BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25767_g1_i2 len=1134 path=[4891:0-285 11031:286-286 975:287-327
2494:328-354 1043:355-377 11074:378-385 11082:386-403 7313:404-419
11106:420-458 11145:459-461 11148:462-462 7371:463-479 5368:480-485
11152:486-528 11195:529-533 7662:534-600 2366:601-633 5522:634-657
11223:658-675 7801:676-688 1258:689-690 5579:691-717 5605:718-763
1649:764-773 1576:774-799 11287:800-805 11293:806-809 5694:810-843
1990:844-881 10358:882-977 11357:978-997 11377:998-1005
7043:1006-1030 7068:1031-1063 7101:1064-1111 6001:1112-1133]

Length=1134
                                                                      Score     E

emb|CAN68643.1|  hypothetical protein VITISV_030810                     337   1e-108   Vitis vinifera
ref|XP_002264678.3|  PREDICTED: beta-glucosidase 46-like                337   2e-107   Vitis vinifera
emb|CBI23186.3|  unnamed protein product                                337   5e-107   
gb|KDO75513.1|  hypothetical protein CISIN_1g0095352mg                  325   4e-104   
gb|KDO75512.1|  hypothetical protein CISIN_1g0095352mg                  325   6e-104   
gb|KHG29723.1|  Beta-glucosidase 46                                     328   7e-104   
ref|XP_006449067.1|  hypothetical protein CICLE_v100148872mg            324   2e-103   
ref|XP_007026017.1|  Beta glucosidase 46 isoform 1                      327   3e-103   
ref|XP_006468004.1|  PREDICTED: beta-glucosidase 46-like                327   6e-103   
ref|XP_011037697.1|  PREDICTED: beta-glucosidase 46-like                323   3e-102   
ref|XP_002305597.2|  glycosyl hydrolase family 1 family protein         323   4e-102   Populus trichocarpa [western balsam poplar]
ref|XP_007026020.1|  Beta glucosidase 46, putative                      321   4e-101   
gb|KHG24858.1|  Beta-glucosidase 46 -like protein                       317   6e-101   
ref|XP_002304950.2|  hypothetical protein POPTR_0004s01900g             319   8e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010101461.1|  Beta-glucosidase 47                                314   9e-101   
ref|XP_006449069.1|  hypothetical protein CICLE_v10017801mg             318   5e-100   
ref|XP_009363823.1|  PREDICTED: beta-glucosidase 45-like isoform X2     316   1e-99    
ref|XP_009363745.1|  PREDICTED: beta-glucosidase 46-like isoform X1     316   2e-99    
ref|XP_008224799.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    315   4e-99    
ref|XP_008384040.1|  PREDICTED: beta-glucosidase 47-like isoform X2     314   7e-99    
ref|XP_008384039.1|  PREDICTED: beta-glucosidase 47-like isoform X1     315   1e-98    
ref|XP_008364100.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    315   1e-98    
ref|XP_010057964.1|  PREDICTED: beta-glucosidase 46 isoform X3          315   1e-98    
ref|XP_006468000.1|  PREDICTED: beta-glucosidase 47-like isoform X1     313   5e-98    
ref|XP_007212382.1|  hypothetical protein PRUPE_ppa005194mg             310   1e-97    
ref|XP_008224797.1|  PREDICTED: beta-glucosidase 47-like                311   2e-97    
ref|XP_007211830.1|  hypothetical protein PRUPE_ppa004523mg             310   4e-97    
ref|XP_010057961.1|  PREDICTED: beta-glucosidase 46 isoform X1          310   6e-97    
gb|KCW75357.1|  hypothetical protein EUGRSUZ_E04103                     310   8e-97    
gb|KHG29721.1|  Beta-glucosidase 46                                     309   3e-96    
ref|XP_008384043.1|  PREDICTED: beta-glucosidase 47-like                308   4e-96    
ref|XP_011037698.1|  PREDICTED: beta-glucosidase 46-like                302   2e-95    
ref|XP_004486131.1|  PREDICTED: beta-glucosidase 47-like                304   4e-95    
ref|XP_004293271.1|  PREDICTED: beta-glucosidase 47-like                305   5e-95    
ref|XP_002305594.1|  glycosyl hydrolase family 1 family protein         305   5e-95    Populus trichocarpa [western balsam poplar]
ref|XP_007026015.1|  Beta-glucosidase 47 isoform 1                      301   8e-95    
ref|XP_007026016.1|  Beta-glucosidase 47 isoform 2                      301   8e-95    
ref|XP_002304951.2|  glycosyl hydrolase family 1 family protein         304   1e-94    Populus trichocarpa [western balsam poplar]
gb|KEH36818.1|  glycoside hydrolase family 1 protein                    301   1e-94    
ref|XP_010267720.1|  PREDICTED: beta-glucosidase 46 isoform X3          304   1e-94    
ref|XP_010267719.1|  PREDICTED: beta-glucosidase 46 isoform X2          304   2e-94    
ref|XP_011037693.1|  PREDICTED: beta-glucosidase 46-like                303   3e-94    
ref|XP_003529622.1|  PREDICTED: beta-glucosidase 46                     302   9e-94    
ref|XP_003610400.1|  Beta-glucosidase                                   301   1e-93    
ref|XP_011037696.1|  PREDICTED: beta-glucosidase 47-like                301   1e-93    
gb|AFK46781.1|  unknown                                                 301   1e-93    
gb|KEH36817.1|  glycoside hydrolase family 1 protein                    301   2e-93    
gb|KHN33045.1|  Beta-glucosidase 47                                     301   3e-93    
ref|XP_010665547.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    301   5e-93    
ref|XP_006391959.1|  hypothetical protein EUTSA_v10023411mg             299   1e-92    
ref|XP_006468001.1|  PREDICTED: beta-glucosidase 47-like isoform X2     298   1e-92    
ref|XP_007147745.1|  hypothetical protein PHAVU_006G151400g             296   1e-92    
gb|AFK44109.1|  unknown                                                 298   3e-92    
ref|XP_010430203.1|  PREDICTED: beta-glucosidase 45-like                296   9e-92    
ref|XP_006301036.1|  hypothetical protein CARUB_v10021428mg             296   1e-91    
ref|XP_010267718.1|  PREDICTED: beta-glucosidase 46 isoform X1          304   2e-91    
ref|NP_974067.1|  beta glucosidase 46                                   290   8e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KEH36812.1|  glycoside hydrolase family 1 protein                    291   9e-91    
gb|KHG29722.1|  Beta-glucosidase 46                                     295   1e-90    
ref|XP_006391958.1|  hypothetical protein EUTSA_v10024134mg             294   1e-90    
ref|XP_009137214.1|  PREDICTED: beta-glucosidase 47-like                293   1e-90    
gb|KFK28775.1|  hypothetical protein AALP_AA7G045800                    293   1e-90    
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                303   2e-90    
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    305   2e-90    
ref|XP_010430204.1|  PREDICTED: beta-glucosidase 46-like isoform X1     293   3e-90    
ref|XP_010418158.1|  PREDICTED: beta-glucosidase 45-like                293   3e-90    
emb|CDO99725.1|  unnamed protein product                                291   4e-90    
ref|XP_008441244.1|  PREDICTED: beta-glucosidase 47                     292   4e-90    
gb|AAU05454.1|  At1g61820                                               289   4e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDX98704.1|  BnaA03g44890D                                          291   5e-90    
gb|KEH36806.1|  glycoside hydrolase family 1 protein                    291   1e-89    
emb|CDX94055.1|  BnaC07g36890D                                          291   1e-89    
ref|XP_004145176.1|  PREDICTED: beta-glucosidase 47-like                291   1e-89    
ref|XP_010473402.1|  PREDICTED: beta-glucosidase 46                     291   1e-89    
emb|CDY68226.1|  BnaCnng58130D                                          288   2e-89    
ref|XP_009105279.1|  PREDICTED: beta-glucosidase 46-like isoform X2     287   2e-89    
gb|KFK40642.1|  hypothetical protein AALP_AA2G023000                    290   3e-89    
gb|KFK40644.1|  hypothetical protein AALP_AA2G023300                    290   4e-89    
ref|NP_850968.1|  beta glucosidase 46                                   289   5e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAC28502.1|  Similar to F4I1.26 putative beta-glucosidase gi|3...    290   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105752.1|  PREDICTED: beta-glucosidase 45-like                289   6e-89    
ref|XP_007026018.1|  Beta glucosidase 46 isoform 2                      288   7e-89    
ref|XP_006413734.1|  hypothetical protein EUTSA_v10024896mg             289   8e-89    
ref|XP_007153925.1|  hypothetical protein PHAVU_003G076700g             288   1e-88    
ref|XP_006300409.1|  hypothetical protein CARUB_v10021331mg             288   1e-88    
ref|XP_009135228.1|  PREDICTED: beta-glucosidase 47 isoform X3          288   1e-88    
emb|CDY47163.1|  BnaA01g22890D                                          288   1e-88    
ref|XP_006383935.1|  hypothetical protein POPTR_0004s01890g             288   1e-88    
ref|XP_002518516.1|  beta-glucosidase, putative                         288   2e-88    Ricinus communis
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            299   2e-88    
ref|XP_010418157.1|  PREDICTED: beta-glucosidase 46                     288   2e-88    
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         299   2e-88    
ref|XP_009135212.1|  PREDICTED: beta-glucosidase 47 isoform X1          288   2e-88    
ref|XP_009135219.1|  PREDICTED: beta-glucosidase 47 isoform X2          288   2e-88    
emb|CDX98706.1|  BnaA03g44910D                                          280   3e-88    
ref|XP_007026019.1|  Beta glucosidase 46 isoform 3                      288   3e-88    
ref|XP_009105270.1|  PREDICTED: beta-glucosidase 46-like isoform X1     287   4e-88    
ref|XP_006343294.1|  PREDICTED: beta-glucosidase 47-like                286   5e-88    
ref|XP_007147744.1|  hypothetical protein PHAVU_006G151300g             287   5e-88    
ref|NP_176374.1|  beta-glucosidase 45                                   286   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137215.1|  PREDICTED: beta-glucosidase 47-like                285   3e-87    
emb|CDY55219.1|  BnaA01g36270D                                          285   3e-87    
ref|XP_007153927.1|  hypothetical protein PHAVU_003G076800g             285   4e-87    
ref|XP_009770584.1|  PREDICTED: beta-glucosidase 18-like                285   5e-87    
ref|XP_002888064.1|  BGLU46                                             284   5e-87    
gb|KHG29724.1|  Beta-glucosidase 46                                     275   7e-87    
ref|XP_002869865.1|  beta-glucosidase 47                                283   1e-86    
ref|XP_009599228.1|  PREDICTED: beta-glucosidase 18-like                278   3e-86    
ref|XP_010449006.1|  PREDICTED: beta-glucosidase 47-like                282   3e-86    
ref|XP_006302139.1|  hypothetical protein CARUB_v10020143mg             282   3e-86    
ref|XP_010439426.1|  PREDICTED: beta-glucosidase 47-like                282   5e-86    
emb|CDX94056.1|  BnaC07g36900D                                          281   9e-86    
gb|KFK40645.1|  hypothetical protein AALP_AA2G023400                    281   1e-85    
ref|XP_004234482.1|  PREDICTED: beta-glucosidase 46-like                281   1e-85    
ref|XP_004976202.1|  PREDICTED: probable inactive beta-glucosidas...    281   1e-85    
