WSL DNFEW  GYT R GL+  D  TQ+RTPKLSAKWYK+F++
Sbjct  446   RGYFSWSLLDNFEWAFGYTVRFGLFHVDYKTQRRTPKLSAKWYKKFLS  493



>ref|XP_010245701.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=512

 Score =   517 bits (1331),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 329/473 (70%), Gaps = 15/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PG I DGSNGDVA D Y  Y ED +L+
Sbjct  29    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHIPGKIKDGSNGDVADDHYHHYMEDVELM  88

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISWSRVLP+GR G +N  GI++Y  LI++LL+KGI+PFVT+NH+D+PQE
Sbjct  89    HYLGVNSYRFSISWSRVLPRGRFGEVNSGGIEFYNKLINALLIKGIQPFVTLNHFDMPQE  148

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL-------  1227
             L+DRY  WL+ ++Q+++ YFA+VCFK  GD+VKYW TFNEPN+  I  Y Y         
Sbjct  149   LEDRYGSWLNSQIQQDFGYFAEVCFKAFGDRVKYWSTFNEPNI--IVPYGYLFGGCPPSR  206

Query  1226  --WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
               +P G+C  G++T + +I AHNMIL+HA A  IY+K YQ +QGG+IGI M  TW+ P+ 
Sbjct  207   CSYPFGDCQSGDSTLEPYIAAHNMILSHATAAEIYKKKYQVKQGGKIGIVMSSTWYEPLR  266

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             ++  D  A +RA +F + WFLDPI YG YP EM+ ILGS LP FS  D +KL     DFI
Sbjct  267   DTLTDNLAVQRALAFDTAWFLDPIFYGEYPPEMRQILGSRLPMFSVEDKKKL-GNKLDFI  325

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             G+NHY+T Y +DC+ S C+ S S         G+   K+G+ IG+ T +P   V P GME
Sbjct  326   GVNHYSTLYVKDCMLSQCESSTSFGEASVYITGE---KDGHPIGDPTAMPSFYVVPYGME  382

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K+++ + P+++TE GY   + PN S  ++L+D  R+++L  YL ++  A+R GA
Sbjct  383   KILMYFKDRYNNTPMFITENGYAQASNPNVSKRDLLNDAGRIEYLKSYLTSLNLAMRHGA  442

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             DVRGYF+WSL DNFEW  GYT R G+Y  D  T +RTPK SA WY+QF+A+ +
Sbjct  443   DVRGYFVWSLIDNFEWLYGYTMRFGIYYVDYKTLERTPKHSAMWYRQFLAREK  495



>ref|XP_010920356.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=510

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 332/474 (70%), Gaps = 11/474 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+SSYQ EG YL   K LSNWDVF+H PG+I D S+GD+A D Y LY ED  L+
Sbjct  32    SFLFGTSTSSYQIEGAYLEGNKSLSNWDVFTHIPGHIEDSSDGDIADDHYHLYMEDIKLM  91

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISWSR+LP+GR G +N  GI +Y  LID+LLLKGI+PFVT+NHYD+PQE
Sbjct  92    HHLGVNSYRFSISWSRILPRGRFGKVNSAGIAFYNRLIDALLLKGIQPFVTLNHYDVPQE  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+DRY  WL+P++Q+++ ++ADVCFK  G KVKYW TFNEPN+     +       ++  
Sbjct  152   LEDRYGAWLNPQIQKDFGHYADVCFKAFGKKVKYWTTFNEPNVVVKRGFMSGEYPPQHCS  211

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G+C  G++  + +I AHN+ILAHA AV IY+K YQ +QGG IG+ +   WF P+ + 
Sbjct  212   KPFGDCLSGDSNIEPYIAAHNIILAHATAVEIYKKKYQVKQGGSIGLVISTNWFEPLRHI  271

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +RA +F + WFLDP+++G YP EM+ +LG  LP FSS D  KL+    DFIGI
Sbjct  272   PADRLAVQRALAFDTAWFLDPVIFGEYPPEMRQVLGLRLPTFSSEDRRKLQY-KLDFIGI  330

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+ Y +DC++S C+    G+T    FV  +  +NG  IG  T +P   V+P GME++
Sbjct  331   NHYTSKYVKDCMFSPCN---EGSTESTAFVISTGERNGIPIGTPTSMPDNYVFPDGMEKM  387

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V YA +++ +IP+++TE GY   +T NS   + L+D  RV++L  YL ++  A+R+GADV
Sbjct  388   VMYAMQRYNNIPMFITENGYAQGSTGNSPTTDTLNDRGRVEYLHGYLTSLTRAMRQGADV  447

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             RGYFIWSL DNFEW  GY++R GLY  +  TQ+RTPKLSAKW K+F+   Q ++
Sbjct  448   RGYFIWSLLDNFEWLFGYSQRFGLYHVNFKTQERTPKLSAKWVKKFLGGPQVIE  501



>ref|XP_009135212.1| PREDICTED: beta-glucosidase 47 isoform X1 [Brassica rapa]
Length=528

 Score =   516 bits (1328),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 245/482 (51%), Positives = 341/482 (71%), Gaps = 21/482 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQ------YEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYK  1584
             +F FGT+SS+YQ      YEG YL+DGK LSNWDVF+   G I DGS+G V+ D Y  Y 
Sbjct  52    DFLFGTASSAYQFCLLIQYEGAYLTDGKALSNWDVFTSISGKIADGSHGKVSVDHYHRYP  111

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
              D DL   LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ H
Sbjct  112   GDLDLKKDLGVNSYRFSLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTH  171

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW  1224
             YD+PQEL+ RY  WL+P+++E++ ++A++CF+H G++VK+W TFNEPN+  I  YR   +
Sbjct  172   YDMPQELECRYGSWLNPQIREDFEHYAEICFRHFGNRVKFWTTFNEPNVQVILGYRKGTY  231

Query  1223  P-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
             P         NC+ G +  +  + AHN+I +H AAV++YR+ + Q+QGG+IGI M   WF
Sbjct  232   PPSRCSKTFANCTRGGSDIEPLVAAHNIIRSHFAAVSLYRERF-QEQGGKIGIVMNAIWF  290

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P+++S  D  AAERA +F   WFLDPI++G YP+EM++ILG  LP+F+  DL+  K  G
Sbjct  291   EPVSDSLADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK-NG  349

Query  884   SDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYP  705
              DFIGIN YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP
Sbjct  350   LDFIGINQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYP  408

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GME ++ YA E++ +IPLYVTE G+ + +T       +L+D +RVKF+++YL A+  A+
Sbjct  409   QGMEEMLMYATEQYKNIPLYVTENGFGENSTG-----VLLNDYRRVKFMSNYLDALKRAM  463

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             RKGADV GYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI+K+    
Sbjct  464   RKGADVGGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQ  523

Query  344   SK  339
             SK
Sbjct  524   SK  525



>emb|CDX98704.1| BnaA03g44890D [Brassica napus]
Length=505

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 330/470 (70%), Gaps = 29/470 (6%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+  PG I DG++G VA D Y  Y ED DL+
Sbjct  48    DFLFGTASSAYQYEGAYLTDGKTLSNWDVFTSIPGKIADGTHGKVAVDHYHRYPEDLDLM  107

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+E               GIEPFVT+ HYD+PQE
Sbjct  108   QDLGVNSYRFSLSWARILPKGRLGDVNME---------------GIEPFVTLTHYDIPQE  152

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY+ WLSP+++E++ ++A +CF+H G++VK+W TFNEPN+  I  YR   +P     
Sbjct  153   LEHRYKSWLSPQIREDFEHYAAICFRHFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  212

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAVN+YR  +Q+ Q G+IGI M   WF P+++S
Sbjct  213   KTFANCTRGGSDIEPLVAAHNIIRSHLAAVNLYRTKFQEDQRGKIGIVMNTIWFEPVSDS  272

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WFLDP+++G YP+EMKDILG  LPEF+  DL++ K  G DFIGI
Sbjct  273   LADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEDLPEFTKDDLKRSK-NGLDFIGI  331

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL++ C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  332   NQYTSRYAKDCLHTACEPGQGG-SRAEGFVYSNALKDGLPLGEPTGVNWFNVYPQGMEEM  390

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ +  T       +L+D +RV+F+++YL A+ TA+RKGADV
Sbjct  391   LMYATERYRNIPLYVTENGFGENNT-----GVLLNDYRRVEFMSNYLDALKTAMRKGADV  445

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF WSL DNFEW SGYT R G+Y  D    +RTP+LSA WYK FI KN
Sbjct  446   RGYFTWSLLDNFEWISGYTIRFGMYHVDFDNLERTPRLSASWYKNFIFKN  495



>ref|XP_006449067.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
 gb|ESR62307.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
Length=431

 Score =   511 bits (1316),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 240/422 (57%), Positives = 314/422 (74%), Gaps = 9/422 (2%)
 Frame = -3

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
             ED DL+ SLGVNS++FSISW+R+LPKGR G++N EGI +Y  LID+LLLKGI+PFVT+  
Sbjct  1     EDIDLMESLGVNSYRFSISWARILPKGRFGDVNSEGINHYNKLIDALLLKGIQPFVTLTQ  60

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYR----  1236
             +D PQE++D+Y  WLSPE Q+++ YFAD+CFK  GD+VK+W T NEPNM  I +YR    
Sbjct  61    FDSPQEIEDKYGAWLSPESQQDFGYFADICFKSFGDRVKFWFTINEPNMQVILSYRLGRH  120

Query  1235  ---YRLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
                +   P GNCS GN+ ++ FI AHN+IL+HA AV+IYR  YQ+ QGG IGI +   WF
Sbjct  121   PPAHCSQPFGNCSRGNSEEEPFIAAHNLILSHATAVDIYRTKYQKDQGGSIGIILNTVWF  180

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P+++ST DK AAERA SF  NWFLDPI++G YP EM +I+GS LP+FSS D EKLK  G
Sbjct  181   EPISSSTADKLAAERAQSFYMNWFLDPIIHGKYPAEMMNIVGSTLPKFSSRDKEKLKQ-G  239

Query  884   SDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYP  705
              DFIGINHYT+ Y QDC++S C P   G ++ EGF  Q+  K+G  +GE T L +  VYP
Sbjct  240   LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWQNVYP  298

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GM +++ Y +E++ + P+++TE GY + + PNSS E++L+D KRVK++A YL A+ TA+
Sbjct  299   QGMWKIIKYIQERYKNTPMFITENGYGEISMPNSSTEDLLNDVKRVKYMASYLDALITAV  358

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             R GADVRGYF+WSL D+FEWT GYT R GL+  D AT KRTPKLSA WYK FIAK++ + 
Sbjct  359   RDGADVRGYFVWSLLDSFEWTYGYTSRFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIK  418

Query  344   SK  339
             S+
Sbjct  419   SQ  420



>ref|XP_010069050.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW57267.1| hypothetical protein EUGRSUZ_H00071 [Eucalyptus grandis]
Length=515

 Score =   513 bits (1322),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 251/477 (53%), Positives = 327/477 (69%), Gaps = 15/477 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SS+Q EG YL+  K LSNWDV++H PG + DGSN DVA D Y L+ ED + +
Sbjct  34    SFLFGTTTSSFQIEGAYLTGNKSLSNWDVYTHIPGKVEDGSNADVADDHYHLFMEDVESM  93

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISWSRVLP GR+G  N +GI +Y NLID+LL KGIEPFVT+NHY+ PQ 
Sbjct  94    EDLGVNSYRFSISWSRVLPHGRYGETNPDGINFYNNLIDALLQKGIEPFVTLNHYEHPQV  153

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+DRY  WLS E+Q ++A+FA+VCF+  GD+VKYW T NEPNM+   AY        +  
Sbjct  154   LEDRYGSWLSSEIQLDFAHFAEVCFEAFGDRVKYWTTINEPNMFTYYAYFEGTYPPGHCS  213

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             +P GNCS G++  + +I  HN++L+HAAAV IYR  YQ +QGG IGI +   +++P+TN+
Sbjct  214   YPVGNCSTGDSFMEPYIATHNVVLSHAAAVEIYRNKYQAKQGGMIGIVISAPYYVPLTNT  273

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA +F   WFLDPIMYG YP EM  I+G+ LP FS+ + +KL +   DFIGI
Sbjct  274   PADKLAAERALAFQIAWFLDPIMYGDYPPEMHQIIGARLPVFSAEERKKL-SNKLDFIGI  332

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT  YA+DC++S C    S  +  E  V  +  K+G  IG+ T + Y  V P  +E  
Sbjct  333   NQYTAAYAKDCMFSPC---TSAYSLGESMVYVTGEKDGTLIGDTTAVSYFYVVPSALEMA  389

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y KE++ + P+++TE GY  +  P   I + L+DTKRV++   YL A+  A+RKGADV
Sbjct  390   VMYVKERYNNTPMFITENGYAQSNAP---IADSLNDTKRVEYFKSYLSALVNAMRKGADV  446

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA-KNQKVDSK  339
             RGYFIWSL DNFEW  GYT R GLY  D  T KRTP+ SAKWYK F+A  N   +SK
Sbjct  447   RGYFIWSLLDNFEWLDGYTIRFGLYHVDFDTLKRTPRQSAKWYKNFLADSNSTTESK  503



>ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana]
 sp|Q9SVS1.2|BGL47_ARATH RecName: Full=Beta-glucosidase 47; Short=AtBGLU47; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE84500.1| beta-glucosidase 47 [Arabidopsis thaliana]
Length=535

 Score =   513 bits (1322),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 335/473 (71%), Gaps = 24/473 (5%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SS+YQYEG YL+DGK LSNWDVF++  G I DGS+G VA D Y  Y  D DL+
Sbjct  62    NFLFGTASSAYQYEGAYLTDGKTLSNWDVFTNISGKIADGSHGKVAVDHYHRYPGDLDLM  121

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N+ GI +Y  +I+ +L  GIEPFVT+ HYD+PQE
Sbjct  122   EDLGVNSYRLSLSWARILPKGRFGDVNMGGIDHYNRMINDILKTGIEPFVTLTHYDIPQE  181

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY  WL+P+++E++ ++A++CF+H GD+VK+W TFNEPN+  I  YR   +      
Sbjct  182   LEYRYGSWLNPQIREDFEHYANICFRHFGDRVKFWSTFNEPNVQVILGYRTGTYPPSRCS  241

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++  +  + AHN+IL+H AAVN+YR  +Q+QQ G+IGI M   WF P+++S
Sbjct  242   KPFGNCSCGDSYIEPLVAAHNIILSHLAAVNLYRTKFQEQQRGQIGIVMNTIWFEPISDS  301

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AA+RA +F   WFLDP+++G YP+EM++ILG  LPEF+  DL+  K    DFIGI
Sbjct  302   LADRLAADRAQAFYLTWFLDPVVFGRYPREMREILGDDLPEFTKDDLKSSK-NALDFIGI  360

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE          P GME +
Sbjct  361   NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVYANALKDGLRLGE----------PVGMEEM  409

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +I LYVTE G+ +  T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  410   LMYATERYKNITLYVTENGFGENNTG-----VLLNDYQRVKFMSNYLDALKRAMRKGADV  464

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             RGYF WSL DNFEW SGYT R G+Y  D +TQ+RTP+LSA WYK FI +++ +
Sbjct  465   RGYFAWSLLDNFEWISGYTIRFGMYHVDFSTQERTPRLSASWYKNFIFQHRAL  517



>ref|XP_008384041.1| PREDICTED: beta-glucosidase 46-like isoform X3 [Malus domestica]
Length=464

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/438 (54%), Positives = 321/438 (73%), Gaps = 9/438 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YL+DGK LSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  21    NFLFGTASSSYQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLM  80

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQE
Sbjct  81    NYIGVNTYRFSISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQE  140

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLS ++Q+++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  141   LEDRYGAWLSSQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYPPARCS  200

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAV++YR  Y ++QGG IGI M   W+ P+++S
Sbjct  201   SPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYHKKQGGSIGIVMNAVWYEPISSS  260

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  NWFLDPI+ G YP EM+++LGS LP FS +D+E LK  G DFIGI
Sbjct  261   LEDRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKMNGLDFIGI  320

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T +  L VYP GME++
Sbjct  321   NHYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKM  379

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR-KGAD  510
             VTY K+++ + P+++TE G+ +   PNSS EE+L+D KRV++L  YLHA+   IR +   
Sbjct  380   VTYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIRSRCKR  439

Query  509   VRGYFIWSLFDNFEWTSG  456
             V G  +       EW  G
Sbjct  440   VLGVVVAGQLRVDEWLYG  457



>ref|NP_001053302.1| Os04g0513100 [Oryza sativa Japonica Group]
 sp|Q7XPY7.2|BGL14_ORYSJ RecName: Full=Probable inactive beta-glucosidase 14; Short=Os4bglu14; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE03397.2| OSJNBa0004N05.21 [Oryza sativa Japonica Group]
 dbj|BAF15216.1| Os04g0513100 [Oryza sativa Japonica Group]
 dbj|BAG90635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77631.1| hypothetical protein OsI_16623 [Oryza sativa Indica Group]
Length=516

 Score =   510 bits (1314),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 327/470 (70%), Gaps = 14/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTSSS+YQ EGGYL   KGLSNWDVF+H+ G I DGSNGD A D Y  Y ED +L+
Sbjct  32    DFLFGTSSSAYQVEGGYLEGNKGLSNWDVFTHKQGTIEDGSNGDTANDHYHRYMEDIELM  91

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LPKGR G++N +G+ +Y  LID L+ KGI+PFVTI HYD+P E
Sbjct  92    HSLGVNSYRFSISWARILPKGRFGDVNPDGVAFYNALIDGLVQKGIQPFVTICHYDIPHE  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L +RY GWLSPE+Q++++YFA+VCFK  GD++K+W TFN+PN+    +Y    +  G CS
Sbjct  152   LDERYGGWLSPEIQKDFSYFAEVCFKLFGDRIKFWTTFNQPNLSIKFSYMDGFYSPGRCS  211

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       GN++ + ++  HN+IL+HA AV++YR  YQ +QGG+IGIA+  TW+ P  N+
Sbjct  212   EPFGKCALGNSSIEPYVAGHNIILSHANAVSVYRNKYQGKQGGQIGIALSITWYEPFRNT  271

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T+D  A +RA SF ++WFLDPI+ G YP EM+++LG  LP+F+S    +L++   DFIG+
Sbjct  272   TIDLLAVKRALSFGASWFLDPILLGDYPTEMREVLGQSLPKFTSKQKNRLQSTKLDFIGL  331

Query  866   NHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             NHYTT Y +DC++S C  DP        +  V     ++G  IG+ TG P+    P GME
Sbjct  332   NHYTTCYVKDCIFSPCEIDP-----VNADARVFSLYERDGVPIGKATGAPFFHDVPRGME  386

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
               VTY K+++ + P Y+TE GY   +  N + ++  +DT R+ ++  YL ++ +AIRKGA
Sbjct  387   EAVTYYKQRYNNTPTYITENGYSQASNSNMTAKDFTNDTGRITYIQGYLISLASAIRKGA  446

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             DVRGYF+WSL D+FEW  GYT R GLY     T KRTPKLS  WY++F+ 
Sbjct  447   DVRGYFVWSLLDDFEWNFGYTLRFGLYHVHYKTLKRTPKLSVDWYRKFLT  496



>ref|XP_008384042.1| PREDICTED: beta-glucosidase 46-like isoform X4 [Malus domestica]
Length=462

 Score =   508 bits (1309),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 230/415 (55%), Positives = 314/415 (76%), Gaps = 8/415 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG YL+DGK LSNWDVF+H+PG+I DG+NGD+A DQY LY ED DL+
Sbjct  21    NFLFGTASSSYQFEGAYLNDGKSLSNWDVFTHKPGHISDGTNGDIAGDQYHLYLEDLDLM  80

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVN+++FSISW+RVLPKGR G +N  GI +Y  LID+LL +GI+PFVT+ HYD+PQE
Sbjct  81    NYIGVNTYRFSISWARVLPKGRFGKVNRAGINHYNKLIDALLRRGIQPFVTLTHYDIPQE  140

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLS ++Q+++ Y+A+ CFK  GD+VKYW+TFNEPN+  I  YR  ++      
Sbjct  141   LEDRYGAWLSSQVQKDFLYYANTCFKFFGDRVKYWVTFNEPNVAVIRGYRSGMYPPARCS  200

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ FI AHN+IL+HAAAV++YR  Y ++QGG IGI M   W+ P+++S
Sbjct  201   SPFGNCTSGDSEREPFIAAHNIILSHAAAVHLYRTKYHKKQGGSIGIVMNAVWYEPISSS  260

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA SF  NWFLDPI+ G YP EM+++LGS LP FS +D+E LK  G DFIGI
Sbjct  261   LEDRLAAERAISFYMNWFLDPILQGKYPAEMRELLGSDLPAFSKSDVEMLKMNGLDFIGI  320

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y++DC++S C+P   G +R EGF  ++  K+G FIGE T +  L VYP GME++
Sbjct  321   NHYTSFYSKDCMFSACEPG-PGASRTEGFALRTAQKDGVFIGEPTSVDXLYVYPQGMEKM  379

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             VTY K+++ + P+++TE G+ +   PNSS EE+L+D KRV++L  YLHA+   IR
Sbjct  380   VTYVKDRYNNTPIFITENGFGEVENPNSSNEELLNDVKRVEYLRSYLHALSEGIR  434



>gb|KDO75513.1| hypothetical protein CISIN_1g0095352mg [Citrus sinensis]
Length=426

 Score =   506 bits (1304),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 239/417 (57%), Positives = 310/417 (74%), Gaps = 9/417 (2%)
 Frame = -3

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G++N EGI +Y  LID+LLLKGI+PFVT+  +D PQ
Sbjct  1     MESLGVNSYRFSISWARILPKGRFGDVNSEGINHYNKLIDALLLKGIQPFVTLTQFDSPQ  60

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYR-------YR  1230
             E++D+Y  WLSPE QE++ YFAD+CFK  GD+VKYW T NEPNM    +YR       + 
Sbjct  61    EIEDKYGAWLSPESQEDFGYFADICFKSFGDRVKYWFTINEPNMQVTLSYRLGCHPPAHC  120

Query  1229  LWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCS+GN+ ++ FI AHN+IL+HA AV+IYR  YQ+ QGG IGI +   WF P+++
Sbjct  121   SQPFGNCSQGNSEEEPFIAAHNLILSHATAVDIYRTKYQKDQGGSIGIILNTLWFEPISS  180

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             ST DK AAERA SF  NWFLDPI+YG YP EM +I+GS LP+FSS D EKLK G  DFIG
Sbjct  181   STADKLAAERAQSFYMNWFLDPIIYGKYPAEMMNIVGSTLPKFSSRDKEKLKQG-LDFIG  239

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+ Y QDC++S C P   G ++ EGF  Q+  K+G  +GE T L +L VYP GM +
Sbjct  240   INHYTSTYVQDCIFSACKPG-PGASKTEGFCLQNSQKHGVPLGEPTTLFWLNVYPQGMWK  298

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             ++ Y KE++ + P+++TE GY +   PNSS E++L+D KRV+++A YL A+ TA+R GAD
Sbjct  299   IIKYIKERYKNTPMFITENGYGEICMPNSSTEDLLNDVKRVEYMASYLDALITAVRDGAD  358

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             VRGYF+WSL D+FEWT GYT R GL+  D AT KRTPKLSA WYK FIAK++ + S+
Sbjct  359   VRGYFVWSLLDSFEWTYGYTARFGLHHVDFATLKRTPKLSATWYKHFIAKHKLIKSQ  415



>ref|XP_010023759.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Eucalyptus grandis]
 gb|KCW60130.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=514

 Score =   509 bits (1312),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 328/473 (69%), Gaps = 13/473 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SS+Q EGGYL   K LSNWDVFSH PG I DGSN DVA D Y+L+ ED  L+
Sbjct  37    SFLFGTATSSFQIEGGYLQGNKSLSNWDVFSHMPGKIEDGSNADVADDHYNLFLEDIQLM  96

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGV++++FSI+WSRVLP+GR G +N EGI++Y N+ID+LL++ I+PFVT+NHYDLPQ 
Sbjct  97    HSLGVDAYRFSIAWSRVLPQGRFGEVNSEGIEFYNNIIDALLVRDIKPFVTLNHYDLPQL  156

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL-------  1227
             L+DRY  WLS E+Q ++ YFA VCF+  GD+V YW  FNEPN+     Y           
Sbjct  157   LEDRYGSWLSSEIQLDFGYFAQVCFEAFGDRVTYWSIFNEPNVLIYHGYLLGTYPPGRCS  216

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             +P GNCS G++  + +I  HN++L+HA A  IYRK YQ++QGG IGI +   WF P  +S
Sbjct  217   YPFGNCSYGDSALEPYIATHNLVLSHATAAEIYRKYYQEKQGGMIGIVISAPWFEPYDDS  276

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +R+ +F   WF+DP++YG YP EM+ +LGS LP +S+ + +KL  G  DFIG+
Sbjct  277   PADRLAVQRSLAFYIAWFVDPLVYGDYPPEMRQVLGSRLPTYSAEERKKLLEGKLDFIGV  336

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT Y +DC++S+C    S  +  + FV  +  K+G +IGE T +P   V P GME +
Sbjct  337   NHYTTLYVKDCMFSSC---ASPYSLGDAFVYLTGEKDGAYIGERTAMPLFFVVPRGMEGI  393

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+++TE GY     P  +I++ L+DTKR+++  +YL  +   +RKGADV
Sbjct  394   VTYVKERYNNTPMFITENGYAQ---PAGAIKDSLNDTKRIEYHENYLAVLSEVVRKGADV  450

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             RGYFIWSL DNFEW  GY  R GL+  D  T KRTPK SA WY +F++++ K+
Sbjct  451   RGYFIWSLLDNFEWLYGYLIRFGLHYVDFQTLKRTPKWSATWYTEFLSEDNKI  503



>gb|EMT09723.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=508

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 335/468 (72%), Gaps = 15/468 (3%)
 Frame = -3

Query  1706  EGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  1527
             EGGYL   KGLSNWDV++H+ G I DGSNGD+AAD Y  Y ED +L+ SLGVNS++FSI+
Sbjct  37    EGGYLEGKKGLSNWDVYTHKQGTIEDGSNGDIAADHYHRYMEDIELMHSLGVNSYRFSIA  96

Query  1526  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSPEM  1347
             W+R+LP+GR G++N +G+ +Y  +I++LL KGI+PFVTI HYD+P EL++RY GWLSPE+
Sbjct  97    WTRILPRGRFGHVNPDGVAFYNAIINALLHKGIQPFVTIFHYDIPHELEERYGGWLSPEI  156

Query  1346  QEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------PHGNCSEGNATK  1188
             Q+++ YFA+VCFK  GD+VK+W+T N+PN+ A  AY    +       P+GNC+ GN++ 
Sbjct  157   QKDFGYFAEVCFKMFGDRVKFWVTMNQPNLLAKFAYMNGWFPPGHCSKPYGNCAFGNSSI  216

Query  1187  DIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSF  1008
             + +IV HNMIL+HA AV+IYR NYQ+ QGG IGIA+   W+ P+ N+TVD+ A ERA SF
Sbjct  217   EPYIVGHNMILSHANAVSIYRNNYQETQGGYIGIAVAARWYEPLRNTTVDQLAVERAISF  276

Query  1007  LSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLY  828
                WFLDPI+ G YP EM+ ILG  LPEF+    +KL A   DFIG+NHY+T+Y +DC++
Sbjct  277   NVPWFLDPIILGDYPAEMRKILGPTLPEFTLKQKKKLHATKLDFIGLNHYSTWYLKDCIF  336

Query  827   STC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDI  654
             S+C  DP M G+ R          ++G  IG+ TG P+    P GME+VV Y K+++ + 
Sbjct  337   SSCEMDP-MDGDARALSLA----ERDGVPIGKQTGAPFFYDVPHGMEKVVMYYKQRYNNT  391

Query  653   PLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDN  474
             P Y+TE GY   +  + + ++   DT+R+ +++ YL  + +A+RKGADVRGYF+WS+ D+
Sbjct  392   PTYITENGYAQASNSSMTAKDFTGDTERIDYISGYLTYLVSAMRKGADVRGYFVWSILDD  451

Query  473   FEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             FEWTSGY  R GLY  D  TQKRTPKLSA+W+++F+ K   V  + Q+
Sbjct  452   FEWTSGYKDRFGLYHVDFKTQKRTPKLSAEWFREFL-KGSLVSREFQN  498



>ref|XP_006451937.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
 gb|ESR65177.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
Length=523

 Score =   507 bits (1306),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 239/469 (51%), Positives = 320/469 (68%), Gaps = 10/469 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++SS+Q EG YL DGK LSNWDVFSH PGNI +  NGDVA D Y  + ED +++ 
Sbjct  48    FLFGTATSSFQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIEIMH  107

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVNS++FSISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ++
Sbjct  108   SLGVNSYRFSISWPRILPKGRFGEVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQI  167

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +D+Y  WLSP+MQ+E+ + A  CF++ GD+VKYW T NEPN+    AY    +       
Sbjct  168   EDKYGSWLSPQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYPPTHCSA  227

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  IV HNM+L+HA AV +YRK++Q++QGG +GI +    + P+ +  
Sbjct  228   PFGNCSAGNSDTEPLIVLHNMLLSHAKAVKLYRKHFQEKQGGSMGIVLHSMMYEPLRDED  287

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +F   W LDP+++G YP EM++ LGS LP FS  + + +K G  DFIGIN
Sbjct  288   SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVK-GSLDFIGIN  346

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY+T YA+DC++S C   +  N    GFV  +  ++G  IGE TG P   V P GME++V
Sbjct  347   HYSTLYAKDCIHSVC--VLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKIV  404

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K+++ +IP+YVTE GY      N   ++++ D KR+++ + YL A+  AIR GADVR
Sbjct  405   DYVKDRYKNIPMYVTENGYSPPKQKNQRSQDLVDDVKRIEYHSGYLSALARAIRNGADVR  464

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GYFIWSL DNFEW  GY+   GLY  DR T +RTPKLSA W+K F+  N
Sbjct  465   GYFIWSLMDNFEWLDGYSVMFGLYYIDRQTLERTPKLSATWFKNFLTDN  513



>ref|XP_010023758.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW60129.1| hypothetical protein EUGRSUZ_H02855 [Eucalyptus grandis]
Length=518

 Score =   507 bits (1305),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 326/469 (70%), Gaps = 14/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SS+Q EG YL   K LSNWDVFSH PG I DGSN DV  + Y+L+ ED +L+
Sbjct  42    SFLFGTATSSFQIEGAYLQGNKSLSNWDVFSHIPGKIEDGSNADVTDNHYNLFMEDIELM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGV++++FSISWSRVLPKGR G +N EGI++Y NLID+LL+KGI+PFVT+NHYD+PQ 
Sbjct  102   CDLGVDAYRFSISWSRVLPKGRFGEVNSEGIEFYNNLIDALLVKGIKPFVTLNHYDIPQL  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL-------  1227
             L+DRY GWLS E+Q ++ YFA VCF+  GD+V YW TFNEPN++    Y           
Sbjct  162   LEDRYGGWLSSEIQLDFGYFAQVCFEAFGDRVTYWTTFNEPNVFIYDGYVVGTYPPGRCS  221

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             +P GNCS G++  + +I  HN++L+HA A  IYRKNYQ++QGG IGI +   W+ P +++
Sbjct  222   YPFGNCSYGDSALEPYIATHNLVLSHATAAQIYRKNYQEKQGGMIGIVISAAWYEPYSDT  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +RA +F   WF+DP +YG YP EM+ I+GS LP FS+ +  +L A   DFIGI
Sbjct  282   PADRLAVQRALAFDFAWFVDPFVYGDYPPEMRQIVGSRLPTFSAEERNRLDA-KLDFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC++STC    S  +  E FV  +  K+G +IGE T +    + P G+E +
Sbjct  341   NHYTTKYAKDCMFSTC---TSPYSLGEAFVYVTGEKDGVYIGERTAMSDFFIVPRGIEGI  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+++TE GY     P   I++ L+DTKR+++   YL  +   +RKGADV
Sbjct  398   VTYVKERYNNTPMFITENGYAQFAGP---IDDSLNDTKRIEYHEGYLAVLSEVVRKGADV  454

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAK  360
             RGYFIWSL DNFEW  GY  R GL+  D  T KRTPK SA WYK+F+++
Sbjct  455   RGYFIWSLLDNFEWLHGYLVRFGLHYVDFQTLKRTPKWSATWYKEFLSE  503



>ref|XP_002448174.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
 gb|EES12502.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
Length=522

 Score =   505 bits (1300),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 236/467 (51%), Positives = 322/467 (69%), Gaps = 8/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+S+YQ EGGYL   KGLSNWD+F+H  G + DG+NGD A D Y  Y ED +L+
Sbjct  33    DFLFGTSTSAYQIEGGYLEGNKGLSNWDIFTHTQGKVEDGTNGDTADDHYHHYMEDIELM  92

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+GVNS++FSI+W+R+LPKGR G++N +G+  Y  LID+LL +GIEPFVTI+H+D+P E
Sbjct  93    HSMGVNSYRFSIAWARILPKGRFGHVNPDGVALYNALIDALLQRGIEPFVTISHFDIPYE  152

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L++RY GWLSP+++ ++ Y ADVCF+  GD+VK+WITFNEPNM+    Y Y  +P G+CS
Sbjct  153   LEERYGGWLSPKIRRDFGYLADVCFRMFGDRVKFWITFNEPNMFTKLGYIYGRFPPGHCS  212

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                     GN++ + +I  HN+IL+HA  VNIY+K YQ +QGG IGI +   W+ P  N+
Sbjct  213   RPFGNCTFGNSSTEPYIAGHNIILSHANVVNIYKKKYQGKQGGRIGITVQSRWYEPFRNT  272

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D    ERA SF + WFLDPI+ G YP  M+ ILG +LPEF+    + L+    DFIG+
Sbjct  273   PTDILGVERALSFGAPWFLDPIILGHYPSAMRKILGPNLPEFTLKQKKILQTSKLDFIGL  332

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y +D + S+  P        +  +  S  ++G  IGE TG PY+   P G+E+V
Sbjct  333   NHYSTNYLKDSI-SSSSPCELDQYDGDAQISTSAERDGILIGERTGSPYINTVPYGIEKV  391

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY   ++ + P+YVTE GY   +  + S ++  +DT RV +L  YL ++ +AIRKGADV
Sbjct  392   VTYLNTRYNNTPIYVTENGYAQASNSSMSAKDFTNDTGRVNYLQGYLTSLASAIRKGADV  451

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
              GYF+WSL DNFEW +GYT+R GLY  D  TQKRTPKLS KWY++F+
Sbjct  452   HGYFVWSLLDNFEWNNGYTQRFGLYYVDYNTQKRTPKLSTKWYREFL  498



>ref|XP_007026015.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
 gb|EOY28637.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
Length=427

 Score =   500 bits (1287),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 229/419 (55%), Positives = 315/419 (75%), Gaps = 9/419 (2%)
 Frame = -3

Query  1592  LYKEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVT  1413
             + +ED +L+  +GVNS++FSISW+R+LPKGR G++N  GI +Y  LI+SLL++GI+PFVT
Sbjct  3     MKQEDLNLMNYIGVNSYRFSISWARILPKGRFGSVNKAGINHYNKLINSLLVRGIKPFVT  62

Query  1412  INHYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRY  1233
             + HYD+PQEL++RY  WLSP++QE++ Y+AD+CFKH GD+VKYW+TFNEPN+  I  YR 
Sbjct  63    LTHYDIPQELENRYGAWLSPQVQEDFKYYADICFKHFGDRVKYWVTFNEPNVAVIRGYRS  122