ref|XP_010533828.1|  PREDICTED: beta-glucosidase 45-like isoform X2     277   2e-85    
ref|XP_006348092.1|  PREDICTED: beta-glucosidase 47-like                280   2e-85    
ref|XP_010431678.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    278   2e-85    
ref|XP_010316607.1|  PREDICTED: beta-glucosidase 18 isoform X2          277   2e-85    
ref|XP_002888065.1|  hypothetical protein ARALYDRAFT_475148             279   3e-85    
ref|XP_008669177.1|  PREDICTED: probable inactive beta-glucosidas...    278   7e-85    
ref|XP_009803936.1|  PREDICTED: beta-glucosidase 18-like                278   8e-85    
ref|XP_006413735.1|  hypothetical protein EUTSA_v10024896mg             278   1e-84    
ref|XP_010533827.1|  PREDICTED: beta-glucosidase 46-like isoform X1     278   2e-84    
ref|XP_006285457.1|  hypothetical protein CARUB_v10006876mg             277   2e-84    
ref|XP_010316605.1|  PREDICTED: beta-glucosidase 18 isoform X1          277   2e-84    
ref|XP_010430205.1|  PREDICTED: beta-glucosidase 46-like isoform X2     276   3e-84    
ref|XP_010273571.1|  PREDICTED: beta-glucosidase 18-like                276   3e-84    
ref|XP_006858057.1|  hypothetical protein AMTR_s00062p00043120          277   4e-84    
ref|XP_010069050.1|  PREDICTED: beta-glucosidase 18-like                276   4e-84    
ref|XP_010434129.1|  PREDICTED: beta-glucosidase 47-like                276   5e-84    
ref|XP_006348091.1|  PREDICTED: probable inactive beta-glucosidas...    276   5e-84    
ref|XP_009608375.1|  PREDICTED: beta-glucosidase 18-like                276   6e-84    
ref|XP_003529623.1|  PREDICTED: beta-glucosidase 46                     276   1e-83    
ref|XP_009617373.1|  PREDICTED: beta-glucosidase 18-like                275   3e-83    
ref|XP_009774064.1|  PREDICTED: beta-glucosidase 18-like                274   4e-83    
ref|XP_010023761.1|  PREDICTED: beta-glucosidase 18-like isoform X3     270   1e-82    
ref|XP_010316603.1|  PREDICTED: beta-glucosidase 18-like isoform X2     270   2e-82    
emb|CDY25326.1|  BnaC01g29950D                                          276   3e-82    
gb|KCW60131.1|  hypothetical protein EUGRSUZ_H02856                     270   9e-82    
ref|XP_010023759.1|  PREDICTED: beta-glucosidase 18-like isoform X1     270   1e-81    
ref|XP_009763871.1|  PREDICTED: beta-glucosidase 18-like                266   1e-81    
ref|XP_002448170.1|  hypothetical protein SORBIDRAFT_06g022420          277   2e-81    Sorghum bicolor [broomcorn]
ref|XP_008669176.1|  PREDICTED: probable inactive beta-glucosidas...    269   3e-81    
ref|NP_193907.2|  beta-glucosidase 47                                   270   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010316604.1|  PREDICTED: beta-glucosidase 18-like                269   3e-81    
ref|XP_010316602.1|  PREDICTED: beta-glucosidase 18-like isoform X1     269   3e-81    
ref|XP_010240133.1|  PREDICTED: probable inactive beta-glucosidas...    266   4e-81    
ref|XP_010240132.1|  PREDICTED: probable inactive beta-glucosidas...    266   4e-81    
ref|NP_001053302.1|  Os04g0513100                                       268   5e-81    Oryza sativa Japonica Group [Japonica rice]
gb|KDP39385.1|  hypothetical protein JCGZ_01142                         265   7e-81    
ref|XP_010920389.1|  PREDICTED: beta-glucosidase 18-like                265   1e-80    
ref|XP_006348093.1|  PREDICTED: beta-glucosidase 18-like                268   1e-80    
ref|NP_001185287.1|  beta-glucosidase 45                                268   1e-80    
ref|XP_004976200.1|  PREDICTED: probable inactive beta-glucosidas...    268   2e-80    
ref|XP_009413740.1|  PREDICTED: beta-glucosidase 18-like isoform X2     266   2e-80    
gb|EMS60351.1|  Beta-glucosidase 16                                     268   2e-80    
ref|XP_002448166.1|  hypothetical protein SORBIDRAFT_06g022385          263   2e-80    Sorghum bicolor [broomcorn]
ref|XP_010920356.1|  PREDICTED: beta-glucosidase 18-like                266   2e-80    
ref|XP_010245701.1|  PREDICTED: beta-glucosidase 18-like                266   2e-80    
ref|XP_002448169.1|  hypothetical protein SORBIDRAFT_06g022410          266   3e-80    Sorghum bicolor [broomcorn]
ref|XP_003581423.1|  PREDICTED: probable inactive beta-glucosidas...    266   3e-80    
ref|XP_009413739.1|  PREDICTED: beta-glucosidase 18-like isoform X1     266   3e-80    
ref|XP_009794052.1|  PREDICTED: beta-glucosidase 18-like                266   6e-80    
ref|XP_002448173.1|  hypothetical protein SORBIDRAFT_06g022450          266   6e-80    Sorghum bicolor [broomcorn]
gb|EMS59801.1|  putative inactive beta-glucosidase 14                   266   9e-80    
gb|EMT31288.1|  Beta-glucosidase 1                                      265   2e-79    
ref|XP_006464712.1|  PREDICTED: beta-glucosidase 18-like isoform X3     261   2e-79    
ref|XP_006451937.1|  hypothetical protein CICLE_v10007996mg             264   3e-79    
gb|EMT09723.1|  Beta-glucosidase 6                                      264   3e-79    
ref|XP_008801279.1|  PREDICTED: beta-glucosidase 18-like                256   3e-79    
ref|XP_010023758.1|  PREDICTED: beta-glucosidase 18-like                264   3e-79    
ref|XP_009624454.1|  PREDICTED: beta-glucosidase 18                     264   3e-79    
gb|KDP39384.1|  hypothetical protein JCGZ_01141                         262   7e-79    
ref|XP_008669175.1|  PREDICTED: probable inactive beta-glucosidas...    262   2e-78    
ref|XP_006464710.1|  PREDICTED: beta-glucosidase 18-like isoform X1     262   2e-78    
ref|XP_009397666.1|  PREDICTED: beta-glucosidase 18-like                261   2e-78    
ref|XP_010473401.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    262   4e-78    
ref|XP_006653596.1|  PREDICTED: beta-glucosidase 16-like                261   4e-78    
ref|XP_006652510.1|  PREDICTED: beta-glucosidase 16-like                260   7e-78    
ref|XP_010644219.1|  PREDICTED: beta-glucosidase 18 isoform X1          259   2e-77    
ref|XP_009794795.1|  PREDICTED: beta-glucosidase 46-like                249   5e-77    
gb|EMS46231.1|  Beta-glucosidase 16                                     257   1e-76    
gb|AID16401.1|  monolignol beta-glucosidase                             256   3e-76    
gb|ABC55715.1|  beta-mannosidase 4                                      256   3e-76    
sp|Q7XSK2.2|BGL16_ORYSJ  RecName: Full=Beta-glucosidase 16; Short...    256   4e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976206.1|  PREDICTED: beta-glucosidase 18-like isoform X3     252   5e-76    
gb|ACJ83780.1|  unknown                                                 246   7e-76    Medicago truncatula
gb|AFO12647.1|  beta-glucosidase                                        248   2e-75    
ref|XP_008454703.1|  PREDICTED: beta-glucosidase 18-like                252   4e-75    
ref|XP_002448179.1|  hypothetical protein SORBIDRAFT_06g022510          253   4e-75    Sorghum bicolor [broomcorn]
ref|XP_004976205.1|  PREDICTED: beta-glucosidase 18-like isoform X2     253   5e-75    
ref|XP_004976204.1|  PREDICTED: beta-glucosidase 18-like isoform X1     253   6e-75    
ref|XP_002448174.1|  hypothetical protein SORBIDRAFT_06g022460          253   6e-75    Sorghum bicolor [broomcorn]
ref|XP_003580124.2|  PREDICTED: beta-glucosidase 16-like                252   2e-74    
ref|XP_002448178.1|  hypothetical protein SORBIDRAFT_06g022500          251   3e-74    Sorghum bicolor [broomcorn]
emb|CDX79092.1|  BnaA01g11590D                                          249   3e-74    
dbj|BAJ92008.1|  predicted protein                                      250   3e-74    
gb|KGN59900.1|  hypothetical protein Csa_3G852490                       251   4e-74    
ref|XP_006370302.1|  hypothetical protein POPTR_0001s41440g             250   5e-74    
ref|XP_004147832.1|  PREDICTED: beta-glucosidase 18-like                251   5e-74    
gb|KFK28774.1|  hypothetical protein AALP_AA7G045600                    250   6e-74    
gb|KHN28048.1|  Beta-glucosidase 18                                     250   8e-74    
ref|XP_003541849.2|  PREDICTED: beta-glucosidase 18-like isoform X1     250   8e-74    
ref|XP_004976207.1|  PREDICTED: beta-glucosidase 18-like                251   9e-74    
ref|XP_010644221.1|  PREDICTED: beta-glucosidase 18-like                249   2e-73    
ref|XP_006593298.1|  PREDICTED: beta-glucosidase 18-like                249   2e-73    
ref|XP_006594785.1|  PREDICTED: beta-glucosidase 18-like isoform X2     249   4e-73    
ref|XP_003541851.2|  PREDICTED: beta-glucosidase 18-like isoform X1     248   4e-73    
ref|XP_009382650.1|  PREDICTED: beta-glucosidase 18-like                247   6e-73    
ref|NP_001053305.1|  Os04g0513900                                       239   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|KEH38761.1|  glycoside hydrolase family 1 protein                    247   1e-72    
dbj|BAJ93784.1|  predicted protein                                      246   1e-72    
sp|Q7XSK0.2|BGL18_ORYSJ  RecName: Full=Beta-glucosidase 18; Short...    246   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011042496.1|  PREDICTED: beta-glucosidase 18-like isoform X1     247   2e-72    
ref|XP_006594784.1|  PREDICTED: beta-glucosidase 18-like isoform X3     246   2e-72    
ref|XP_006594783.1|  PREDICTED: beta-glucosidase 18-like isoform X2     246   4e-72    
ref|XP_004487691.1|  PREDICTED: beta-glucosidase 18-like                245   6e-72    
ref|XP_009605774.1|  PREDICTED: probable inactive beta-glucosidas...    242   6e-72    
ref|XP_004141366.1|  PREDICTED: beta-glucosidase 18-like                244   7e-72    
gb|EMS66653.1|  Beta-glucosidase 16                                     245   9e-72    
ref|XP_008453064.1|  PREDICTED: beta-glucosidase 18-like                244   2e-71    
ref|XP_004154892.1|  PREDICTED: beta-glucosidase 18-like                243   2e-71    
gb|EAZ31331.1|  hypothetical protein OsJ_15448                          242   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007021332.1|  Beta-glucosidase 45, putative                      246   2e-71    
gb|EYU26405.1|  hypothetical protein MIMGU_mgv1a004080mg                244   3e-71    
gb|KGN59899.1|  hypothetical protein Csa_3G852480                       243   3e-71    
ref|XP_004147833.1|  PREDICTED: beta-glucosidase 18-like                243   3e-71    
gb|EMT03996.1|  Beta-glucosidase 1                                      241   4e-71    
ref|XP_006348229.1|  PREDICTED: beta-glucosidase 18-like                243   5e-71    
gb|KHN28049.1|  Beta-glucosidase 18                                     243   6e-71    
ref|XP_009378508.1|  PREDICTED: beta-glucosidase 18-like                242   6e-71    
ref|XP_009605773.1|  PREDICTED: beta-glucosidase 18-like isoform X1     242   7e-71    
ref|XP_007149593.1|  hypothetical protein PHAVU_005G082800g             242   7e-71    
ref|NP_001148165.1|  beta-glucosidase precursor                         242   8e-71    Zea mays [maize]
ref|XP_007149594.1|  hypothetical protein PHAVU_005G082900g             242   8e-71    
gb|KEH38756.1|  glycoside hydrolase family 1 protein                    242   8e-71    
ref|XP_007149591.1|  hypothetical protein PHAVU_005G082800g             242   9e-71    
ref|XP_004976203.1|  PREDICTED: beta-glucosidase 16-like                241   1e-70    
ref|XP_009768487.1|  PREDICTED: beta-glucosidase 18-like                241   1e-70    
emb|CDP05879.1|  unnamed protein product                                242   1e-70    
dbj|BAO04172.1|  hypothetical protein                                   241   2e-70    
ref|XP_009605772.1|  PREDICTED: beta-glucosidase 18-like isoform X2     238   3e-70    
ref|XP_008454668.1|  PREDICTED: beta-glucosidase 18-like                240   3e-70    
ref|XP_010274443.1|  PREDICTED: beta-glucosidase 18-like                240   3e-70    
ref|XP_004160619.1|  PREDICTED: beta-glucosidase 18-like                239   8e-70    
ref|XP_011098338.1|  PREDICTED: beta-glucosidase 18-like                239   1e-69    
ref|NP_001140717.1|  beta-glucosidase precursor                         238   2e-69    Zea mays [maize]
ref|XP_006348383.1|  PREDICTED: beta-glucosidase 18-like                236   2e-69    
ref|XP_009605771.1|  PREDICTED: beta-glucosidase 18-like isoform X1     238   2e-69    
ref|XP_009762322.1|  PREDICTED: beta-glucosidase 18-like                238   2e-69    
gb|KDO75517.1|  hypothetical protein CISIN_1g0455342mg                  233   2e-69    
ref|XP_007145856.1|  hypothetical protein PHAVU_007G273800g             238   2e-69    
ref|XP_006348230.1|  PREDICTED: beta-glucosidase 18-like                238   3e-69    
gb|KHN36807.1|  Beta-glucosidase 18                                     238   4e-69    
gb|KFK40643.1|  hypothetical protein AALP_AA2G023200                    235   8e-69    
ref|XP_004244205.1|  PREDICTED: beta-glucosidase 18-like                237   9e-69    
ref|XP_008384041.1|  PREDICTED: beta-glucosidase 46-like isoform X3     235   9e-69    
ref|XP_011098340.1|  PREDICTED: beta-glucosidase 18-like                237   1e-68    
ref|XP_009378491.1|  PREDICTED: beta-glucosidase 18-like isoform X2     234   2e-68    
ref|XP_008384042.1|  PREDICTED: beta-glucosidase 46-like isoform X4     234   2e-68    
ref|XP_008226781.1|  PREDICTED: beta-glucosidase 18-like                232   2e-68    
gb|AIP98403.1|  beta-glucosidase                                        235   3e-68    
emb|CDP05880.1|  unnamed protein product                                235   6e-68    
ref|XP_009378490.1|  PREDICTED: beta-glucosidase 18-like isoform X1     234   1e-67    
ref|XP_010324440.1|  PREDICTED: beta-glucosidase 18-like                233   2e-67    
ref|XP_009630283.1|  PREDICTED: beta-glucosidase 18-like                233   3e-67    
ref|XP_002448177.1|  hypothetical protein SORBIDRAFT_06g022490          233   3e-67    Sorghum bicolor [broomcorn]
ref|XP_008226671.1|  PREDICTED: beta-glucosidase 18-like                232   5e-67    
emb|CDY25325.1|  BnaC01g29940D                                          229   1e-66    
sp|Q9ZT64.1|CBG_PINCO  RecName: Full=Coniferin beta-glucosidase; ...    230   2e-66    Pinus contorta
ref|XP_008386133.1|  PREDICTED: beta-glucosidase 18-like isoform X2     231   2e-66    
ref|XP_008386132.1|  PREDICTED: beta-glucosidase 18-like isoform X1     231   2e-66    
ref|NP_001132535.1|  hypothetical protein                               224   8e-66    Zea mays [maize]
ref|XP_008226673.1|  PREDICTED: beta-glucosidase 18-like isoform X2     229   9e-66    
ref|XP_009772387.1|  PREDICTED: beta-glucosidase 18-like                229   9e-66    
ref|XP_008226672.1|  PREDICTED: beta-glucosidase 18-like isoform X1     229   9e-66    
ref|XP_008658981.1|  PREDICTED: uncharacterized protein LOC100502...    225   2e-65    
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 227   3e-65    
ref|XP_011098339.1|  PREDICTED: beta-glucosidase 18-like                228   4e-65    
gb|AFK42730.1|  unknown                                                 217   5e-65    
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 226   8e-65    
ref|XP_010910031.1|  PREDICTED: beta-glucosidase 25 isoform X3          223   1e-64    
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    225   1e-64    
ref|NP_001167660.1|  beta-glucosidase precursor                         225   2e-64    
tpg|DAA36952.1|  TPA: hypothetical protein ZEAMMB73_325029              224   3e-64    
ref|XP_008661459.1|  PREDICTED: hypothetical protein isoform X1         224   4e-64    
emb|CDY07263.1|  BnaC04g19080D                                          224   4e-64    
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             223   5e-64    
ref|XP_002987383.1|  hypothetical protein SELMODRAFT_235275             223   6e-64    
ref|XP_008789190.1|  PREDICTED: putative beta-glucosidase 41 isof...    221   6e-64    
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          223   6e-64    
ref|XP_006656394.1|  PREDICTED: beta-glucosidase 25-like isoform X2     220   2e-63    
emb|CDP05878.1|  unnamed protein product                                215   2e-63    
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          221   3e-63    
ref|XP_010675614.1|  PREDICTED: beta-glucosidase 18-like                222   4e-63    
emb|CDP05535.1|  unnamed protein product                                222   5e-63    
ref|XP_010675613.1|  PREDICTED: beta-glucosidase 18-like                221   7e-63    
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     220   8e-63    
emb|CDP11229.1|  unnamed protein product                                221   9e-63    
emb|CAN74265.1|  hypothetical protein VITISV_040977                     220   9e-63    
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     219   9e-63    
gb|EMT00549.1|  Beta-glucosidase 6                                      221   1e-62    
ref|XP_002965185.1|  hypothetical protein SELMODRAFT_167232             220   1e-62    
gb|KHG19061.1|  Beta-glucosidase 40 -like protein                       218   1e-62    
ref|XP_002962270.1|  hypothetical protein SELMODRAFT_76384              220   1e-62    
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     220   1e-62    
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    219   1e-62    
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                219   2e-62    
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           219   2e-62    
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     219   2e-62    
gb|EEE58575.1|  hypothetical protein OsJ_09895                          219   2e-62    
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          219   2e-62    
gb|AAF04007.1|AF163097_1  dalcochinin 8'-O-beta-glucoside beta-gl...    220   2e-62    
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           219   2e-62    
gb|KHN20526.1|  Beta-glucosidase 40                                     219   2e-62    
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    218   3e-62    
ref|XP_003563435.2|  PREDICTED: beta-glucosidase 25                     216   3e-62    
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                219   3e-62    
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    218   3e-62    
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    218   3e-62    
tpg|DAA44054.1|  TPA: hypothetical protein ZEAMMB73_095768              218   3e-62    
ref|NP_001049358.1|  Os03g0212800                                       219   5e-62    
ref|XP_007033096.1|  B-S glucosidase 44                                 218   6e-62    
ref|NP_001268161.1|  beta-glucosidase precursor                         218   6e-62    
ref|XP_003607795.1|  Beta-glucosidase                                   215   7e-62    
gb|AES89992.2|  beta-glucosidase                                        215   8e-62    
gb|EEC74750.1|  hypothetical protein OsI_10506                          218   8e-62    
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          218   1e-61    
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                218   1e-61    
ref|XP_010267847.1|  PREDICTED: putative beta-glucosidase 41 isof...    215   1e-61    
gb|EMS61848.1|  Beta-glucosidase 25                                     221   1e-61    
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         218   1e-61    
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                217   2e-61    
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                217   2e-61    
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    218   2e-61    
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             216   2e-61    
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             216   2e-61    
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                216   3e-61    
gb|AAV34606.1|  beta-glycosidase                                        217   3e-61    
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              216   3e-61    
dbj|BAJ98823.1|  predicted protein                                      216   3e-61    
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                216   4e-61    
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                216   4e-61    
emb|CBI27264.3|  unnamed protein product                                217   4e-61    
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      216   4e-61    
gb|EMT28326.1|  Beta-glucosidase 1                                      208   5e-61    
gb|KEH36809.1|  glycoside hydrolase family 1 protein                    215   5e-61    
dbj|BAO04177.1|  hypothetical protein                                   215   5e-61    
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         216   5e-61    
ref|XP_007038935.1|  Vicianin hydrolase, putative                       216   5e-61    
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             215   6e-61    
ref|XP_003607794.1|  Beta-glucosidase                                   215   6e-61    
emb|CDP05539.1|  unnamed protein product                                216   7e-61    
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    215   7e-61    
ref|XP_011018314.1|  PREDICTED: beta-glucosidase 40-like isoform X2     214   7e-61    
emb|CDP05536.1|  unnamed protein product                                216   7e-61    
gb|KEH36808.1|  glycoside hydrolase family 1 protein                    214   8e-61    
emb|CBI33559.3|  unnamed protein product                                214   9e-61    
ref|XP_008226797.1|  PREDICTED: putative beta-glucosidase 41 isof...    214   1e-60    
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             214   1e-60    
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      214   1e-60    
ref|XP_010920385.1|  PREDICTED: beta-glucosidase 18-like                206   1e-60    
gb|KEH30294.1|  glycoside hydrolase family 1 protein                    215   1e-60    
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 214   2e-60    
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             214   2e-60    
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     214   2e-60    
gb|KDO81804.1|  hypothetical protein CISIN_1g0105881mg                  211   2e-60    