Query  1232  RLWP-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLF  1074
              L+P        GNCS G++  + F+ AHN+IL+HAAAV+IYR  YQ+QQ G IGI M  
Sbjct  123   GLYPPSRCSSSFGNCSSGDSENEPFVAAHNIILSHAAAVDIYRTKYQKQQRGSIGIVMNA  182

Query  1073  TWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLK  894
              W+ P++NS  DK AAERA SF  NWFLDPI+ G YP EM++ILGS LP FS+ D +KLK
Sbjct  183   IWYEPISNSFEDKQAAERAQSFYMNWFLDPIILGKYPLEMQEILGSDLPVFSNHDQKKLK  242

Query  893   AGGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLA  714
             + G DFIG+NHYT++Y +DC++S C+    G+++ EGF  ++  K+G FIG+ T + +L 
Sbjct  243   S-GLDFIGVNHYTSFYIRDCMFSVCEQG-PGSSKTEGFALRTALKDGIFIGKSTAVDWLY  300

Query  713   VYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVG  534
             VYP GM+++VTY KE++  IP+++TE G+ +    +S  EE L+D  RV++++ YL  + 
Sbjct  301   VYPQGMDKIVTYIKERYNSIPMFITENGFGENDKADSPTEESLNDVNRVEYISGYLDTLA  360

Query  533   TAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
              A+RKGADVRGYF+WSL DNFEWTSGYT R GL+  D AT +RTP+ SA WYKQFIA +
Sbjct  361   AALRKGADVRGYFLWSLLDNFEWTSGYTIRFGLHHVDYATLERTPRASAIWYKQFIANH  419



>gb|EMS59801.1| putative inactive beta-glucosidase 14 [Triticum urartu]
Length=552

 Score =   504 bits (1298),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 239/468 (51%), Positives = 335/468 (72%), Gaps = 15/468 (3%)
 Frame = -3

Query  1706  EGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSIS  1527
             EGGYL   KGLSNWDV++H+ G I DGSNGD+AAD Y  Y ED +L+ SLGVNS++FSI+
Sbjct  81    EGGYLEGKKGLSNWDVYTHKQGTIEDGSNGDIAADHYHRYMEDIELMHSLGVNSYRFSIA  140

Query  1526  WSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSPEM  1347
             W+R+LP+GR G++N +G+ +Y  +I++LL KGI+PFVTI HYD+P EL++RY GWLSPE+
Sbjct  141   WARILPRGRFGHVNPDGVAFYNAIINALLHKGIQPFVTIFHYDIPHELEERYGGWLSPEI  200

Query  1346  QEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCSE-------GNATK  1188
             Q+++ YFA++CFK  GD+VK+W+T N+PN+ A  +Y    +P G+CSE       GN++ 
Sbjct  201   QKDFGYFANICFKLFGDRVKFWLTMNQPNLLAKFSYLNGWFPPGHCSEPFGNCAFGNSSI  260

Query  1187  DIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSF  1008
             + +I  HNMIL+HA  V+IYR NYQ++QGG IGIA+   W+ P+ N+T+D+ A ERA SF
Sbjct  261   EPYIAGHNMILSHANVVSIYRNNYQERQGGYIGIAVSARWYEPLRNTTIDQLAVERAISF  320

Query  1007  LSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLY  828
                WFLDPI+ G YP EM+ ILG  LPEF+    +KL A   DFIG+NHY+T+YA+DC++
Sbjct  321   NVPWFLDPIILGDYPAEMRKILGPTLPEFTLKQKKKLHATKLDFIGLNHYSTWYAKDCIF  380

Query  827   STC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDI  654
             S C  DP M G+ R    V   + ++G  IG+ TG P+    P GME+ V Y K+++ + 
Sbjct  381   SPCEMDP-MDGDAR----VLSLVERDGVPIGKETGAPFFYDVPHGMEKAVMYYKQRYNNT  435

Query  653   PLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDN  474
             P Y+TE GY   +  + + ++   DT+R+ +++ YL  + +AIRKGADVRGYF+WS+ D+
Sbjct  436   PTYITENGYAQASNSSMTAKDFTGDTERIDYISGYLTYLVSAIRKGADVRGYFVWSILDD  495

Query  473   FEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             FEWTSGY  R GLY  D  TQKRTPKLSA+W+++F+ K   V  + Q+
Sbjct  496   FEWTSGYKDRFGLYHVDFKTQKRTPKLSAEWFREFL-KGSLVSREFQN  542



>gb|KHG24858.1| Beta-glucosidase 46 -like protein [Gossypium arboreum]
Length=417

 Score =   498 bits (1282),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 236/415 (57%), Positives = 304/415 (73%), Gaps = 13/415 (3%)
 Frame = -3

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLGVNS++FSISW+R+LPKGR G IN  GIK+Y N+ID LLLKGIEPF+T+ H D PQ
Sbjct  1     MHSLGVNSYRFSISWARILPKGRFGEINEAGIKFYNNVIDGLLLKGIEPFITLTHIDFPQ  60

Query  1388  ELQDRYQGWLSPEMQ----EEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP  1221
             EL+DRY  WLSPE Q    E++AY+AD+CFK  GD+VKYW+TFNEP+      Y+   +P
Sbjct  61    ELEDRYGSWLSPESQLTILEDFAYYADICFKSFGDRVKYWVTFNEPSFQVKLGYQAGTFP  120

Query  1220  -------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFL  1062
                     GNC+ G++ K+ FI AHN+ILAH AAV+IYR  YQ  QGG IGI +   W+ 
Sbjct  121   PSRCSKPFGNCTYGDSEKEPFIAAHNIILAHIAAVHIYRTKYQATQGGSIGIVLHCFWYE  180

Query  1061  PMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGS  882
             P++NS  DK AAERA SF  NWFLDPI++G YP+EM+DILGS LPEFS T+ +KL  G  
Sbjct  181   PISNSVADKLAAERAQSFSINWFLDPIIFGRYPQEMQDILGSILPEFSKTEKQKLNKG-L  239

Query  881   DFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPP  702
             DFIGINHYT++Y +DC+ +TC+P   G ++ EG+  QS  KNG  IGE T L  + VYP 
Sbjct  240   DFIGINHYTSFYVRDCMLTTCEPG-KGTSKTEGYWAQSSQKNGIDIGEPTELAGMNVYPQ  298

Query  701   GMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             GME++VTY K+++ ++P+ +TE GY D   PNS+ E +LHD +R+K+LA YL A+ TAI+
Sbjct  299   GMEKIVTYLKDRYHNVPMIITENGYGDMNKPNSTTESLLHDVERIKYLAGYLDALSTAIK  358

Query  521   KGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             KGADVRGYF+WSL DNFEW  GYT R GL+  D  T +RTPK SA WY+ FI+++
Sbjct  359   KGADVRGYFVWSLLDNFEWNDGYTIRFGLHHVDYKTLRRTPKSSATWYRNFISQH  413



>ref|XP_006464710.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Citrus sinensis]
Length=523

 Score =   502 bits (1293),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 239/469 (51%), Positives = 317/469 (68%), Gaps = 10/469 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++SS+Q EG YL DGK LSNWDVFSH PGNI +  NGDVA D Y  + ED  ++ 
Sbjct  48    FLFGTATSSFQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMH  107

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVNS++FSISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L
Sbjct  108   SLGVNSYRFSISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQL  167

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y  WLSP+MQ+E+ + A  CF++ GD+VKYW T NEPN+    AY    +       
Sbjct  168   EEKYGSWLSPQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYPPTHCSA  227

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  IV HNM+L+HA AV +YRK++Q++QGG +GI +    + P+ +  
Sbjct  228   PFGNCSVGNSDTEPLIVLHNMLLSHAKAVKLYRKHFQEKQGGSMGIVLHSMMYEPLRDED  287

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +F   W LDP+++G YP EM++ LGS LP FS  + + +K G  DFIGIN
Sbjct  288   SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVK-GSLDFIGIN  346

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY+T YA+DC++S C   +  N    GFV  +  ++G  IGE TG P   V P GME++V
Sbjct  347   HYSTLYAKDCIHSVC--VLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKIV  404

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K+ + +IP+YVTE GY      N   + ++ D KR+++ + YL A+  AIR GADVR
Sbjct  405   DYVKDTYKNIPMYVTENGYSPPKQKNQRSQNLVDDVKRIEYHSGYLSALARAIRNGADVR  464

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GYFIWSL DNFEW  GY+   GLY  DR T +RTPKLSA W+K F+  N
Sbjct  465   GYFIWSLMDNFEWLDGYSVVFGLYYIDRQTLERTPKLSATWFKNFLTDN  513



>ref|XP_004976205.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Setaria italica]
Length=508

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 320/472 (68%), Gaps = 11/472 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PG I DGS GD+A D Y  Y ED +L+
Sbjct  36    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHAPGRIKDGSAGDIADDHYHRYDEDVELM  95

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVN+++FSISW+RVLP+GR G +N  GI++Y  LIDSLLLKGIEPFVT+NHYD+PQE
Sbjct  96    NSLGVNAYRFSISWARVLPEGRFGRVNPLGIEFYNKLIDSLLLKGIEPFVTLNHYDIPQE  155

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLS E+Q ++ +FADVCF   GD+VKYW TFNEPN+  +  Y    +      
Sbjct  156   LEDRYGAWLSAEIQRDFGHFADVCFAAFGDRVKYWTTFNEPNVAVLTGYMLGTYPPARCS  215

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G+C+ G++  + ++  HN++L+HA AV IY++ YQ +Q G IGI M  TW+ P+T++
Sbjct  216   PPFGSCAGGDSDAEPYVTTHNVVLSHATAVEIYKRKYQSKQKGLIGIVMYTTWYEPLTDT  275

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AAERA +F   WF+DPI+YG YP EM+ +LGS LP FS  +  KL     DFIGI
Sbjct  276   PEDRLAAERALAFSVPWFVDPIVYGDYPPEMRQVLGSRLPTFSPEERRKL-GYKLDFIGI  334

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC++S+  P   G   +      +  +NG  IG  TG P   V P G+E++
Sbjct  335   NHYTTLYARDCMFSSGCP--LGQGTQHALAAVTGERNGVPIGPPTGRPMFYVVPDGIEKM  392

Query  686   VTYAKEKFPDIPLYVTETGYCD-TTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VTY   ++ ++P++VTE GY D     +   +++LHD  R+++L  YL  V  AIR GAD
Sbjct  393   VTYIMRRYNNLPMFVTENGYPDGGEAGHDHAKDLLHDQGRIQYLDGYLTKVAKAIRDGAD  452

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             VRGYF+WSL DNFEW  GYT R GLY  D  T +R PK SA WYK+F+   Q
Sbjct  453   VRGYFVWSLMDNFEWLYGYTLRYGLYYVDYQTLERKPKSSALWYKRFLQSFQ  504



>ref|XP_009605773.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   500 bits (1287),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 244/472 (52%), Positives = 318/472 (67%), Gaps = 13/472 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++S+YQ EG +L DGKGLSNWDVFSH  G I +G  GD+A D Y  + ED +L+ 
Sbjct  40    FLFGATTSAYQIEGAFLEDGKGLSNWDVFSHTKGRIKNGDTGDIADDHYHRFLEDVELMH  99

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+NS++FSISWSR+LP+GR G +N  GI +Y  LIDSL LKGI PFVT+NH+D PQEL
Sbjct  100   SLGLNSYRFSISWSRILPRGRFGKVNFAGIMFYNKLIDSLSLKGITPFVTLNHHDHPQEL  159

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWLSP MQEE++YFA +CF+  GD+V+YW T NEPNM+A  AY   ++       
Sbjct  160   EEKYGGWLSPLMQEEFSYFAQICFESFGDRVQYWTTINEPNMFAEMAYVRGVYPPAHCSR  219

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  I  HNM+LAHA A  +YR+++Q + GG IGI +    + P+ N  
Sbjct  220   PFGNCSVGNSDTEPLIAMHNMLLAHAKAAKLYREHFQPKHGGMIGIVVHAFMYKPLRNDD  279

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA  F + W  DP++YG YP+EM++ LGS LP F+S D  KL     DFIG+N
Sbjct  280   FDRDAANRALVFTAAWVFDPLVYGYYPREMREYLGSSLPTFTS-DERKLIKDSIDFIGVN  338

Query  863   HYTTYYAQDCLYSTCDPSM-----SGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T Y +DC+YS+C  S       G+    G++     K+G  IGE TG+P   V P G
Sbjct  339   HYGTLYVKDCIYSSCVCSNSSCIAGGDHPIHGYLITLGEKDGVPIGEPTGMPRFFVVPRG  398

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y K+++P+ P++VTE GY       +   E+ HD KRV+F   YL ++  AIRK
Sbjct  399   MEEIVDYMKKRYPNKPMFVTENGYSSLNPTTAQAAELQHDIKRVEFHKSYLASLARAIRK  458

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             GADVRGYFIWSL DNFEWTSGY  + GLY  DR+T  R PKLSAKWY+ F+ 
Sbjct  459   GADVRGYFIWSLMDNFEWTSGYEVKFGLYYVDRSTLDRVPKLSAKWYRDFLT  510



>ref|XP_006370302.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
 gb|ERP66871.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
Length=522

 Score =   499 bits (1285),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 320/469 (68%), Gaps = 15/469 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             FFFGTS+SSYQ EG Y+ DGKGL+NWDVFSH PGNI +  NGD+A + Y  + ED +L+ 
Sbjct  36    FFFGTSTSSYQVEGAYIEDGKGLNNWDVFSHIPGNIKNNDNGDIADNHYYRFLEDIELMC  95

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG N+++FSISW+R+LP+G+ G +N  GI +Y  LID+LL +G+EPFVTI+H+D+PQEL
Sbjct  96    SLGTNAYRFSISWTRILPRGKFGQVNPRGIMFYNKLIDNLLERGLEPFVTIHHHDIPQEL  155

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
              DRY GWLSP MQE++ YFA++CFK  GD++K WIT NEPN+    +Y  R W       
Sbjct  156   VDRYGGWLSPLMQEDFVYFAEICFKSFGDRIKNWITMNEPNLLVDMSY-IRGWYPPAHCS  214

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  I  HNMIL HA AV +YR+++Q +QGG IGI     +F P+ ++
Sbjct  215   PPFGNCSAGNSDIEPLIAMHNMILGHAKAVKLYREHFQLKQGGSIGIVGFTEYFEPLRDN  274

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              +D+ A  RA +F + W  D +++G YP EM+  LGS LP FS  +   +K G  DFIG+
Sbjct  275   ELDRQAVSRALAFTNAWLFDAVVFGDYPAEMRLYLGSALPTFSPEETSYVK-GSLDFIGM  333

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             N YT+ YA+DC++S C   +SG  R   GFV  +  ++G  IG   G P   V P GME+
Sbjct  334   NFYTSLYAKDCIHSAC---ISGGDRPIRGFVHTTGERDGEPIGGRCGNPRFFVVPEGMEK  390

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y KE++ ++P++VTE G+      N  ++ +L DT RV F   YL A+  AIR GAD
Sbjct  391   IVNYMKERYNNMPMFVTENGFSPPQQ-NDQVQALLQDTNRVNFHKSYLAALARAIRNGAD  449

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             VRGYF+WSL DNFEW  GY++R GLY  DR T +R PKLSAKWYK F+A
Sbjct  450   VRGYFVWSLVDNFEWIDGYSQRYGLYYVDRQTLERVPKLSAKWYKNFLA  498



>ref|XP_009382650.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 318/464 (69%), Gaps = 21/464 (5%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGTS+S+YQ EG Y    K LSNWDVF+H Q G I DGSNGDVAAD Y +Y ED +L
Sbjct  37    SFLFGTSTSAYQIEGAYQEGNKSLSNWDVFTHSQGGKIKDGSNGDVAADHYHIYMEDIEL  96

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLG+NS++FSISWSRVLP+GR+G IN  GI +Y NLIDSLLL+GIEPFVT++HYD+PQ
Sbjct  97    MHSLGINSYRFSISWSRVLPRGRYGKINPTGIAFYNNLIDSLLLRGIEPFVTLSHYDIPQ  156

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             EL+DRY  WLSP++Q+++ YFA+VCF   GD+VKYW TFNEP M     Y    +P G+ 
Sbjct  157   ELEDRYGAWLSPKIQKDFGYFAEVCFSKFGDRVKYWSTFNEPRMMVRYGYGTGEYPPGHR  216

Query  1208  SEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAA  1029
             ++       FI  HN IL+HA AV IYRK YQ +Q G IGI +   WF P+ N+++D   
Sbjct  217   NKE------FIAGHNAILSHATAVEIYRKRYQVKQQGMIGIVIFMCWFEPLRNNSLDFLV  270

Query  1028  AERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTY  849
             A +  SF + WFLDPI++G YP EM+  LGS LP FS  +  KL+    DFIGINHYT+ 
Sbjct  271   ARQVMSFQAAWFLDPIIHGDYPPEMRQALGSKLPTFSIKERRKLQY-KLDFIGINHYTSL  329

Query  848   YAQDCLYSTCDPSMSGNTREEGFVGQSL---SKNGNFIGELTGLPYLAVYPPGMERVVTY  678
             Y +DC +S C  S +        +G+S     +NG  IG+ T +P   V P G+E VV Y
Sbjct  330   YVRDCTFSPCKSSRN--------IGESFIYTERNGIPIGKPTAMPNYYVVPYGIEEVVLY  381

Query  677   AKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGY  498
                ++ + P+++TE GY   +  NSS+ E+L+D+ RV  +  YL  +  A+RKGADVRGY
Sbjct  382   TMRRYNNTPMFITENGYAQHS--NSSMTELLNDSDRVDAMRQYLTYLNNAMRKGADVRGY  439

Query  497   FIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             F+WSL DNFEW  GYT R GL+  D  TQKRTPKLSA+WYKQF+
Sbjct  440   FVWSLMDNFEWLYGYTMRFGLHHVDYNTQKRTPKLSARWYKQFL  483



>ref|XP_003541851.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=537

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 318/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT +SSYQ EG Y  DGKGLSNWD FSH PG I    NGD+A D Y  Y ED +L++
Sbjct  51    FLFGTGTSSYQIEGAYFEDGKGLSNWDAFSHTPGKIKKDENGDIADDHYHRYLEDIELMS  110

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+HYDLPQEL
Sbjct  111   SLGVNVYRFSISWARILPRGIYGDINPSGIMFYNKIIDNLLLRGIEPFVTIHHYDLPQEL  170

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GW+SP +Q ++ +FA++CFK  GD+VKYW T NEPN++A   Y    +       
Sbjct  171   EERYGGWISPLIQSDFVHFAEICFKSFGDRVKYWTTINEPNLFADFGYMEGTYAPGHCSP  230

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  IV HNM+L+HA AV +YRK++Q +QGG IGI      + P+ +  
Sbjct  231   PFGNCNTGNSDVEPLIVMHNMLLSHAKAVELYRKHFQAKQGGTIGIVAFSFMYDPLRDEE  290

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  R  +F   W LDP+++G YP EM+ ILGS +P FS  + + L  G  DFIGIN
Sbjct  291   CDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPVE-KSLIKGSLDFIGIN  349

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY T YA+DC  STC  S+  +    GF+ ++ +++G  IG+ TG+P   V P GME++V
Sbjct  350   HYGTLYAKDCSLSTC--SLGADHPIAGFLERTATRDGIPIGDPTGVPDFFVVPRGMEKLV  407

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ ++P+Y+TE GY     P+ +I ++L D KR+ +   YL A+  +IRKGADVR
Sbjct  408   EYIKIRYRNMPMYITENGYSQPPKPDVTIHDLLQDFKRIDYHKAYLAALLRSIRKGADVR  467

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY IWSL DNFEWTSGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  468   GYMIWSLLDNFEWTSGYDIRFGLYYVDRGTLERIPKLSVQWFSSFL  513



>ref|XP_006594785.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=543

 Score =   499 bits (1285),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 318/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT +SSYQ EG Y  DGKGLSNWD FSH PG I    NGD+A D Y  Y ED +L++
Sbjct  51    FLFGTGTSSYQIEGAYFEDGKGLSNWDAFSHTPGKIKKDENGDIADDHYHRYLEDIELMS  110

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+HYDLPQEL
Sbjct  111   SLGVNVYRFSISWARILPRGIYGDINPSGIMFYNKIIDNLLLRGIEPFVTIHHYDLPQEL  170

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GW+SP +Q ++ +FA++CFK  GD+VKYW T NEPN++A   Y    +       
Sbjct  171   EERYGGWISPLIQSDFVHFAEICFKSFGDRVKYWTTINEPNLFADFGYMEGTYAPGHCSP  230

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  IV HNM+L+HA AV +YRK++Q +QGG IGI      + P+ +  
Sbjct  231   PFGNCNTGNSDVEPLIVMHNMLLSHAKAVELYRKHFQAKQGGTIGIVAFSFMYDPLRDEE  290

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  R  +F   W LDP+++G YP EM+ ILGS +P FS  + + L  G  DFIGIN
Sbjct  291   CDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPVE-KSLIKGSLDFIGIN  349

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY T YA+DC  STC  S+  +    GF+ ++ +++G  IG+ TG+P   V P GME++V
Sbjct  350   HYGTLYAKDCSLSTC--SLGADHPIAGFLERTATRDGIPIGDPTGVPDFFVVPRGMEKLV  407

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ ++P+Y+TE GY     P+ +I ++L D KR+ +   YL A+  +IRKGADVR
Sbjct  408   EYIKIRYRNMPMYITENGYSQPPKPDVTIHDLLQDFKRIDYHKAYLAALLRSIRKGADVR  467

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY IWSL DNFEWTSGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  468   GYMIWSLLDNFEWTSGYDIRFGLYYVDRGTLERIPKLSVQWFSSFL  513



>ref|XP_007021332.1| Beta-glucosidase 45, putative [Theobroma cacao]
 gb|EOY12857.1| Beta-glucosidase 45, putative [Theobroma cacao]
Length=617

 Score =   501 bits (1290),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 317/462 (69%), Gaps = 12/462 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+ SSYQ EGGYL DGKGLSNWD FSH PGNI +  NGDVA D Y L+ ED ++ 
Sbjct  48    NFLFGTAISSYQVEGGYLDDGKGLSNWDAFSHVPGNIKNNENGDVADDDYHLFLEDIEMA  107

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FSISW+R+LP+GR G +N  GIK+Y N+ID+LL++GIEPFVTI H+D PQE
Sbjct  108   RSLGVNSYRFSISWARILPRGRFGEVNPSGIKFYNNIIDNLLIRGIEPFVTIFHHDHPQE  167

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP MQE++   A+ CFK+ GD+VKYW+T NE N++A  AY   L+      
Sbjct  168   LEDRYGSWLSPLMQEDFVLLAETCFKNFGDRVKYWVTINEANLFADMAYIRGLYPPARCS  227

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  +V HNM+L+HA AV +YR+ +Q +QGG +G+      + P+ + 
Sbjct  228   APFGNCSVGNSDIEPLVVLHNMLLSHAKAVKLYREQFQPEQGGSLGLIAHSHMYEPLRDG  287

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A +RA +F   W +DP+++G YP EM+   GS LP FS  + E +K G  DFIGI
Sbjct  288   EADLQAVKRALAFTVGWAIDPLVFGDYPPEMRQYHGSELPRFSPEETEYVK-GSIDFIGI  346

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T YA+DC++S C  ++ G+    GF   +  ++G  IGE TG+    V P GME++
Sbjct  347   NHYSTLYAKDCIHSHC--ALGGDHFIRGFAYTTGERDGILIGEPTGVERFYVVPRGMEKI  404

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y  +++ ++P+YVTE GY    T    + ++LHD  R+KF   YL A+  AIR GADV
Sbjct  405   VDYVSKRYNNMPIYVTENGYSPPQT--EQVPDLLHDVNRIKFHRSYLAALARAIRNGADV  462

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKW  381
             RGYF+WSL DNFEWT GY+   G+Y  DR T KRTPKLSAKW
Sbjct  463   RGYFVWSLMDNFEWTGGYSVTFGVYYVDRQTLKRTPKLSAKW  504



>ref|XP_007026016.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
 gb|EOY28638.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
Length=417

 Score =   493 bits (1270),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 308/408 (75%), Gaps = 9/408 (2%)
 Frame = -3

Query  1559  LGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQ  1380
             +GVNS++FSISW+R+LPKGR G++N  GI +Y  LI+SLL++GI+PFVT+ HYD+PQEL+
Sbjct  4     IGVNSYRFSISWARILPKGRFGSVNKAGINHYNKLINSLLVRGIKPFVTLTHYDIPQELE  63

Query  1379  DRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------  1221
             +RY  WLSP++QE++ Y+AD+CFKH GD+VKYW+TFNEPN+  I  YR  L+P       
Sbjct  64    NRYGAWLSPQVQEDFKYYADICFKHFGDRVKYWVTFNEPNVAVIRGYRSGLYPPSRCSSS  123

Query  1220  HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTV  1041
              GNCS G++  + F+ AHN+IL+HAAAV+IYR  YQ+QQ G IGI M   W+ P++NS  
Sbjct  124   FGNCSSGDSENEPFVAAHNIILSHAAAVDIYRTKYQKQQRGSIGIVMNAIWYEPISNSFE  183

Query  1040  DKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINH  861
             DK AAERA SF  NWFLDPI+ G YP EM++ILGS LP FS+ D +KLK+ G DFIG+NH
Sbjct  184   DKQAAERAQSFYMNWFLDPIILGKYPLEMQEILGSDLPVFSNHDQKKLKS-GLDFIGVNH  242

Query  860   YTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVT  681
             YT++Y +DC++S C+    G+++ EGF  ++  K+G FIG+ T + +L VYP GM+++VT
Sbjct  243   YTSFYIRDCMFSVCEQG-PGSSKTEGFALRTALKDGIFIGKSTAVDWLYVYPQGMDKIVT  301

Query  680   YAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRG  501
             Y KE++  IP+++TE G+ +    +S  EE L+D  RV++++ YL  +  A+RKGADVRG
Sbjct  302   YIKERYNSIPMFITENGFGENDKADSPTEESLNDVNRVEYISGYLDTLAAALRKGADVRG  361

Query  500   YFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             YF+WSL DNFEWTSGYT R GL+  D AT +RTP+ SA WYKQFIA +
Sbjct  362   YFLWSLLDNFEWTSGYTIRFGLHHVDYATLERTPRASAIWYKQFIANH  409



>ref|XP_004976204.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Setaria italica]
Length=510

 Score =   497 bits (1279),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 320/474 (68%), Gaps = 13/474 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQP--GNILDGSNGDVAADQYDLYKEDAD  1572
             +F FGT++SSYQ EG YL   K LSNWDVF+H P  G I DGS GD+A D Y  Y ED +
Sbjct  36    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHAPVSGRIKDGSAGDIADDHYHRYDEDVE  95

Query  1571  LLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLP  1392
             L+ SLGVN+++FSISW+RVLP+GR G +N  GI++Y  LIDSLLLKGIEPFVT+NHYD+P
Sbjct  96    LMNSLGVNAYRFSISWARVLPEGRFGRVNPLGIEFYNKLIDSLLLKGIEPFVTLNHYDIP  155

Query  1391  QELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW----  1224
             QEL+DRY  WLS E+Q ++ +FADVCF   GD+VKYW TFNEPN+  +  Y    +    
Sbjct  156   QELEDRYGAWLSAEIQRDFGHFADVCFAAFGDRVKYWTTFNEPNVAVLTGYMLGTYPPAR  215

Query  1223  ---PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
                P G+C+ G++  + ++  HN++L+HA AV IY++ YQ +Q G IGI M  TW+ P+T
Sbjct  216   CSPPFGSCAGGDSDAEPYVTTHNVVLSHATAVEIYKRKYQSKQKGLIGIVMYTTWYEPLT  275

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             ++  D+ AAERA +F   WF+DPI+YG YP EM+ +LGS LP FS  +  KL     DFI
Sbjct  276   DTPEDRLAAERALAFSVPWFVDPIVYGDYPPEMRQVLGSRLPTFSPEERRKL-GYKLDFI  334

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             GINHYTT YA+DC++S+  P   G   +      +  +NG  IG  TG P   V P G+E
Sbjct  335   GINHYTTLYARDCMFSSGCP--LGQGTQHALAAVTGERNGVPIGPPTGRPMFYVVPDGIE  392

Query  692   RVVTYAKEKFPDIPLYVTETGYCD-TTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
             ++VTY   ++ ++P++VTE GY D     +   +++LHD  R+++L  YL  V  AIR G
Sbjct  393   KMVTYIMRRYNNLPMFVTENGYPDGGEAGHDHAKDLLHDQGRIQYLDGYLTKVAKAIRDG  452

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             ADVRGYF+WSL DNFEW  GYT R GLY  D  T +R PK SA WYK+F+   Q
Sbjct  453   ADVRGYFVWSLMDNFEWLYGYTLRYGLYYVDYQTLERKPKSSALWYKRFLQSFQ  506



>ref|XP_004487691.1| PREDICTED: beta-glucosidase 18-like [Cicer arietinum]
Length=525

 Score =   497 bits (1279),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 236/477 (49%), Positives = 323/477 (68%), Gaps = 12/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+SSYQ EG    DGKGLSNWDVFSH PG I +  NGD+A D Y  Y+ED  L++
Sbjct  38    FLFGASTSSYQIEGAAFEDGKGLSNWDVFSHTPGKINNNENGDIADDHYHHYQEDIKLMS  97

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +GNIN  G+ +Y N+ID+LLL+GIEPFVTI+H+DLPQEL
Sbjct  98    SLGINVYRFSISWTRILPRGIYGNINPSGVMFYNNIIDNLLLRGIEPFVTIHHHDLPQEL  157

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DRY GWLSP +Q ++ +FA++CFK  GD+VKYWIT NEP + A  A+   ++       
Sbjct  158   EDRYGGWLSPLIQRDFVHFAEICFKSFGDRVKYWITINEPTLVADNAFIKGIYSSGHCSL  217

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC  GN+  +  +V HNM+L+HA AV +YR +YQ +QGG IGI      + P+    
Sbjct  218   PFGNCYTGNSDVEPLLVMHNMLLSHAKAVELYRNHYQAKQGGTIGIVAHTFMYEPLREEE  277

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F+  W LDP+++G YP EM+ ILG  LP+FS  + + L  G  DFIGIN
Sbjct  278   CDRQAANRALAFVIGWLLDPLVFGEYPVEMRSILGHQLPKFSLKE-KSLLRGSLDFIGIN  336

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y   YA+DC +S C    +   R  GFV  +  K+G  IG+  G+P   V P G+E++V
Sbjct  337   NYGALYAKDCYFSNCPIEAAQPIR--GFVETTGMKDGIPIGDKVGMPRFFVVPNGVEKIV  394

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              + K ++ ++P+Y+TE GY     PN ++ ++LHD KR+++   YL A+  AIRKGADVR
Sbjct  395   DHIKIRYHNMPMYITENGYSSLLNPNMTMHDLLHDFKRIEYHKAYLTALRRAIRKGADVR  454

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             GY +WSLFDNFEW+SGY    GLY  DR T +R PKLS +W+  F+  N   D+ ++
Sbjct  455   GYMVWSLFDNFEWSSGYDITFGLYYVDRQTLERIPKLSVQWFSSFL--NNDSDTNIE  509



>ref|XP_009135228.1| PREDICTED: beta-glucosidase 47 isoform X3 [Brassica rapa]
Length=508

 Score =   495 bits (1275),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 237/476 (50%), Positives = 332/476 (70%), Gaps = 29/476 (6%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+DGK              I DGS+G V+ D Y  Y  D DL 
Sbjct  52    DFLFGTASSAYQYEGAYLTDGK--------------IADGSHGKVSVDHYHRYPGDLDLK  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  98    KDLGVNSYRFSLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQE  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL+P+++E++ ++A++CF+H G++VK+W TFNEPN+  I  YR   +P     
Sbjct  158   LECRYGSWLNPQIREDFEHYAEICFRHFGNRVKFWTTFNEPNVQVILGYRKGTYPPSRCS  217

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAV++YR+ + Q+QGG+IGI M   WF P+++S
Sbjct  218   KTFANCTRGGSDIEPLVAAHNIIRSHFAAVSLYRERF-QEQGGKIGIVMNAIWFEPVSDS  276

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AAERA +F   WFLDPI++G YP+EM++ILG  LP+F+  DL+  K  G DFIGI
Sbjct  277   LADSLAAERAQAFYLTWFLDPIVFGRYPREMQEILGQDLPKFTRDDLKSSK-NGLDFIGI  335

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  336   NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLALGEPTGVNWFNVYPQGMEEM  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G+ + +T       +L+D +RVKF+++YL A+  A+RKGADV
Sbjct  395   LMYATEQYKNIPLYVTENGFGENSTG-----VLLNDYRRVKFMSNYLDALKRAMRKGADV  449

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
              GYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI+K+    SK
Sbjct  450   GGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHMSSQSK  505



>ref|XP_009768487.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=530

 Score =   496 bits (1277),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 315/472 (67%), Gaps = 13/472 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++S+YQ EG +L DGKGLSNWDVFSH  G I +G  GD+A D Y  + ED +L+ 
Sbjct  40    FLFGATTSAYQIEGAFLEDGKGLSNWDVFSHTKGRIKNGDTGDIADDHYHRFLEDVELMH  99

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+NS++FSISWSR+LP+GR G +N  GI +Y  LIDSL LKGI PF+T+NH+D PQEL
Sbjct  100   SLGLNSYRFSISWSRILPRGRFGKLNFAGIIFYNKLIDSLSLKGITPFMTLNHHDHPQEL  159

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWL+P MQEE+ YFA +CF+  GD+VKYW T NEPNM+A  AY   ++       
Sbjct  160   EEKYGGWLNPLMQEEFTYFAQICFESFGDRVKYWTTINEPNMFAEMAYVRGVYPPAHCSR  219

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  I  HN++LAHA A  +YR+ +Q + GG IGI +    + P+ N  
Sbjct  220   PFGNCSVGNSDTEPLIAMHNILLAHAKAAKLYRERFQSKHGGLIGIVVHAFMYKPLRNDD  279

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA  F + W  DP++YG YP+EM+  LGS LP F+S D  KL     DFIG+N
Sbjct  280   FDRDAANRALVFTAAWVFDPLVYGYYPREMRQYLGSSLPRFTS-DERKLIKDSIDFIGVN  338

Query  863   HYTTYYAQDCLYSTCDPSM-----SGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC+YS+C  S       G+    G++     K+G  IGE TG+P   V P G
Sbjct  339   HYGTLYAKDCIYSSCVCSNSSCIAGGDHPIHGYLITLGEKDGVPIGEPTGMPRFFVVPRG  398

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y K+++P+ P++VTE GY       +   E+ HD KRV+F   YL ++  AIRK
Sbjct  399   MEEIVDYMKKRYPNKPMFVTENGYSSLNPTTAQAAELQHDIKRVEFHKSYLASLARAIRK  458

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             GADVRGYFIWSL DNFEW SGY  + GLY  DR+T  R PKLSAKWY+ F+ 
Sbjct  459   GADVRGYFIWSLMDNFEWASGYELKFGLYYVDRSTLNRVPKLSAKWYRDFLT  510



>gb|EMS46231.1| Beta-glucosidase 16 [Triticum urartu]
Length=509

 Score =   495 bits (1275),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 328/481 (68%), Gaps = 16/481 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++SSYQ EG YL DGKGLSNWDVF+H Q   I DG NGDVA D Y  Y ED +++
Sbjct  33    FLFGAATSSYQIEGAYLEDGKGLSNWDVFTHTQSREINDGRNGDVADDHYHRYMEDVEIM  92