gb|KFK39133.1|  beta-glucosidase 44                                     214   2e-60    
ref|XP_006384235.1|  hypothetical protein POPTR_0004s10900g             214   3e-60    
ref|NP_001078176.1|  beta glucosidase 43                                212   3e-60    
gb|AFZ78536.1|  beta-glucosidase                                        214   3e-60    
ref|XP_006369420.1|  hypothetical protein POPTR_0001s23050g             213   3e-60    
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    214   3e-60    
ref|XP_011013402.1|  PREDICTED: beta-glucosidase 12-like                214   4e-60    
ref|XP_006582226.1|  PREDICTED: beta-glucosidase 25-like isoform X4     211   4e-60    
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      213   4e-60    
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     213   4e-60    
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             213   4e-60    
ref|NP_001146333.1|  hypothetical protein                               211   4e-60    
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                213   4e-60    
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       213   4e-60    
ref|XP_011008770.1|  PREDICTED: beta-glucosidase 12-like                213   4e-60    
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41-like...    213   5e-60    
ref|XP_007161525.1|  hypothetical protein PHAVU_001G076700g             213   5e-60    
emb|CBI27265.3|  unnamed protein product                                213   5e-60    
ref|XP_008352397.1|  PREDICTED: beta-glucosidase 12-like                210   5e-60    
ref|NP_001064347.1|  Os10g0323500                                       213   5e-60    
gb|KEH33228.1|  glycoside hydrolase family 1 protein                    213   5e-60    
ref|XP_011025247.1|  PREDICTED: beta-glucosidase 12-like                210   5e-60    
ref|XP_011014103.1|  PREDICTED: beta-glucosidase 12-like                213   5e-60    
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  212   6e-60    
gb|EEC66726.1|  hypothetical protein OsI_33062                          213   6e-60    
ref|XP_010099017.1|  putative inactive beta-glucosidase 14              205   6e-60    
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                213   6e-60    
ref|XP_011008768.1|  PREDICTED: beta-glucosidase 12-like isoform X1     213   7e-60    
dbj|BAB02019.1|  beta-glucosidase                                       212   7e-60    
ref|XP_011008769.1|  PREDICTED: beta-glucosidase 12-like isoform X2     213   7e-60    
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     213   8e-60    
ref|XP_006582225.1|  PREDICTED: beta-glucosidase 25-like isoform X3     211   8e-60    
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                213   8e-60    
ref|XP_006582224.1|  PREDICTED: beta-glucosidase 25-like isoform X2     211   9e-60    
ref|XP_006369423.1|  linamarase family protein                          213   1e-59    
gb|AFZ78535.1|  beta-glucosidase                                        213   1e-59    
ref|XP_010109366.1|  Beta-glucosidase 40                                212   1e-59    
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                213   1e-59    
ref|XP_004153110.1|  PREDICTED: beta-glucosidase 47-like                211   1e-59    
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             212   1e-59    
dbj|BAO04176.1|  hypothetical protein                                   212   1e-59    
ref|XP_004158044.1|  PREDICTED: beta-glucosidase 47-like                211   1e-59    
ref|XP_006369422.1|  hypothetical protein POPTR_0001s23070g             212   1e-59    
ref|NP_188435.2|  beta glucosidase 43                                   212   1e-59    
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                212   1e-59    
gb|ACN41025.1|  unknown                                                 212   1e-59    
gb|AFW69121.1|  hypothetical protein ZEAMMB73_597791                    211   1e-59    
gb|KHG17589.1|  Beta-glucosidase 44 -like protein                       208   1e-59    
gb|ACN29297.1|  unknown                                                 204   2e-59    
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          212   2e-59    
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     212   2e-59    
ref|XP_010242490.1|  PREDICTED: beta-glucosidase 4                      211   2e-59    
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     211   2e-59    
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         211   2e-59    
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    211   2e-59    
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     211   2e-59    
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                211   2e-59    
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     211   2e-59    
emb|CDX95557.1|  BnaC01g34490D                                          211   2e-59    
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                211   2e-59    
gb|KHN44611.1|  Beta-glucosidase 44                                     209   2e-59    
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     211   3e-59    
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                212   3e-59    
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                211   3e-59    
ref|XP_004966955.1|  PREDICTED: beta-glucosidase 24-like                211   3e-59    
ref|XP_007214434.1|  hypothetical protein PRUPE_ppa025660mg             210   3e-59    
emb|CDP21897.1|  unnamed protein product                                207   3e-59    
gb|KEH30288.1|  cyanogenic beta-glucosidase, putative                   209   3e-59    
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             211   3e-59    
gb|EMS46293.1|  Beta-glucosidase 34                                     211   3e-59    
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 212   4e-59    
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           211   4e-59    
ref|XP_004294321.1|  PREDICTED: putative beta-glucosidase 41-like...    211   4e-59    
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 212   4e-59    
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          210   5e-59    
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     211   5e-59    
gb|KHN33323.1|  Beta-glucosidase 12                                     209   5e-59    
ref|XP_006348385.1|  PREDICTED: beta-glucosidase 18-like                210   6e-59    
ref|XP_003539051.1|  PREDICTED: beta-glucosidase 12-like                211   6e-59    
ref|XP_002533126.1|  beta-glucosidase, putative                         210   6e-59    
gb|AFZ78537.1|  beta-glucosidase                                        210   6e-59    
ref|XP_002883106.1|  beta-glucosidase                                   210   6e-59    
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    210   6e-59    
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             210   7e-59    
gb|KDO50113.1|  hypothetical protein CISIN_1g0406882mg                  205   7e-59    
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             209   7e-59    
emb|CDX85027.1|  BnaC05g20280D                                          210   7e-59    
gb|KFK39134.1|  beta-glucosidase 44                                     210   7e-59    
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                210   7e-59    
gb|ACL53709.1|  unknown                                                 208   7e-59    
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                210   8e-59    
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                210   8e-59    
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      210   8e-59    
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                210   8e-59    
emb|CDY64930.1|  BnaCnng45520D                                          210   9e-59    
ref|NP_188436.1|  beta-glucosidase 44                                   210   9e-59    
ref|XP_007131974.1|  hypothetical protein PHAVU_011G056100g             210   9e-59    
ref|XP_002530914.1|  beta-glucosidase, putative                         209   9e-59    
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    209   1e-58    
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                209   1e-58    
gb|KHN25275.1|  Beta-glucosidase 12                                     208   1e-58    
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                210   1e-58    
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                210   1e-58    
gb|AAM61600.1|  beta-glucosidase, putative                              209   1e-58    
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                209   1e-58    
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             210   1e-58    
gb|EAZ31332.1|  hypothetical protein OsJ_15449                          209   1e-58    
emb|CDP05537.1|  unnamed protein product                                210   1e-58    
ref|XP_006371008.1|  hypothetical protein POPTR_0019s02590g             209   1e-58    
ref|XP_008236024.1|  PREDICTED: cyanogenic beta-glucosidase-like        209   1e-58    
ref|NP_173978.1|  beta glucosidase 40                                   209   1e-58    
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                209   1e-58    
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                209   1e-58    
ref|XP_007033088.1|  Beta-glucosidase 44                                209   2e-58    
ref|XP_007045905.1|  Beta glucosidase 40                                209   2e-58    
ref|XP_006858818.1|  hypothetical protein AMTR_s00066p00171930          209   2e-58    
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                209   2e-58    
gb|ABR17782.1|  unknown                                                 206   2e-58    
ref|XP_010539263.1|  PREDICTED: putative beta-glucosidase 41 isof...    209   2e-58    
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                209   2e-58    
emb|CDY42461.1|  BnaA10g08370D                                          209   2e-58    
emb|CDX95558.1|  BnaC01g34500D                                          208   2e-58    
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             209   2e-58    
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            209   2e-58    
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             209   2e-58    
ref|XP_009341391.1|  PREDICTED: beta-glucosidase 13-like                209   2e-58    
ref|XP_009341390.1|  PREDICTED: beta-glucosidase 24-like                209   2e-58    
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             208   3e-58    
ref|XP_002512097.1|  beta-glucosidase, putative                         208   3e-58    
ref|XP_003537946.1|  PREDICTED: beta-glucosidase 12-like                208   3e-58    
ref|XP_003546992.2|  PREDICTED: cyanogenic beta-glucosidase-like ...    209   3e-58    
ref|XP_002299251.1|  Cyanogenic beta-glucosidase precursor family...    208   3e-58    



>emb|CAN68643.1| hypothetical protein VITISV_030810 [Vitis vinifera]
Length=444

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 196/264 (74%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR+ YQ++QGG IGI +   W  P +NST DK AA+RA SF  NWFLDPI++G YP+EM
Sbjct  177   IYRRQYQEKQGGSIGIVLHAKWIEPFSNSTADKLAADRAQSFFMNWFLDPIIFGRYPEEM  236

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LPEFS  D +KL     DFIGINHYT+ YAQDC++S C+P   G +R EGF  
Sbjct  237   NTILGSILPEFSCNDRKKLNKA-LDFIGINHYTSLYAQDCIFSLCEPG-KGASRTEGFCR  294

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  IGE   L ++ VYP GMEKMVTY+KE++S IP+++TENGY D   PNS IE
Sbjct  295   QTPEKDGVSIGESTALAWLHVYPQGMEKMVTYVKERYSGIPMFITENGYVDENDPNSTIE  354

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L D KRV++ A YL+AL+TA+RKGADVRGYF WSL DNFEWT+GYTKR GL+  D  T
Sbjct  355   EFLYDVKRVEYMAAYLDALSTAVRKGADVRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGT  414

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRTPKLSA WYK FIA+   V++
Sbjct  415   LKRTPKLSATWYKLFIARYSLVKT  438



>ref|XP_002264678.3| PREDICTED: beta-glucosidase 46-like [Vitis vinifera]
Length=530

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 196/264 (74%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR+ YQ++QGG IGI +   W  P +NST DK AA+RA SF  NWFLDPI++G YP+EM
Sbjct  263   IYRRQYQEKQGGSIGIVLHAKWIEPFSNSTADKLAADRAQSFFMNWFLDPIIFGRYPEEM  322

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LPEFS  D +KL     DFIGINHYT+ YAQDC++S C+P   G +R EGF  
Sbjct  323   NTILGSILPEFSCNDRKKLNKA-LDFIGINHYTSLYAQDCIFSLCEPG-KGASRTEGFCR  380

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  IGE   L ++ VYP GMEKMVTY+KE++S IP+++TENGY D   PNS IE
Sbjct  381   QTPEKDGVSIGESTALAWLHVYPQGMEKMVTYVKERYSGIPMFITENGYVDENDPNSTIE  440

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L D KRV++ A YL+AL+TA+RKGADVRGYF WSL DNFEWT+GYTKR GL+  D  T
Sbjct  441   EFLYDVKRVEYMAAYLDALSTAVRKGADVRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGT  500

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRTPKLSA WYK FIA+   V++
Sbjct  501   LKRTPKLSATWYKLFIARYSLVKT  524