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FSISW+R+LP+GR G +N   I +Y  LI +LL KGIEPFVT++H+DLP E
Sbjct  93    HDLGVNSYRFSISWARLLPRGRLGGVNTAAIAFYDRLIAALLEKGIEPFVTLHHFDLPHE  152

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY GWL   ++EE+ Y+ADVCFK  GD+VK+W T NEPN++   AY   ++      
Sbjct  153   LETRYGGWLGAGIREEFDYYADVCFKAFGDRVKFWTTLNEPNLFTKFAYMLGMYPPKHCS  212

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G C+ GN+ ++ ++ AHNMIL+HAAAV+ Y++NYQ  QGG IGI +   W+ P+TNS
Sbjct  213   PPFGTCNSGNSRREPYVAAHNMILSHAAAVDNYKRNYQATQGGSIGIVIAMKWYEPLTNS  272

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF  +WFLDPI +G YP+EM+++L S+LP+F+S + ++L    +DFIG+
Sbjct  273   TKDILAARRALSFEVDWFLDPIFFGDYPREMREMLSSNLPKFTSEE-KRLLQSKADFIGV  331

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC+ S CD  +  GN   +  VG+   ++G  IG  T        P GME 
Sbjct  332   NHYTAIYAKDCISSPCDIKTYEGNAMVQA-VGE---RDGVAIGRPTAFHGYYDVPEGMEL  387

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y  +++ + P+Y+TE GY   +  ++S+EE+++D  RV +L  YL  + +A+RKGA+
Sbjct  388   IVKYVNQRYENTPVYITENGYSQLS--DNSMEELINDVGRVNYLQGYLTCISSAVRKGAN  445

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             V GYF+WSL DNFEW  G+T R G+Y  D  TQ+RTPK+S KWY+ F+  ++ VD     
Sbjct  446   VHGYFVWSLMDNFEWGFGFTVRFGIYHVDFETQERTPKMSGKWYRDFLTGSRPVDQAQTL  505

Query  329   R  327
             R
Sbjct  506   R  506



>ref|XP_007145856.1| hypothetical protein PHAVU_007G273800g [Phaseolus vulgaris]
 gb|ESW17850.1| hypothetical protein PHAVU_007G273800g [Phaseolus vulgaris]
Length=531

 Score =   496 bits (1276),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 238/477 (50%), Positives = 328/477 (69%), Gaps = 12/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+SSYQ EG  L DGKGLSNWDVFSH PG I +  NGD+A D Y LY ED  L++
Sbjct  39    FLFGASTSSYQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMS  98

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLPQEL
Sbjct  99    SLGINVYRFSISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPQEL  158

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWLSP +Q ++ YFA++CFK  GD++KYW T NEPN++A AA+   ++       
Sbjct  159   EEQYGGWLSPLIQRDFVYFAEICFKSFGDRIKYWATINEPNLFADAAFIRGIYPPGHCSP  218

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  I  HNM+L+HA AV +YRK++Q++QGG IGI      + P+ +  
Sbjct  219   PFGNCSTGNSDVEPLIAMHNMLLSHAKAVELYRKHFQEKQGGIIGIVAHTFMYEPLRDEE  278

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A +R  +F+ +W LDP+++G YP EM+ ILGS LP+FS  + + L  G SDFIGIN
Sbjct  279   YDRQAVKRVLAFVVSWCLDPLVFGEYPAEMRSILGSLLPKFSPEE-KNLIKGSSDFIGIN  337

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y T YA+DC  S C   +  +   +GFV  +  ++G  IG+ TG P   V P G+E++V
Sbjct  338   NYGTLYAKDCSLSAC--PLGADRPIKGFVETTGIRDGIPIGDQTGNPRFFVVPSGLEKIV  395

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ + P+Y+TE GY     P+ ++ ++L D KRV +   YL A+  AIRKGADVR
Sbjct  396   DYIKTRYHNRPMYITENGYSSPPKPDVTMNDLLQDFKRVDYHKAYLAALLRAIRKGADVR  455

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             GY IWSL DNFEW SGY  R GLY  +R T +R PKLS +W+  F+  N  +++  Q
Sbjct  456   GYMIWSLMDNFEWASGYGIRYGLYYVNRDTLERIPKLSVQWFSSFL--NNTINTNKQ  510



>gb|KHN28048.1| Beta-glucosidase 18 [Glycine soja]
Length=546

 Score =   496 bits (1277),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 315/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DG+GLSNWDVFSH PG I +  NGD+A D Y  Y ED +L++
Sbjct  51    FLFGTSTSSYQIEGAPFEDGRGLSNWDVFSHTPGKIKNDENGDIADDHYHRYLEDIELMS  110

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+H+DLPQEL
Sbjct  111   SLGVNVYRFSISWTRILPRGIYGDINPNGIMFYNKIIDNLLLRGIEPFVTIHHHDLPQEL  170

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GW+S  MQ ++ +FA++CFK  GD+VKYW T NEP + A  AY   ++       
Sbjct  171   EERYGGWISLLMQRDFVHFAEICFKSFGDRVKYWTTINEPALVANYAYMKGIYAPGHCSP  230

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  IV HNM+LAHA AV +YRK++Q +QGG IGI      F P+ +  
Sbjct  231   PFGNCNTGNSDVEPLIVVHNMLLAHAKAVELYRKHFQAKQGGTIGIVAHSVMFEPLRDEE  290

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +FL  W LDP+++G YP EM  ILGS LP FS  +   LK G  DFIGIN
Sbjct  291   CDRQAVNRALAFLIPWVLDPLVFGEYPAEMHSILGSQLPVFSLKEKSLLK-GSIDFIGIN  349

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY + Y +DC  S C  S+  +    GFV  +  ++G  IG+ TG  +  V P GM+++V
Sbjct  350   HYGSLYVKDCSLSAC--SLEADHPITGFVEVTGIRDGVPIGDQTGFSWFYVVPRGMQKLV  407

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ +IP+Y+TE GYC    P+ ++ ++L D KR+ +   YL A+  AIRKGADVR
Sbjct  408   DYVKIRYHNIPMYITENGYCSPLKPDETMHDLLQDVKRIDYHKAYLAALLRAIRKGADVR  467

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY IWSL DNFEW +GY  R GLY  +R T +R PKLS +W+  F+
Sbjct  468   GYMIWSLLDNFEWANGYEIRYGLYHVNRDTHERIPKLSVQWFSSFL  513



>emb|CDY25325.1| BnaC01g29940D [Brassica napus]
Length=479

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 317/474 (67%), Gaps = 47/474 (10%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQ-PGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGTSSS+YQYEG YL+DGKGL+NWDVFSH+ PG+ILDG NGD+A DQY+ + ED   
Sbjct  38    DFLFGTSSSAYQYEGAYLTDGKGLNNWDVFSHEKPGDILDGGNGDIAVDQYNRFMEDIQS  97

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +  LGVNS++FSISWSRVLPKGR G IN  G+++Y  LID+L+  GI PFVT+NH+D PQ
Sbjct  98    MNYLGVNSYRFSISWSRVLPKGRLGGINHLGVEHYNRLIDALIRNGITPFVTLNHFDYPQ  157

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL++R++ WLSPEMQ+E+ Y AD CFKH GD+VK+WIT NEPN   I +Y   ++     
Sbjct  158   ELENRFKSWLSPEMQKEFGYLADTCFKHFGDRVKHWITINEPNQQIILSYLKGIFPPNRC  217

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCS+GN+  + FI AHN ILAHA AV IY+  Y+++Q G IGI +  +WF P+++
Sbjct  218   SMPFGNCSQGNSETEPFIAAHNTILAHAKAVQIYQTKYKKEQKGSIGIVVQTSWFEPISD  277

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             ST DK AAERA SF SNW LDP++YG YPKEM                            
Sbjct  278   STADKNAAERAQSFYSNWILDPVVYGKYPKEM----------------------------  309

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
                       DCL S C+ S  G +R EGF  + + K    +GE+T + +L + P G  +
Sbjct  310   ----------DCLISACN-SGDGASRSEGFALKLIQKGNISVGEVTDVSWLNIDPKGFRK  358

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             ++ Y  +++P+IP+++TE G  +   P ++++E+L+DTKRV++L+ YL A+ TA+R GA+
Sbjct  359   MLNYLTDRYPNIPMFITENGLGELQKPETTVKELLNDTKRVRYLSGYLDALKTAMRDGAN  418

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             V+GYF WSL DNFEW  GY  R G+Y  D  T KRTPK SA WYK FI  + + 
Sbjct  419   VKGYFAWSLLDNFEWLYGYKLRFGIYHVDYTTLKRTPKQSAYWYKNFIENHMRT  472



>gb|KEH36809.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=471

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/415 (56%), Positives = 303/415 (73%), Gaps = 9/415 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G ILDG+NGDVA D Y  Y+ED DL+
Sbjct  43    NFLFGTASSSYQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLM  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
                GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQE
Sbjct  103   EHTGVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P     
Sbjct  163   LEERYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCS  222

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NS
Sbjct  223   DSFGNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNS  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGI
Sbjct  283   TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +
Sbjct  342   NHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             VTY K+++ +IP+++TE G+  + +   + E  L+D KRV++L+ YL ++ TAIR
Sbjct  401   VTYIKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIR  455



>ref|XP_006593298.1| PREDICTED: beta-glucosidase 18-like [Glycine max]
Length=536

 Score =   494 bits (1273),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 235/466 (50%), Positives = 315/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DG+GLSNWDVFSH PG I +  NGD+A D Y  Y ED +L++
Sbjct  41    FLFGTSTSSYQIEGAPFEDGRGLSNWDVFSHTPGKIKNDENGDIADDHYHRYLEDIELMS  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +G+IN  GI +Y  +ID+LLL+GIEPFVTI+H+DLPQEL
Sbjct  101   SLGVNVYRFSISWTRILPRGIYGDINPNGIMFYNKIIDNLLLRGIEPFVTIHHHDLPQEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GW+S  MQ ++ +FA++CFK  GD+VKYW T NEP + A  AY   ++       
Sbjct  161   EERYGGWISLLMQRDFVHFAEICFKSFGDRVKYWTTINEPALVANYAYMKGIYAPGHCSP  220

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  IV HNM+LAHA AV +YRK++Q +QGG IGI      + P+ +  
Sbjct  221   PFGNCNTGNSDVEPLIVVHNMLLAHAKAVELYRKHFQAKQGGTIGIVAHSVMYEPLRDEE  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +FL  W LDP+++G YP EM  ILGS LP FS  +   LK G  DFIGIN
Sbjct  281   CDRQAVNRALAFLIPWVLDPLVFGEYPAEMHSILGSQLPVFSLKEKSLLK-GSIDFIGIN  339

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY + Y +DC  S C  S+  +    GFV  +  ++G  IG+ TG  +  V P GM+++V
Sbjct  340   HYGSLYVKDCSLSAC--SLEADHPITGFVEVTGIRDGVPIGDQTGFSWFYVVPRGMQKLV  397

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ +IP+Y+TE GYC    P+ ++ ++L D KR+ +   YL A+  AIRKGADVR
Sbjct  398   DYVKIRYHNIPMYITENGYCSPLKPDETMHDLLQDVKRIDYHKAYLAALLRAIRKGADVR  457

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY IWSL DNFEW +GY  R GLY  +R T +R PKLS +W+  F+
Sbjct  458   GYMIWSLLDNFEWANGYEIRYGLYHVNRDTHERIPKLSVQWFSSFL  503



>ref|XP_002448178.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
 gb|EES12506.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
Length=510

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 316/468 (68%), Gaps = 12/468 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PG I DGS GD A D Y  +++D +L+
Sbjct  40    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHIPGRIEDGSTGDTADDHYHRFEDDVELM  99

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+R+LP+GR G +N EGI +Y  LIDSLLLKGIEPFVT+ HYD+PQE
Sbjct  100   HSLGTNAYRFSISWARILPRGRFGQVNPEGIAFYNKLIDSLLLKGIEPFVTLAHYDIPQE  159

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L DRY  WLS E+Q ++ Y ADVCF   GD+VK+W TFNEPN+     Y    +P G CS
Sbjct  160   LVDRYGAWLSTEVQRDFGYLADVCFAAFGDRVKHWATFNEPNVAMTKGYMLGTYPPGRCS  219

Query  1205  -------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                    +GN+  + ++  HN++L+HA AV IY++ YQ++Q G IGI M   WF+P+T++
Sbjct  220   PPFGSCAQGNSDAEPYVATHNVVLSHATAVEIYKRKYQRKQKGMIGIVMAAFWFVPLTDT  279

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAG-GSDFIG  870
              VD+ A ERA +F   W+LDPI+YG YP EM+ +LGS LP FS   +EK K G   DFIG
Sbjct  280   PVDRMATERALAFSVPWYLDPIVYGDYPPEMRQLLGSKLPTFSP--VEKRKLGYKLDFIG  337

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYTT Y +DC++++  P  SG   +      +  +NG  IG  T +P     P G+E+
Sbjct  338   INHYTTLYVKDCMFTSGCP--SGQDIQYALAAYTGERNGIPIGPPTAMPLFFDVPDGIEK  395

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY  +++ ++P+++TE GY       + +E+ L D  R+++L  YL  +   IR GAD
Sbjct  396   MVTYIMKRYNNLPMFITENGYAQGGVGYNQVEDWLDDQSRIQYLDGYLTKLAKVIRDGAD  455

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             VRGYFIWSL DNFEWT GYT R GL+  D  TQ+R PK SA WYK+F+
Sbjct  456   VRGYFIWSLIDNFEWTYGYTLRFGLHYVDYQTQERKPKSSALWYKRFL  503



>ref|XP_002448179.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
 gb|EES12507.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Length=516

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 312/467 (67%), Gaps = 9/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PG I D S GDVA D Y  Y+ED +L+
Sbjct  45    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHAPGRIKDRSTGDVADDHYHRYEEDIELM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+RVLPKGR G +N  GI +Y  LIDSLLLKGIEPFVT+ HYD PQE
Sbjct  105   HSLGTNAYRFSISWARVLPKGRFGKVNPAGIAFYNKLIDSLLLKGIEPFVTLTHYDTPQE  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPH----  1218
             L+DRY  WLS E + ++ + ADVCF   GD+VKYW TFNEPN+     Y    +P     
Sbjct  165   LEDRYGAWLSAEARRDFGHLADVCFAAFGDRVKYWSTFNEPNVVVTRGYMVGTYPPERCS  224

Query  1217  ---GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                G+C+ GN+  + ++  HN++LAHA AV IY++ YQ +Q G IGI M   W +P+T++
Sbjct  225   PPLGSCARGNSDAEPYVATHNVVLAHATAVEIYKRKYQSKQKGMIGIVMSALWLVPLTDT  284

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              VD+ A ERA +F + WFLDPI+YG YP EM+ +LGS LP FS  +  KL     DFIGI
Sbjct  285   PVDRLATERALAFDAPWFLDPIIYGDYPPEMRQLLGSKLPTFSPEERRKL-GYKLDFIGI  343

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC++S+  PS SG          +  +NG  IG  T +P     P G+E++
Sbjct  344   NHYTTLYAKDCMFSSGCPS-SGQEIHHALAAFTGERNGIPIGPPTAMPKFYFVPDGIEKM  402

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY  +++ ++P+++TE GY       +++E+ L D  R+++L  YL  +   IR GADV
Sbjct  403   VTYIMKRYNNLPMFITENGYAQGGDSYTNVEDWLDDQGRIQYLDGYLTKLAKVIRDGADV  462

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GYT R GL+  D  TQ+R PK SA WYK+F+
Sbjct  463   RGYFVWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYKRFL  509



>gb|KFK40643.1| hypothetical protein AALP_AA2G023200 [Arabis alpina]
Length=454

 Score =   491 bits (1264),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 240/472 (51%), Positives = 312/472 (66%), Gaps = 48/472 (10%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADL  1569
             +F FGTSSSSYQYEG Y++DGKGL+NWDVF+H  P  ILD S+GD+A DQY LY ED   
Sbjct  12    DFLFGTSSSSYQYEGAYVTDGKGLNNWDVFTHVNPEKILDESHGDIAVDQYHLYMEDIQS  71

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + +LGVNS++ SISWSR+LPKGR G IN  GIK+Y +LID+L+  GI PFVT+NH+D PQ
Sbjct  72    MINLGVNSYRLSISWSRILPKGRIGGINYLGIKHYNSLIDALIKNGITPFVTLNHFDYPQ  131

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY--------RY  1233
             EL++R+  WLSPEMQ E+ Y AD+CFKH GD+V +WIT NEPN   I +Y        R 
Sbjct  132   ELENRFNSWLSPEMQTEFGYLADICFKHFGDRVTHWITINEPNQQIIGSYIKGTFPPARC  191

Query  1232  RLWPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
              + P+GNCS+GN+  + FI AHNMILAHA AV IYR  YQ+ Q G IGI +  +WF P++
Sbjct  192   SM-PYGNCSQGNSETEPFIAAHNMILAHAKAVQIYRTKYQKAQRGIIGIVVQTSWFEPVS  250

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +S VDK AAERA SF SNW LDP++YG YP+EM +ILGS LP+FS               
Sbjct  251   DSIVDKKAAERAQSFYSNWILDPVVYGKYPEEMVNILGSSLPQFSRA-------------  297

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
                                      T+ EGF  +   K    IGELT + +  + P G  
Sbjct  298   -------------------------TKSEGFALKLDRKGNASIGELTDVSWQHIDPEGFR  332

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y   +FP+IP+++TE GY     P +++EE+L+DTKR+++++ YL A+  A+R GA
Sbjct  333   KMLNYLTNRFPNIPIFITENGYGHLQKPETTVEELLNDTKRIQYMSGYLDALKAAMRDGA  392

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             +V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI ++
Sbjct  393   NVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTTLKRTPKQSASWYKNFIKQH  444



>ref|XP_004976207.1| PREDICTED: beta-glucosidase 18-like [Setaria italica]
Length=594

 Score =   496 bits (1276),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 315/467 (67%), Gaps = 10/467 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+HQPG I D S GD+A D Y  +++D +L+
Sbjct  124   SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHQPGRIKDRSTGDIADDHYHRFEDDVELM  183

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+R+LP+GR G +NL GI +Y  LIDSLL KGIEPFVT+ HYD+PQE
Sbjct  184   HSLGTNAYRFSISWARILPRGRFGRVNLAGIAFYDELIDSLLHKGIEPFVTLTHYDIPQE  243

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLS E+Q ++ YFADVCF   GD+VKYW TFNEPN+     Y    +      
Sbjct  244   LEDRYGSWLSDEIQRDFGYFADVCFAAFGDRVKYWATFNEPNVAVRKGYMLGTYPPARCS  303

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P+G+C+ G++  + ++  HN++L+HA AV IY++ YQ +Q G IGI M  TWF PMT++
Sbjct  304   PPYGSCARGDSGAEPYLATHNVVLSHATAVEIYKRKYQSEQKGLIGIVMSTTWFKPMTDA  363

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              VD+ A ERA +F   WFLDPI+YG YP EM+ ILGS LP FS  +  KL     DFIG+
Sbjct  364   PVDRLATERALAFDVPWFLDPIVYGDYPPEMRQILGSRLPAFSPDERRKL-GYKLDFIGV  422

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC++S   P   G   +      +  +NG  +G  T +P   V P G+E++
Sbjct  423   NHYTTLYARDCMFSPGCP--LGQETQHALAAVTGERNGLPVGPPTAMPTFYVVPEGIEKI  480

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY  +++ ++P+++TE GY       + +E+ L D  R+++L  YL  +   IR GADV
Sbjct  481   VTYIMKRYNNLPMFITENGYAQGGDGYAHVEDWLDDQGRIEYLDGYLTKLAKVIRDGADV  540

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGYF+WSL DNFEW  GYT R GL+  D  TQ+R PK SA WY++F+
Sbjct  541   RGYFVWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYQRFL  587



>ref|XP_007149593.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21587.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=530

 Score =   493 bits (1270),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 238/477 (50%), Positives = 324/477 (68%), Gaps = 12/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+SSYQ EG  L DGKGLSNWDVFSH PG I +  NGD+A D Y LY ED  L++
Sbjct  39    FLFGASTSSYQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMS  98

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLP+EL
Sbjct  99    SLGINVYRFSISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPREL  158

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWLSP +Q ++ YFA++CFK  GD++KYW T NEPN+ A  A+    +       
Sbjct  159   EEQYGGWLSPLIQRDFVYFAEICFKSFGDRIKYWTTINEPNLIADFAFIRGTYPPGHCSP  218

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  I  HNM+L+HA AV +YRK++Q++QGG IGI      + P+ +  
Sbjct  219   PFGNCSAGNSDVEPLIAMHNMLLSHAKAVELYRKHFQEKQGGVIGIVAHTFMYEPLRDEE  278

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A +R  SF+ +W LDP+++G YP EM+ ILGS LP+FS  + + L  G SDFIGIN
Sbjct  279   YDRQAVKRVLSFVVSWCLDPLVFGEYPAEMRSILGSQLPKFSHEE-KNLIKGSSDFIGIN  337

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y T YA+DC  S C   +  +    GFV  +  ++G  IG+ TG P   V P G+E++V
Sbjct  338   NYGTLYAKDCSLSAC--PIGADRPIRGFVETTGIRDGIPIGDQTGNPRFFVVPSGLEKIV  395

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ + P+Y+TE GY     P+ ++ ++L D KRV F   YL A+  AIRKGADVR
Sbjct  396   DYIKIRYHNRPMYITENGYSSPPKPDETVNDLLQDFKRVDFHKAYLAALLRAIRKGADVR  455

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             GY IWSL DNFEW SGY  R GLY  +R T +R PKLS +W+  F+  N  +++  Q
Sbjct  456   GYMIWSLMDNFEWASGYGIRYGLYYVNRDTLERIPKLSVQWFSSFL--NNTINTSKQ  510



>gb|KEH36808.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=477

 Score =   491 bits (1264),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 231/415 (56%), Positives = 303/415 (73%), Gaps = 9/415 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G ILDG+NGDVA D Y  Y+ED DL+
Sbjct  43    NFLFGTASSSYQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLM  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
                GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQE
Sbjct  103   EHTGVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P     
Sbjct  163   LEERYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCS  222

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NS
Sbjct  223   DSFGNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNS  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGI
Sbjct  283   TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +
Sbjct  342   NHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENI  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             VTY K+++ +IP+++TE G+  + +   + E  L+D KRV++L+ YL ++ TAIR
Sbjct  401   VTYIKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIR  455



>ref|XP_006652510.1| PREDICTED: beta-glucosidase 16-like [Oryza brachyantha]
Length=518

 Score =   492 bits (1267),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 232/482 (48%), Positives = 328/482 (68%), Gaps = 15/482 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL D KGL+NWDVF+H   G I DG NGD+A D Y  Y ED D+L
Sbjct  38    FLFGAATSAYQIEGAYLDDNKGLNNWDVFTHTHAGKISDGGNGDIADDHYHRYTEDVDIL  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGV+S++FSISW+RVLP GR G +N  GI +Y  LID+LL KGI+PFVT+NH+D+P E
Sbjct  98    HNLGVDSYRFSISWARVLPSGRLGGVNSAGIAFYNRLIDALLQKGIQPFVTLNHFDIPHE  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ R+ GWL   +QEE+ Y++D+CF+  GD+V++W TFNEPN++    +   ++      
Sbjct  158   LETRFGGWLGAAIQEEFVYYSDICFRAFGDRVRFWTTFNEPNLFTRFQFVLGVYPPNHCS  217

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++ ++ +I +HN++L+HAAAV+ Y+ NYQ +QGG IGI +   W+ P+TN+
Sbjct  218   PPFGNCSSGDSGREPYIASHNILLSHAAAVHNYKANYQAKQGGSIGIVIAMKWYEPLTNT  277

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF  +WFLDPI +G YP++M++I+ S+LP+F+  + + L+    DFIGI
Sbjct  278   TEDVRAARRAQSFEVDWFLDPIFFGDYPRDMREIISSNLPKFTPQEKKLLQMNKVDFIGI  337

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT+ YA+DC+YS C   +  GN      V  +  +NG  IG  T      V P G+E 
Sbjct  338   NHYTSIYAKDCIYSPCKLDTYEGN----ALVYTTARRNGKQIGGSTAFDTYFVVPKGIES  393

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
              V Y  +++ +  +Y+TE GY   +  N   E +++D +RV +L DYL  + +AIRKGAD
Sbjct  394   AVMYVHDRYKNTAIYITENGYSQHSDTNIK-ELIINDVERVNYLHDYLSYLSSAIRKGAD  452

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS-KMQ  333
             VRGYF+WS+ DNFEWT GYT + GLY  D  TQ+R P++SA WYK F+   ++ D  ++Q
Sbjct  453   VRGYFVWSIVDNFEWTFGYTVKFGLYHVDFDTQERIPRMSATWYKDFLTGCRQADGLQVQ  512

Query  332   SR  327
             SR
Sbjct  513   SR  514



>ref|XP_007149591.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 ref|XP_007149592.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21585.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21586.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=532

 Score =   493 bits (1268),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 238/477 (50%), Positives = 324/477 (68%), Gaps = 12/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+SSYQ EG  L DGKGLSNWDVFSH PG I +  NGD+A D Y LY ED  L++
Sbjct  39    FLFGASTSSYQIEGAPLEDGKGLSNWDVFSHIPGKISNDENGDIADDHYHLYSEDIKLMS  98

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +G+IN  GIK+Y  +ID+LLL+GIEPFVTI+H+DLP+EL
Sbjct  99    SLGINVYRFSISWTRILPRGIYGDINPSGIKFYNKIIDNLLLRGIEPFVTIHHHDLPREL  158

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWLSP +Q ++ YFA++CFK  GD++KYW T NEPN+ A  A+    +       
Sbjct  159   EEQYGGWLSPLIQRDFVYFAEICFKSFGDRIKYWTTINEPNLIADFAFIRGTYPPGHCSP  218

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  I  HNM+L+HA AV +YRK++Q++QGG IGI      + P+ +  
Sbjct  219   PFGNCSAGNSDVEPLIAMHNMLLSHAKAVELYRKHFQEKQGGVIGIVAHTFMYEPLRDEE  278

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A +R  SF+ +W LDP+++G YP EM+ ILGS LP+FS  + + L  G SDFIGIN
Sbjct  279   YDRQAVKRVLSFVVSWCLDPLVFGEYPAEMRSILGSQLPKFSHEE-KNLIKGSSDFIGIN  337

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y T YA+DC  S C   +  +    GFV  +  ++G  IG+ TG P   V P G+E++V
Sbjct  338   NYGTLYAKDCSLSAC--PIGADRPIRGFVETTGIRDGIPIGDQTGNPRFFVVPSGLEKIV  395

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ + P+Y+TE GY     P+ ++ ++L D KRV F   YL A+  AIRKGADVR
Sbjct  396   DYIKIRYHNRPMYITENGYSSPPKPDETVNDLLQDFKRVDFHKAYLAALLRAIRKGADVR  455

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             GY IWSL DNFEW SGY  R GLY  +R T +R PKLS +W+  F+  N  +++  Q
Sbjct  456   GYMIWSLMDNFEWASGYGIRYGLYYVNRDTLERIPKLSVQWFSSFL--NNTINTSKQ  510



>ref|XP_006653596.1| PREDICTED: beta-glucosidase 16-like, partial [Oryza brachyantha]
Length=503

 Score =   491 bits (1265),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 320/468 (68%), Gaps = 13/468 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL D KGLS WDVF+H Q G I DG NGDVA D Y  Y ED D+L
Sbjct  22    FLFGAATSAYQIEGAYLEDNKGLSIWDVFTHAQAGRISDGRNGDVADDHYHRYMEDVDIL  81

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P E
Sbjct  82    HNLGVNSYRFSISWARILPRGRLGGVNSVGIAFYDRLINALLKKGIQPFVTLNHFDIPHE  141

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             LQ RY GWL   ++EE+ Y++DVCF   GD+V++W TFNEPN+ +   +   ++      
Sbjct  142   LQARYGGWLGAGIREEFVYYSDVCFDAFGDRVRFWATFNEPNLLSKFQFMLGVYPPNRCS  201

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G+CS G++ ++ ++ AHN++L+HAAAV  Y+ NYQ +QG  IGI +   W+ P+TNS
Sbjct  202   PPFGSCSGGDSRREPYVAAHNILLSHAAAVQNYKTNYQAKQGSSIGIVIAMKWYDPLTNS  261

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF   WFLDPI +G YP+EM++IL  +LPEF++ + + L     DF+GI
Sbjct  262   TEDVRAARRALSFEVEWFLDPIFFGDYPREMREILSLNLPEFTAEEKKLLWTNKVDFVGI  321

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREE-GFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT+ YA+DC+YS C      NT E    V     +NG  IG+ T      V P G+E 
Sbjct  322   NHYTSIYAKDCIYSPCKL----NTYESNALVYAPSERNGVKIGKPTAFDVFFVVPQGIES  377

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
              V Y  +++ D  +Y+TE GY      ++++EE+++D +RV +L DYL  + +AIRKGA+
Sbjct  378   AVMYVTDRYKDTIIYITENGYSQRIHNDTNMEELINDVERVSYLHDYLKYLSSAIRKGAN  437

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             V GYF+WSL DNFEWT GYT + GLY  D  TQ+RTPK+SAKWYK F+
Sbjct  438   VGGYFVWSLMDNFEWTFGYTVKFGLYHVDFDTQERTPKMSAKWYKDFL  485



>sp|Q7XSK2.2|BGL16_ORYSJ RecName: Full=Beta-glucosidase 16; Short=Os4bglu16; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54544.1| OSJNBa0004N05.24 [Oryza sativa Japonica Group]
 emb|CAE01908.2| OSJNBb0070J16.1 [Oryza sativa Japonica Group]
 gb|EEC77634.1| hypothetical protein OsI_16626 [Oryza sativa Indica Group]
Length=516

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/482 (49%), Positives = 329/482 (68%), Gaps = 16/482 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL D KGL+NWDVF+H Q G I DG NGDVA D Y  Y ED D+L
Sbjct  37    FLFGAATSAYQIEGAYLDDNKGLNNWDVFTHTQAGRISDGRNGDVADDHYHRYTEDVDIL  96

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P E
Sbjct  97    HNLGVNSYRFSISWARILPRGRLGGVNSAGIAFYNRLINALLQKGIQPFVTLNHFDIPHE  156

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+ RY GWL   ++EE+ Y++DVCF   GD+V++W TFNEPN+     Y        +  
Sbjct  157   LETRYGGWLGAAIREEFEYYSDVCFNAFGDRVRFWTTFNEPNLSTRHQYILGEFPPNHCS  216

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++ ++ +  AHN++L+HAAAV+ Y+ NYQ +QGG IGI +   W+ P+TNS
Sbjct  217   PPFGNCSSGDSRREPYAAAHNILLSHAAAVHNYKTNYQAKQGGSIGIVIAVKWYEPLTNS  276

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA +F  +WFLDPI +G YP+EM++IL S+LP+F+  + + L+    DFIGI
Sbjct  277   TEDVRAARRALAFEVDWFLDPIFFGDYPREMREILSSNLPKFTPEEKKLLQNNKVDFIGI  336

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC+YS C   +  GN      V     +NG  IG+ T L    V P  ME+
Sbjct  337   NHYTAIYAKDCIYSPCTLDTYEGN----ALVYAIGRRNGKIIGKPTALHGYFVVPEAMEK  392

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VV Y  +++ +  +Y+TE GY   +  ++S+E++++D +RV ++ DYL  + +AIRKGA+
Sbjct  393   VVMYVNDRYRNTTIYITENGYSQHS--DTSMEDLINDVERVNYMHDYLKYLSSAIRKGAN  450

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS-KMQ  333
             V GYF WS+ DNFEW  GYT + GLYQ D  TQ+R P++SAKWY+ F+  +   D  +++
Sbjct  451   VGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDTQERIPRMSAKWYRDFLTSSSLTDGLQVR  510

Query  332   SR  327
             SR
Sbjct  511   SR  512



>gb|AID16401.1| monolignol beta-glucosidase, partial [synthetic construct]
Length=498

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/482 (49%), Positives = 329/482 (68%), Gaps = 16/482 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL D KGL+NWDVF+H Q G I DG NGDVA D Y  Y ED D+L
Sbjct  19    FLFGAATSAYQIEGAYLDDNKGLNNWDVFTHTQAGRISDGRNGDVADDHYHRYTEDVDIL  78

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISW+R+LP+GR G +N  GI +Y  LI++LL KGI+PFVT+NH+D+P E
Sbjct  79    HNLGVNSYRFSISWARILPRGRLGGVNSAGIAFYNRLINALLQKGIQPFVTLNHFDIPHE  138

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+ RY GWL   ++EE+ Y++DVCF   GD+V++W TFNEPN+     Y        +  
Sbjct  139   LETRYGGWLGAAIREEFEYYSDVCFNAFGDRVRFWTTFNEPNLSTRHQYILGEFPPNHCS  198

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS G++ ++ +  AHN++L+HAAAV+ Y+ NYQ +QGG IGI +   W+ P+TNS
Sbjct  199   PPFGNCSSGDSRREPYAAAHNILLSHAAAVHNYKTNYQAKQGGSIGIVIAVKWYEPLTNS  258

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA +F  +WFLDPI +G YP+EM++IL S+LP+F+  + + L+    DFIGI
Sbjct  259   TEDVRAARRALAFEVDWFLDPIFFGDYPREMREILSSNLPKFTPEEKKLLQNNKVDFIGI  318

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC+YS C   +  GN      V     +NG  IG+ T L    V P  ME+
Sbjct  319   NHYTAIYAKDCIYSPCTLDTYEGN----ALVYAIGRRNGKIIGKPTALHGYFVVPEAMEK  374

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VV Y  +++ +  +Y+TE GY   +  ++S+E++++D +RV ++ DYL  + +AIRKGA+
Sbjct  375   VVMYVNDRYRNTTIYITENGYSQHS--DTSMEDLINDVERVNYMHDYLKYLSSAIRKGAN  432

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDS-KMQ  333
             V GYF WS+ DNFEW  GYT + GLYQ D  TQ+R P++SAKWY+ F+  +   D  +++
Sbjct  433   VGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDTQERIPRMSAKWYRDFLTSSSLTDGLQVR  492

Query  332   SR  327
             SR
Sbjct  493   SR  494



>sp|Q7XSK0.2|BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54546.1| OSJNBa0004N05.26 [Oryza sativa Japonica Group]
 emb|CAE01910.2| OSJNBb0070J16.3 [Oryza sativa Japonica Group]
 emb|CAH67620.1| OSIGBa0140J09.1 [Oryza sativa Indica Group]
Length=505

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/468 (50%), Positives = 311/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVF+H PGNI DGSNGD+A D Y  Y+ED +L+
Sbjct  35    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHLPGNIKDGSNGDIADDHYHRYEEDVELM  94

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVN+++FSISWSR+LPKGR G +N  GI +Y  LIDS+LLKGI+PFVT+ HYD+PQE
Sbjct  95    NSLGVNAYRFSISWSRILPKGRFGGVNPAGIDFYNKLIDSILLKGIQPFVTLTHYDIPQE  154

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L+DRY  WL+ E+Q ++ +FADVCF   GD+VKYW TFNEPN+     Y    +P   CS
Sbjct  155   LEDRYGAWLNAEIQSDFGHFADVCFGAFGDRVKYWTTFNEPNVAVRHGYMLGTYPPSRCS  214