>emb|CBI23186.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   337 bits (863),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 193/258 (75%), Gaps = 2/258 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR+ YQ++QGG IGI +   W  P +NST DK AA+RA SF  NWFLDPI++G YP+EM
Sbjct  263   IYRRQYQEKQGGSIGIVLHAKWIEPFSNSTADKLAADRAQSFFMNWFLDPIIFGRYPEEM  322

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LPEFS  D +KL     DFIGINHYT+ YAQDC++S C+P   G +R EGF  
Sbjct  323   NTILGSILPEFSCNDRKKLNKA-LDFIGINHYTSLYAQDCIFSLCEPG-KGASRTEGFCR  380

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  IGE   L ++ VYP GMEKMVTY+KE++S IP+++TENGY D   PNS IE
Sbjct  381   QTPEKDGVSIGESTALAWLHVYPQGMEKMVTYVKERYSGIPMFITENGYVDENDPNSTIE  440

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L D KRV++ A YL+AL+TA+RKGADVRGYF WSL DNFEWT+GYTKR GL+  D  T
Sbjct  441   EFLYDVKRVEYMAAYLDALSTAVRKGADVRGYFAWSLLDNFEWTYGYTKRFGLHHVDYGT  500

Query  413   LKRTPKLSAKWYKQFIAK  360
             LKRTPKLSA WYK FIA+
Sbjct  501   LKRTPKLSATWYKLFIAR  518



>gb|KDO75513.1| hypothetical protein CISIN_1g0095352mg [Citrus sinensis]
Length=426

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 197/265 (74%), Gaps = 2/265 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF P+++ST DK AAERA SF  NWFLDPI+YG YP EM
Sbjct  153   IYRTKYQKDQGGSIGIILNTLWFEPISSSTADKLAAERAQSFYMNWFLDPIIYGKYPAEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +I+GS LP+FSS D EKLK G  DFIGINHYT+ Y QDC++S C P   G ++ EGF  
Sbjct  213   MNIVGSTLPKFSSRDKEKLKQG-LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCL  270

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   L ++ VYP GM K++ Y+KE++ N P+++TENGY +   PNS+ E
Sbjct  271   QNSQKHGVPLGEPTTLFWLNVYPQGMWKIIKYIKERYKNTPMFITENGYGEICMPNSSTE  330

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND KRV++ A YL+AL TA+R GADVRGYF+WSL D+FEWT+GYT R GL+  D  T
Sbjct  331   DLLNDVKRVEYMASYLDALITAVRDGADVRGYFVWSLLDSFEWTYGYTARFGLHHVDFAT  390

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             LKRTPKLSA WYK FIAK++ ++S+
Sbjct  391   LKRTPKLSATWYKHFIAKHKLIKSQ  415



>gb|KDO75512.1| hypothetical protein CISIN_1g0095352mg, partial [Citrus sinensis]
Length=431

 Score =   325 bits (833),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 197/265 (74%), Gaps = 2/265 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF P+++ST DK AAERA SF  NWFLDPI+YG YP EM
Sbjct  158   IYRTKYQKDQGGSIGIILNTLWFEPISSSTADKLAAERAQSFYMNWFLDPIIYGKYPAEM  217

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +I+GS LP+FSS D EKLK G  DFIGINHYT+ Y QDC++S C P   G ++ EGF  
Sbjct  218   MNIVGSTLPKFSSRDKEKLKQG-LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCL  275

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   L ++ VYP GM K++ Y+KE++ N P+++TENGY +   PNS+ E
Sbjct  276   QNSQKHGVPLGEPTTLFWLNVYPQGMWKIIKYIKERYKNTPMFITENGYGEICMPNSSTE  335

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND KRV++ A YL+AL TA+R GADVRGYF+WSL D+FEWT+GYT R GL+  D  T
Sbjct  336   DLLNDVKRVEYMASYLDALITAVRDGADVRGYFVWSLLDSFEWTYGYTARFGLHHVDFAT  395

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             LKRTPKLSA WYK FIAK++ ++S+
Sbjct  396   LKRTPKLSATWYKHFIAKHKLIKSQ  420



>gb|KHG29723.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=529

 Score =   328 bits (841),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG IGI +   W+ P++NS VDK AAERA SF  NWFL+PI+YG YP++M
Sbjct  263   VYRTKYQETQGGSIGIVLNGAWYEPISNSLVDKLAAERARSFTINWFLEPILYGRYPRQM  322

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEFS+T+ +KLK G  DFIGINHYT+YY QDC++S C+P   G ++ EG+  
Sbjct  323   QNILGSILPEFSATEKQKLKQG-LDFIGINHYTSYYVQDCMFSACEPG-PGTSKMEGYCA  380

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGE   L    VYP G+EK+VTYLK ++ NIP+ +TENGY D   PNS  E
Sbjct  381   QSSQKNGTPIGEPTELAGKNVYPEGIEKIVTYLKNRYHNIPIIITENGYGDMNKPNSTTE  440

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
               L+D KRV++FA YL+AL+TAIRKGADVRGYFIWSL DNFEW  GYT R GL+  D  T
Sbjct  441   ARLHDEKRVEYFARYLDALSTAIRKGADVRGYFIWSLLDNFEWNNGYTVRYGLHHVDYET  500

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             LKRTPK SA WYK FI+++   E K++
Sbjct  501   LKRTPKSSATWYKNFISQHMVKEPKVE  527



>ref|XP_006449067.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
 gb|ESR62307.1| hypothetical protein CICLE_v100148872mg, partial [Citrus clementina]
Length=431

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 197/265 (74%), Gaps = 2/265 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF P+++ST DK AAERA SF  NWFLDPI++G YP EM
Sbjct  158   IYRTKYQKDQGGSIGIILNTVWFEPISSSTADKLAAERAQSFYMNWFLDPIIHGKYPAEM  217

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +I+GS LP+FSS D EKLK G  DFIGINHYT+ Y QDC++S C P   G ++ EGF  
Sbjct  218   MNIVGSTLPKFSSRDKEKLKQG-LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCL  275

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   L +  VYP GM K++ Y++E++ N P+++TENGY + + PNS+ E
Sbjct  276   QNSQKHGVPLGEPTTLFWQNVYPQGMWKIIKYIQERYKNTPMFITENGYGEISMPNSSTE  335

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND KRVK+ A YL+AL TA+R GADVRGYF+WSL D+FEWT+GYT R GL+  D  T
Sbjct  336   DLLNDVKRVKYMASYLDALITAVRDGADVRGYFVWSLLDSFEWTYGYTSRFGLHHVDFAT  395

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             LKRTPKLSA WYK FIAK++ ++S+
Sbjct  396   LKRTPKLSATWYKHFIAKHKLIKSQ  420



>ref|XP_007026017.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
 gb|EOY28639.1| Beta glucosidase 46 isoform 1 [Theobroma cacao]
Length=529

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 196/265 (74%), Gaps = 2/265 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF  ++NS  DK AAERA SF   WFLDPI++G YP EM
Sbjct  255   IYRTKYQETQGGSIGIVLHCFWFESISNSLADKLAAERAQSFTMKWFLDPIIFGRYPPEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEFS+T+ EKL  G  DFIG+NHY++YY +DC++S C+P   G ++ EGF G
Sbjct  315   QNILGSILPEFSTTEKEKLNKG-LDFIGVNHYSSYYVKDCMFSVCEPG-TGTSKTEGFWG  372

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGEL  L ++ VYP GMEK+VTYLKE + NIP+ +TENGY + +  NS  E
Sbjct  373   QSSQKNGIPIGELTDLDWLNVYPQGMEKIVTYLKETYHNIPMIITENGYGEVSKANSTTE  432

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L+D KRV++ A YL+ L+TAIRKGADVRGYF+WSL DNFEW FGYT R GL+  D  T
Sbjct  433   EFLHDVKRVEYLAGYLDQLSTAIRKGADVRGYFVWSLLDNFEWNFGYTVRFGLHHVDFKT  492

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             LKRTPK SA WYK FI+++ +V+ +
Sbjct  493   LKRTPKSSATWYKNFISEHGQVKDQ  517



>ref|XP_006468004.1| PREDICTED: beta-glucosidase 46-like [Citrus sinensis]
Length=558

 Score =   327 bits (837),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 197/265 (74%), Gaps = 2/265 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF P+++ST DK AAERA SF  NWFLDPI+YG YP EM
Sbjct  285   IYRTKYQKDQGGSIGIILNTLWFEPISSSTADKLAAERAQSFYMNWFLDPIIYGKYPAEM  344

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +I+GS LP+FSS D EKLK G  DFIGINHYT+ Y QDC++S C P   G ++ EGF  
Sbjct  345   MNIVGSTLPKFSSRDKEKLKQG-LDFIGINHYTSTYVQDCIFSACKPG-PGASKTEGFCL  402

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   L ++ VYP GM K++ Y+KE++ N P+++TENGY +   PNS+ E
Sbjct  403   QNSQKHGVPLGEPTTLFWLNVYPQGMWKIIKYIKERYKNTPMFITENGYGEICMPNSSTE  462