Query  1205  E--------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
                      G++  + ++ AHN+IL+HA A+ IY++ YQ +Q G IG+ +  TW+ P+ +
Sbjct  215   PPFGHCARGGDSHAEPYVAAHNVILSHATAIEIYKRKYQSKQRGMIGMVLYSTWYEPLRD  274

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
                D+ A ERA +F + WFLDP++YG YP EM+ ILG  LP FS  D  KL+    DFIG
Sbjct  275   VPEDRLATERALAFETPWFLDPLVYGDYPPEMRQILGGRLPSFSPEDRRKLRY-KLDFIG  333

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             +NHYTT YA+DC++S C     G   +      +   NG  IG  T +P   V P G+E+
Sbjct  334   VNHYTTLYARDCMFSDCP---QGQETQHALAAVTGESNGLPIGTPTAMPTFYVVPDGIEK  390

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y   ++ ++P+++TE GY       +  E+ + D  R+++L  YL  +   IR GAD
Sbjct  391   MVKYFMRRYNNLPMFITENGYAQGGDSYTDAEDWIDDEDRIEYLEGYLTKLAKVIRDGAD  450

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             VRGYF WS+ DNFEW  GYT R GLY  D  TQ+R+PKLSA WYK+F+
Sbjct  451   VRGYFAWSVVDNFEWLFGYTLRFGLYYIDYRTQERSPKLSALWYKEFL  498



>ref|XP_011042496.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Populus euphratica]
Length=537

 Score =   492 bits (1266),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 319/469 (68%), Gaps = 15/469 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG Y+ DGKGL+NWDVFSH PGNI +  NGD+A + Y  + ED +L++
Sbjct  41    FIFGTSTSSYQVEGAYIEDGKGLNNWDVFSHIPGNIKNNDNGDIADNHYYRFLEDIELMS  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG N+++FSISW+R+LP+G+ G +N  GI +Y  LID+LL +G+EPFVTI+H+D+PQEL
Sbjct  101   SLGTNAYRFSISWARILPRGKFGQVNPRGIMFYNKLIDNLLERGMEPFVTIHHHDIPQEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
              DRY GWLSP MQE++ YFA+ CFK  GD++K WIT NEPN+    +Y  R W       
Sbjct  161   VDRYGGWLSPLMQEDFVYFAETCFKSFGDRIKNWITMNEPNLLVDMSY-IRGWYPPAHCS  219

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  I  HNMIL HA AV +YR+++Q +QGG IGI     +F P+ +S
Sbjct  220   PPFGNCSAGNSDIEPPIAMHNMILGHAKAVKLYREHFQLEQGGYIGIVGFTEYFEPLRDS  279

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              +D+ A  RA +F + W  D +++G YP EM+  LGS LP FS  +   LK G  DFIG+
Sbjct  280   ELDRQAVRRALAFTNAWLFDAVVFGDYPAEMRLYLGSALPTFSLEETCYLK-GSLDFIGM  338

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             N YT+ YA+DC++S C   +SG  R   GFV  +  ++G  IG   G P   V P GME+
Sbjct  339   NFYTSLYAKDCIHSAC---ISGGDRPIRGFVYTTGERDGEPIGGRCGNPRFFVVPEGMEK  395

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y KE++ ++P++VTE G+      N  ++ +L DT RV F   YL A+  AIR GA+
Sbjct  396   IVNYMKERYNNMPMFVTENGFSPPQQ-NDQVQALLQDTSRVNFHKSYLAALARAIRNGAN  454

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             VRGYF+WSL DNFEW  GY+ R GLY  DR T +R PKLSAKWYK+F+A
Sbjct  455   VRGYFVWSLVDNFEWIDGYSLRYGLYYVDRQTLERVPKLSAKWYKKFLA  503



>ref|XP_004141366.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
 gb|KGN55151.1| hypothetical protein Csa_4G638400 [Cucumis sativus]
Length=523

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 322/480 (67%), Gaps = 10/480 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFGTS+SSYQ EGGY+ DG+G SNWDVFSH PGNI +   GDVA D Y  + ED +++
Sbjct  38    HFFFGTSTSSYQIEGGYVEDGRGTSNWDVFSHIPGNIKNSDTGDVADDHYHRFMEDIEMM  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             +S+G+N+++FSISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP E
Sbjct  98    SSMGMNAYRFSISWTRILPKGRFGKVNRRGIVFYNKIIDNLLLKGIEPFVTIHHHDLPDE  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L  RY  W+S  MQE++ YFA +CFK  GD+VK+WIT NEPN+  +  Y   ++      
Sbjct  158   LDKRYGSWMSSHMQEDFVYFAKICFKEFGDRVKHWITINEPNLVTLMGYIKGVYPPAHCS  217

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  IV HNM+LAHA AV IYR  +Q++QGG IG+      + P+TN+
Sbjct  218   PPFGNCSVGNSDIEPLIVMHNMLLAHAKAVFIYRTQFQKKQGGSIGLVAYCHMYEPLTNN  277

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A +RA  F   W  DPI+YG YPKEM+++ GS LP FS+T+   +K G  D+I +
Sbjct  278   EFDLQAVDRALIFSFAWVYDPIVYGDYPKEMREVFGSQLPSFSNTEKNIIK-GSLDYICV  336

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DCL+S C  S  G+   +GF+     +N   IG+ TG+    V P G+E+ 
Sbjct  337   NHYTTLYAKDCLHSPC--SNGGDRPIKGFLDTMGYRNSVSIGDPTGMDRFFVVPRGLEKT  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y  +++P+ P++VTE GY    +  + +E++++DTKRV F  +YL ++  A+R GADV
Sbjct  395   INYINQRYPNKPIFVTENGYSTPPSDGNKVEDIINDTKRVNFHRNYLASLVRAMRNGADV  454

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQSR  327
             RGYF+WSL DN EW  G+  R GL   D  T +R PKLSA W+   +  N +  S + ++
Sbjct  455   RGYFVWSLMDNLEWIHGFNTRFGLVYVDFQTLERRPKLSAHWFASLLGGNLQHSSSILNK  514



>ref|XP_010644219.1| PREDICTED: beta-glucosidase 18 isoform X1 [Vitis vinifera]
 emb|CBI20346.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   491 bits (1263),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 237/472 (50%), Positives = 316/472 (67%), Gaps = 16/472 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++SSYQ EG  L DGK  +NWDVF H PG I +G  GD+A D Y  + ED +++ 
Sbjct  40    FLFGAATSSYQIEGAVLEDGKSPNNWDVFCHIPGGIKNGDTGDIADDHYHQFLEDIEIIH  99

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISWSRVLP+GR G +N +G+ +Y  +ID+LLLKGIEP+VTI H+D PQEL
Sbjct  100   SLGVNAYRFSISWSRVLPRGRLGEVNPKGVMFYSKIIDNLLLKGIEPYVTIYHHDHPQEL  159

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++R+  WLSP MQEE+ +FA+ CF++ GD+VKYW T NEPN+ A  AY   LW       
Sbjct  160   EERFGAWLSPLMQEEFVHFAETCFENFGDRVKYWTTINEPNLLAEMAY---LWGRYPPAH  216

Query  1223  ---PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
                P GNCS GN+  +   V HNM+L+HA A NIYR  YQ +QGG IGI        P+ 
Sbjct  217   CSAPFGNCSSGNSDTEPLFVLHNMLLSHAKAANIYRHKYQLKQGGFIGIIANTLMCEPLR  276

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +  +D+ AA+RA +F   W LDP+++G YP EM+   G+ LP F+S +  KL     DFI
Sbjct  277   DIELDREAAKRALAFYIAWMLDPLVFGDYPPEMRQYHGNELPRFTSEE-TKLLTQSLDFI  335

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             GINHYTT YA+DC++STC  S  G+   +GFV  +  ++G  IGE TG+    + P GME
Sbjct  336   GINHYTTLYAKDCIHSTC--SSDGDRAIQGFVYLTGERHGVPIGERTGMRRFFIVPRGME  393

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y KE++ ++P++VTE GY      +   E+++ D KR++F   YL A+  AIR GA
Sbjct  394   KIIEYVKERYNNMPMFVTENGYSPPEKEDEQEEDLVQDAKRIEFHKAYLAALARAIRNGA  453

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             DVRGYFIWSL DNFEW  GY  R GLY  DR T +RTPKLSA+WY  F+  +
Sbjct  454   DVRGYFIWSLMDNFEWVYGYNTRFGLYYVDRQTLRRTPKLSARWYANFLTNS  505



>ref|XP_003580124.2| PREDICTED: beta-glucosidase 16-like [Brachypodium distachyon]
Length=554

 Score =   492 bits (1266),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 237/480 (49%), Positives = 326/480 (68%), Gaps = 16/480 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL D K L+NWDVF+H +PG I DG NGDVA D Y  Y ED +++
Sbjct  77    FLFGAATSAYQIEGAYLEDNKSLNNWDVFTHTRPGGIRDGRNGDVADDHYHRYMEDVEIM  136

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISWSR+LP+GR G +N  GI +Y  LI +LL KGIEPFVT+NH+D+P E
Sbjct  137   HNLGVNSYRFSISWSRILPRGRLGGVNSAGIAFYDRLIAALLQKGIEPFVTLNHFDVPHE  196

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             ++ RY  WL   ++EE+ Y+ADVCF+  GD+VKYW TFNEPN++   AY    +      
Sbjct  197   METRYGSWLGAGIREEFDYYADVCFRAFGDRVKYWTTFNEPNLFTKFAYLLGEYPPNHCS  256

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G C+ GN+ ++ ++ AHN++L+HAAAVN Y+KNYQ +QGG IGI +   W+ P+TN 
Sbjct  257   PPFGACNSGNSRREPYVAAHNILLSHAAAVNNYKKNYQAKQGGSIGIVVAMKWYEPLTNR  316

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF   WFLDPI +G YP+EM+++L ++LP+F+  + +KL     DFIGI
Sbjct  317   TEDIRAARRALSFEVEWFLDPIFFGDYPREMREMLSANLPKFTPEE-KKLMQNKVDFIGI  375

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             N YT  YA+DC+   C+  +  GN      V  +  ++G  IG+ T        P GME+
Sbjct  376   NQYTAIYARDCISLPCNIMTYEGNA----MVLATGERDGVLIGKPTAFKGYYDVPQGMEQ  431

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
              V Y  E++ + P+YVTE GY   +  ++S+E++++D  RV +L  YL ++ +A+RKGA+
Sbjct  432   AVKYVNERYENTPVYVTENGYSQQS--DNSVEDLINDVGRVNYLQGYLTSISSAVRKGAN  489

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             VRGYF+WSL DNFEW  GYT R GLY  D  TQKR PK SAKWY+ F+A    VD ++Q+
Sbjct  490   VRGYFVWSLIDNFEWGFGYTVRFGLYHVDFETQKRIPKTSAKWYRGFLAGAGPVDDQVQA  549



>ref|XP_006348229.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=538

 Score =   491 bits (1264),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 317/474 (67%), Gaps = 13/474 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++S+YQ EG +L DGKGLSNWDVFSH  G I +G  GD+A D Y  ++ED +L+ 
Sbjct  41    FLFGTTTSAYQIEGAFLEDGKGLSNWDVFSHTKGRINNGDTGDIADDHYHRFQEDVELMH  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             S+G+NS++FSISWSRVLP+GR G +N  G+ +Y  LIDSLLLKGI PFVT+NH+D P EL
Sbjct  101   SIGLNSYRFSISWSRVLPRGRFGKVNFAGVTFYNELIDSLLLKGITPFVTLNHHDHPHEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y GWL+P MQEE++YFA +CF   GD+VKYW T NEPNM+A  AY   ++       
Sbjct  161   EEKYGGWLNPIMQEEFSYFAQICFSSFGDRVKYWTTINEPNMFAEMAYVRGVYPPARCSP  220

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  +  HNM+LAHA A  +YR+++Q + GG IGI +    + P+ N+ 
Sbjct  221   PFGNCSAGNSDAEPLVAMHNMLLAHAKAAKLYREHFQPKHGGLIGIVVHSFMYKPLRNND  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA  F + W  DP+++G YP EM+  L   LP F+S D  KL     DF+GIN
Sbjct  281   FDRDAANRAVLFTAAWVFDPLVHGDYPPEMRKYLLDALPRFTS-DERKLIKDSIDFMGIN  339

Query  863   HYTTYYAQDCLYSTCDPSM-----SGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC+YS+C  S       G+    G++     K+G  IGE TG+    V P G
Sbjct  340   HYGTLYAKDCIYSSCVCSNSSCIAGGDHPIHGYLITLAEKDGVSIGEPTGMSRFFVVPNG  399

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y K+++ + P++VTE GY       +  +E+ +DTKRV+F   YL ++  AIRK
Sbjct  400   MEEIVDYMKKRYHNKPMFVTENGYASLNPTTAQADELQNDTKRVEFHKSYLASLARAIRK  459

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GADVRGYFIWSL DNFEWTSGY  + GLY  DRAT  R PKLSAKWY  F+  N
Sbjct  460   GADVRGYFIWSLMDNFEWTSGYELKFGLYYVDRATLDRVPKLSAKWYTDFLTNN  513



>gb|KEH38756.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=528

 Score =   490 bits (1261),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 317/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DGKGLSNWD FSH PG I +  NGD+A D Y  Y ED  L++
Sbjct  39    FLFGTSTSSYQIEGAAFEDGKGLSNWDKFSHTPGMINNDENGDIANDHYHRYLEDIKLMS  98

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISWSR+LP+G +G+IN  G+ +Y NLID+LLL+GIEPFVTI+H+DLPQEL
Sbjct  99    SLGINVYRFSISWSRILPRGTYGDINPSGVMFYNNLIDNLLLRGIEPFVTIHHHDLPQEL  158

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GWLSP +Q ++ +FA++CFK  GD+VKYW+T NEP + +  A+    +       
Sbjct  159   EERYGGWLSPLIQRDFVHFAEICFKSFGDRVKYWVTINEPTLVSDFAFIRGKYPPSHCSP  218

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC  GN+  +  +V HNM+L+HA AV +YRK+YQ +Q G +GI      + P+ +  
Sbjct  219   PFGNCYTGNSDVEPLLVMHNMLLSHAKAVELYRKHYQAKQAGTVGIVAHTFMYEPLRDEE  278

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +F+  W LDP+++G YP EM+ ILG+ LP+ S+ +   L+ G  DFIGIN
Sbjct  279   CDRQATNRALAFVIGWLLDPLVFGEYPAEMRSILGNRLPKISTKEKSLLR-GSLDFIGIN  337

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y   YA+DC  STC    +   R  GF+  +  ++G  IG+ TG+P   V P GME++V
Sbjct  338   NYGALYAKDCYLSTCPLEAARPIR--GFLETTGMRDGIPIGDQTGMPRFFVVPKGMEKIV  395

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K K+ ++P+Y+TE GY      + ++ ++LHD KR+++   YL A+  AIRKGADVR
Sbjct  396   DYIKIKYQNLPMYITENGYSSPLNASMTMHDLLHDFKRIEYHKAYLAALLRAIRKGADVR  455

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY +WSLFDNFEW SGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  456   GYMVWSLFDNFEWNSGYNVRFGLYYVDRQTLERIPKLSVEWFSSFL  501



>ref|XP_007026018.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
 gb|EOY28640.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
Length=497

 Score =   489 bits (1258),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 302/424 (71%), Gaps = 19/424 (4%)
 Frame = -3

Query  1694  LSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSISWSRV  1515
             L+  + L N   F   P N L G+           Y+ED DL+ SLGVNS++FSISW+R+
Sbjct  28    LTLEQSLGNLSAF---PPNFLFGTASSA-------YQEDIDLMHSLGVNSYRFSISWARI  77

Query  1514  LPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSPEMQEEY  1335
             LPKGR G IN  GI +Y  LID+LLLKGI+P VT+ H D PQEL+DRY  WLSPE QE++
Sbjct  78    LPKGRFGKINEAGINFYNKLIDALLLKGIKPLVTLTHVDFPQELEDRYGSWLSPEWQEDF  137

Query  1334  AYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL-------WPHGNCSEGNATKDIFI  1176
             AYFAD+CFK  GD+V+YW+TFNEP+     AYR  +       WP GNC+ G++ K+ FI
Sbjct  138   AYFADICFKSFGDRVQYWVTFNEPDFQVKFAYRTGIFPPSRCSWPFGNCTYGDSEKEPFI  197

Query  1175  VAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNW  996
              AHN+ILAH AAV+IYR  YQ+ QGG IGI +   WF  ++NS  DK AAERA SF   W
Sbjct  198   AAHNIILAHIAAVHIYRTKYQETQGGSIGIVLHCFWFESISNSLADKLAAERAQSFTMKW  257

Query  995   FLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD  816
             FLDPI++G YP EM++ILGS LPEFS+T+ EKL   G DFIG+NHY++YY +DC++S C+
Sbjct  258   FLDPIIFGRYPPEMQNILGSILPEFSTTEKEKLNK-GLDFIGVNHYSSYYVKDCMFSVCE  316

Query  815   PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDIPLYVTE  636
             P  +G ++ EGF GQS  KNG  IGELT L +L VYP GME++VTY KE + +IP+ +TE
Sbjct  317   PG-TGTSKTEGFWGQSSQKNGIPIGELTDLDWLNVYPQGMEKIVTYLKETYHNIPMIITE  375

Query  635   TGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDNFEWTSG  456
              GY + +  NS+ EE LHD KRV++LA YL  + TAIRKGADVRGYF+WSL DNFEW  G
Sbjct  376   NGYGEVSKANSTTEEFLHDVKRVEYLAGYLDQLSTAIRKGADVRGYFVWSLLDNFEWNFG  435

Query  455   YTKR  444
             YT +
Sbjct  436   YTVK  439



>ref|XP_004154892.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=507

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 312/469 (67%), Gaps = 12/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG S+SSYQ EGGYL DGKG+SNWDVFSH PG I +   GDVA D Y  + ED +L+
Sbjct  31    HFFFGASTSSYQIEGGYLEDGKGISNWDVFSHIPGKITNNDTGDVADDHYHRFLEDIELM  90

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+N+++FSISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P E
Sbjct  91    HSMGLNAYRFSISWTRILPRGRFGKVNKGGINFYNKIIDNLLLKGIEPFVTIYHFDYPME  150

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY+ W+S +MQ+E+  FA VCF+  GD+VKYW+T NEP M AI  YR   +      
Sbjct  151   LERRYESWMSSQMQDEFVEFAKVCFEEFGDRVKYWMTINEPEMVAILGYRMGSFPPAHCS  210

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G CS GN+ ++  IV HN +LAHA AV++YR ++Q +QGG IGI +    + P+   
Sbjct  211   PPFGKCSMGNSDREPLIVVHNQLLAHAKAVSLYRTHFQVKQGGSIGITISIQMYEPLDQQ  270

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D  A +R  +F   W  DPI+YG YPKEM++ILGS LP FS  D   +K G  DFI I
Sbjct  271   S-DTQAVDRILAFYVGWIYDPIVYGDYPKEMREILGSELPSFSDEDKRYIK-GSLDFISI  328

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC +S+C   +  N     FV  +  +NG  IG+  G+P L V P GME+V
Sbjct  329   NHYTTKYAKDCFHSSCPDEV--NRPINAFVETTPYRNGILIGDPMGIPGLYVVPRGMEKV  386

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K ++P+  ++VTE GY    +  + +E +L+D KR+KF   YL A+  A+R G DV
Sbjct  387   INYIKRRYPNHSIFVTENGYSMPPSDGNKVETILNDCKRIKFHKSYLAALARAMRNGGDV  446

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDR-ATQKRTPKLSAKWYKQFIA  363
             RGYFIWSL DNFEW  GY  R GL+  D   T +R PKLSA W+  F+ 
Sbjct  447   RGYFIWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFASFLG  495



>dbj|BAJ93784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 236/481 (49%), Positives = 327/481 (68%), Gaps = 16/481 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++SSYQ EG YL DGKGLSNWDVF+H Q   I DG NGDVA D Y  Y ED +++
Sbjct  33    FLFGAATSSYQIEGAYLEDGKGLSNWDVFTHTQSREINDGRNGDVADDHYHRYMEDVEIM  92

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGVNS++FSISW+RVLP+GR G +N   I +Y  LI +LL KGIEPFVT++H+DLP E
Sbjct  93    HNLGVNSYRFSISWARVLPRGRLGGVNSAAIAFYNRLIAALLEKGIEPFVTLHHFDLPHE  152

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ R+ GWL   ++EE+ Y+ADVCFK  GD+VK+W T NEPN++   AY    +      
Sbjct  153   LETRHGGWLGAGIREEFGYYADVCFKAFGDRVKFWTTLNEPNLFTKFAYMLGQYPPKHCS  212

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G C+ G++ ++ ++ AHNMI++HAAAV+ Y++NYQ  QGG IGI +   W+ P+TNS
Sbjct  213   PPFGTCNSGDSRREPYVAAHNMIMSHAAAVDNYKRNYQATQGGSIGIVIAMKWYEPLTNS  272

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA +F  +WFLDPI +G YP+EM+++L S+LP F+S + ++L    +DFIG+
Sbjct  273   TEDILAARRALAFEVDWFLDPIFFGDYPREMREMLSSNLPTFTSEE-KRLLQSKADFIGV  331

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC+ S C+  S  GN   +  VG+   ++G  IG  T  P     P GME 
Sbjct  332   NHYTAIYAKDCIASPCNIKSYEGNALVQA-VGE---RDGVAIGRPTAFPGYYDVPEGMEL  387

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y  +++ + P+YVTE G+   +  ++S+E++++D  RV  L  YL  + +A+R+GA+
Sbjct  388   IVKYVNQRYENAPVYVTENGFSQFS--DNSMEDLINDVGRVNCLQGYLTCISSAVRRGAN  445

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             VRGYF+WSL DNFEW  G+T R GLY  D  TQ+RTPK+S KWY+ F+  +  VD     
Sbjct  446   VRGYFVWSLMDNFEWGFGFTVRFGLYYVDFETQERTPKMSGKWYRDFLTGSVLVDQAQTL  505

Query  329   R  327
             R
Sbjct  506   R  506



>ref|XP_007147745.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
 gb|ESW19739.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
Length=451

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/416 (54%), Positives = 306/416 (74%), Gaps = 11/416 (3%)
 Frame = -3

Query  1586  KEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTIN  1407
             +ED DL+  +GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+LL +GIEPFVTI+
Sbjct  24    QEDVDLMDYIGVNSYRFSLSWARILPKGRFGKVNRAGIDYYNRLIDTLLSRGIEPFVTIS  83

Query  1406  HYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL  1227
             HYD+PQELQ+RY+GWLSP + E++ Y+AD+CFK+ GD+VKYWITFNEPN+  I  YR  +
Sbjct  84    HYDIPQELQERYEGWLSPNIAEDFKYYADICFKNFGDRVKYWITFNEPNVAFICGYRKGI  143

Query  1226  WPHGNCS--------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFT  1071
             WP G CS         G++ ++ FI   N++L+HA AV++YR  YQ+ QGG+IG+ M   
Sbjct  144   WPPGRCSGSFGNCTNGGDSEREPFIAGSNLLLSHATAVHLYRTKYQKIQGGKIGLVMHTM  203

Query  1070  WFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKA  891
             WF P++NS+ DK AAERA SF  NWFLDP++ G YP+EM++ILG  LP     +LEKLK 
Sbjct  204   WFEPISNSSEDKIAAERAQSFFMNWFLDPVIRGEYPREMREILGEDLPPV-PYNLEKLKP  262

Query  890   GGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAV  711
                DFIG+NHYT+Y+ +DC++S C+P + G+TR EGF  +    NG  IGE T L +L V
Sbjct  263   -AIDFIGVNHYTSYFVKDCIHSVCEPGL-GSTRTEGFALKLAKMNGMSIGEPTSLHWLYV  320

Query  710   YPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGT  531
             YP GME++VTY KE++ +IP+++TE G       N + +E+++D +RV++L  YL ++ T
Sbjct  321   YPQGMEKIVTYIKERYNNIPMFITENGVGMRENSNLTTKEMINDVERVEYLRAYLDSLAT  380

Query  530   AIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             AIRKGADVRGYF+WSL DNFEWT G + R GL++ D  T +RTP++SA WYK FIA
Sbjct  381   AIRKGADVRGYFLWSLLDNFEWTEGSSIRFGLHRVDYDTLQRTPRMSASWYKNFIA  436



>gb|KEH38761.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=529

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 231/466 (50%), Positives = 317/466 (68%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DGKGLSNWD FSH PG I +  NGD+A D Y  Y ED  L++
Sbjct  41    FLFGTSTSSYQIEGAAFEDGKGLSNWDKFSHTPGMINNDENGDIANDHYHRYLEDIKLMS  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +G+IN  G+ +Y NLID+LLL+GIEPFVTI+H DLP+EL
Sbjct  101   SLGINVYRFSISWTRILPRGIYGDINPSGVMFYNNLIDNLLLRGIEPFVTIHHQDLPEEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS-  1206
             + RY GWLSP +Q ++ +FA++CFK  GD+VKYW+T NEPN+ A   +    +P G+CS 
Sbjct  161   EQRYGGWLSPLIQRDFVHFAEICFKSFGDRVKYWVTINEPNLVADFGFMRGTYPPGHCSP  220

Query  1205  ------EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
                    GN+  +  +  HNM+L+HA AV++YRK YQ +QGG IGI      + P+ +  
Sbjct  221   PFGNCYTGNSDVEPLLAMHNMLLSHAKAVDLYRKQYQAKQGGTIGIVAHTFMYEPLRDEE  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F+  W LDP+++G YP +M+ ILGS LP FSS +   L+ G  DFIGIN
Sbjct  281   CDRQAANRALAFVIGWLLDPLVFGEYPADMRSILGSQLPRFSSKEKSLLR-GSLDFIGIN  339

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y   YA+DC  STC   +      +GF+  +  ++G  IG+ TG+ +  V P GME++V
Sbjct  340   NYGALYAKDCYLSTC--PLEAARPIKGFLQTTGMRDGIPIGDQTGMKWFFVVPKGMEKIV  397

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K K+ ++P+Y+TE GY        ++ ++LHD KR+++   YL A+  A+RKGADVR
Sbjct  398   DYIKIKYHNMPMYITENGYSSPLNAGMTMNDLLHDFKRIEYHKAYLAALLRAMRKGADVR  457

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY +WSLFDNFEW SGY K+ GLY  DR T +R PKLS +W+  F+
Sbjct  458   GYMVWSLFDNFEWNSGYDKKFGLYYVDRQTLERIPKLSVEWFSSFL  503



>ref|XP_008454703.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=480

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 314/469 (67%), Gaps = 12/469 (3%)
 Frame = -3

Query  1712  QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  1533
             Q EG YL DGKGLSNWDVFSH PG I +   GDVA D Y  + ED +L+ S+G+NS++FS
Sbjct  3     QIEGAYLEDGKGLSNWDVFSHLPGRIRNNDTGDVADDHYHRFLEDIELMHSMGMNSYRFS  62

Query  1532  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSP  1353
             ISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  RY  W+S 
Sbjct  63    ISWTRILPKGRFGKVNRRGIAFYNKIIDNLLLKGIEPFVTIHHHDLPAELDKRYGSWMSA  122

Query  1352  EMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------PHGNCSEGNA  1194
             EMQE++ YFA +CF+  GD+VKYWIT NEPN+  +  Y   ++       P GNCS GNA
Sbjct  123   EMQEDFVYFAKICFEEFGDRVKYWITINEPNVITLMGYTKGVYPPGHCSPPFGNCSIGNA  182

Query  1193  TKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAH  1014
               +  IV HNM+LAHA AV +Y  ++Q++QGG IGI      + P+T+   D  AAERA 
Sbjct  183   DIEPLIVMHNMLLAHAKAVRLYCTHFQKKQGGSIGIVAYGHMYEPLTDHEYDIKAAERAF  242

Query  1013  SFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEK-LKAGGSDFIGINHYTTYYAQD  837
              F+  W  DPI+YG YPKEM++ILGS LP FS  D+EK +  G  DF+ +NHYTT+Y +D
Sbjct  243   IFIFAWVYDPIVYGDYPKEMQEILGSQLPSFS--DIEKNIIRGSLDFVCVNHYTTFYTKD  300

Query  836   CLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPD  657
             CL+S C  S  G+    G++  +  ++G  IG+ TG+    V P G+ +V+ Y KE++P+
Sbjct  301   CLHSPC--SDGGDHAITGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYPN  358

Query  656   IPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFD  477
              P++VTE GY       +++E+++ DTKRV +  DYL ++  A+R GADVRGYF+WSL D
Sbjct  359   KPIFVTENGYSMPQAEGNNVEDLIKDTKRVNYHKDYLASLAKAMRDGADVRGYFVWSLID  418

Query  476   NFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             NFEW  GY  R GL   DR T +R PKLSA W+  F+  N    +K  S
Sbjct  419   NFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKYSS  467



>ref|XP_010644221.1| PREDICTED: beta-glucosidase 18-like [Vitis vinifera]
 emb|CBI20347.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   487 bits (1254),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 234/471 (50%), Positives = 323/471 (69%), Gaps = 11/471 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++S+YQ EG +L DGK LSNWDVFSH PG I  G NGDVA D Y  Y ED +L+ 
Sbjct  37    FLFGTATSAYQIEGAFLEDGKTLSNWDVFSHIPGKIERGENGDVAVDHYHRYLEDIELMH  96

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISW+RVLP+GR G+IN  G+++Y  +ID LLLKGIEPFVTI+H+D+PQEL
Sbjct  97    SLGVNAYRFSISWARVLPRGRFGSINPAGVEFYNKIIDCLLLKGIEPFVTISHHDIPQEL  156

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHG----  1215
             +  Y G+LSP +Q+++  FA  CF++ GD+VKYW TFNEPN++A   Y   ++P G    
Sbjct  157   EHGYGGFLSPLVQDDFVLFAKTCFENYGDRVKYWTTFNEPNIYADMGYIRGVYPPGHCLE  216

Query  1214  ---NCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
                NCS GN+ ++  +V HNM+++HA A  IYR+ YQ +QGG IG+ +    + P+++  
Sbjct  217   PYHNCSAGNSEREPLLVVHNMLISHAKAAYIYRERYQLKQGGSIGVVVHAFMYEPISDQE  276

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F   W LDP++ G YP EM  +LG ++P+FS  +L+K+K G  DFIGIN
Sbjct  277   CDREAASRALAFNIAWVLDPLLNGDYPPEMYRLLGENMPKFSPDELKKIK-GSIDFIGIN  335

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY++ YA++C YS   PS  G    +GFV  +  ++G  IGE T +P   V P G+E+++
Sbjct  336   HYSSLYAENCSYS---PSKLGCQAIKGFVYTTGERDGVPIGEETAIPRFYVVPSGLEKLI  392

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ + P++VTE G      P      +L+DTKRV++   YL ++  AIRKGADVR
Sbjct  393   DYLKTRYNNKPIFVTENGLSQMDQPEERNRVLLNDTKRVEYHKGYLASLAQAIRKGADVR  452

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQK  351
             GYF+WSL DNFEWT+GY+ R GLY  D  T  R PK S+KWY  F++ N +
Sbjct  453   GYFVWSLLDNFEWTNGYSIRFGLYYVDYKTLCRIPKFSSKWYTSFLSYNSQ  503



>ref|XP_004147833.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=514

 Score =   486 bits (1252),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 313/469 (67%), Gaps = 12/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG S+SSYQ EGGYL DGKG+SNWDVFSH PG I +   GDVA D Y  + ED +L+
Sbjct  38    HFFFGASTSSYQIEGGYLEDGKGISNWDVFSHIPGKITNNDTGDVADDHYHRFLEDIELM  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+N+++FSISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P E
Sbjct  98    HSMGLNAYRFSISWTRILPRGRFGKVNKGGINFYNKIIDNLLLKGIEPFVTIYHFDYPME  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY+ W+S +MQ+++  FA VCF+  GD+VKYW+T NEP M AI  YR   +      
Sbjct  158   LERRYESWMSSQMQDDFVEFAKVCFEEFGDRVKYWMTINEPEMVAILGYRMGSFPPAHCS  217

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G CS GN+ ++  IV HN +LAHA AV++YR ++Q +QGG IGI +    + P+   
Sbjct  218   PPFGKCSMGNSDREPLIVVHNQLLAHAKAVSLYRTHFQVKQGGSIGITISIQMYEPLDQQ  277

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D  A +R  +F   W  DPI+YG YPKEM++ILGS LP FS  D   +K G  DFI I
Sbjct  278   S-DTQAVDRILAFYVGWIYDPIVYGDYPKEMREILGSELPSFSDEDKRYIK-GSLDFISI  335

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC +S+C   +  N     FV  +  +NG  IG+  G+P L V P GME+V
Sbjct  336   NHYTTKYAKDCFHSSCPDEV--NRPINAFVETTPYRNGILIGDPMGIPGLYVVPRGMEKV  393

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K+++P+  ++VTE GY    +  + +E +L+D KR+KF   YL A+  A+R G DV
Sbjct  394   INYIKQRYPNHSIFVTENGYSMRPSDGNKVETILNDWKRIKFHKSYLAALARAMRNGGDV  453

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDR-ATQKRTPKLSAKWYKQFIA  363
             RGYFIWSL DNFEW  GY  R GL+  D   T +R PKLSA W+  F+ 
Sbjct  454   RGYFIWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFASFLG  502



>gb|KGN59899.1| hypothetical protein Csa_3G852480 [Cucumis sativus]
Length=518

 Score =   486 bits (1252),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 313/469 (67%), Gaps = 12/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG S+SSYQ EGGYL DGKG+SNWDVFSH PG I +   GDVA D Y  + ED +L+
Sbjct  42    HFFFGASTSSYQIEGGYLEDGKGISNWDVFSHIPGKITNNDTGDVADDHYHRFLEDIELM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+N+++FSISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P E
Sbjct  102   HSMGLNAYRFSISWTRILPRGRFGKVNKGGINFYNKIIDNLLLKGIEPFVTIYHFDYPME  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY+ W+S +MQ+++  FA VCF+  GD+VKYW+T NEP M AI  YR   +      
Sbjct  162   LERRYESWMSSQMQDDFVEFAKVCFEEFGDRVKYWMTINEPEMVAILGYRMGSFPPAHCS  221

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G CS GN+ ++  IV HN +LAHA AV++YR ++Q +QGG IGI +    + P+   
Sbjct  222   PPFGKCSMGNSDREPLIVVHNQLLAHAKAVSLYRTHFQVKQGGSIGITISIQMYEPLDQQ  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             + D  A +R  +F   W  DPI+YG YPKEM++ILGS LP FS  D   +K G  DFI I
Sbjct  282   S-DTQAVDRILAFYVGWIYDPIVYGDYPKEMREILGSELPSFSDEDKRYIK-GSLDFISI  339

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT YA+DC +S+C   +  N     FV  +  +NG  IG+  G+P L V P GME+V
Sbjct  340   NHYTTKYAKDCFHSSCPDEV--NRPINAFVETTPYRNGILIGDPMGIPGLYVVPRGMEKV  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K+++P+  ++VTE GY    +  + +E +L+D KR+KF   YL A+  A+R G DV
Sbjct  398   INYIKQRYPNHSIFVTENGYSMRPSDGNKVETILNDWKRIKFHKSYLAALARAMRNGGDV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDR-ATQKRTPKLSAKWYKQFIA  363
             RGYFIWSL DNFEW  GY  R GL+  D   T +R PKLSA W+  F+ 
Sbjct  458   RGYFIWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFASFLG  506



>ref|XP_004158044.1| PREDICTED: beta-glucosidase 47-like [Cucumis sativus]
Length=468

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/415 (55%), Positives = 311/415 (75%), Gaps = 10/415 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQ+EG +LSDGKGLSNWDVF+H+PGNI DG+NGDVA DQY LY+ED DL+
Sbjct  42    DFLFGTASSAYQFEGAFLSDGKGLSNWDVFTHEPGNIKDGTNGDVAVDQYHLYQEDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LP+GR G +N  GI +Y  LIDSLL +GIEPFVT+ HYD+PQ+
Sbjct  102   EFIGVNSYRFSISWARILPEGRFGEVNHAGIDHYNKLIDSLLKRGIEPFVTLTHYDIPQK  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+D+Y  WLSP +QE++ Y+AD+CFK  G++VKYW+TFNEPN+  I  YR   +P     
Sbjct  162   LEDKYGAWLSPLVQEDFRYYADICFKSFGNRVKYWVTFNEPNVQVIRGYRKGTFPPSRCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ F+ AHN+IL+HAAAVN YR  YQ +QGG IGI +   WF P+++S
Sbjct  222   SSFGNCSSGDSEREPFVAAHNIILSHAAAVNTYRSKYQAKQGGLIGIVVNAVWFEPISDS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A+ERA SF  NWFLDPI++G+YP  M++ILG  LP FS+ D +KLK  G+DFIGI
Sbjct  282   FKDILASERALSFYMNWFLDPIVFGNYPAVMEEILGLDLPNFSTEDQKKLK-NGADFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YYA+DCL+S+C+P   G+++ EGFV  +  K    IGE T + ++ V P GM ++
Sbjct  341   NHYTSYYAKDCLHSSCEPG-QGSSKIEGFVFWTPMKEEILIGEPTEISWIYVNPQGMNKM  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             VTY KE++ ++P++VTE GY     PN+  E++L DT R+ ++  YL A+ T++R
Sbjct  400   VTYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTGRIDYMRSYLGALETSMR  453



>ref|XP_004160619.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=527

 Score =   486 bits (1251),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 232/484 (48%), Positives = 322/484 (67%), Gaps = 14/484 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFGTS+SSYQ EGGY+ DG+G SNWDVFSH PGNI +   GDVA D Y  + ED +++
Sbjct  38    HFFFGTSTSSYQIEGGYVEDGRGTSNWDVFSHIPGNIKNSDTGDVADDHYHRFMEDIEMM  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             +S+G+N+++FSISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP E
Sbjct  98    SSMGMNAYRFSISWTRILPKGRFGKVNRRGIVFYNKIIDNLLLKGIEPFVTIHHHDLPDE  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L  RY  W+S  MQE++ YFA +CFK  GD+VK+WIT NEPN+  +  Y   ++      
Sbjct  158   LDKRYGSWMSSHMQEDFVYFAKICFKEFGDRVKHWITINEPNLVTLMGYIKGVYPPAHCS  217

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQ----QQQGGEIGIAMLFTWFLP  1059
              P GNCS GN+  +  IV HNM+LAHA AV IYR  +Q    ++QGG IG+      + P
Sbjct  218   PPFGNCSVGNSDIEPLIVMHNMLLAHAKAVFIYRTQFQVYVVEKQGGSIGLVAYCHMYEP  277

Query  1058  MTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSD  879
             +TN+  D  A +RA  F   W  DPI+YG YPKEM+++ GS LP FS+T+   +K G  D
Sbjct  278   LTNNEFDLQAVDRALIFSFAWVYDPIVYGDYPKEMREVFGSQLPSFSNTEKNIIK-GSLD  336

Query  878   FIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             +I +NHYTT YA+DCL+S C  S  G+   +GF+     +N   IG+ TG+    V P G
Sbjct  337   YICVNHYTTLYAKDCLHSPC--SNGGDRPIKGFLDTMGYRNSVSIGDPTGMDRFFVVPRG  394

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             +E+ + Y  +++P+ P++VTE GY    +  + +E++++DTKRV F  +YL ++  A+R 
Sbjct  395   LEKTINYINQRYPNKPIFVTENGYSTPPSDGNKVEDIINDTKRVNFHRNYLASLVRAMRN  454

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             GADVRGYF+WSL DN EW  G+  R GL   D  T +R PKLSA W+   +  N +  S 
Sbjct  455   GADVRGYFVWSLMDNLEWIHGFNTRFGLVYVDFQTLERRPKLSAHWFASLLGGNLQHSSS  514

Query  338   MQSR  327
             + ++
Sbjct  515   ILNK  518



>ref|XP_003541849.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=532

 Score =   486 bits (1251),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/466 (50%), Positives = 312/466 (67%), Gaps = 10/466 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DG G SNWDVF H PG I +  NGD+A D Y  Y ED +L++
Sbjct  41    FLFGTSTSSYQIEGAPFEDGSGTSNWDVFCHTPGKINNDENGDIADDHYHRYLEDIELMS  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL
Sbjct  101   SLGVNVYRFSISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++ Y GW+SP +Q ++ +FA++CFK  GD+VKYW T NEPN ++  AY   ++       
Sbjct  161   EEIYGGWISPLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYPPGRCSP  220

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC  GN+  +  I  HNM+L+HA AV++YRK++Q +QGG IGI      F P+ +  
Sbjct  221   PFGNCKTGNSDVEPLIALHNMLLSHAKAVDLYRKHFQAKQGGTIGIVADSLMFEPLRDEE  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F     LDP+++G YP EM+ ILGS LP FS  + + L  G  DFIGIN
Sbjct  281   CDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSPKE-KSLIKGSLDFIGIN  339

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY T YA+DC  STC  S+  +    GFV  + ++NG  IGE TG+    V P G+E++ 
Sbjct  340   HYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPTGIAQFFVVPRGVEKLA  397

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ +IP+Y+TE GY     P+ +I + L D KR+ +   YL A+  +IRKGADVR
Sbjct  398   DYIKMRYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGADVR  457

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             GY IWSL DNFEW SGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  458   GYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFL  503



>ref|XP_008454668.1| PREDICTED: beta-glucosidase 18-like [Cucumis melo]
Length=519

 Score =   485 bits (1249),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 319/469 (68%), Gaps = 12/469 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG S+SSYQ EGGYL DGKG+SNWDVFSH PG I++   GDVA D Y  Y ED +L+
Sbjct  45    HFFFGASTSSYQIEGGYLEDGKGISNWDVFSHTPGKIINNDTGDVADDHYHRYLEDIELM  104

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              S+G+N+++FSISW+R+LP+GR G +N  GI +Y  +ID+LLLKGIEPFVTI H+D P E
Sbjct  105   HSMGMNAYRFSISWTRILPRGRLGKVNKRGINFYNKIIDNLLLKGIEPFVTIYHFDYPME  164

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY+ W+S +M++++  FA++CF+  GD+VKYW+T NEP M AI  Y+   +      
Sbjct  165   LETRYESWMSSQMKDDFVDFANICFEEFGDRVKYWMTINEPEMVAILGYKKGNFPPAHCS  224

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+ ++  IV HN +LAHA AV++YR ++Q++QGG IGI +    + P+ + 
Sbjct  225   PPFGNCSMGNSDREPLIVMHNQLLAHAKAVSLYRTHFQEKQGGSIGITISMQMYEPL-DQ  283

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
              +D+ AA+R  +F   W  DPI+YG YPK+M++ILGS LP FS  D + +K G  DFI I
Sbjct  284   QLDRKAADRFLAFHVGWIYDPIVYGDYPKKMREILGSELPSFSDEDKKYIK-GSLDFISI  342

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT Y +DC +S+C  +   N     F   +  +NG  IG+  G+P L V P GME+V
Sbjct  343   NHYTTKYVKDCFHSSC--TDEANRPINAFTETTPYRNGILIGDQMGMPGLYVVPRGMEKV  400

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K+K+P+  ++VTE GY   T+  + +E++++D KR+KF   YL A+  A+R G  V
Sbjct  401   INYIKQKYPNQSIFVTENGYSMPTSDGNKVEDIVNDWKRIKFHKSYLAALAKAMRNGGHV  460

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDR-ATQKRTPKLSAKWYKQFIA  363
             RGYF WSL DNFEW  GY  R GL+  D   T +R PKLSA W+  F+ 
Sbjct  461   RGYFAWSLMDNFEWIRGYDTRFGLFYVDHLKTLERRPKLSAHWFTSFLG  509



>dbj|BAJ92008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   484 bits (1247),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 327/481 (68%), Gaps = 15/481 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL DGKGLSNWDVF+H Q   I DG NGD+A D Y  Y ED +++
Sbjct  30    FLFGVATSAYQIEGAYLEDGKGLSNWDVFTHTQSRKIKDGRNGDIADDHYHRYMEDVEIM  89

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +LGV+S++FSISWSR+LP+GR G +N  GI +Y  LI  LL KGIEPFVT++H+++PQE
Sbjct  90    HNLGVDSYRFSISWSRILPRGRLGGVNSAGIAFYDRLIAELLQKGIEPFVTLHHFEMPQE  149

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L  RY GWL   ++EE+ Y+ADVCFK  G++VK+W TFNEPN++A  AY    +      
Sbjct  150   LGTRYGGWLGVGIREEFGYYADVCFKAFGNRVKFWTTFNEPNLFAKLAYMLGNYPPAHCS  209

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC+ G++ ++ ++ AHNM+L+HAAAV+ Y++NYQ  QGG IGI +   W+ P+TNS
Sbjct  210   PPFGNCNSGDSHREPYVAAHNMLLSHAAAVDNYKRNYQATQGGSIGIVIAMKWYEPLTNS  269

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF  +WFL+PI +G YP+EM ++L S+L +F+S +   L+   +DFIGI
Sbjct  270   TEDILAARRALSFEVDWFLEPIFFGDYPREMHEMLSSNLLKFTSEEKRLLQKNKADFIGI  329

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSL-SKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC+ S C+      T E   + Q+L  ++G  IG  T L      P GME 
Sbjct  330   NHYTAIYAKDCISSPCNVE----TYEGNALVQALGERDGVEIGRPTALHGYYDVPEGMEL  385

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +V Y  +++ + P+YVTE GY   +  N+S+E +++D  RV +L  YL ++ +A+R+GA+
Sbjct  386   IVKYVNQRYKNTPVYVTENGYSQFS--NNSMEGLINDVGRVNYLQGYLTSISSAVRRGAN  443

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             V GYF+WSL DNFEW  G+T R GLY  D  T +RTPK+S KWY+ F+  ++ VD     
Sbjct  444   VSGYFVWSLMDNFEWFFGFTVRFGLYHVDFETCERTPKMSGKWYRDFLTCSRPVDQARTL  503

Query  329   R  327
             R
Sbjct  504   R  504



>ref|XP_004153110.1| PREDICTED: beta-glucosidase 47-like [Cucumis sativus]
Length=469

 Score =   483 bits (1243),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 226/415 (54%), Positives = 310/415 (75%), Gaps = 10/415 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQ+EG +LSDGKGLSNWDVF+H+PG I DG+NGDVA DQY LY+ED DL+
Sbjct  42    DFLFGTASSAYQFEGAFLSDGKGLSNWDVFTHEPGTIKDGTNGDVAVDQYHLYQEDLDLM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               +GVNS++FSISW+R+LP+GR G +N  GI +Y  LIDSLL +GIEPFVT+ HYD+PQ+
Sbjct  102   EFIGVNSYRFSISWARILPEGRFGEVNRAGIDHYNKLIDSLLKRGIEPFVTLTHYDIPQK  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+D+Y  WLSP +QE++ Y+AD+CFK  G++VKYW+TFNEPN+  I  YR   +P     
Sbjct  162   LEDKYGAWLSPLVQEDFRYYADICFKSFGNRVKYWVTFNEPNVQVIRGYRKGTFPPSRCS  221

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++ ++ F+ AHN+IL+HAAAVN YR  YQ +QGG IGI +   WF P+++S
Sbjct  222   SSFGNCSSGDSEREPFVAAHNIILSHAAAVNTYRSKYQAKQGGLIGIVINAVWFEPISDS  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  A+ERA SF  NWFLDPI++G+YP  M++ILG  LP FS+ D +KLK  G+DFIGI
Sbjct  282   FKDILASERALSFYMNWFLDPIVFGNYPAVMEEILGLDLPNFSTEDQKKLK-NGADFIGI  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YYA+DCL+S+C+P   G+++ EGFV  +  K    IGE T + ++ V P GM ++
Sbjct  341   NHYTSYYAKDCLHSSCEPG-QGSSKIEGFVFWTPMKEEILIGEPTEISWIYVNPQGMNKM  399

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIR  522
             VTY KE++ ++P++VTE GY     PN+  E++L DT R+ ++  YL A+ T++R
Sbjct  400   VTYIKERY-NVPIFVTENGYGQKNKPNNQTEDLLDDTGRIDYMRSYLGALETSMR  453



>gb|KHN28049.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   485 bits (1248),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 236/477 (49%), Positives = 319/477 (67%), Gaps = 12/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT +SSYQ EG  L DGKGLSNWDVFSH PGNI +  NGD+A D Y  Y ED +L++
Sbjct  38    FLFGTCTSSYQIEGAPLEDGKGLSNWDVFSHIPGNINNDENGDIADDHYHRYLEDIELMS  97

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N ++FSISW+R+LP+G +G+IN  G+ +Y  +ID+LLL+GIEPFVTI+H+D P EL
Sbjct  98    SLGINVYRFSISWARILPRGIYGDINPSGVMFYNKIIDNLLLRGIEPFVTIHHHDYPGEL  157

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY  WLSP +Q ++ +FA+VCFK  GD+VKYW T NEPN++A   +    +       
Sbjct  158   EERYGAWLSPLIQRDFVHFAEVCFKSFGDRVKYWATINEPNLFADMGFIRGTYPPGHCSP  217

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  I  HNMIL+HA AV +YRK++Q +QGG IGI      + P+ +  
Sbjct  218   PFGNCNTGNSDVEPLIAVHNMILSHAKAVELYRKHFQAKQGGIIGIVTHTFMYEPLRDEE  277

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A +RA +F+  W LDP+++G YP EM  ILGS LP FS  + + L  G  DFIGIN
Sbjct  278   CDRQAVKRALAFVVAWSLDPLVFGDYPPEMHSILGSQLPRFSPEE-KSLIKGSIDFIGIN  336

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             +Y T YA+DC  + C        R  GFV  + +++G  IG+LTG P   V P G+E++V
Sbjct  337   NYGTLYAKDCSLTACPLGTDRPIR--GFVEATGTRDGIPIGDLTGNPRFFVVPRGLEKIV  394

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ ++P+Y+TE GY     PN +++++L D KR+ +   YL A+  AIRKGADVR
Sbjct  395   DYIKIRYHNMPMYITENGYSSPHKPNVTMDDLLQDFKRIDYHKAYLAALLRAIRKGADVR  454

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQ  333
             GY IWSL DNFEWTSGY  R GLY  DR T +R PK S +W+  F+  N  + S  Q
Sbjct  455   GYMIWSLMDNFEWTSGYGVRYGLYYVDRHTLERIPKRSVQWFSSFL--NDTIHSNKQ  509



>gb|KGN59900.1| hypothetical protein Csa_3G852490 [Cucumis sativus]
Length=545

 Score =   485 bits (1248),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 312/470 (66%), Gaps = 10/470 (2%)
 Frame = -3

Query  1718  SYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHK  1539
             +Y+ EG YL DGKGLSNWDVFSH P  I +   GDVA D Y  + ED +L+ S+G+NS++
Sbjct  66    NYKVEGAYLEDGKGLSNWDVFSHLPARIRNSDTGDVADDHYHRFLEDIELMHSMGMNSYR  125

Query  1538  FSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWL  1359
             FSISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  RY  W+
Sbjct  126   FSISWTRILPKGRFGKVNRRGIAFYNKIIDNLLLKGIEPFVTIHHHDLPAELDKRYGSWM  185

Query  1358  SPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------PHGNCSEG  1200
             S +MQE++ YFA +CF+  GD+VKYWIT NEPN+  +  Y   ++       P GNCS G
Sbjct  186   SAQMQEDFVYFAKICFEEFGDRVKYWITINEPNVITLMGYTKGVYPPGHCSPPFGNCSTG  245

Query  1199  NATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAER  1020
             NA  +  +V HNM+LAHA AV +YR ++Q++QGG IGI      + P+T+   D  AA+R
Sbjct  246   NADIEPLVVMHNMLLAHAKAVRLYRTHFQKKQGGSIGIVAYCHMYEPLTDHEYDIKAAQR  305

Query  1019  AHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQ  840
             A  F+  W  DPI+YG YPKEM++ILGS LP FS  + + ++ G  DFI +NHYTT+Y +
Sbjct  306   ALIFIFAWVYDPIVYGDYPKEMREILGSQLPSFSDVEKDIIR-GSLDFICVNHYTTFYTK  364

Query  839   DCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFP  660
             DCL+S C     GN    G++  +  ++G  IG+ TG+    V P G+ +V+ Y KE++P
Sbjct  365   DCLHSAC--FGGGNHPVTGYLNTTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYP  422

Query  659   DIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLF  480
             + P++VTE GY    +  +  E ++ DTKRV +  +YL ++  A+R GADVRGYF+WSL 
Sbjct  423   NKPIFVTENGYSSPQSEGNETEVLIKDTKRVNYHKNYLASLANAMRDGADVRGYFVWSLI  482

Query  479   DNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             DNFEW  GY  R GL   DR T +R PKLSA W+  F+  N    +K  S
Sbjct  483   DNFEWADGYDTRFGLLYVDRKTLERRPKLSAHWFSSFLGGNLHELTKYSS  532



>gb|KEH36818.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=418

 Score =   479 bits (1234),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/412 (55%), Positives = 298/412 (72%), Gaps = 9/412 (2%)
 Frame = -3

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + ++ VNS++FSISW+RVLPKGR G +N  GI YY  LID+LLLKGIEPFVT++H+DLPQ
Sbjct  1     MEAMKVNSYRFSISWARVLPKGRFGEVNSGGISYYNRLIDALLLKGIEPFVTLSHFDLPQ  60

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL DRY+GWLSPE QE++ Y AD+CFK  GD+VKYW TFNEP+      YR  +      
Sbjct  61    ELGDRYEGWLSPESQEDFVYLADLCFKSFGDRVKYWATFNEPDYLITYGYRKGIAPPFRC  120

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCSEG++ K+ ++  HN+IL+HAAA  IYR  YQ +QGG+IGI + F W+ P++N
Sbjct  121   SKPFGNCSEGDSEKEPYLAVHNIILSHAAAAYIYRTKYQAEQGGKIGIVLHFDWYEPISN  180

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             S  DK A ERA SF +NW LDPI++G YP  M+ ILG  LP+FS+ + EKLK+ G DFIG
Sbjct  181   SMADKLATERARSFTNNWLLDPIIFGEYPPVMQKILGDILPKFSNNNKEKLKS-GLDFIG  239

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHY +YY +DC+YS C+P   G TR EG   QS  K+G  IG+ T + +  VYP GME+
Sbjct  240   INHYASYYIKDCIYSKCEPG-PGITRTEGLFQQSAEKDGVPIGKPTSIDWQYVYPQGMEK  298

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             +VTY K ++ + P+++TE GY +   PN++ E+ L+D  R  ++A +L ++  AIRKGAD
Sbjct  299   IVTYVKTRYNNTPMFITENGYGELDNPNNTEEQYLNDFDRKNYMAGHLLSLLEAIRKGAD  358

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             VRGYF WSL DNFEW  GYT R GL+  D AT KRTP+LSA WYK+FIAK++
Sbjct  359   VRGYFAWSLLDNFEWLQGYTVRFGLHHVDYATLKRTPRLSANWYKEFIAKHK  410



>ref|XP_007212382.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
 gb|EMJ13581.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
Length=473

 Score =   481 bits (1239),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 313/470 (67%), Gaps = 54/470 (11%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ                             NGD+A DQY LY ED DL+
Sbjct  42    NFLFGTASSSYQI----------------------------NGDIAVDQYHLYLEDLDLM  73

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             + +GVN+ +FSISW+RVLPKGR G +N  GI +Y   ID+LL +                
Sbjct  74    SYIGVNTCRFSISWARVLPKGRFGEVNRAGIDHYNKFIDTLLRR----------------  117

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
               D Y  WLSP++QE++ ++A++CF   GD+VKYW+TFNEPN+  I  YR  ++P     
Sbjct  118   --DIYGAWLSPKVQEDFKHYANICFNFFGDRVKYWVTFNEPNVAVIHGYRSGIYPPSRCS  175

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC+ G++ K+ FI AHN+IL+HAAAVNIYR  YQ++QGG IG+ M   WF P++NS
Sbjct  176   SPFGNCTSGDSEKEPFIAAHNIILSHAAAVNIYRTKYQKKQGGSIGMVMNAVWFEPISNS  235

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               DK AAERA SF  NW LDPI++G YP EM +ILG+ LP FS +D+E L+    DFIGI
Sbjct  236   LEDKLAAERAQSFYMNWLLDPIVHGRYPAEMHEILGADLPIFSESDVEMLRKNRLDFIGI  295

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++Y +DC++S C+P   G +R EGF  Q+  K+G F+GE T + +L VYP GM+++
Sbjct  296   NHYTSFYVKDCIFSECEPG-PGASRTEGFTLQTAEKDGVFLGEPTSVDWLYVYPQGMDKI  354

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY K+++ + P+++TE G+ +T   NS+ EE+L+D KRV+++  YLHA+  A+RKGADV
Sbjct  355   VTYVKDRYNNTPIFITENGFGETEISNSTNEELLNDAKRVEYMRSYLHALAEAMRKGADV  414

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF+WSL DNFEWTSGYT   GL+  D AT KRT +LSA WYK FI+ +
Sbjct  415   RGYFVWSLLDNFEWTSGYTVCFGLHHVDYATLKRTQRLSAAWYKTFISNH  464



>ref|XP_009630283.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=539

 Score =   483 bits (1244),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 236/478 (49%), Positives = 317/478 (66%), Gaps = 20/478 (4%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+S+YQ EG Y+ DG+ LSNWDVFSH  G+I +G NGDVA D Y  Y ED D++
Sbjct  47    SFLFGTSTSAYQIEGAYIEDGRSLSNWDVFSHTNGSITNGGNGDVADDHYHSYLEDIDIM  106

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVN+++FSISWSRVLP+G+ G +N  GIK+Y N+ID+LLLKG+ PFVTI+H D PQE
Sbjct  107   ASLGVNAYRFSISWSRVLPRGKLGAVNPAGIKFYNNIIDNLLLKGVAPFVTIHHNDFPQE  166

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP MQEE+ +FA+ CFK  GD+VKYW T NEPN++A  AY   ++      
Sbjct  167   LEDRYGAWLSPLMQEEFVHFAETCFKGFGDRVKYWATINEPNLFAELAYMNGVFPPSHCS  226

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G CS GN+  +  +V HN ILAHA AV +YR ++Q +QGG IG+      + P+T+ 
Sbjct  227   PPFGKCSSGNSDIEPLLVVHNSILAHAKAVKLYRHHFQAEQGGMIGMVASAYMYKPITDD  286

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AA RA +F   W LDP++YG YP EM++  G  LP+FSS + ++L    +DFIG+
Sbjct  287   EADIKAAARALTFHVAWLLDPLVYGDYPTEMREYHGRKLPKFSSEE-KRLIKNSTDFIGL  345

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLS-----------KNGNFIGELTGLPY  720
             NHY+T   +DCL S C  +M+ N       G++ +           ++G F+G+  G+P 
Sbjct  346   NHYSTLLVKDCLLSNCPCNMNDNNNPTCSHGENRAILGFLLTTGQNEDGAFVGDPMGMPG  405

Query  719   LAVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHA  540
             L V P G+E +V Y K+++ ++P+ VTE GY           E++ D KR+K+   YL +
Sbjct  406   LYVVPQGIEEIVDYIKKRYNNMPIIVTENGYASIDKQEEGY-ELVKDMKRIKYHKAYLAS  464

Query  539   VGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             +  +IR GADVRGYFIWSL DNFEW  GYT + GLYQ +  T  R PKLSA WYK F+
Sbjct  465   LARSIRNGADVRGYFIWSLMDNFEWIFGYTIKFGLYQVNPLTLDRIPKLSAHWYKDFL  522



>ref|NP_001148165.1| beta-glucosidase precursor [Zea mays]
 gb|ACG29990.1| beta-glucosidase [Zea mays]
Length=510

 Score =   482 bits (1241),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 310/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVFSH PG I DGS GDVA D Y  Y++D +L+
Sbjct  40    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELM  99

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+R+LP+GR G +N  GI +Y  LIDSLLLKGIEPFVT++HYD+PQE
Sbjct  100   HSLGTNAYRFSISWARILPRGRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQE  159

Query  1385  LQDRYQGWL-SPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             L+DRY  WL   E + ++ + ADVCF   GD+V++W TFNEPN+     Y    +P G C
Sbjct  160   LEDRYGAWLGGAEARRDFGHLADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYPPGRC  219

Query  1208  S----EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTV  1041
             S     GN+  + ++ AHN++LAHAAAV IY+  YQ +Q G IGI M   WF+P+T++  
Sbjct  220   SRSCARGNSDAEPYVAAHNVVLAHAAAVQIYKTKYQSKQKGLIGIVMSTVWFVPLTDAPA  279

Query  1040  DKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINH  861
             D+ A ERA +F   WFLDPI+YG YP EM+ +LGS LP FS  +  KL   G DFIGINH
Sbjct  280   DRLATERALAFDVPWFLDPIIYGDYPPEMRRLLGSRLPTFSPEERRKLSY-GLDFIGINH  338

Query  860   YTTYYAQDCLYST--CDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             YTT YA+DC++S   C    SG    +     +  ++G  IG  T +P   V P G+E++
Sbjct  339   YTTLYARDCMFSPGYCP---SGQEFHQSLAAYTGERDGIPIGPPTAMPTFYVVPDGIEKM  395

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTP-NSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VTY   ++ ++P+++TE GY        +  E+ L D  R+++L  YL  +   I  GAD
Sbjct  396   VTYIMNRYSNLPMFITENGYAQGGDGYTTRAEDWLDDQGRIQYLEGYLAKLAKVISDGAD  455

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             VRGYFIWSL DNFEW  GYT R GL+  D  TQ+R PK SA WYK+F+
Sbjct  456   VRGYFIWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYKRFL  503



>ref|XP_006594783.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=533

 Score =   482 bits (1241),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 312/467 (67%), Gaps = 11/467 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DG G SNWDVF H PG I +  NGD+A D Y  Y ED +L++
Sbjct  41    FLFGTSTSSYQIEGAPFEDGSGTSNWDVFCHTPGKINNDENGDIADDHYHRYLEDIELMS  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN ++FSISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL
Sbjct  101   SLGVNVYRFSISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++ Y GW+SP +Q ++ +FA++CFK  GD+VKYW T NEPN ++  AY   ++       
Sbjct  161   EEIYGGWISPLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYPPGRCSP  220

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC  GN+  +  I  HNM+L+HA AV++YRK++Q +QGG IGI      F P+ +  
Sbjct  221   PFGNCKTGNSDVEPLIALHNMLLSHAKAVDLYRKHFQAKQGGTIGIVADSLMFEPLRDEE  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F     LDP+++G YP EM+ ILGS LP FS  + + L  G  DFIGIN
Sbjct  281   CDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSPKE-KSLIKGSLDFIGIN  339

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGE-LTGLPYLAVYPPGMERV  687
             HY T YA+DC  STC  S+  +    GFV  + ++NG  IGE  TG+    V P G+E++
Sbjct  340   HYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPQTGIAQFFVVPRGVEKL  397

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
               Y K ++ +IP+Y+TE GY     P+ +I + L D KR+ +   YL A+  +IRKGADV
Sbjct  398   ADYIKMRYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGADV  457

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             RGY IWSL DNFEW SGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  458   RGYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFL  504



>emb|CDP05879.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   483 bits (1243),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 311/474 (66%), Gaps = 16/474 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++SSYQ EG    DG+ LSNWDVF+H  GNI +G N D+A D Y  Y ED +++ 
Sbjct  52    FLFGVATSSYQVEGAVHEDGRSLSNWDVFAHTKGNIENGDNADIADDHYHRYLEDIEIMH  111

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGV+S++FS+SW R+LP+G+ G++N  GI +Y  +ID+LLL+GIEPF+TI+H+DLPQEL
Sbjct  112   SLGVDSYRFSVSWERILPRGKFGDVNPAGILFYNKIIDNLLLRGIEPFLTIHHHDLPQEL  171

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
              DRY GWLSP +QE++   A+ CFKH GD+V+YWIT NEPN+ +  AY    +       
Sbjct  172   MDRYGGWLSPLIQEDFVRLAEACFKHFGDRVRYWITINEPNLVSEFAYERGKYPPARCSP  231

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQ---QQQGGEIGIAMLFTWFLPMT  1053
             P GNCS GN+  +  IV HNM+LAHA AV +YR+ +Q    +QGG IG+ +    + P+T
Sbjct  232   PFGNCSAGNSDVEPLIVMHNMLLAHAKAVKLYREQFQASRAKQGGTIGLVVSTHMYEPLT  291

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +  +D+ AA R  +F   W  DP+++G YP EM+   GS LP F+S D  +L    SDF+
Sbjct  292   DDELDREAASRGLAFYVGWSFDPVVFGDYPPEMRRYHGSELPTFTS-DERQLMRDSSDFL  350

Query  872   GINHYTTYYAQDCLYSTC-----DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVY  708
             G+NHY T YA+DC++S+C       S  G+    GFV  +  ++G  IGE TG P   V 
Sbjct  351   GLNHYATLYAKDCIHSSCTCFVQSCSPGGDRAIRGFVSTTGFRDGVAIGEPTGNPRFFVV  410

Query  707   PPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTA  528
             P GME  V Y KE++ + P+++TE GY         ++++ HD KRV +   YL A+  A
Sbjct  411   PRGMEEAVDYIKERYHNKPMFITENGYSSPKGQQEQVDDLQHDIKRVAYHKSYLSALARA  470

Query  527   IRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             IR GADVRGYFIWSL DNFEWT GY  + GLY  DR T  R PK SAKWY+ F+
Sbjct  471   IRNGADVRGYFIWSLIDNFEWTDGYDIKFGLYAVDRVTMDRIPKSSAKWYRDFL  524



>ref|XP_007149594.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
 gb|ESW21588.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
Length=526

 Score =   481 bits (1237),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 312/475 (66%), Gaps = 10/475 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+SSYQ EG    DGKGLSNWDVFSH  G I +  NGD+A D Y  Y +D +L++
Sbjct  51    FLFGTSTSSYQIEGAAFEDGKGLSNWDVFSHLSGKINNNENGDIADDHYHRYLKDIELMS  110

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGV+ ++FSISW+R+LP+G +G++N  GI +Y  +ID+LLLKGIEPFVTINH+DLPQEL
Sbjct  111   SLGVDVYRFSISWTRILPRGIYGDVNPSGIMFYNMIIDNLLLKGIEPFVTINHHDLPQEL  170

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY GWLSP +Q ++ +FA++CFK  G +VKYW + NEP++  I  Y    +       
Sbjct  171   EERYGGWLSPLIQRDFVHFAEICFKSFGGRVKYWTSINEPSLVTINGYMKGTYPPGHCSP  230

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  IV HN +L+HA AV +YRK +Q +QGG IGI      + P  N  
Sbjct  231   PFGNCSTGNSDVEPLIVMHNRLLSHAKAVELYRKQFQAKQGGTIGIVAHTFMYEPFRNEE  290

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A +R  +F+  W LDP+++G YP EM  ILG+ LP FS  + ++L  G  DFIGIN
Sbjct  291   CDRQAVKRVLAFVIAWVLDPLVFGEYPAEMHSILGNQLPVFSPEE-KRLIKGSLDFIGIN  349

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
             HY + YA+DC  S C  S   +    GFV  +  ++G  IG+ TG+P   V P GME++V
Sbjct  350   HYGSLYAKDCSLSAC--SQGADHPITGFVETTGIRDGIPIGDQTGMPLFFVVPMGMEKIV  407

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K ++ ++P+Y+TE GYC     + ++  +L D KR+ +   YL A+  AIRKGADVR
Sbjct  408   DYIKIRYHNMPMYITENGYCLPLKQDVTVNYLLQDFKRIDYHKAYLAALLRAIRKGADVR  467

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             GY IWSL DNFEW  GY  R GLY  DR T +R PKLS +W+  F+      +++
Sbjct  468   GYMIWSLLDNFEWARGYDMRFGLYYVDRNTLERIPKLSVQWFSSFLNNTISTNTR  522



>ref|XP_009772387.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   481 bits (1238),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 239/482 (50%), Positives = 318/482 (66%), Gaps = 23/482 (5%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGTS+S+YQ EG Y+ DG+ LSNWDVFSH  G+I +G NGDVA D Y  Y ED D++
Sbjct  47    SFLFGTSTSAYQIEGAYIEDGRSLSNWDVFSHTNGSITNGGNGDVADDHYHRYLEDIDIM  106

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLGVN+++FSISWSR+LP+G+ G +N  GIK+Y N+ID+LLLKG+ PFVTI+H D PQE
Sbjct  107   ASLGVNAYRFSISWSRLLPRGKLGVVNPAGIKFYNNIIDNLLLKGVTPFVTIHHNDYPQE  166

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WLSP MQEE+ +FA+ CFK  GD+VKYW+T NEPN++A  AY   ++      
Sbjct  167   LEDRYGAWLSPLMQEEFVHFAETCFKSFGDRVKYWVTINEPNLFAELAYMNGIFPPSHCS  226

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  +V HN ILAHA AV +YR ++Q +QGG IG+      + P+ + 
Sbjct  227   PPFGNCSSGNSDTEPLLVIHNSILAHAKAVKLYRHHFQVEQGGMIGLVASAYMYKPIKDD  286

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AA RA +F   W LDP++YG YP EM++  G  LPEFS  +  KL     DFIG+
Sbjct  287   EADIKAAARALTFHVAWLLDPLVYGDYPTEMREYHGKKLPEFSPEE-SKLIKNSIDFIGL  345

Query  866   NHYTTYYAQDCLYS---------TCDPSMSGNTREEGFV---GQSLSKNGNFIGELTGLP  723
             NHY+T + +DCL S             S   N    GF+   GQ  +++G F+G+  G+P
Sbjct  346   NHYSTLFVKDCLLSNCTCNNDNNNPTCSHGENRAILGFLLTAGQ--NEDGAFVGDPMGMP  403

Query  722   YLAVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLH  543
              L V P GME +V Y K+++ ++P++VTE GY          EE++ D KR+K+   YL 
Sbjct  404   GLYVVPQGMEEIVDYIKKRYNNMPIFVTENGYASIDKQEEG-EELVKDIKRIKYHKAYLA  462

Query  542   AVGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             ++  +IR GADVRGYFIWSL DNFEW  GYT + GLYQ +  T  R+PKLSA WY  F+ 
Sbjct  463   SLARSIRNGADVRGYFIWSLMDNFEWVFGYTIKFGLYQVNPLTLDRSPKLSAHWYNDFLT  522

Query  362   KN  357
              +
Sbjct  523   NS  524



>ref|XP_010274443.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=522

 Score =   480 bits (1236),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 313/462 (68%), Gaps = 8/462 (2%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+S+YQ EG  L  G+GLSNWDVFSH PG I  G N D A D Y LY +D DL+ 
Sbjct  44    FLFGTSTSAYQTEGAILEGGRGLSNWDVFSHVPGKIETGENADTADDHYHLYLQDIDLMH  103

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+N+++FSISW+R+LP+GR G++N  GI +Y ++ID+LL +GIEPFVT+ H+ LPQEL
Sbjct  104   SLGINAYRFSISWARILPRGRFGDVNPTGIAFYNSIIDNLLRRGIEPFVTLYHHXLPQEL  163