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND KRV++ A YL+AL TA+R GADVRGYF+WSL D+FEWT+GYT R GL+  D  T
Sbjct  463   DLLNDVKRVEYMASYLDALITAVRDGADVRGYFVWSLLDSFEWTYGYTARFGLHHVDFAT  522

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             LKRTPKLSA WYK FIAK++ ++S+
Sbjct  523   LKRTPKLSATWYKHFIAKHKLIKSQ  547



>ref|XP_011037697.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=515

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 197/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W+ P++NST +K A ERA +FL  WFLDPI++G YP+EM
Sbjct  252   IYRTKYQREQRGSIGIVMHCMWYEPISNSTANKLAVERAQAFLLRWFLDPIIFGRYPEEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             K +LGS LPEFS  D+ KL+ G  DFIG+NHYT+YY QDC+ S C+P   G+TR EG   
Sbjct  312   KKVLGSTLPEFSRNDMNKLRKG-LDFIGMNHYTSYYVQDCILSVCEPG-KGSTRTEGSSL  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+ + + ++ VYP GMEKMVTY+KE++ NIP+ +TENGY   +  N NIE
Sbjct  370   LTQEKDGVPIGKPSEVDWLHVYPQGMEKMVTYVKERYHNIPMIITENGYSQVSNSNRNIE  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L+DT RV++ + YL+AL TA++KGADVRGYF WS  DNFEWTFGYT+R GLY  D  T
Sbjct  430   EFLHDTGRVEYMSGYLDALLTAMKKGADVRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTT  489

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             +KRTP+LSA WYK+FIA+ +  +S+M
Sbjct  490   MKRTPRLSATWYKEFIARYKVDKSQM  515



>ref|XP_002305597.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86108.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 197/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W+ P++NST +K A ERAH+F   WFLDPI++G YP+EM
Sbjct  252   IYRTKYQREQRGSIGIVMNCMWYEPISNSTANKLAVERAHAFFLRWFLDPIIFGRYPEEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             K +LGS LPEFS  D+ KL+ G  DFIG+NHYT+YY QDC+ S C+P   G+TR EG   
Sbjct  312   KKVLGSTLPEFSRNDMNKLRKG-LDFIGMNHYTSYYVQDCILSVCEPG-KGSTRTEGSSL  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+ + + ++ VYP GMEKMVTY+KE+++N P+ +TENGY   +  N NIE
Sbjct  370   LTQEKDGVPIGKPSEVDWLHVYPQGMEKMVTYVKERYNNTPMIITENGYAQVSNSNGNIE  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L+DT RV++ + YL+AL TA++KGADVRGYF WS  DNFEWTFGYT+R GLY  D  T
Sbjct  430   EFLHDTGRVEYMSGYLDALLTAMKKGADVRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTT  489

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             +KRTP+LSA WYK+FIA+ +  +S+M
Sbjct  490   MKRTPRLSATWYKEFIARYKVDKSQM  515



>ref|XP_007026020.1| Beta glucosidase 46, putative [Theobroma cacao]
 gb|EOY28642.1| Beta glucosidase 46, putative [Theobroma cacao]
Length=529

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/263 (59%), Positives = 193/263 (73%), Gaps = 2/263 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG IGI +   WF P++NS  DK AAERA SF  NWFLDPI++G YP EM
Sbjct  255   IYRTKYQAKQGGSIGIVLNCAWFEPISNSLADKLAAERAQSFSINWFLDPIIFGRYPIEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEFS T+ EKL+ G  DFIGINHY++ Y QDC++S C+P   G ++ EGF  
Sbjct  315   QNILGSILPEFSITEKEKLQKG-LDFIGINHYSSSYVQDCMFSACEPG-TGTSKTEGFWR  372

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  KNG  IGE   L ++ VYP GMEK+VTYLK+++ NIP+ +TENGY +    N+ IE
Sbjct  373   QTSQKNGIPIGESTDLDWLYVYPGGMEKIVTYLKKRYHNIPMIITENGYGEEGKANATIE  432

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L D KR ++ A YL+AL+TAIRKGADVRGYF WSL DNFEW +GYT+R GL+  D  T
Sbjct  433   DFLQDVKRAEYMAGYLDALSTAIRKGADVRGYFAWSLLDNFEWQYGYTRRFGLHHVDYKT  492

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTPK SA WYK+FIA   KV+
Sbjct  493   LKRTPKFSASWYKEFIAVQGKVK  515



>gb|KHG24858.1| Beta-glucosidase 46 -like protein [Gossypium arboreum]
Length=417

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 191/259 (74%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ  QGG IGI +   W+ P++NS  DK AAERA SF  NWFLDPI++G YP+EM
Sbjct  157   IYRTKYQATQGGSIGIVLHCFWYEPISNSVADKLAAERAQSFSINWFLDPIIFGRYPQEM  216

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +DILGS LPEFS T+ +KL  G  DFIGINHYT++Y +DC+ +TC+P   G ++ EG+  
Sbjct  217   QDILGSILPEFSKTEKQKLNKG-LDFIGINHYTSFYVRDCMLTTCEPG-KGTSKTEGYWA  274

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGE   L  + VYP GMEK+VTYLK+++ N+P+ +TENGY D   PNS  E
Sbjct  275   QSSQKNGIDIGEPTELAGMNVYPQGMEKIVTYLKDRYHNVPMIITENGYGDMNKPNSTTE  334

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +L+D +R+K+ A YL+AL+TAI+KGADVRGYF+WSL DNFEW  GYT R GL+  D  T
Sbjct  335   SLLHDVERIKYLAGYLDALSTAIKKGADVRGYFVWSLLDNFEWNDGYTIRFGLHHVDYKT  394

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPK SA WY+ FI+++
Sbjct  395   LRRTPKSSATWYRNFISQH  413



>ref|XP_002304950.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
 gb|EEE85461.2| hypothetical protein POPTR_0004s01900g, partial [Populus trichocarpa]
Length=501

 Score =   319 bits (818),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 197/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W+ P++NST +K A ERA +F   WFLDPI++G YP+EM
Sbjct  238   IYRTKYQREQRGSIGIVMNCMWYEPISNSTANKLAVERALAFFLRWFLDPIIFGRYPEEM  297

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             K++LGS LPEFS  D+ KL+ G  DFIG+NHYT+YY QDC+ S C+P   G+TR EG   
Sbjct  298   KEVLGSTLPEFSRNDMNKLRKG-LDFIGMNHYTSYYVQDCILSVCEPG-KGSTRTEGSSL  355

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+ + + ++ VYP GMEKMVTY+KE+++N P+ +TENGY   +  N NIE
Sbjct  356   LTQEKDGVPIGKPSEVDWLHVYPQGMEKMVTYVKERYNNTPMIITENGYSQVSNSNGNIE  415

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L+DT RV++ + YL+AL TA++KGADVRGYF WS  DNFEWTFGYT+R GLY  D  T
Sbjct  416   EFLHDTGRVEYMSGYLDALLTAMKKGADVRGYFAWSFLDNFEWTFGYTRRFGLYHVDYTT  475

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             +KRTP+LSA WYK+FIA+ +  +S+M
Sbjct  476   MKRTPRLSATWYKEFIARYKVDKSQM  501



>ref|XP_010101461.1| Beta-glucosidase 47 [Morus notabilis]
 gb|EXB88444.1| Beta-glucosidase 47 [Morus notabilis]
Length=340

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 188/261 (72%), Gaps = 2/261 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG IGI M   W+ P +NS  DK A ERA SF  NWFLDPI+ G YP EM
Sbjct  70    LYRTKYQKTQGGSIGIVMNCLWYEPFSNSLEDKLAVERALSFYMNWFLDPIILGKYPAEM  129

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             K+ILG HLP FS  D+EKLK  G DFIGINHYT++YA+DC +STC+P  AG ++ EG   
Sbjct  130   KEILGDHLPAFSKDDMEKLK-NGLDFIGINHYTSFYAKDCKFSTCEPK-AGASKTEGLSL  187

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K+G  IGE + + +I VYP GMEK++TY+K++++N P+++TENGY     PN   E
Sbjct  188   RIAQKDGLFIGEPSEVDWIYVYPQGMEKIITYIKDRYNNTPMFITENGYGYKEKPNFKRE  247

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND KRV +   YL+A+ATA+RKGADVRGYF WSL DNFEW  GYT+R GLY  D  T
Sbjct  248   DLLNDVKRVDYMRSYLDAIATAVRKGADVRGYFAWSLLDNFEWISGYTERFGLYHVDYAT  307

Query  413   LKRTPKLSAKWYKQFIAKNRK  351
             LKR+ +LSA WY+QFIA   K
Sbjct  308   LKRSARLSADWYRQFIANETK  328



>ref|XP_006449069.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
 gb|ESR62309.1| hypothetical protein CICLE_v10017801mg [Citrus clementina]
Length=523