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCSE  1203
             +DRY GWLSP +QE++ YFA++CF+  GD+VKYW + NEPN++A  AY   ++P G  SE
Sbjct  164   EDRYGGWLSPLIQEDFGYFAEICFRRFGDRVKYWSSLNEPNLYAHFAYLRGMYPPGRRSE  223

Query  1202  GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAE  1023
                  + F V HNM+L+HA A  +YR  YQQ+QGG IGI +    + P+ +  VD+ A  
Sbjct  224   ----MEPFTVLHNMLLSHARAAYLYRSRYQQKQGGSIGIVVNTAMYEPLRDEAVDREAVS  279

Query  1022  RAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYA  843
             RA +F  +  LDP+++G YP EM+  LG+ LP+FS  + + L  G  DFIGINHY++ YA
Sbjct  280   RALAFYVSGVLDPLIHGDYPPEMRHHLGARLPKFSVEESKALN-GSIDFIGINHYSSLYA  338

Query  842   QDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKF  663
             +DC+ S C    S      GFV  +  ++G  IGE T +P   + P G+E++V Y K ++
Sbjct  339   KDCINSPCPTGESHAFL--GFVYTTGFRDGVAIGEPTPMPRFFIVPDGLEKMVEYIKTRY  396

Query  662   PDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSL  483
              + P +VTE G      P    E +LHD KRV+FL  YL ++  AIR GADVRGYF+WSL
Sbjct  397   NNKPTFVTENGIAQLDQPGQR-EVLLHDNKRVEFLKGYLASLARAIRNGADVRGYFVWSL  455

Query  482   FDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
              DNFEWT+G+  R GLY  D  T +RTPKLSAKWY+ F+  N
Sbjct  456   MDNFEWTNGFRMRFGLYYVDYQTLERTPKLSAKWYRDFLTPN  497



>dbj|BAO04172.1| hypothetical protein [Delphinium grandiflorum]
Length=525

 Score =   480 bits (1236),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 313/473 (66%), Gaps = 11/473 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG S+SSYQ EG    DG+GL+NWDVF+H  GNI+DG + D   D Y   +ED +L+
Sbjct  33    SFFFGASTSSYQIEGAVHEDGRGLNNWDVFTHIKGNIIDGDDADQTDDHYHRTEEDIELM  92

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG+N+++FSISW+R+LPKGR G++N EGI +Y  LID+L+ KGIEPFVTI+H+D+P E
Sbjct  93    QSLGINAYRFSISWTRILPKGRFGDVNPEGILFYNKLIDNLVQKGIEPFVTISHHDVPLE  152

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY  WLSP +Q+++AY+AD+CF+  GD+VKYWIT NEPN++A  AY Y  +P     
Sbjct  153   LEERYGSWLSPLIQDDFAYYADICFRTFGDRVKYWITINEPNLFATNAYMYGTYPPGRCS  212

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC  G++  +  I  HNMIL+HA A NIY+KNYQ +Q G I I    + ++P+T+S
Sbjct  213   AEFGNCPSGDSNTEPLIAVHNMILSHAKAANIYKKNYQAKQRGFISIVPNASMYVPLTDS  272

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AA RA +F + W LDP++ G YP EM+  LG  LP+FS  +   LK    DFI I
Sbjct  273   KEDREAANRALAFCAPWILDPLILGKYPSEMRKYLGDQLPKFSPEEKAMLK-DSLDFISI  331

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY T YA+DC++S+CD   +G    +GFV  +  KNG  IGE T      + P G+   
Sbjct  332   NHYVTLYAKDCIHSSCD---TGGHAVQGFVYTTGEKNGIPIGERTAFYRFFIIPDGIRMA  388

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K ++ + PLYV E G C    P     E+L D +RV +   YL AV  AIR GADV
Sbjct  389   IEYIKARYNNRPLYVLENGICQENEPLELNGELLQDRQRVNYHKAYLAAVNRAIRDGADV  448

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             R YF+WSL DNFEW SGYT R GLY  D  T KRTPKLSAKWY  F+     V
Sbjct  449   RSYFVWSLLDNFEWASGYTYRYGLYYVDYKTLKRTPKLSAKWYSNFLNNESGV  501



>emb|CDX79092.1| BnaA01g11590D [Brassica napus]
Length=470

 Score =   478 bits (1229),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 321/476 (67%), Gaps = 35/476 (7%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG YL+ GK LSNWDVF+   G I DGS G V+ D Y  Y  D DL+
Sbjct  20    DFLFGTASSAYQYEGAYLTGGKTLSNWDVFTSISGKIADGSQGKVSVDHYHRYPGDLDLM  79

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++FS+SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQE
Sbjct  80    EDLGVNSYRFSLSWARILPKGRFGDVNMEGINHYNRMINAILKRGMEPFVTLTHYDMPQE  139

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL P+++E++ ++A++CF+H G++VK+W TFNE N+  I  YR   +P     
Sbjct  140   LECRYGSWLKPQIREDFEHYAEICFRHFGNRVKFWTTFNESNVQVILGYRKGTYPPSRCS  199

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                 NC+ G +  +  + AHN+I +H AAV++YR+ + Q+QGG+IGI M   WF P+++S
Sbjct  200   KTFANCTRGGSDIEPLVAAHNIIRSHFAAVSLYRERF-QEQGGKIGIVMNAIWFEPVSDS  258

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D  AAERA +F   WFLDPI                   F+  DL+  K  G DFIGI
Sbjct  259   LADSLAAERAQAFYLTWFLDPI-------------------FTRDDLKSSK-NGLDFIGI  298

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE TG+ +  VYP GME +
Sbjct  299   NQYTSRYAKDCLHSVCEPG-KGGSRAEGFVHSNALKDGLPLGEPTGVNWFNVYPQGMEEM  357

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + YA E++ +IPLYVTE G       ++S   +L+D +RVKF+++YL A+  A+RKG DV
Sbjct  358   LMYATERYRNIPLYVTENG------KDNSTGVLLNDYRRVKFMSNYLDALKRAMRKGEDV  411

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             RGYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI+K+    SK
Sbjct  412   RGYFTWSLLDNFEWISGYTVRFGMYHVDFNTLERTPRLSASWYKNFISKHISSQSK  467



>emb|CDY68226.1| BnaCnng58130D, partial [Brassica napus]
Length=438

 Score =   476 bits (1226),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 318/458 (69%), Gaps = 28/458 (6%)
 Frame = -3

Query  1712  QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  1533
             QYEG YL+DGK LSNWDVF+   G I DGS+G V+ D Y  Y  D DL+  LGVNS++FS
Sbjct  6     QYEGAYLTDGKALSNWDVFTSISGKIADGSHGKVSVDHYHRYPGDLDLMKDLGVNSYRFS  65

Query  1532  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSP  1353
             +SW+R+LPKGR G++N+EGI +Y  +I+++L +G+EPFVT+ HYD+PQEL+ RY  WL+P
Sbjct  66    LSWARILPKGRFGDVNMEGIDHYNRMINAILKRGMEPFVTLTHYDMPQELECRYGSWLNP  125

Query  1352  EMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCSEGNATKDIFIV  1173
             +++E++ ++A++C +H G++VK   TF                   NC+ G +  +  + 
Sbjct  126   QIREDFEHYAEICSRHFGNRVK---TF------------------ANCTSGGSDIEPLVT  164

Query  1172  AHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWF  993
             AHN+I +H AAV++YR+ +Q++Q G+IGI M   WF P+++S  D+ AAERA +F   WF
Sbjct  165   AHNIIRSHLAAVSLYREVFQEKQKGKIGIVMNAIWFEPVSDSLADRLAAERAQAFYLTWF  224

Query  992   LDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDP  813
             LDP+++G YPKEM+ ILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P
Sbjct  225   LDPLVFGRYPKEMQKILGKDLPKFTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEP  283

Query  812   SMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDIPLYVTET  633
                G +R EGFV  +  K+G  +GE TG+ +  VYP GM+ ++ YA E++ +IPLYVTE 
Sbjct  284   G-KGGSRAEGFVHSNAIKDGLALGEPTGVNWFNVYPQGMKEMLMYATERYKNIPLYVTEN  342

Query  632   GYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDNFEWTSGY  453
             G+ + +T       +L+D +RV+F+++YL A   A+RKGADVRGYF WSL DNFEW SGY
Sbjct  343   GFGENSTG-----VLLNDYRRVQFMSNYLDAFKRAMRKGADVRGYFTWSLLDNFEWISGY  397

Query  452   TKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             T R G+Y  D  T +RTP+LSA WYK FI K+    SK
Sbjct  398   TVRFGMYHVDSNTLERTPRLSASWYKNFIFKHTSSQSK  435



>ref|XP_011098340.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=550

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 315/474 (66%), Gaps = 16/474 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             FFFG S+S+YQ EG    DGKGLSNWDV+    GNI DG++GD+A D Y  Y ED +++ 
Sbjct  60    FFFGASTSAYQIEGAVHEDGKGLSNWDVYCRIQGNIADGTSGDIANDHYHRYMEDIEIIH  119

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+ +++FSISWSRVLP+GRHG +N  GI +Y ++ID+LLL+GI+PFVTI H + PQEL
Sbjct  120   SLGLTAYRFSISWSRVLPRGRHGGVNQAGITFYNSIIDNLLLRGIQPFVTIFHNEYPQEL  179

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DR  GWLSP MQEE+ +FA+ CFKH  D+VKYW+T NEPN+ A   Y   L+       
Sbjct  180   EDRIGGWLSPVMQEEFVHFAETCFKHFADRVKYWMTINEPNLLAEVTYERGLFPPARCSP  239

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G+C+ GN+  +  I  HNM+LAHA AV +YR+ Y+ +  G IGI +    + P+T S 
Sbjct  240   PFGHCAGGNSDVEPLIAVHNMLLAHAKAVKLYREQYKSKVNGVIGITVCAYMYTPLTESE  299

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D  AA RA +F + W LDP+++G YP EMK   GS LP FSS + E L+    DF+GIN
Sbjct  300   DDTEAANRALAFNAAWMLDPLVFGDYPPEMKRYHGSELPSFSSEERELLR-DSIDFMGIN  358

Query  863   HYTTYYAQDCLYSTCDP-----SMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC++S+C       ++  +    GFV  +  +NG  IGE TG+    V P G
Sbjct  359   HYGTLYAKDCIHSSCVCNDSVYTLGSDRLIRGFVYTTGERNGVPIGEPTGMSQFFVVPRG  418

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y KE++ + P++VTE GY   ++P +  +   HD KR+ +   YL ++  A+R 
Sbjct  419   MEDIVNYMKERYHNKPMFVTENGY---SSPGNEDDVYQHDVKRIHYHQLYLASLAQAVRN  475

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GADVRGYFIWSL DNFEW+SGY  + G+Y+ D  T  R PKLSA WYK F++ +
Sbjct  476   GADVRGYFIWSLMDNFEWSSGYALKFGIYRIDPQTLNRIPKLSATWYKDFLSNS  529



>ref|NP_001140717.1| beta-glucosidase precursor [Zea mays]
 gb|ACF84449.1| unknown [Zea mays]
 gb|AFW58838.1| beta-glucosidase [Zea mays]
Length=511

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 308/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SSYQ EG YL   K LSNWDVFSH PG I DGS GDVA D Y  Y++D +L+
Sbjct  41    SFLFGTATSSYQIEGAYLEGNKSLSNWDVFSHVPGRIEDGSTGDVADDHYHRYEDDIELM  100

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+R+LP+GR G +N  GI +Y  LIDSLLLKGIEPFVT++HYD+PQE
Sbjct  101   HSLGTNAYRFSISWARILPRGRFGEVNPAGIAFYNRLIDSLLLKGIEPFVTLSHYDIPQE  160

Query  1385  LQDRYQGWL-SPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNC  1209
             L+DRY  WL   E + ++ + ADVCF   GD+V++W TFNEPN+     Y    +P G C
Sbjct  161   LEDRYGAWLGGAEARRDFGHLADVCFAAFGDRVRHWATFNEPNVAVTRGYMLGTYPPGRC  220

Query  1208  S----EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTV  1041
             S     GN+  + ++ AHN++LAHAAAV IY+  YQ +Q G IGI M   WF+P+T++  
Sbjct  221   SRSCARGNSDAEPYVAAHNVVLAHAAAVQIYKTKYQSKQKGLIGIVMSTVWFVPLTDAPA  280

Query  1040  DKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINH  861
             D+ A ERA +F   WFLDPI+YG YP EM+ +LGS LP FS  +   L   G DFIGINH
Sbjct  281   DRLATERALAFDVPWFLDPIIYGDYPPEMRRLLGSRLPTFSPEERRTLGY-GLDFIGINH  339

Query  860   YTTYYAQDCLYST--CDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             YTT YA+DC+ S   C    SG    +     +  ++G  IG  T +P   V P G+E++
Sbjct  340   YTTLYARDCMISPGYCP---SGQEFHQSLAAYTGERDGIPIGPPTAMPTFYVVPDGIEKM  396

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTP-NSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             VTY   ++ ++P+++TE GY        +  E+ L D  R+++L  YL  +   I  GAD
Sbjct  397   VTYIMNRYSNLPMFITENGYAQGGDGYTTRAEDWLDDQGRIQYLEGYLAKLAKVISDGAD  456

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             VRGYFIWSL DNFEW  GYT R GL+  D  TQ+R PK SA WYK+F+
Sbjct  457   VRGYFIWSLIDNFEWLYGYTLRFGLHYVDYQTQERKPKSSALWYKRFL  504



>gb|KEH36812.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=420

 Score =   474 bits (1220),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 222/410 (54%), Positives = 296/410 (72%), Gaps = 9/410 (2%)
 Frame = -3

Query  1556  GVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQD  1377
             GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQEL++
Sbjct  5     GVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQELEE  64

Query  1376  RYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-------H  1218
             RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P        
Sbjct  65    RYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCSDSF  124

Query  1217  GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVD  1038
             GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NST D
Sbjct  125   GNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNSTED  184

Query  1037  KAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHY  858
             K AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGINHY
Sbjct  185   KLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGINHY  243

Query  857   TTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTY  678
             T+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +VTY
Sbjct  244   TSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENIVTY  302

Query  677   AKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGY  498
              K+++ +IP+++TE G+  + +   + E  L+D KRV++L+ YL ++ TAIRKGADV+GY
Sbjct  303   IKDRYNNIPMFITENGFGTSESSYPTTEYELNDVKRVEYLSSYLDSLATAIRKGADVKGY  362

Query  497   FIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             F+WS+ DNFEW  GY+ R GL+  D AT  RTP+ SA WYK FI++++ +
Sbjct  363   FVWSILDNFEWNHGYSIRFGLHHVDFATLNRTPRGSAFWYKNFISEHKNL  412



>gb|AAU05454.1| At1g61820 [Arabidopsis thaliana]
 gb|AAU45206.1| At1g61820 [Arabidopsis thaliana]
Length=425

 Score =   474 bits (1219),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 301/424 (71%), Gaps = 10/424 (2%)
 Frame = -3

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
             ED   +  LGVNS++ SISWSRVLP GR G IN +GIKYY NLID+L+ KGI PFVT+NH
Sbjct  2     EDIQSMNFLGVNSYRLSISWSRVLPNGRFGVINYKGIKYYNNLIDALIKKGITPFVTLNH  61

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW  1224
             +D PQEL++R++ WLS EMQ+++ Y AD+CFKH GD+VK+WIT NEPN     AYR  L+
Sbjct  62    FDYPQELENRFKSWLSSEMQKDFGYLADICFKHFGDRVKHWITINEPNQHISLAYRSGLF  121

Query  1223  P-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
             P       +GNC+ GN+  + FI AHNMILAHA A+ IYR  YQ++Q G IGI +  +WF
Sbjct  122   PPARCSMPYGNCTHGNSETEPFIAAHNMILAHAKAIQIYRTKYQREQKGIIGIVVQTSWF  181

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P+++S  DK AAERA SF SNW LDP++YG YP+EM ++LGS LP+FSS ++  L +  
Sbjct  182   EPISDSIADKNAAERAQSFYSNWILDPVVYGKYPEEMVNLLGSALPKFSSNEMNSLMSYK  241

Query  884   SDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF-IGELTGLPYLAVY  708
             SDF+GINHYT+Y+ QDCL + C+ S  G ++ EG +   L + GN  IGELT + +  + 
Sbjct  242   SDFLGINHYTSYFIQDCLITACN-SGDGASKSEG-LALKLDRKGNVSIGELTDVNWQHID  299

Query  707   PPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTA  528
             P G  +++ Y K ++ +IP+Y+TE G+     P +++EE+LHDTKR+++L+ YL A+  A
Sbjct  300   PNGFRKMLNYLKNRYHNIPMYITENGFGQLQKPETTVEELLHDTKRIQYLSGYLDALKAA  359

Query  527   IRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             +R GA+V+GYF WSL DNFEW  GY  R GL+  D  T KRTPK SA WYK FI +N  +
Sbjct  360   MRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTTLKRTPKQSATWYKNFIEQNVNI  419

Query  347   DSKM  336
             + ++
Sbjct  420   EDQI  423



>ref|XP_006348230.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=528

 Score =   477 bits (1228),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 315/474 (66%), Gaps = 17/474 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+S+YQ EG Y  DG+ LSNWD + H  G I +G +GD+A D Y  Y ED D++A
Sbjct  45    FLFGTSTSAYQVEGAYSEDGRSLSNWDTYCHINGRIPNGGSGDIADDHYHRYLEDIDIMA  104

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISWSR+LP+G+ G +N  GIK+Y N+IDSLLLKGI PFVTI+HYD PQE 
Sbjct  105   SLGVNAYRFSISWSRILPRGKLGLVNPAGIKFYNNIIDSLLLKGIIPFVTIHHYDYPQEF  164

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DR+Q WLSP MQEE+ YFA++CFK  G++VKYW T NEPN++   AY   ++       
Sbjct  165   EDRFQAWLSPLMQEEFVYFAEICFKSFGNRVKYWATLNEPNLYMEMAYLKGVFPPSHCSP  224

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G CS GN+  +  +V HN ILAHA AV IYR  +Q++QGG IG+      + PMT++ 
Sbjct  225   PFGKCSYGNSDIEPLLVVHNSILAHAKAVKIYRDQFQEKQGGTIGMVASAYMYKPMTDNE  284

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D  A  RA +F   W LDP++YG YP EM+  LG+ LP FSS + + L    +DFIG+N
Sbjct  285   ADNKATNRALAFHVAWLLDPLVYGDYPIEMRHYLGTKLPIFSSEE-KILIKNSTDFIGLN  343

Query  863   HYTTYYAQDCLYSTCDPSMS------GNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVYP  705
             HYTT++ +DCL S C    S      G  R   G+V  +  K+G +IG+  G+P + V P
Sbjct  344   HYTTWFVKDCLNSNCTCMESDVLCTHGENRAIRGYVLITGQKDGAYIGDQMGMPGVYVVP  403

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GME +V Y  +++ ++P++VTE GY   +  N    ++  D KR+K+   YL ++  +I
Sbjct  404   QGMEDIVDYVNKRYNNLPIFVTENGY--ASNENQEEYDMDQDRKRIKYHKAYLASLARSI  461

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             R GADVRGYF+WSL DNFEW  GYT + GLY  DR +  R+PKLSA W++ F+ 
Sbjct  462   RNGADVRGYFVWSLMDNFEWRFGYTVKFGLYHVDRFSLNRSPKLSAHWFRDFLT  515



>emb|CDX94056.1| BnaC07g36900D [Brassica napus]
Length=529

 Score =   477 bits (1228),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 236/478 (49%), Positives = 326/478 (68%), Gaps = 28/478 (6%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQP--------GNILDGSNGDVAADQYDL  1590
             +F FGT+SS+YQYEG YL+DGK LSNWDVF+  P        G I DGS+G VA D Y L
Sbjct  49    DFLFGTASSAYQYEGAYLADGKTLSNWDVFTSIPLLDMSICIGKIADGSHGKVAVDHYHL  108

Query  1589  YKEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKG-IEPFVT  1413
             Y ED DL+  LGVNS++FS+SW+R+LP GR G++N+EGI ++  +I+++L KG +EPF+T
Sbjct  109   YPEDLDLMKDLGVNSYRFSLSWARILPNGRFGDVNMEGIDHHNRMINAILEKGRMEPFIT  168

Query  1412  INHYD--LPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY  1239
             + HY   L     D   G L+P  +E++ ++A++CF+H G++VK+W T NEPN+  I  Y
Sbjct  169   LTHYMTFLKNSSLDMEVG-LTP--KEDFEHYAEICFRHFGNRVKFWTTLNEPNVQVILGY  225

Query  1238  RYRLWP-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAM  1080
             R   +P         NC+ G +  +  + AHN+I +H AAVN+YR  +Q++Q G+IGI M
Sbjct  226   RKGTYPPSRCSKTFANCTRGGSDIEPLVAAHNIIRSHLAAVNLYRTKFQEEQRGKIGIVM  285

Query  1079  LFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEK  900
                WF P+++S  D+ AAERA +F   WFLDP+++G YP+EMKDILG +LP+F+    + 
Sbjct  286   NTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREMKDILGEYLPKFTKDGFKS  345

Query  899   LKAGGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPY  720
              K  G DFIGIN YT+ YA+DCL++ C P   G +R EGFV  +  K+G  +GE TG+ +
Sbjct  346   SK-NGLDFIGINQYTSRYAKDCLHTACKPG-QGGSRAEGFVYSNALKDGLPLGEPTGVNW  403

Query  719   LAVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHA  540
               VYP GME ++ YA E++ +IPLYVTE G+ +  T       +L+D + VKF+++YL A
Sbjct  404   FKVYPQGMEEMLMYATERYRNIPLYVTENGFGENNT-----GVLLNDYRSVKFMSNYLDA  458

Query  539   VGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             +  A+RKGADVRGYF WSL DNFEW SGYT R G+Y  D  T +RTP+LSA WYK FI
Sbjct  459   LKRAMRKGADVRGYFTWSLLDNFEWISGYTVRFGMYHVDFDTLERTPRLSASWYKNFI  516



>emb|CDP05880.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   478 bits (1231),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 229/486 (47%), Positives = 327/486 (67%), Gaps = 17/486 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+SSYQ EG  L DGK LSNWDVF  + G++ +G   D+AAD Y  Y ED +++ 
Sbjct  50    FLFGVSTSSYQIEGAILDDGKSLSNWDVFVRKRGSVNNGDTADIAADHYHRYLEDIEIIH  109

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGV++++FSISW+R+LP+G+ G++N  GI +Y  +ID+LL++GI+PFVTI+HYD PQEL
Sbjct  110   SLGVDAYRFSISWARILPRGKLGDVNPAGIMFYNKIIDNLLIRGIKPFVTIHHYDFPQEL  169

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
              DRY GWLSP MQ++Y  FA+ CFK+ GD+V+YWIT NE N+ +  AY   ++       
Sbjct  170   LDRYGGWLSPFMQDDYVRFAETCFKYFGDRVRYWITMNEANLLSELAYEKGIYPPGHCSP  229

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQ---QQQGGEIGIAMLFTWFLPMT  1053
             P GNCS GN+  +  I  HNM+LAH+ AV +YR+ +Q    +QGG +G+A+    + P++
Sbjct  230   PFGNCSAGNSDIEPLIAMHNMLLAHSKAVKLYREQFQASEHKQGGMMGVAVSAMMYEPLS  289

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +  +DK AA RA +F   W LDP++YG YP EM+   G  LP F+S + ++L +  +DFI
Sbjct  290   DDELDKEAANRALAFSLAWGLDPLVYGDYPPEMRRYHGKELPTFTSEE-KQLLSNSTDFI  348

Query  872   GINHYTTYYAQDCLYSTCDPS----MSGNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVY  708
             G+NHY T YA+DC+YS C  S    + G  R  +GFV     ++G  IGE TG+    + 
Sbjct  349   GLNHYATVYAKDCIYSNCMCSNTTCLPGENRAIKGFVSTITERDGVPIGEPTGMFQTFIV  408

Query  707   PPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTA  528
             P G++ +V YAK+++PD P+++ E GYC     +  ++++ HDTKRV++   Y+ ++  A
Sbjct  409   PRGIKEIVDYAKKRYPDKPVFIVENGYC-PPWEHGEVDDLQHDTKRVEYHKAYIASLAQA  467

Query  527   IRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             IR GADVRGYFIW+L D FEW+SGY  + GLY FDR T  R P+LSA WY+ F+ K    
Sbjct  468   IRDGADVRGYFIWTLMDAFEWSSGYDLKFGLYSFDRVTLNRIPRLSANWYRDFLRKTSLK  527

Query  347   DSKMQS  330
             D + +S
Sbjct  528   DLESRS  533



>ref|XP_004244205.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=538

 Score =   478 bits (1229),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 235/472 (50%), Positives = 311/472 (66%), Gaps = 13/472 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++S+YQ EG  L DGKGLSNWDVFSH  G I +G  GDVA D Y  ++ED +L+ 
Sbjct  41    FLFGITTSAYQIEGAILEDGKGLSNWDVFSHTKGTINNGDTGDVADDHYHRFQEDVELMH  100

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             S+G+NS++FSISWSRVLP+G  G +N  G+ +Y  LIDSLLL+GI  FVT+NH+D P EL
Sbjct  101   SIGLNSYRFSISWSRVLPRGSFGKVNFAGVTFYNELIDSLLLRGITAFVTLNHHDHPHEL  160

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++++ GWL+P MQEE++YFA +CF+  GD+VKYW T NEPNM+A  AY   ++       
Sbjct  161   EEKHGGWLNPIMQEEFSYFAKICFESFGDRVKYWTTINEPNMFAEMAYVRGVYPPARCSP  220

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  +  HNM+LAHA A  +YR+++Q + GG IGI +    + P+ N+ 
Sbjct  221   PFGNCSAGNSDTEPLVAMHNMLLAHAKAAKLYREHFQPKHGGMIGIVVHSFMYKPLRNND  280

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA  F + W  DP+++G YP EM+  L   LP F+S D  KL     DF+GIN
Sbjct  281   FDRDAAHRAVLFTAAWVFDPLVHGDYPPEMRKYLADALPRFTS-DERKLIKDSIDFMGIN  339

Query  863   HYTTYYAQDCLYSTCDPSM-----SGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC+ S+C  S       G+    G++     K+G  IGE TG+    V P G
Sbjct  340   HYGTLYAKDCINSSCVCSNSSCIAGGDHPIHGYLITLGEKDGVSIGEPTGMSRFFVVPNG  399

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y K+++ + P++VTE GY       +  +E+ HDTKRV+F   YL ++  AIRK
Sbjct  400   MEEIVDYMKKRYHNKPMFVTENGYASLNPTTAQADELQHDTKRVEFHKSYLASLARAIRK  459

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             GADVRGYFIWSL DNFEWTSGY  + GLY  DR T  R PKLSAKWY  F+ 
Sbjct  460   GADVRGYFIWSLMDNFEWTSGYELKFGLYYVDRHTLDRVPKLSAKWYTDFLT  511



>gb|EYU26405.1| hypothetical protein MIMGU_mgv1a004080mg [Erythranthe guttata]
Length=545

 Score =   476 bits (1226),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 315/477 (66%), Gaps = 16/477 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+S+YQ EG  + DGK +SNWD+F    G I DG+NGDVA D Y  Y ED +++ 
Sbjct  51    FLFGASTSAYQIEGAVVEDGKSVSNWDIFCRTDGRISDGTNGDVADDHYHRYMEDIEIMH  110

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+ +++FSISWSR+LP+GR G +N   I +Y ++ID+L+++GIEPFVTI H++ PQEL
Sbjct  111   SLGLTAYRFSISWSRILPRGRFGGVNQAAIIFYNSIIDNLVVRGIEPFVTIFHHEYPQEL  170

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DR+ GWLSP MQEE+ + A++CFK+  D+VKYWIT NEPN+++   Y    +       
Sbjct  171   EDRFGGWLSPLMQEEFVHLAEMCFKYFADRVKYWITINEPNLFSEMGYERATYPPARCSP  230

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNC+ GN+  +  IV HNM+L HA A  +YR  ++ +  G + IA+    + P+T++ 
Sbjct  231   PFGNCATGNSDSEPLIVVHNMLLGHAKAAKLYRDQFKSKVDGLMSIAVCAFMYTPLTDNM  290

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK AA+RA +F   W LDP++YG YP+EMK+  GS LP FSS + E LK    DFIGIN
Sbjct  291   YDKEAAKRALAFNVAWTLDPLVYGDYPQEMKNYHGSELPSFSSEEKELLK-DSIDFIGIN  349

Query  863   HYTTYYAQDCLYSTCDPSMSGNTRE-----EGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY   YA+DC++S+C  + S  T+       GFV  +  +NG  IGE TG+    V P G
Sbjct  350   HYGVLYAKDCVHSSCPCNDSSCTQGSDRPIRGFVYTTGERNGIPIGERTGMSRFFVVPSG  409

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y KE++ +  ++VTE GY   ++PN   +   HD KR+++   YL  +  AIRK
Sbjct  410   MEDIVDYVKERYNNKTMFVTENGY---SSPNDEDDIYEHDVKRIQYHRSYLEYLAQAIRK  466

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             GADVRGYFIWSL DNFEW+SGY  + GLY  DR T  R PKLSA WY+ F+  +  V
Sbjct  467   GADVRGYFIWSLMDNFEWSSGYAIKFGLYHIDRLTLNRIPKLSANWYRDFLGNSSIV  523



>ref|XP_002448170.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
 gb|EES12498.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
Length=817

 Score =   484 bits (1246),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 229/447 (51%), Positives = 308/447 (69%), Gaps = 11/447 (2%)
 Frame = -3

Query  1664  DVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSISWSRVLPKGRHGNIN  1485
             D F+ + G I DGSNGDVA D Y  YKED +++ SLG++ ++FS+SWSR+LPKGR G +N
Sbjct  363   DYFNQKSGKIEDGSNGDVATDHYHRYKEDIEIMHSLGLDCYRFSLSWSRILPKGRFGGVN  422

Query  1484  LEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKH  1305
               G+K+Y +LI+ LL KGI+PFVTINHYD+PQELQ+RY  WLSPE+QE++ YFA++CFK 
Sbjct  423   PAGVKFYNSLINGLLGKGIQPFVTINHYDIPQELQERYGSWLSPEIQEDFTYFAELCFKM  482

Query  1304  LGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCSE-------GNATKDIFIVAHNMILAHA  1146
              GD+VK+W TFNE N      Y    +P  +CSE       GN++ + +I AHNMILAHA
Sbjct  483   FGDRVKHWATFNEANFLTKLKYSMGKFPPSHCSEPYGKCNSGNSSTEPYIAAHNMILAHA  542

Query  1145  AAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSY  966
              AVNIYRKNY+ +QGG IGI++   W+ P+ N T D  A  RA SF + WFLDP+ +G Y
Sbjct  543   MAVNIYRKNYKVKQGGSIGISLYMRWYEPLRNITEDHLAVSRALSFQAPWFLDPLFFGDY  602

Query  965   PKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREE  786
             P +M+ ILG +LP+F+  + + LK    DFIGINHY T Y +DC++S CD         +
Sbjct  603   PHQMRQILGPNLPKFTKGEKQLLK-NQIDFIGINHYETLYIKDCIHSLCDLDTYAG---D  658

Query  785   GFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPN  606
               V +S  +NG  IG+ T +    V P  ME++V Y K+++  IPLY+TE GY      +
Sbjct  659   ALVTESAERNGILIGKPTPVANTCVVPSSMEKLVMYLKQRYKSIPLYITENGYAQIGNSS  718

Query  605   SSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQF  426
             ++ EE+++DT+R  ++ DYL  +  AIRKGADVRGYF+WSL DNFEW SGYT + GLY  
Sbjct  719   TTTEELINDTERSSYIHDYLTYLSLAIRKGADVRGYFVWSLMDNFEWLSGYTTKYGLYYV  778

Query  425   DRATQKRTPKLSAKWYKQFIAKNQKVD  345
             D  + KRTPKLSAKWY +FI  N+ ++
Sbjct  779   DFKSLKRTPKLSAKWYSKFIKGNEHIE  805



>gb|EMS60351.1| Beta-glucosidase 16 [Triticum urartu]
Length=530

 Score =   474 bits (1220),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/484 (48%), Positives = 318/484 (66%), Gaps = 26/484 (5%)
 Frame = -3

Query  1706  EGGYLSDGKGLSNWDVFSHQPGN-ILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFSI  1530
             EG YL DGKGLSNWD F+H     I DG NGDVA D Y  Y ED +++ SLGVNS++FSI
Sbjct  46    EGAYLEDGKGLSNWDFFTHTNSRGIDDGRNGDVADDHYHRYMEDLEIIHSLGVNSYRFSI  105

Query  1529  SWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWL---  1359
             SW+R+LP+GR G +N  GI +Y  LI +++ KGIEPFVT++H+DLP E++ RY GWL   
Sbjct  106   SWARILPRGRLGGVNSAGIDFYDRLIAAVVQKGIEPFVTLHHFDLPHEMETRYGGWLGAG  165

Query  1358  -------------SPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-  1221
                           P  +EE+ Y+ADVCFK  GD+VK+W TFNEPN++   AY    +P 
Sbjct  166   IREPALHRQKQQEKPFPREEFDYYADVCFKAFGDRVKFWATFNEPNLFTRLAYVLGKYPP  225

Query  1220  ------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLP  1059
                    G C  GN+ ++ ++ AHNM+L+HAAAV+ Y+KNYQ  QGG IGI +   W+ P
Sbjct  226   ARCSAPFGTCDSGNSHREPYVAAHNMLLSHAAAVHNYKKNYQATQGGSIGIVIAMKWYEP  285

Query  1058  MTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSD  879
             +TN+T D  AA RA SF  +WFL+PI +G YP+EM ++L S+LP+F+S +   L+   +D
Sbjct  286   LTNTTEDILAARRALSFEVDWFLEPIFFGDYPREMHELLASNLPKFTSEEKSLLQKNKAD  345

Query  878   FIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             FIG+NHYTT Y +DC+ S CD +          V  +  ++G  IG+ T      V P G
Sbjct  346   FIGVNHYTTIYVKDCISSPCDLNTYEAYEGNALVLATGERDGVAIGKPTAFDGYYVVPEG  405

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME++V Y  +++ + P+YVTE GY   +  N++++E+++D +RV +L  YL  + +AIRK
Sbjct  406   MEQIVKYVNQRYTNTPVYVTENGYSQYS--NNTMDELMNDGERVNYLQGYLTFLSSAIRK  463

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             GA+VRGYF+WS+ DNFEWT G+T R GLY  D  TQKRTPK+SAKWY+ F+  ++  D  
Sbjct  464   GANVRGYFVWSIIDNFEWTFGFTVRFGLYHVDYETQKRTPKMSAKWYRDFLMGSRPTDQV  523

Query  338   MQSR  327
                R
Sbjct  524   QTLR  527



>ref|XP_009413740.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   472 bits (1214),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/468 (49%), Positives = 310/468 (66%), Gaps = 37/468 (8%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
              F FGT++SSYQ EG YL   K LSNWDVF+H PG I DG  GD+A D Y  Y ED  L+
Sbjct  31    TFLFGTATSSYQIEGAYLEGNKSLSNWDVFTHLPGKIKDGRTGDIADDHYHRYMEDISLM  90

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVNS++FS+SWSR+LP+                         I+PFVT+NH+D+PQE
Sbjct  91    HSLGVNSYRFSMSWSRILPR-------------------------IQPFVTLNHFDVPQE  125

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L+DRY  WLSP+++E++ + A+VCFK  GD+VK+W TFNEPN++   +Y +  +P G CS
Sbjct  126   LEDRYGSWLSPQIREDFGHLAEVCFKEFGDRVKFWTTFNEPNLFVKFSYAFGKYPPGRCS  185

Query  1205  E-------GNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
             E       G++  + +I AHN+IL+HA AV+IYRKNYQ +QGG IGI +   W+ P+TNS
Sbjct  186   EPYANCTTGDSEVEPYIAAHNIILSHATAVDIYRKNYQVKQGGSIGIVITSKWYEPLTNS  245

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  A +RA SF   W LDPI+ G YP EM ++LGS LP F+  + +KL     DFIGI
Sbjct  246   TADCLATQRALSFEGPWILDPILLGDYPSEMHEVLGSRLPIFTYEE-KKLLLNKLDFIGI  304

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y  DC+ S+CD  + G  R +  +  +  K+G  IGE T LP     P G+E++
Sbjct  305   NHYSTNYVMDCMLSSCD--LDGYMR-DALIATTGYKDGVLIGEPTALPTYYAVPYGIEKM  361

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             V Y  E++ ++P+Y+TE GY   ++  +  +E+++DT+R+KF+  YL  +  AI +GADV
Sbjct  362   VRYIMERYNNVPMYITENGYAQGSS-GAFTKELINDTERIKFMHSYLTFLSAAISQGADV  420

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             RGYF WSL DNFEW  GYT R GL+  D  TQ+RTPKLSAKWYK+F++
Sbjct  421   RGYFSWSLLDNFEWAFGYTVRFGLFHVDYKTQRRTPKLSAKWYKKFLS  468



>ref|XP_009378508.1| PREDICTED: beta-glucosidase 18-like [Pyrus x bretschneideri]
Length=516

 Score =   473 bits (1217),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 240/479 (50%), Positives = 315/479 (66%), Gaps = 15/479 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +FFFG ++SSYQ EG YL DGKGLSNWDVF+  PG I D +NGDVA D Y+LY ED +L+
Sbjct  38    DFFFGAATSSYQVEGAYLQDGKGLSNWDVFTKIPGKIEDNANGDVADDHYNLYLEDIELM  97

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG+  ++FSISWSR+LP G  G  N  GI +Y  LI+ L+ KGIEPFVTI+H DLP  
Sbjct  98    HSLGIRGYRFSISWSRILPDGMLGTPNPSGITFYNKLINHLVSKGIEPFVTIHHTDLPYL  157

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ R  GWLSP ++EE+A FA +CFK+ GD+V+YW+T NEPN+ A  AY   ++      
Sbjct  158   LEARDGGWLSPLLREEFARFATICFKNFGDRVRYWVTINEPNLIADLAYISGIFPPARCS  217

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  I  HNM++AH  AV+IYR  +  +Q G IGI      + P+ + 
Sbjct  218   PPFGNCSTGNSDVEPLIAMHNMLIAHGMAVDIYRSFFWPKQQGFIGIVSSAFMYEPLRDE  277

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AA+RA +F   W LDP++YG YP EM+   G  LP+FS+ + ++L  G  DFIG+
Sbjct  278   ERDRLAADRALAFNVAWMLDPLIYGDYPAEMRQCHGLALPKFSANE-KRLLRGSIDFIGV  336

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y +DC+ STC PS  G+    GF+  +  ++G  IGE TG  YL V P GME +
Sbjct  337   NHYSTLYVKDCINSTC-PS-GGDRPIRGFLNTTSYRDGVPIGEPTGTSYLFVVPRGMEEI  394

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K ++ ++P++VTE GY   T P    E  L D  R+ F   YL ++  AIRKGA+V
Sbjct  395   IDYLKRRYHNVPMFVTENGY---TLPAQQNE--LQDMGRINFHKAYLVSLARAIRKGANV  449

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSKMQS  330
             RGYFIWSL DNFEW SGYT R GLY  DR T +RTPKLSAKW+  F+  N   + +  S
Sbjct  450   RGYFIWSLMDNFEWLSGYTSRFGLYYVDRQTLERTPKLSAKWFASFLKNNNHNEKEESS  508



>ref|XP_011098338.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=549

 Score =   474 bits (1219),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 228/483 (47%), Positives = 314/483 (65%), Gaps = 16/483 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG S+S+YQ EG  L DGK LSNWDVF    G+I DG NGDVA D Y  Y ED +++ 
Sbjct  60    FHFGASTSAYQVEGASLEDGKSLSNWDVFCRIEGSIADGRNGDVADDHYHRYMEDIEIMH  119

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+ +++FSISWSRVLP+GR+G +N   + +Y ++ID+LLL+GIEPFVTI H + PQEL
Sbjct  120   SLGLTAYRFSISWSRVLPRGRYGGVNQAAVSFYNSIIDNLLLRGIEPFVTIFHNEYPQEL  179

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DR+ GWLSP MQEE+ +FA+ CF +  D+VKYW+T NEPN+ +  +Y    +       
Sbjct  180   EDRFGGWLSPLMQEEFVHFAETCFSYFADRVKYWMTINEPNLTSEMSYERATYPPARCSP  239

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G+C+ GN+  +  I  HNM+LAHA A  +YR+ ++ +  G I I +L   + P+T   
Sbjct  240   PFGHCASGNSDVEPLIAVHNMLLAHAKAAKLYRERFKSKVNGVISITVLAFMYTPLTEDE  299

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              DK AA RA +F   W LDP+++G YP EMK I GS LP FS  + E L+    D+IGIN
Sbjct  300   ADKEAANRALAFNVAWVLDPLVFGDYPPEMKRIHGSELPRFSLEERELLR-DSVDYIGIN  358

Query  863   HYTTYYAQDCLYSTCDPSMSGNTRE-----EGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC++STC  + S  T+       GFV  +  ++G  IGE TG+    V P G
Sbjct  359   HYGTLYAKDCIHSTCSCNESSCTQGGDRPIRGFVATTGVRDGVTIGEPTGMSRFFVVPRG  418

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             +E +V Y K+++ + P+ VTE GY   ++P +  +   HD KR+ +   YL  +  A+R 
Sbjct  419   LEDIVRYIKDRYHNKPMIVTENGY---SSPGNEDDIYKHDVKRIHYHQSYLAHLAQAVRN  475

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             GADVRGYFIWSL DNFEW++GYT + G+Y+ DR T  R PKLSA WY+ F+  +  +D  
Sbjct  476   GADVRGYFIWSLLDNFEWSNGYTAKFGIYRVDRQTLNRIPKLSAVWYRDFLRNSSLIDVH  535

Query  338   MQS  330
             + S
Sbjct  536   LSS  538



>ref|XP_009605771.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   473 bits (1217),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 315/485 (65%), Gaps = 16/485 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+S+YQ EG Y+ DG+ LSNWDV+    G I +G +GD+A D Y  Y ED D +A
Sbjct  47    FLFGTSTSAYQIEGAYIEDGRSLSNWDVYCRINGRIPNGGSGDIADDHYHRYLEDIDRMA  106

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISWSR+LP+GR G +N  GI++Y N+I +LLLKGI PFVTI+HYD PQE 
Sbjct  107   SLGVNAYRFSISWSRILPRGRFGAVNPAGIRFYNNIIVNLLLKGITPFVTIHHYDYPQEF  166

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DRY  WLSP MQEE+ +FA+ CFK  GD+VKYW T NEPN++A  AY   ++       
Sbjct  167   EDRYGAWLSPLMQEEFVHFAETCFKSFGDRVKYWSTMNEPNLFAEMAYLKGVFPPSHCSP  226

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G CS GN+  +  +  HN ILAHA AV +YR+ +Q +QGG IG+      + PMT+  
Sbjct  227   PFGKCSSGNSDVEPLLAVHNSILAHAKAVKLYRRQFQTEQGGMIGMVASAYMYKPMTDDE  286

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D  AA RA +F   W LDP++YG YP EM++  G  LP+FSS + ++L    +DFIG+N
Sbjct  287   ADTKAATRALAFHVAWLLDPLVYGDYPIEMREYHGKKLPKFSSEE-KRLIKNSTDFIGLN  345

Query  863   HYTTYYAQDCLYSTCDPS------MSGNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVYP  705
             HYTT++ +DCL+S C  +        G  R   GF+  +  K+G  IG+  G+P + V P
Sbjct  346   HYTTWFVKDCLHSNCTCTDTDVLCTHGENRAIGGFLLITGQKDGASIGDPMGMPGVYVVP  405

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GME +V Y  +++ + P++VTE GY           ++  D KR+K+   YL ++  +I
Sbjct  406   QGMEEIVDYVNKRYNNTPIFVTENGYASNENQGGGY-DLDQDMKRIKYHKAYLASLARSI  464

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVD  345
             R GADVRGYFIWSL DNFEW  GYT + GLY  D  T  R+PKLSA+WYK F+  +   D
Sbjct  465   RNGADVRGYFIWSLMDNFEWRFGYTIKFGLYHVDPLTLDRSPKLSAQWYKNFLTNSSLND  524

Query  344   SKMQS  330
              + +S
Sbjct  525   IQAKS  529



>ref|XP_009762322.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=531

 Score =   473 bits (1216),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 311/476 (65%), Gaps = 16/476 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+S+YQ EG Y+ DG+ LSNWDV+    G I +G +GD+A D Y  Y ED D +A
Sbjct  47    FLFGTSTSAYQIEGAYIEDGRSLSNWDVYCRINGRIPNGGSGDIADDHYHRYLEDIDRMA  106

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISWSR+LP+GR G +N  GIK+Y N+ID+LLLKGI PFVTI+H D PQE 
Sbjct  107   SLGVNAYRFSISWSRILPRGRFGAVNPAGIKFYNNIIDNLLLKGITPFVTIHHDDYPQEF  166

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DRY  WLSP MQEE+ +FA+ CFK  GD+VKYW T NEPN++A  AY   ++       
Sbjct  167   EDRYGAWLSPLMQEEFVHFAETCFKSFGDRVKYWATINEPNLFAEMAYLKGVFPPSHCSP  226

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G CS GN+  +  +V HN ILAHA AV +YR  +Q +QGG IG+ +    + PMT+  
Sbjct  227   PFGKCSSGNSDVEPLLVVHNSILAHAKAVKLYRHQFQTEQGGMIGMVVSAYMYKPMTDDE  286

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D  A+ RA +F   W LDP++YG YP EM++  G  LP+FSS + ++L    +DFIG+N
Sbjct  287   ADTKASTRALAFHVAWLLDPLVYGDYPIEMREYHGKKLPKFSSEE-KRLIKNSTDFIGLN  345

Query  863   HYTTYYAQDCLYSTCD-------PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYP  705
             HYTT++ +DCL+S C         +   N    GF+  +  K+G  IG+  G+P + V P
Sbjct  346   HYTTWFVKDCLHSNCTCVDTDVLCTHGENRAICGFLLITGQKDGASIGDPMGMPGVYVVP  405

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GME +V Y K+ + +IP+YVTE GY           ++  D KR+K+   YL ++  +I
Sbjct  406   QGMEDIVDYVKKTYNNIPIYVTENGYASNENQGGGY-DLDQDMKRIKYHKAYLASLARSI  464

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             R GADVRGYFIWSL DNFEW  GYT + GLY  D  T  R+PKLSA+WYK  +  +
Sbjct  465   RNGADVRGYFIWSLMDNFEWRFGYTIKFGLYHVDPLTLDRSPKLSAQWYKNLLTNS  520



>gb|KCW60131.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=497

 Score =   471 bits (1211),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 226/473 (48%), Positives = 313/473 (66%), Gaps = 30/473 (6%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT++SS+Q EGGYL   K LSNWDVFSH PG I DGSN DVA D Y+L+ ED  L+
Sbjct  37    SFLFGTATSSFQIEGGYLQGNKSLSNWDVFSHMPGKIEDGSNADVADDHYNLFLEDIQLM  96

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGV++++FSI+WSRVLP+GR G +N EGI++Y N+ID+LL++                
Sbjct  97    HSLGVDAYRFSIAWSRVLPQGRFGEVNSEGIEFYNNIIDALLVR----------------  140

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
              +DRY  WLS E+Q ++ YFA VCF+  GD+V YW  FNEPN+     Y    +P     
Sbjct  141   -EDRYGSWLSSEIQLDFGYFAQVCFEAFGDRVTYWSIFNEPNVLIYHGYLLGTYPPGRCS  199

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS G++  + +I  HN++L+HA A  IYRK YQ++QGG IGI +   WF P  +S
Sbjct  200   YPFGNCSYGDSALEPYIATHNLVLSHATAAEIYRKYYQEKQGGMIGIVISAPWFEPYDDS  259

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +R+ +F   WF+DP++YG YP EM+ +LGS LP +S+ + +KL  G  DFIG+
Sbjct  260   PADRLAVQRSLAFYIAWFVDPLVYGDYPPEMRQVLGSRLPTYSAEERKKLLEGKLDFIGV  319

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYTT Y +DC++S+C    S  +  + FV  +  K+G +IGE T +P   V P GME +
Sbjct  320   NHYTTLYVKDCMFSSC---ASPYSLGDAFVYLTGEKDGAYIGERTAMPLFFVVPRGMEGI  376

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             VTY KE++ + P+++TE GY     P  +I++ L+DTKR+++  +YL  +   +RKGADV
Sbjct  377   VTYVKERYNNTPMFITENGYAQ---PAGAIKDSLNDTKRIEYHENYLAVLSEVVRKGADV  433

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKV  348
             RGYFIWSL DNFEW  GY  R GL+  D  T KRTPK SA WY +F++++ K+
Sbjct  434   RGYFIWSLLDNFEWLYGYLIRFGLHYVDFQTLKRTPKWSATWYTEFLSEDNKI  486



>gb|KEH36810.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=420

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/379 (58%), Positives = 280/379 (74%), Gaps = 9/379 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G ILDG+NGDVA D Y  Y+ED DL+
Sbjct  43    NFLFGTASSSYQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLM  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
                GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQE
Sbjct  103   EHTGVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P     
Sbjct  163   LEERYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCS  222

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NS
Sbjct  223   DSFGNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNS  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGI
Sbjct  283   TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +
Sbjct  342   NHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENI  400

Query  686   VTYAKEKFPDIPLYVTETG  630
             VTY K+++ +IP+++TE G
Sbjct  401   VTYIKDRYNNIPMFITENG  419



>ref|XP_010675613.1| PREDICTED: beta-glucosidase 18-like [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 312/471 (66%), Gaps = 10/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FG  +S+YQ EG YL DGK LSNWDVF+H PGNI  G NGDVA D Y  Y ED + L
Sbjct  43    NFIFGVGTSAYQIEGAYLEDGKSLSNWDVFTHVPGNIESGENGDVADDHYHHYMEDIEKL  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVN+++FSISW+R+LP+GR G  N  G+ +Y N+ID+LLLKGI+PFVTI+H D+PQE
Sbjct  103   EYLGVNAYRFSISWTRILPRGRFGEKNPSGVLFYNNIIDNLLLKGIQPFVTIHHNDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAY-------RYRL  1227
             L+DRY  WLS E+QE++  FA  CF++ GD+VKYW+T NEPN+ AI AY       R   
Sbjct  163   LEDRYGSWLSSEIQEDFVLFAKTCFENFGDRVKYWVTINEPNINAILAYMEGAFPPRRCS  222

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  IVAHNM+++HA AV +YR  +Q +QGG IGI +    +   T+ 
Sbjct  223   APFGNCSVGNSNMEPLIVAHNMLISHAKAVKVYRDQFQPKQGGSIGIVVHAFHYERYTDD  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
                  A ERA++F   W +DP++YG YP  M+  +G  LP FS  ++ KL  G  DF+G+
Sbjct  283   EWGFQAIERAYAFNLAWLIDPLIYGDYPAIMRKYIGKELPNFSIEEV-KLVKGSVDFVGL  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT++YA DCL+ + D + S +   +GF  ++ S++G  IG+  G+    V P GME++
Sbjct  342   NHYTSFYAIDCLHHSTDCTPSEHRPVKGFTARTGSRDGIPIGDEMGMFGFHVVPHGMEKL  401

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y   ++P++ +Y+TE GYC       +  ++L D KR+K+   YL A+  A+R+GA V
Sbjct  402   LNYINMRYPNLSIYITENGYCPPYYQVGT--QMLSDFKRIKYHEAYLAALSKAMREGAKV  459

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQ  354
             +GYF WS  DNFEW  GY    GLY  DR T +R P+LSAKWY +FIA  +
Sbjct  460   KGYFAWSFMDNFEWLQGYNISFGLYFVDRKTMERIPRLSAKWYSEFIANGE  510



>ref|XP_004147832.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=557

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/499 (47%), Positives = 315/499 (63%), Gaps = 30/499 (6%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYD----LYKED  1578
             +FFFGT++S+YQ EG YL DGKGLSNWDVFSH P  I +   GDVA D Y     LY   
Sbjct  49    DFFFGTATSAYQVEGAYLEDGKGLSNWDVFSHLPARIRNSDTGDVADDHYHRFLVLYCYI  108

Query  1577  AD--------LLASLGVN--------SHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDS  1446
              D        +  S+G+           K SISW+R+LPKGR G +N  GI +Y  +ID+
Sbjct  109   IDWRVIIMIKITRSVGIEVNFGVFEFGRKISISWTRILPKGRFGKVNRRGIAFYNKIIDN  168

Query  1445  LLLKGIEPFVTINHYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNE  1266
             LLLKGIEPFVTI+H+DLP EL  RY  W+S +MQE++ YFA +CF+  GD+VKYWIT NE
Sbjct  169   LLLKGIEPFVTIHHHDLPAELDKRYGSWMSAQMQEDFVYFAKICFEEFGDRVKYWITINE  228

Query  1265  PNMWAIAAYRYRLW-------PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQ  1107
             PN+  +  Y   ++       P GNCS GNA  +  +V HNM+LAHA AV +YR ++Q++
Sbjct  229   PNVITLMGYTKGVYPPGHCSPPFGNCSTGNADIEPLVVMHNMLLAHAKAVRLYRTHFQKK  288

Query  1106  QGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLP  927
             QGG IGI      + P+T+   D  AA+RA  F+  W  DPI+YG YPKEM++ILGS LP
Sbjct  289   QGGSIGIVAYCHMYEPLTDHEYDIKAAQRALIFIFAWVYDPIVYGDYPKEMREILGSQLP  348

Query  926   EFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNF  747
              FS  + + ++ G  DFI +NHYTT+Y +DCL+S C     GN    G++  +  ++G  
Sbjct  349   SFSDVEKDIIR-GSLDFICVNHYTTFYTKDCLHSAC--FGGGNHPVTGYLNTTAYRDGVS  405

Query  746   IGELTGLPYLAVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRV  567
             IG+ TG+    V P G+ +V+ Y KE++P+ P++VTE GY    +  +  E ++ DTKRV
Sbjct  406   IGDPTGIDVFFVVPRGLGKVINYIKERYPNKPIFVTENGYSSPQSEGNETEVLIKDTKRV  465

Query  566   KFLADYLHAVGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSA  387
              +  +YL ++  A+R GADVRGYF+WSL DNFEW  GY  R GL   DR T +R PKLSA
Sbjct  466   NYHKNYLASLANAMRDGADVRGYFVWSLIDNFEWADGYDTRFGLLYVDRKTLERRPKLSA  525

Query  386   KWYKQFIAKNQKVDSKMQS  330
              W+  F+  N    +K  S
Sbjct  526   HWFSSFLGGNLHELTKYSS  544



>ref|XP_008453064.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=546

 Score =   471 bits (1212),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 312/459 (68%), Gaps = 10/459 (2%)
 Frame = -3

Query  1712  QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNSHKFS  1533
             + +GG++ DG+G SNWDVFSH PG I D   GDVA D Y  + ED +L++S+G+N+++FS
Sbjct  68    RLKGGFVEDGRGKSNWDVFSHIPGKIKDNDTGDVADDHYHRFTEDIELMSSMGMNAYRFS  127

Query  1532  ISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQGWLSP  1353
             ISW+R+LPKGR G +N  GI +Y  +ID+LLLKGIEPFVTI+H+DLP EL  RY  W+S 
Sbjct  128   ISWTRILPKGRFGEVNRRGIIFYNKIIDNLLLKGIEPFVTIHHHDLPDELDKRYGSWMSS  187

Query  1352  EMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------PHGNCSEGNA  1194
             +MQE++ YFA +CF+  GD+VK+WIT NEPN+  + AY   ++       P GNCS GN+
Sbjct  188   QMQEDFVYFARICFEEFGDRVKHWITINEPNLVTLMAYIRGVYPPAHCSPPFGNCSAGNS  247

Query  1193  TKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAH  1014
               +  IV HNM+LAHA AV +YR ++Q++QGG IGI  +   + P+TN   D  A +RA 
Sbjct  248   DIEPLIVMHNMLLAHAKAVFLYRTHFQKKQGGSIGITAVGHMYEPLTNHEFDIEAVDRAL  307

Query  1013  SFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDC  834
              F   W  DPI+YG YPKEM+++ GS LP FS T+   +K G  D+I +NHYTT Y +DC
Sbjct  308   IFNFAWVYDPIVYGDYPKEMREVFGSQLPSFSKTEKSIIK-GSLDYICVNHYTTLYTKDC  366

Query  833   LYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVVTYAKEKFPDI  654
             L+S C  S  G+   +GF+  +  ++   IG+ TG+    V P G+E+++ Y ++++P+ 
Sbjct  367   LHSPC--SNGGDRPIKGFLDTTGYRDSVSIGDPTGVDRFFVVPRGLEKIINYIRQRYPNN  424

Query  653   PLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIWSLFDN  474
             P+ VTE GY    +   ++E++++DTKRV F  +YL ++  A+R GADVRGYF+WSL DN
Sbjct  425   PIVVTENGYSMPPSDGKTLEDIINDTKRVNFHKNYLASLVRAMRNGADVRGYFVWSLMDN  484

Query  473   FEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             FEW  G+T R GL+  D  T +R PKLSA W+  F+  N
Sbjct  485   FEWIDGFTTRFGLWYVDFQTLERRPKLSAHWFASFLGGN  523



>ref|XP_010316607.1| PREDICTED: beta-glucosidase 18 isoform X2 [Solanum lycopersicum]
Length=425

 Score =   466 bits (1199),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 219/413 (53%), Positives = 297/413 (72%), Gaps = 11/413 (3%)
 Frame = -3

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
             ED  L+  +GVNS++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGIEPF+T+ H
Sbjct  3     EDIKLMEDMGVNSYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIEPFITLTH  62

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW  1224
             YD+PQEL++RY GWLS  +Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   +
Sbjct  63    YDVPQELEERYGGWLSSRIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYREGTY  122

Query  1223  P-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
             P        GNCS G++ ++ FI AHNMIL+HAAA++IYR  YQ++QGG IGI++   WF
Sbjct  123   PPARCSGIFGNCSAGDSEREPFIAAHNMILSHAAAISIYRTRYQKRQGGMIGISLDTQWF  182

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P +NS+ D AAAERA SF  NWFLDPI+ G YPKEM  ILGS+LP+FS  DL KL + G
Sbjct  183   EPFSNSSEDIAAAERARSFYVNWFLDPIILGRYPKEMVQILGSNLPDFSKNDLSKL-SYG  241

Query  884   SDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYP  705
              DFIGIN+YT  Y +DCLYS C+    GNT  EG    +  K+G +IG+ TG P++ +YP
Sbjct  242   LDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSYLATTEKDGVYIGQPTGAPWIFLYP  298

Query  704   PGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAI  525
              GM+++V Y +E+F + P+ +TE G  +    N SI + L+D+ RV +L   L+++  AI
Sbjct  299   QGMKKIVMYMRERFNNTPVVITENGIAENDNLNPSITDTLNDSHRVNYLYSCLNSLANAI  358

Query  524   RKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             R+GADVRGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  359   REGADVRGYFVWSLLDNFEWLHGYKLRFGLHYVNYTNLQRTPKLSATRYKQLM  411



>ref|XP_006594784.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Glycine max]
Length=507

 Score =   469 bits (1206),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 306/461 (66%), Gaps = 11/461 (2%)
 Frame = -3

Query  1724  SSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLASLGVNS  1545
             SSS + EG    DG G SNWDVF H PG I +  NGD+A D Y  Y ED +L++SLGVN 
Sbjct  21    SSSERIEGAPFEDGSGTSNWDVFCHTPGKINNDENGDIADDHYHRYLEDIELMSSLGVNV  80

Query  1544  HKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQELQDRYQG  1365
             ++FSISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQEL++ Y G
Sbjct  81    YRFSISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQELEEIYGG  140

Query  1364  WLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------PHGNCS  1206
             W+SP +Q ++ +FA++CFK  GD+VKYW T NEPN ++  AY   ++       P GNC 
Sbjct  141   WISPLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYPPGRCSPPFGNCK  200

Query  1205  EGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAA  1026
              GN+  +  I  HNM+L+HA AV++YRK++Q +QGG IGI      F P+ +   D+ AA
Sbjct  201   TGNSDVEPLIALHNMLLSHAKAVDLYRKHFQAKQGGTIGIVADSLMFEPLRDEECDRQAA  260

Query  1025  ERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYY  846
              RA +F     LDP+++G YP EM+ ILGS LP FS  + + L  G  DFIGINHY T Y
Sbjct  261   SRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSPKE-KSLIKGSLDFIGINHYGTLY  319

Query  845   AQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGE-LTGLPYLAVYPPGMERVVTYAKE  669
             A+DC  STC  S+  +    GFV  + ++NG  IGE  TG+    V P G+E++  Y K 
Sbjct  320   AKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPQTGIAQFFVVPRGVEKLADYIKM  377

Query  668   KFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVRGYFIW  489
             ++ +IP+Y+TE GY     P+ +I + L D KR+ +   YL A+  +IRKGADVRGY IW
Sbjct  378   RYHNIPMYITENGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIW  437

Query  488   SLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             SL DNFEW SGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  438   SLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFL  478



>ref|XP_010324440.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=521

 Score =   466 bits (1199),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 315/487 (65%), Gaps = 27/487 (6%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGTS+S+YQ EGGY+ DGK LSNWDV+SH  G+I +G NGD+A D Y  Y ED D++ 
Sbjct  44    FLFGTSTSAYQIEGGYIEDGKSLSNWDVYSHTNGSIKNGGNGDIADDHYHRYLEDIDIME  103

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISWSRVLP G  G +N  G+K+Y N+ID+LLLKGI PFVT +H D PQEL
Sbjct  104   SLGVNAYRFSISWSRVLPNGSSGPMNPAGMKFYNNIIDNLLLKGITPFVTTHHNDYPQEL  163

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             ++RY  WLSP MQEE+ +FA  CFK+ GD+VKYW T NEPN+++  AY   ++       
Sbjct  164   EERYGAWLSPFMQEEFVHFASTCFKNFGDRVKYWATINEPNLFSELAYMKGIFPPSHCSP  223

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G C  GN+  +  +V HN ILAHA AV IYR  +Q +Q G IG+      + PMT+  
Sbjct  224   PFGKCGYGNSDIEPLLVVHNSILAHAKAVKIYRDQFQVEQRGMIGMVASAYMYKPMTDDE  283

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGS-DFIGI  867
             VDK AA RA +F   W LDP+++G YP EM+   G  LP FS    EKL    S DFIGI
Sbjct  284   VDKKAATRALTFHVAWLLDPLVHGDYPIEMRHYHGKKLPRFSFE--EKLLIKKSIDFIGI  341

Query  866   NHYTTYYAQDCLYSTC------DPSMSGNTREEGFVGQSLS----KNGNFIGELTGLPYL  717
             NHY+T + +DCL+S C      +P+ S +      VG  L+    K+G FIG+  GLP L
Sbjct  342   NHYSTLFVKDCLHSNCTCMHENNPTCS-HGENHAIVGFLLTSGQNKDGEFIGDPMGLPGL  400

Query  716   AVYPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAV  537
              V P GME ++ Y K+++ ++P++VTE GY       S+  ++  D  R+KF   YL ++
Sbjct  401   YVVPQGMEDIIDYIKKRYNNMPIFVTENGY------GSNDNDLDKDINRIKFHKAYLASL  454

Query  536   GTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
               +IR GADVRGYFIWSL DNFEW  GYT + GLY  D  T  R+PKLSA WY  F+  +
Sbjct  455   ARSIRNGADVRGYFIWSLMDNFEWNFGYTIKFGLYYVDPFTLDRSPKLSAHWYHNFLTND  514

Query  356   QKVDSKM  336
              + +  +
Sbjct  515   IQAEKSI  521



>ref|XP_008226673.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Prunus mume]
Length=526

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 305/476 (64%), Gaps = 17/476 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG  +SSYQ EG YL DGK LSNWDVF H PG I    NGDVA D Y  Y ED +L+ 
Sbjct  36    FLFGAGTSSYQVEGAYLEDGKSLSNWDVFCHTPGTIESNENGDVADDHYHRYLEDIELMH  95

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+NS++FSISW+R+LP G  G  N  GI +Y  LID LLLKGIEPFVT++H D+PQ L
Sbjct  96    SLGMNSYRFSISWARILPDGMLGKTNPSGITFYNKLIDHLLLKGIEPFVTVHHNDMPQVL  155

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             + R  GWLSP ++EE+A+FA +CFK  GD+VKYWITFNEPN+    AY  R W       
Sbjct  156   EQRDGGWLSPLLREEFAHFASICFKSFGDRVKYWITFNEPNLMIEFAY-IRGWYPPARCS  214

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  I  HN+++AHA AV+ YR+ +  +Q G IGI      + P+ + 
Sbjct  215   TPFGNCSSGNSDTEPLIAMHNILIAHATAVDTYRRVFWPKQHGFIGIVANAHMYEPLRDD  274

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +RA +F   W  DP+++G YP EM++  G  LP FS  + + L+ G  DFIG 
Sbjct  275   ERDRHAVDRALAFNVAWMFDPLVHGDYPSEMRECPGLELPRFSHNEKQLLR-GSIDFIGF  333

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y +DC++S C   + G+    GF+  +  ++G  IGE TG+P   V P GME++
Sbjct  334   NHYSTLYVKDCIHSAC--PLGGDHAIRGFLNTTGYRDGVPIGEPTGMPRFFVVPRGMEKM  391

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K+++ + P+++TE GY   + P    E  L D  R+KF   Y+ +V  AIR GADV
Sbjct  392   LDYLKQRYNNKPMFITENGY---SLPTPQTE--LQDWNRIKFHKAYMASVARAIRNGADV  446

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             RGYFIWSL DNFEW SGYT R GLY  DR T  RTPKLSA W+  F+  +   D +
Sbjct  447   RGYFIWSLMDNFEWLSGYTTRFGLYYVDRKTLHRTPKLSAGWFASFLRNSSHNDRE  502



>ref|XP_002448177.1| hypothetical protein SORBIDRAFT_06g022490 [Sorghum bicolor]
 gb|EES12505.1| hypothetical protein SORBIDRAFT_06g022490 [Sorghum bicolor]
Length=517

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 310/468 (66%), Gaps = 15/468 (3%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL DGKGL NWDVF+H   G I+DG  GDVA D Y  Y  D ++L
Sbjct  35    FLFGAATSAYQIEGAYLEDGKGLCNWDVFTHTHTGAIMDGRTGDVADDHYHRYMGDVEIL  94

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVN+++FSISW+R+LP+GR G +N  GI +Y  LID+LL KGI+PFVT+NH+D+P E
Sbjct  95    QSLGVNAYRFSISWARILPRGRLGGVNAGGIAFYNRLIDALLQKGIQPFVTLNHFDMPHE  154

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPN-------MWAIAAYRYRL  1227
             L  RY GWL   +++E+ Y+ADVCF   GD+V++W TFNEPN       M  +   R+  
Sbjct  155   LDVRYVGWLGAGIRDEFEYYADVCFAAFGDRVRFWTTFNEPNLSTKFQYMLGVYPPRHCS  214

Query  1226  WPHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P G+C+ GN+ ++ ++ AHN+I++HAAAV  Y+++YQ +QGG IGI     W+ P+TN+
Sbjct  215   PPFGSCNSGNSHREPYVAAHNIIMSHAAAVRNYKESYQAKQGGSIGIVTAMKWYEPLTNT  274

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T D  AA RA SF + WFLDPI +G YP+ M++IL S+LP F++ + + L     DFIG+
Sbjct  275   TEDILAARRAQSFETEWFLDPIFFGDYPRAMREILQSNLPTFTAEEKKLLLQYKPDFIGL  334

Query  866   NHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             NHYT  YA+DC++S C+  +  GN     FV  +  K+G  IG  T L      P  +E 
Sbjct  335   NHYTAIYAKDCIHSPCNLQTYEGN----AFVLATGEKDGVKIGRDTALSGFYDVPEAIEP  390

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
              + +   ++ D P+Y+TE G+   +  N   E +++D  R  +L  Y+  +  A+R GA+
Sbjct  391   AIMFVNGRYKDTPVYITENGFSQWSDANR--EGLINDVARKNYLQGYVTCLSKAVRNGAN  448

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             VRGYF+W+L DNFEWT GYT R GLY  D  TQ+RTP++SA WY+ F+
Sbjct  449   VRGYFVWTLLDNFEWTFGYTVRFGLYHVDYDTQERTPRMSATWYQGFL  496



>ref|XP_004976203.1| PREDICTED: beta-glucosidase 16-like [Setaria italica]
Length=518

 Score =   464 bits (1193),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/485 (47%), Positives = 317/485 (65%), Gaps = 20/485 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++S+YQ EG YL DGK L NWDVF+H    I DG NGDVA D Y  Y  D ++L 
Sbjct  37    FLFGAATSAYQIEGAYLEDGKSLCNWDVFTHTHVGIKDGRNGDVADDHYHRYMGDVEILQ  96

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVN+++FSISW+R+LP+GR G +N +GI +Y  LID+LL KGI+PFVT++H+D+P EL
Sbjct  97    SLGVNAYRFSISWARILPRGRLGGVNPDGIAFYNRLIDALLQKGIQPFVTLHHFDMPHEL  156

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             + R+ GWL   ++EE+ ++ADVCF+  GD+V++W TFNEPN++    Y    +       
Sbjct  157   EVRHVGWLGAGIREEFEHYADVCFRAFGDRVRFWTTFNEPNLFTKFQYMLGAYPPSHCSA  216

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G C+ G++ ++ +  AHN+I++HAAAV  Y++NYQ +QGG IGI +   W+ P+TN+T
Sbjct  217   PFGTCNSGDSQREPYAAAHNIIMSHAAAVRNYKENYQAKQGGSIGIVIAMKWYEPLTNTT  276

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D  AA RA SF   WFLDPI +G YP  M++IL S+LP F+S + +KL    SDFIG+N
Sbjct  277   EDILAARRAQSFELEWFLDPIFFGDYPSHMREILRSNLPTFTSEE-KKLLQYKSDFIGLN  335

Query  863   HYTTYYAQDCLYSTCDPSM-SGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
              YT  YA+DC++S CD S   GN      V  +  ++G  IG  T L    V P  +E  
Sbjct  336   LYTAIYAKDCIHSPCDLSTYEGN----ALVFATGERDGVMIGGDTALGGFYVVPQAVEPA  391

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y  +++ D P+YV+E GY   +  +   EE+++D +R+ +L  Y+  +  AIR GADV
Sbjct  392   IMYVNQRYKDTPVYVSENGYSQWS--DVGREELINDVERLNYLQGYVTHLSRAIRNGADV  449

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQ--FDRATQKRTPKLSAKWYKQFIAKNQK---VDS  342
             RGYF+W+L DNFEWT GYT R GLY   FD   + RTP++SA+WY+ F+  +      D 
Sbjct  450   RGYFVWTLMDNFEWTFGYTVRFGLYHVDFDTPERTRTPRMSARWYRSFLTGSSAGALTDE  509

Query  341   KMQSR  327
               Q R
Sbjct  510   AQQGR  514



>ref|XP_010533828.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Tarenaya hassleriana]
Length=421

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 289/417 (69%), Gaps = 8/417 (2%)
 Frame = -3

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             +ASLGVNS++FSISW+R+LPKGR G IN  GIKYY  LID+LL KGI+PFVT+NH D PQ
Sbjct  1     MASLGVNSYRFSISWARILPKGRFGGINYSGIKYYNRLIDALLSKGIQPFVTLNHLDYPQ  60

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
             EL+DRYQ WLSPE++E++ Y AD CF++ G +VK+WIT NEPN   + +YR  ++     
Sbjct  61    ELEDRYQSWLSPEIREDFGYLADTCFRYFGHRVKHWITVNEPNQQIVLSYRKGIFPPCRC  120

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P+GNC +GN+  + F  AHNMILAHA AV IYR  YQ++Q G IGI +  +WF P++ 
Sbjct  121   SSPYGNCGKGNSETEPFTAAHNMILAHAEAVRIYRTKYQKEQSGSIGIVVQTSWFEPISE  180

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
             ST DK AAERA SF SNW LDP +YG YP EM ++LG  LPEFS    + LK  G DF+G
Sbjct  181   STADKLAAERAQSFYSNWILDPAIYGKYPDEMVELLGPALPEFSVDQAKDLKKLGVDFVG  240

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+Y+ +DC +S+C     G++R EGF  +   K    IGELT + +  VYP G  +
Sbjct  241   INHYTSYFVKDCYFSSCQRG-DGSSRTEGFALKFDRKGNVSIGELTDVDWQHVYPRGFRK  299

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             V+ Y K ++ + P++VTE GY D    ++++EE+++D KR +++  +L+A+  A+R GA+
Sbjct  300   VLDYIKNRYHNTPIFVTENGYGDLEKQDTTVEELVNDIKRREYMRGHLNALQAAMRNGAN  359

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             V+GYF WSL DN+EW  GY  R GL+  D  T  RTPKLSA WYK FI  +    S+
Sbjct  360   VKGYFAWSLLDNYEWLYGYRLRFGLFHVDFTTLNRTPKLSASWYKYFINYHTNTSSR  416



>gb|KHN36807.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 307/470 (65%), Gaps = 14/470 (3%)
 Frame = -3

Query  1742  FFFGTSSSSY-QYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F F  S+  Y Q EG    DG G SNWDVFSH PG I +  NGD+A D Y  Y ED +L+
Sbjct  34    FTFPFSAFKYVQIEGAPFEDGSGTSNWDVFSHTPGKINNDENGDIADDHYHRYLEDIELM  93

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             +SLGVN ++FSISW+R+LP+G +GNIN  GI +Y  +ID+LLL+GIEPFVTI+H+D+PQE
Sbjct  94    SSLGVNVYRFSISWTRILPRGIYGNINPSGIMFYNKIIDNLLLRGIEPFVTIHHHDMPQE  153

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L++ Y GW+SP +Q ++ +FA++CFK  GD+VKYW T NEPN ++  AY   ++      
Sbjct  154   LEEIYGGWISPLIQRDFVHFAEICFKSFGDRVKYWTTINEPNQFSDFAYMRGIYPPGRCS  213

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNC  GN+  +  I  HNM+L+HA AV++YRK++Q +QGG IGI      F P+ + 
Sbjct  214   PPFGNCKTGNSDVEPLIALHNMLLSHAKAVDLYRKHFQAKQGGTIGIVADSLMFEPLRDE  273

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ AA RA +F     LDP+++G YP EM+ ILGS LP FS  + + L  G  DFIGI
Sbjct  274   ECDRQAASRALTFELARVLDPLVFGEYPAEMRSILGSKLPVFSPKE-KSLIKGSLDFIGI  332

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY T YA+DC  STC  S+  +    GFV  + ++NG  IGE TG+    V P G+E++
Sbjct  333   NHYGTLYAKDCTLSTC--SLGADHPIRGFVETTATRNGVPIGEPTGIAQFFVVPRGVEKL  390

Query  686   VTYAKEKFPDIPLY---VTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKG  516
               Y K ++ +IP+    VT  GY     P+ +I + L D KR+ +   YL A+  +IRKG
Sbjct  391   ADYIKMRYHNIPMRPITVTMEGYSPPPKPDVTIHDSLQDFKRIDYHKAYLAALLRSIRKG  450

Query  515   ADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             ADVRGY IWSL DNFEW SGY  R GLY  DR T +R PKLS +W+  F+
Sbjct  451   ADVRGYMIWSLMDNFEWASGYDIRFGLYYVDRQTLERIPKLSVQWFSSFL  500



>ref|XP_008226671.1| PREDICTED: beta-glucosidase 18-like [Prunus mume]
Length=533

 Score =   463 bits (1191),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 308/470 (66%), Gaps = 15/470 (3%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG S+SSYQ EG YL DGKGLSNWD F+  PG I D  NG+VA D Y+ Y ED +L+
Sbjct  42    DFLFGASTSSYQVEGAYLEDGKGLSNWDFFTQIPGKIADDDNGEVADDHYNRYLEDIELM  101

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLG N+++FSISW+R+LP G  G++N  GI +Y  LID+L+ KGIEPFVTI+H DLPQ 
Sbjct  102   HSLGTNAYRFSISWARILPDGMLGSVNPRGIIFYNKLIDNLISKGIEPFVTIHHSDLPQV  161

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ R  GWLSP +++E+ +FA VCF+  GD+VKYW+T NEPNM A  AY   L+      
Sbjct  162   LEQRDGGWLSPLLRKEFVHFASVCFESFGDRVKYWVTINEPNMMAYFAYLKGLYPPARCS  221

Query  1223  -PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
              P GNCS GN+  +  I  HNM++AHA AV IYR  + ++Q G IGI      + P+ + 
Sbjct  222   PPFGNCSTGNSDIEPLIGMHNMLIAHAMAVEIYRTFFWRKQNGFIGIVAHAFMYEPLRDE  281

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+ A +RA +F   W  DP++YG YP EM+   G  LP FS+ + + L+ G  DFIG+
Sbjct  282   ERDRDAVDRALAFNVAWTFDPVVYGDYPAEMRHCHGLELPRFSAKEKQLLR-GSIDFIGV  340

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHY+T Y +DC++S C PS  G+    GF+  +  ++G  IGE TGL    V P GME++
Sbjct  341   NHYSTLYVKDCIHSPC-PS-GGDRPIMGFLNTTGYRDGVPIGEPTGLADFFVVPRGMEKI  398

Query  686   VTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADV  507
             + Y K+++ ++P++VTE G C   T  + +E    D  R+ F   YL ++  AIR GADV
Sbjct  399   IDYVKQRYNNMPMFVTENG-CTLQTQENELE----DRDRINFHKSYLASLARAIRSGADV  453

Query  506   RGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             RGYF+WS+ DNFEW  GYTKR GLY  DR T +RTPKLS  W+  F+  N
Sbjct  454   RGYFVWSVMDNFEWVKGYTKRFGLYYVDRETLERTPKLSVGWFASFLRNN  503



>ref|XP_008226672.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Prunus mume]
Length=528

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/478 (49%), Positives = 305/478 (64%), Gaps = 19/478 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQ--YEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADL  1569
             F FG  +SSYQ   EG YL DGK LSNWDVF H PG I    NGDVA D Y  Y ED +L
Sbjct  36    FLFGAGTSSYQAYVEGAYLEDGKSLSNWDVFCHTPGTIESNENGDVADDHYHRYLEDIEL  95

Query  1568  LASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQ  1389
             + SLG+NS++FSISW+R+LP G  G  N  GI +Y  LID LLLKGIEPFVT++H D+PQ
Sbjct  96    MHSLGMNSYRFSISWARILPDGMLGKTNPSGITFYNKLIDHLLLKGIEPFVTVHHNDMPQ  155

Query  1388  ELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-----  1224
              L+ R  GWLSP ++EE+A+FA +CFK  GD+VKYWITFNEPN+    AY  R W     
Sbjct  156   VLEQRDGGWLSPLLREEFAHFASICFKSFGDRVKYWITFNEPNLMIEFAY-IRGWYPPAR  214

Query  1223  ---PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
                P GNCS GN+  +  I  HN+++AHA AV+ YR+ +  +Q G IGI      + P+ 
Sbjct  215   CSTPFGNCSSGNSDTEPLIAMHNILIAHATAVDTYRRVFWPKQHGFIGIVANAHMYEPLR  274

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             +   D+ A +RA +F   W  DP+++G YP EM++  G  LP FS  + + L+ G  DFI
Sbjct  275   DDERDRHAVDRALAFNVAWMFDPLVHGDYPSEMRECPGLELPRFSHNEKQLLR-GSIDFI  333

Query  872   GINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGME  693
             G NHY+T Y +DC++S C   + G+    GF+  +  ++G  IGE TG+P   V P GME
Sbjct  334   GFNHYSTLYVKDCIHSAC--PLGGDHAIRGFLNTTGYRDGVPIGEPTGMPRFFVVPRGME  391

Query  692   RVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGA  513
             +++ Y K+++ + P+++TE GY   + P    E  L D  R+KF   Y+ +V  AIR GA
Sbjct  392   KMLDYLKQRYNNKPMFITENGY---SLPTPQTE--LQDWNRIKFHKAYMASVARAIRNGA  446

Query  512   DVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKNQKVDSK  339
             DVRGYFIWSL DNFEW SGYT R GLY  DR T  RTPKLSA W+  F+  +   D +
Sbjct  447   DVRGYFIWSLMDNFEWLSGYTTRFGLYYVDRKTLHRTPKLSAGWFASFLRNSSHNDRE  504



>ref|XP_010675614.1| PREDICTED: beta-glucosidase 18-like [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   461 bits (1186),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/471 (48%), Positives = 305/471 (65%), Gaps = 11/471 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FG ++S+YQ EG YL DGK L+NWDVFS  PGNI +G NG VA D Y  Y ED + L
Sbjct  57    DFLFGVATSAYQIEGAYLEDGKSLNNWDVFSRIPGNIANGDNGYVADDHYHRYMEDIENL  116

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              +L VN+++FSISW+R+LP+GR+G +N  G+ +Y  +ID+LLL GIEPFVTI H DLPQE
Sbjct  117   KNLRVNTYRFSISWARILPRGRYGEVNPLGVAFYNKIIDNLLLAGIEPFVTIYHADLPQE  176

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+DRY  WL+  +QE++ +FA  CF++ GD+V+YW T NEPN+    +Y  R W      
Sbjct  177   LEDRYGSWLNAIIQEDFVHFAKTCFENFGDRVRYWSTINEPNLLTDMSY-IRGWFPPGHC  235

Query  1223  --PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTN  1050
               P GNCS GN+  +  IV HNM+++HA AV +YR  +Q  QGG IGI ++   + P  +
Sbjct  236   SPPFGNCSRGNSDVEPLIVIHNMLISHAKAVKLYRDQFQPIQGGTIGIVIVAVNYEPYRD  295

Query  1049  STVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIG  870
                   A ERA +F   W +DP++YG YP  M+   G  LP FS  + E +K G  DF G
Sbjct  296   DIFSHQAVERAFAFNVAWVMDPLIYGDYPPLMRKYHGKELPMFSKEERELVK-GSVDFFG  354

Query  869   INHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMER  690
             INHYT+ YA DC + + + +     R  GF G +  ++G  IG+ TG P   V P GME+
Sbjct  355   INHYTSLYAVDCFFYSAECNSGEKRRIRGFAGTTGYRDGIPIGDETGNPRFFVVPQGMEK  414

Query  689   VVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGAD  510
             V+ Y   K+P+  LYVTE GY      +++  ++L D KRVK+   YL ++  AIR+GA 
Sbjct  415   VMNYMGVKYPNTTLYVTENGYSPPRL-STNRSDMLQDFKRVKYHQAYLKSLARAIRRGAK  473

Query  509   VRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             V+GYF W+L DNFEW SGY    GLY  DR TQ RTPKLSAKWY +F+A+N
Sbjct  474   VKGYFAWTLMDNFEWASGYNVTYGLYYVDRRTQIRTPKLSAKWYAKFLAEN  524



>ref|XP_011098339.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=568

 Score =   462 bits (1188),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 228/474 (48%), Positives = 308/474 (65%), Gaps = 19/474 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FG ++S+YQ EG  L DG+  SNWDVF    G+I DG NGD+A D Y  Y ED +++ 
Sbjct  78    FLFGAATSAYQIEGAVLEDGRSFSNWDVFCRIQGSIADGKNGDIAEDHYHRYMEDIEIMH  137

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLG+ +++FSISWSRVLP+GR G +N  GI +Y ++ID+LLL+GI+PFVTI H + PQE 
Sbjct  138   SLGLTAYRFSISWSRVLPRGRLGGVNQAGITFYNSIIDNLLLRGIQPFVTIFHNEYPQEF  197

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +DR+ GWLSP MQEE+ +FA+ CFKH  D+VKYW+T NEPN++A  AY    +       
Sbjct  198   EDRFGGWLSPVMQEEFVHFAETCFKHFSDRVKYWMTINEPNLFAEMAYERATFPPARCSP  257

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P G+C+ GN+  +  I  HN++LAHA A  +YR+ Y+ +  G I I +    + P+ +  
Sbjct  258   PFGHCASGNSDVEPLIAVHNLLLAHAKAAKLYREQYKSKVNGVISITVCAFMYTPLRDVE  317

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ AA RA +F   W LDP+++G YP EM+   GS LP FS  + E L+    DFIGIN
Sbjct  318   DDREAANRALAFNVAWALDPLVFGDYPPEMRSYHGSELPSFSPEERELLR-DSIDFIGIN  376

Query  863   HYTTYYAQDCLYSTC---DPSMS-GNTRE-EGFVGQSLSKNGNFIGELTGLPYLAVYPPG  699
             HY T YA+DC++S+C   D S S G+ R   GFV  +   NG  IGE TG+    V P G
Sbjct  377   HYGTLYAKDCIHSSCICNDSSCSQGSDRPIRGFVYTTGECNGVTIGERTGMSRFFVVPRG  436

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             ME +V Y KE++ + P++VTE GY   ++P S  +   HD KR+ +   YL     A+R 
Sbjct  437   MEDIVHYMKERYHNKPMFVTENGY---SSPGSEDDIYQHDVKRIHYHQSYL---AQAVRN  490

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GADVRGYFIWSL DNFEW+SGY  R G+Y+ D  T  R PKLSA WY+ F++ +
Sbjct  491   GADVRGYFIWSLMDNFEWSSGYGTRFGIYRIDPQTLNRIPKLSATWYRDFLSNS  544



>gb|AIP98403.1| beta-glucosidase [Pinus sylvestris]
Length=513

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 321/475 (68%), Gaps = 23/475 (5%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             +F FGT+SS+YQYEG    DGKG S WD  +H PG I D SNGDVAADQY  Y ED +L+
Sbjct  33    DFMFGTASSAYQYEGAVREDGKGPSTWDALTHMPGRIKDSSNGDVAADQYHRYMEDIELM  92

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
             ASLG+++++FSISWSR+LP+GR G IN+ GI+YY NLID+LL  GI+PFVT+ H+DLP+ 
Sbjct  93    ASLGLDAYRFSISWSRILPEGR-GEINMAGIEYYNNLIDALLQNGIQPFVTLFHFDLPKA  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWPHGNCS  1206
             L+D Y GWLSP++  ++  +A++CF+  GD+VKYW T NEPN++    Y   ++P   C+
Sbjct  152   LEDSYGGWLSPQIINDFEAYAEICFRAFGDRVKYWATVNEPNLFVPLGYTVGIFPPTRCA  211

Query  1205  EGNA----------TKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPM  1056
               NA          + + ++ AH+++LAHAAAV  YR+ YQ+ QGG IG+ M   W+ P+
Sbjct  212   APNANSLCITGNCSSAEPYLAAHHVLLAHAAAVEKYREKYQKIQGGSIGLVMSAPWYEPL  271

Query  1055  TNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDF  876
              +S  +++A +R  SF   WFLDPI++G YP+EM++ LGS LP  SS    KL+ G  D+
Sbjct  272   EDSPEERSAVDRILSFNLRWFLDPIVFGDYPQEMRERLGSRLPSISSELSAKLR-GSFDY  330

Query  875   IGINHYTTYYAQDCLYSTCDPSMSGNTRE----EGFVGQSLSKNGNFIGELTGLPYLAVY  708
             +GINHYTT      LY+T  P +S +  +    +  V  +  ++G  IGE TG+  L V 
Sbjct  331   MGINHYTT------LYATTTPPLSPDNTQYLYPDSRVYLTGERHGVSIGERTGMDGLFVV  384

Query  707   PPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTA  528
             P G++++V Y KE + +  + +TE GY D+   +S+++E L+D +R++F  D L  +  A
Sbjct  385   PHGIQKIVEYVKEFYDNPIIIITENGYPDSEESSSTLQENLNDVRRIRFHGDCLSYLSAA  444

Query  527   IRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRAT-QKRTPKLSAKWYKQFI  366
             I+ G+DVRGYF+WSL DNFEW  GYT R GLY  D  + QKR PKLSA+W++QF+
Sbjct  445   IKNGSDVRGYFVWSLLDNFEWAFGYTIRFGLYHVDFISDQKRYPKLSARWFRQFL  499



>ref|XP_008661459.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW58836.1| beta-glucosidase [Zea mays]
Length=519

 Score =   458 bits (1179),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 224/485 (46%), Positives = 315/485 (65%), Gaps = 21/485 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL DGKGL NWDVF+H   G ++DG  GDVA D Y  Y  D ++L
Sbjct  39    FLFGAATSAYQIEGAYLEDGKGLCNWDVFTHTHSGGVMDGRTGDVADDHYHRYVGDLEIL  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVN+++FSISW+RVLP+GR G +N  G+ +Y  LID+LL KGI+PFVT+NH+D+P+E
Sbjct  99    QSLGVNAYRFSISWARVLPRGRVGGVNAGGVAFYNRLIDALLQKGIQPFVTLNHFDMPRE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY GWL   ++EEY ++ADVCF   GD+V+ W TFNEPN+  +  ++Y L       
Sbjct  159   LEVRYGGWLDAGIREEYEHYADVCFGAFGDRVRLWTTFNEPNL--LVKFQYMLGAYPPSR  216

Query  1223  ---PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
                P G+C  G++ ++ +  AHN+I++HAAAV  YR+ YQ  QGG +GI     W+ P+T
Sbjct  217   CSPPFGSCGSGDSRREPYAAAHNIIMSHAAAVRAYREKYQATQGGSVGIVAAMKWYEPLT  276

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             NST D  AA RA +F ++WFL+PI  G YP  M++ILGS LP F++ +   L    +DFI
Sbjct  277   NSTDDILAARRAQAFETDWFLEPIFLGDYPGAMREILGSDLPTFTAEEKALLLRYKADFI  336

Query  872   GINHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSK-NGNFIGELTGLPYLAVYPPG  699
             G+NHYT  YA+DCL S C+  S  GN     FV  +  + +G  IG  T L      P  
Sbjct  337   GLNHYTAIYARDCLRSPCNLGSYEGNA----FVSATGERDDGVKIGGDTALAGFFDVPEA  392

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             +E  + Y   ++   P+Y+TE GY   +  ++S EE++ D +R  +L  Y+  +  A+R 
Sbjct  393   IELAIQYVNGRYKGTPVYITENGYSQWS--DASREELIDDVRRKNYLQGYITYLSKAVRN  450

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI-AKNQKVDS  342
             GA+VRGYF+W+L DNFEW  GY  + GLY  D  TQ+RTP++SA+WY+ F+ A+  + D 
Sbjct  451   GANVRGYFVWTLLDNFEWAFGYRLKYGLYHVDFDTQERTPRMSARWYQGFLTARTSQRDE  510

Query  341   KMQSR  327
               Q+R
Sbjct  511   AAQAR  515



>gb|KFK28774.1| hypothetical protein AALP_AA7G045600 [Arabis alpina]
Length=509

 Score =   457 bits (1177),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/483 (48%), Positives = 320/483 (66%), Gaps = 47/483 (10%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQY+G YL+DGK LSNWDVF+  PG I DGS+G VA D Y  Y ED +L+
Sbjct  47    NFLFGTASSSYQYQGAYLTDGKTLSNWDVFTSIPGKIADGSHGKVAVDHYHRYPEDLNLM  106

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
               LGVNS++ S+SW+R+LPKGR G++N               + GIEPFVT+ HYD+PQE
Sbjct  107   EDLGVNSYRLSLSWARILPKGRFGDVN---------------MAGIEPFVTLTHYDIPQE  151

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L+ RY  WL+P+++E++ ++A++CF++ G++VK+W TFNEPN+  I  YR   +P     
Sbjct  152   LEFRYGSWLNPQIREDFEHYAEICFQYFGNRVKFWSTFNEPNVQVILGYRKGTYPPSRCS  211

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNC++G++  +  + AHN+I +H AAVNIYRKNYQ++Q G+IGI M   WF P+++S
Sbjct  212   KSFGNCTQGDSYIEPLVAAHNIIRSHLAAVNIYRKNYQEEQRGKIGIVMNTIWFEPVSDS  271

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
               D+     A +F  NWFLDP+++G YPKEM++I G  LPEF+  D  K+   G DFIGI
Sbjct  272   LADRL----AQAFYMNWFLDPVVFGRYPKEMQEIFGEDLPEFTK-DERKMSKKGLDFIGI  326

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGE-LTGLPYLAVYPPGMER  690
             N YT+ YA+DCL+S C+P   G +R EGFV  +  K+G  +GE +    +   +     +
Sbjct  327   NQYTSNYAKDCLHSPCEPG-KGGSRVEGFVDPNALKDGLPLGETVFSETFFEFF--DWSK  383

Query  689   VVTYAKEK-----------FPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLH  543
             +V+Y   +             +IPLY+TE GY +  T       +L+D  RVKF++ YL 
Sbjct  384   LVSYLSSRNGEDVDVCNKAIQNIPLYLTENGYGENNT-----RIMLNDYPRVKFMSCYLD  438

Query  542   AVGTAIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIA  363
             A+  A+RKGADVRGYF WSL DNFEWT GYT + GLY  D  T +RTP+LSA WYK+FI 
Sbjct  439   ALKRAMRKGADVRGYFTWSLLDNFEWTLGYTIQFGLYHVDFNTLERTPRLSASWYKKFIF  498

Query  362   KNQ  354
             +++
Sbjct  499   QHR  501



>ref|XP_010316603.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Solanum lycopersicum]
Length=431

 Score =   454 bits (1169),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 293/414 (71%), Gaps = 11/414 (3%)
 Frame = -3

Query  1586  KEDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTIN  1407
             +ED  L+  +GVN ++FSISW+R+LPKG  G++N+ GI++Y  LID+LL KGI+P +T+ 
Sbjct  8     QEDIKLMEDMGVNGYRFSISWARILPKGTFGDVNMAGIEHYNKLIDALLQKGIQPLITLT  67

Query  1406  HYDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRL  1227
             HYD+PQEL++RY GWLS ++Q++++Y+AD+CFK+ GD+VKYW T NEPN+ A+  YR   
Sbjct  68    HYDIPQELEERYGGWLSSQIQDDFSYYADICFKYFGDRVKYWTTINEPNLMAVRGYRLGT  127

Query  1226  WPH-------GNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTW  1068
             +P        GNCS G++ ++ FI AHNMIL+HAAAV+ YR  YQ++QGG IGI++   W
Sbjct  128   YPPSRCSGIVGNCSAGDSEREPFIAAHNMILSHAAAVSTYRTRYQKRQGGMIGISLDTQW  187

Query  1067  FLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAG  888
             + P +NS  D AA ERA SF  NWFLDPI+ G YPKEM +ILGS+LP+FS  DL KL + 
Sbjct  188   YEPFSNSPEDIAATERARSFYVNWFLDPIILGRYPKEMVEILGSNLPDFSKNDLSKL-SY  246

Query  887   GSDFIGINHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVY  708
             G DFIGIN+YT  Y +DCLYS C+    GNT  EG   ++  K+G +IG+ T + +L +Y
Sbjct  247   GLDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSFFETREKDGVYIGQPTEVDWLFLY  303

Query  707   PPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTA  528
             P GM+++V Y K++F + P+ +TE G  +    N SI + L+D  RV ++  YL+++  A
Sbjct  304   PQGMKKIVMYMKDRFNNTPMVITENGIAENDNLNPSITDTLNDIHRVNYMHSYLNSLANA  363

Query  527   IRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             I  GADVRGYF+WSL DNFEW  GY  R GL+  +    +RTPKLSA  YKQ +
Sbjct  364   ITDGADVRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNLQRTPKLSATMYKQLM  417



>gb|KEH36807.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=411

 Score =   452 bits (1164),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 271/370 (73%), Gaps = 9/370 (2%)
 Frame = -3

Query  1745  NFFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLL  1566
             NF FGT+SSSYQ+EG +LSDGKGL+NWDVF+H+ G ILDG+NGDVA D Y  Y+ED DL+
Sbjct  43    NFLFGTASSSYQFEGAFLSDGKGLNNWDVFTHKTGTILDGTNGDVAVDHYHRYQEDVDLM  102

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
                GVNS++FS+SW+R+LPKGR G +N  GI YY  LID+L+ KGIEPFVTI HYD+PQE
Sbjct  103   EHTGVNSYRFSLSWARILPKGRFGKVNRAGINYYNRLIDALVDKGIEPFVTITHYDIPQE  162

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLWP-----  1221
             L++RY+ WLSPE+QE++ Y+AD+CFK+ GD+VKYW+TFNEPN+  I  YR  L+P     
Sbjct  163   LEERYKSWLSPEIQEDFRYYADICFKYFGDRVKYWVTFNEPNVAVICGYRTGLYPPSRCS  222

Query  1220  --HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNS  1047
                GNCS GN+ ++ FI A N+IL+H AAV++YR  YQ+ QGG+IGIAM   W+ P +NS
Sbjct  223   DSFGNCSYGNSEREPFIAASNIILSHLAAVDVYRAKYQKNQGGKIGIAMNAIWYEPFSNS  282

Query  1046  TVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGI  867
             T DK AAER  SF  NWFLDPI+ G YP EM +ILG  L  FS  D EK K  G DFIGI
Sbjct  283   TEDKLAAERTQSFYMNWFLDPIILGKYPAEMHEILGPDLLVFSKYDKEKFK-NGLDFIGI  341

Query  866   NHYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERV  687
             NHYT+YY +DC++S C+    G+++ EGF   S   N   IGE T L +  V+P GME +
Sbjct  342   NHYTSYYVKDCIFSACEQG-KGSSKTEGFALTSAQMNDKSIGEPTALAWFYVHPQGMENI  400

Query  686   VTYAKEKFPD  657
             VTY K++  D
Sbjct  401   VTYIKDRIWD  410



>ref|NP_001167660.1| beta-glucosidase precursor [Zea mays]
 gb|ACG25510.1| beta-glucosidase [Zea mays]
Length=519

 Score =   456 bits (1174),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 223/485 (46%), Positives = 314/485 (65%), Gaps = 21/485 (4%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSH-QPGNILDGSNGDVAADQYDLYKEDADLL  1566
             F FG ++S+YQ EG YL DGKGL NWDVF+H   G ++DG  GDVA D Y  Y  D ++L
Sbjct  39    FLFGAATSAYQIEGAYLEDGKGLCNWDVFTHTHSGGVMDGRTGDVADDHYHRYMGDLEIL  98

Query  1565  ASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQE  1386
              SLGVN+++FSISW+RVLP+GR G +N  G+ +Y  LID+LL KGI+PFVT+NH+D+P+E
Sbjct  99    QSLGVNAYRFSISWARVLPRGRVGGVNAGGVAFYNRLIDALLQKGIQPFVTLNHFDMPRE  158

Query  1385  LQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW------  1224
             L+ RY GWL   ++EEY ++ DVCF   GD+V+ W TFNEPN+  +  ++Y L       
Sbjct  159   LEVRYGGWLDAGIREEYEHYPDVCFGAFGDRVRLWTTFNEPNL--LVKFQYMLGAYPPSR  216

Query  1223  ---PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMT  1053
                P G+C  G++ ++ +  AHN+I++HAAAV  YR  YQ  QGG +GI     W+ P+T
Sbjct  217   CSPPFGSCGSGDSRREPYAAAHNIIMSHAAAVRAYRDKYQATQGGSVGIVAAMKWYEPLT  276

Query  1052  NSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFI  873
             NST D  AA RA +F ++WFL+PI  G YP  M++ILGS LP F++ +   L    +DFI
Sbjct  277   NSTDDILAARRAQAFETDWFLEPIFLGDYPGAMREILGSDLPTFTAEEKALLLRYKADFI  336

Query  872   GINHYTTYYAQDCLYSTCD-PSMSGNTREEGFVGQSLSK-NGNFIGELTGLPYLAVYPPG  699
             G+NHYT  YA+DCL S C+  S  GN     FV  +  + +G  IG  T L      P  
Sbjct  337   GLNHYTAIYARDCLRSPCNLGSYEGNA----FVSATGERDDGVKIGGDTALAGFFDVPEA  392

Query  698   MERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRK  519
             +E  + Y   ++   P+Y+TE GY   +  ++S EE+++D +R  +L  Y+  +  A+R 
Sbjct  393   IELAIQYVNGRYKGTPVYITENGYSQWS--DASREELINDVRRKNYLQGYITYLSKAVRN  450

Query  518   GADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI-AKNQKVDS  342
             GA+VRGYF+W+L DNFEW  GY  + GLY  D  TQ+RTP++SA+WY+ F+ A+  + D 
Sbjct  451   GANVRGYFVWTLLDNFEWAFGYRLKYGLYHVDFDTQERTPRMSARWYQGFLTARTSQRDE  510

Query  341   KMQSR  327
               Q+R
Sbjct  511   AAQAR  515



>ref|XP_006464711.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Citrus sinensis]
Length=492

 Score =   455 bits (1171),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 294/469 (63%), Gaps = 41/469 (9%)
 Frame = -3

Query  1742  FFFGTSSSSYQYEGGYLSDGKGLSNWDVFSHQPGNILDGSNGDVAADQYDLYKEDADLLA  1563
             F FGT++SS+Q EG YL DGK LSNWDVFSH PGNI +  NGDVA D Y  + ED  ++ 
Sbjct  48    FLFGTATSSFQVEGAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIGIMH  107

Query  1562  SLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINHYDLPQEL  1383
             SLGVNS++FSISW R+LPKGR G +N  GI +Y  LID+LLL+GIEPFVTI H+D PQ+L
Sbjct  108   SLGVNSYRFSISWPRILPKGRFGKVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQL  167

Query  1382  QDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW-------  1224
             +++Y  WLSP+MQ+E+ + A  CF++ GD+VKYW T NEPN+    AY    +       
Sbjct  168   EEKYGSWLSPQMQKEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYPPTHCSA  227

Query  1223  PHGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWFLPMTNST  1044
             P GNCS GN+  +  IV HNM+L+HA AV +YRK++Q++QGG +GI +    + P+ +  
Sbjct  228   PFGNCSVGNSDTEPLIVLHNMLLSHAKAVKLYRKHFQEKQGGSMGIVLHSMMYEPLRDED  287

Query  1043  VDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGIN  864
              D+ A  RA +F   W LDP+++G YP EM++ LGS LP FS  +               
Sbjct  288   SDRQAVSRALAFNVGWMLDPLVFGDYPAEMREYLGSQLPRFSKEE---------------  332

Query  863   HYTTYYAQDCLYSTCDPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAVYPPGMERVV  684
                                + N    GFV  +  ++G  IGE TG P   V P GME++V
Sbjct  333   -------------------TNNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKIV  373

Query  683   TYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGTAIRKGADVR  504
              Y K+ + +IP+YVTE GY      N   + ++ D KR+++ + YL A+  AIR GADVR
Sbjct  374   DYVKDTYKNIPMYVTENGYSPPKQKNQRSQNLVDDVKRIEYHSGYLSALARAIRNGADVR  433

Query  503   GYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFIAKN  357
             GYFIWSL DNFEW  GY+   GLY  DR T +RTPKLSA W+K F+  N
Sbjct  434   GYFIWSLMDNFEWLDGYSVVFGLYYIDRQTLERTPKLSATWFKNFLTDN  482



>ref|XP_010240132.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Brachypodium 
distachyon]
Length=431

 Score =   449 bits (1156),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 212/415 (51%), Positives = 295/415 (71%), Gaps = 14/415 (3%)
 Frame = -3

Query  1583  EDADLLASLGVNSHKFSISWSRVLPKGRHGNINLEGIKYYRNLIDSLLLKGIEPFVTINH  1404
             ED +L+ SLGVNS++FSI+W+R+LP+GR G++N +G+ +Y  +ID+L  KGI+PFVTI H
Sbjct  2     EDIELMHSLGVNSYRFSIAWTRILPRGRFGDVNPDGVAFYNAIIDALWQKGIQPFVTIFH  61

Query  1403  YDLPQELQDRYQGWLSPEMQEEYAYFADVCFKHLGDKVKYWITFNEPNMWAIAAYRYRLW  1224
             YD+P EL +RY GWLSPE+Q+++ YFA+VCFK  GD+VK+W T NEPN+    +Y    +
Sbjct  62    YDIPHELDERYGGWLSPEIQKDFGYFAEVCFKMFGDRVKFWTTINEPNLLTKFSYMDGWY  121

Query  1223  P-------HGNCSEGNATKDIFIVAHNMILAHAAAVNIYRKNYQQQQGGEIGIAMLFTWF  1065
             P        GNC+ GN++ + +IVAHNMIL+HA AV+IYR NYQ +QGG+IGI +   W+
Sbjct  122   PPCRCSKPFGNCAFGNSSIEPYIVAHNMILSHANAVSIYRNNYQGKQGGQIGITVSARWY  181

Query  1064  LPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGG  885
              P  N+TVD  A +RA SF + WFLDPI+ G YP EM+ +LG++LP F+S +  KL+A  
Sbjct  182   EPFRNTTVDLLAVQRAISFNAPWFLDPIILGDYPPEMRQMLGANLPNFTSKEKRKLQATK  241

Query  884   SDFIGINHYTTYYAQDCLYSTC--DPSMSGNTREEGFVGQSLSKNGNFIGELTGLPYLAV  711
              DFIG+NHYTT Y +DC++S C  DP + G+ R    V     ++G  IGE TG PY   
Sbjct  242   LDFIGLNHYTTVYLKDCIFSPCAVDP-IDGDAR----VVSLAERDGVLIGEPTGTPYFYD  296

Query  710   YPPGMERVVTYAKEKFPDIPLYVTETGYCDTTTPNSSIEEVLHDTKRVKFLADYLHAVGT  531
              P GME+VV + K+++ + P Y+TE GY   +  + +  + ++D  R+ ++  YL  + +
Sbjct  297   VPHGMEKVVMHYKQRYNNTPTYITENGYAQASNHSMAANDFINDAGRIHYIRGYLTFLAS  356

Query  530   AIRKGADVRGYFIWSLFDNFEWTSGYTKRMGLYQFDRATQKRTPKLSAKWYKQFI  366
             AIRKGAD+RGYF+WSL D+FEWTSGYT+R GLY  D  TQKRTPKLSA WY++F+
Sbjct  357   AIRKGADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDFKTQKRTPKLSAGWYRKFL  411



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5027111451418