 Score =   318 bits (815),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 197/259 (76%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W  PM+NS  DK AAERA +F  NWFLDPI++G YPKEM
Sbjct  257   IYRTKYQKEQEGNIGIVMNVLWLEPMSNSLEDKLAAERAQAFYLNWFLDPIIFGKYPKEM  316

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP FS  DLEKLK  G DF+GINHYT++Y +DC++S C+P   GN++ EG + 
Sbjct  317   YEILGSSLPSFSKYDLEKLK-NGLDFVGINHYTSFYVKDCIFSVCEPG-PGNSKTEGSIL  374

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  +NG LIGE   + ++ VYP GM ++VTY+KE+++NIP+Y+TENG+ +   P+++IE
Sbjct  375   RTAKRNGVLIGEPTDVDWLFVYPQGMSEIVTYIKERYNNIPMYITENGFGERDNPHTSIE  434

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LNDT+RV++ +++L++LA A+R GADVRGYF WSL DNFEW  GYT R GL+  D  T
Sbjct  435   DLLNDTRRVRYMSNHLDSLAIAVRNGADVRGYFAWSLLDNFEWNDGYTIRFGLHHVDYAT  494

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RT +LSA WYKQ+IAK+
Sbjct  495   LERTKRLSANWYKQYIAKH  513



>ref|XP_009363823.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Pyrus x bretschneideri]
Length=497

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI M   W+ P++NS  DK AAERA SF  NWFLDP++ G YP EM
Sbjct  231   LYRTKYQKKQGGSIGIVMNALWYEPISNSLEDKLAAERAISFYMNWFLDPVLQGKYPAEM  290

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG+ LP FS +D+E LK  G DFIGINHYT++Y++DC++S C+P   G +R EGF  
Sbjct  291   REILGADLPAFSKSDVEMLKKSGLDFIGINHYTSFYSKDCMFSACEPG-PGTSRTEGFAL  349

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+VTY+K++++N P+++TENG+ +   PNS  E
Sbjct  350   RTAQKDGVFIGEPTAVDWLYVYPQGMEKIVTYVKDRYNNTPIFITENGFGEVENPNSCNE  409

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YLNALA  IRKGADVRGY +WSL DNFEWT G   R GL++ D  T
Sbjct  410   ELLNDVKRVEYMKSYLNALAEGIRKGADVRGYVVWSLLDNFEWTSGLRVRFGLHRVDYAT  469

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRT +LSA WYKQF++ N+ V++ +
Sbjct  470   LKRTQRLSAAWYKQFVS-NQTVQTHL  494



>ref|XP_009363745.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Pyrus x bretschneideri]
Length=518

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI M   W+ P++NS  DK AAERA SF  NWFLDP++ G YP EM
Sbjct  252   LYRTKYQKKQGGSIGIVMNALWYEPISNSLEDKLAAERAISFYMNWFLDPVLQGKYPAEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG+ LP FS +D+E LK  G DFIGINHYT++Y++DC++S C+P   G +R EGF  
Sbjct  312   REILGADLPAFSKSDVEMLKKSGLDFIGINHYTSFYSKDCMFSACEPG-PGTSRTEGFAL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+VTY+K++++N P+++TENG+ +   PNS  E
Sbjct  371   RTAQKDGVFIGEPTAVDWLYVYPQGMEKIVTYVKDRYNNTPIFITENGFGEVENPNSCNE  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YLNALA  IRKGADVRGY +WSL DNFEWT G   R GL++ D  T
Sbjct  431   ELLNDVKRVEYMKSYLNALAEGIRKGADVRGYVVWSLLDNFEWTSGLRVRFGLHRVDYAT  490

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRT +LSA WYKQF++ N+ V++ +
Sbjct  491   LKRTQRLSAAWYKQFVS-NQTVQTHL  515



>ref|XP_008224799.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Prunus 
mume]
Length=513

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 192/259 (74%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IG+ M   W+ P++NS  DK AAERA SF  NWFLDPI++G YP EM
Sbjct  247   IYRTQYQKKQGGSIGMIMNAVWYEPISNSLEDKLAAERAQSFYMNWFLDPIVHGKYPAEM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG+ LP FS +D+E L+    DFIGINHYT++Y +DC++S C+P   G +R EGF  
Sbjct  307   QEILGADLPIFSESDVEMLRKNRLDFIGINHYTSFYIKDCIFSECEPG-PGASRTEGFAL  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  +GE   + ++ VYP GM+K+VTY+K++++N P+++TENG+  T   NS  E
Sbjct  366   RTAEKDGVFLGEPTSVDWLYVYPQGMDKIVTYVKDRYNNTPIFITENGFGKTDNSNSTNE  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRVK+   YL+ALA A+RKGADVRGYF+WSL DNFEWT GYT R GL+  D  T
Sbjct  426   ELLNDVKRVKYMRSYLHALAEAMRKGADVRGYFVWSLLDNFEWTSGYTVRFGLHHVDYAT  485

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LSA WYKQFI+ +
Sbjct  486   LKRTKRLSADWYKQFISNH  504



>ref|XP_008384040.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Malus domestica]
Length=497

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 194/266 (73%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  Y ++QGG IGI M   W+ P+++S  D+ AAERA SF  NWFLDPI+ G YP EM
Sbjct  231   LYRTKYHKKQGGSIGIVMNAVWYEPISSSLEDRLAAERAISFYMNWFLDPILQGKYPAEM  290

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP FS +D+E LK  G DFIGINHYT++Y++DC++S C+P   G +R EGF  
Sbjct  291   RELLGSDLPAFSKSDVEMLKMNGLDFIGINHYTSFYSKDCMFSACEPG-PGASRTEGFAL  349

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   +  + VYP GMEKMVTY+K++++N P+++TENG+ +   PNS+ E
Sbjct  350   RTAQKDGVFIGEPTSVDXLYVYPQGMEKMVTYVKDRYNNTPIFITENGFGEVENPNSSNE  409

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YL+AL+  IRKGADVRGY +WSL DNFEWT GYT R GL+  D  T
Sbjct  410   ELLNDVKRVEYLRSYLHALSEGIRKGADVRGYLVWSLLDNFEWTSGYTVRFGLHHVDYAT  469

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKR  +LSA WYKQF++ N  V++ +
Sbjct  470   LKRNQRLSAAWYKQFVS-NHTVQTHL  494



>ref|XP_008384039.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Malus domestica]
Length=518

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 194/266 (73%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  Y ++QGG IGI M   W+ P+++S  D+ AAERA SF  NWFLDPI+ G YP EM
Sbjct  252   LYRTKYHKKQGGSIGIVMNAVWYEPISSSLEDRLAAERAISFYMNWFLDPILQGKYPAEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP FS +D+E LK  G DFIGINHYT++Y++DC++S C+P   G +R EGF  
Sbjct  312   RELLGSDLPAFSKSDVEMLKMNGLDFIGINHYTSFYSKDCMFSACEPG-PGASRTEGFAL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   +  + VYP GMEKMVTY+K++++N P+++TENG+ +   PNS+ E
Sbjct  371   RTAQKDGVFIGEPTSVDXLYVYPQGMEKMVTYVKDRYNNTPIFITENGFGEVENPNSSNE  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YL+AL+  IRKGADVRGY +WSL DNFEWT GYT R GL+  D  T
Sbjct  431   ELLNDVKRVEYLRSYLHALSEGIRKGADVRGYLVWSLLDNFEWTSGYTVRFGLHHVDYAT  490

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKR  +LSA WYKQF++ N  V++ +
Sbjct  491   LKRNQRLSAAWYKQFVS-NHTVQTHL  515



>ref|XP_008364100.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 47-like [Malus 
domestica]
Length=518

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 196/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++Q G IGI M   W+ P++NS  DK+AAERA SF  NWFLDP++ G YP EM
Sbjct  252   LYRTKYQKKQRGSIGIVMNALWYEPISNSLEDKSAAERAMSFYMNWFLDPVLQGKYPAEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG+ LP FS +D+E LK  G DFIGI HYT++Y++DC++S C+P   G +R EGF  
Sbjct  312   REILGADLPAFSKSDVEMLKKNGLDFIGIKHYTSFYSKDCMFSACEPG-PGXSRTEGFAL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+VTY+K++++N P+++TENG+ +   PNS  E
Sbjct  371   RTAQKDGVFIGEPTSVDWLYVYPQGMEKIVTYVKDRYNNTPIFITENGFGEVGNPNSCNE  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YL+ALA  IRKGADVRGY +WSL DNFEWT GYT R GL++ D  T
Sbjct  431   ELLNDVKRVEYMRSYLHALAEGIRKGADVRGYLVWSLLDNFEWTSGYTVRFGLHRVDYAT  490

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRT +LSA WYKQF++ N  V++ +
Sbjct  491   LKRTQRLSAAWYKQFVS-NHTVQTHL  515



>ref|XP_010057964.1| PREDICTED: beta-glucosidase 46 isoform X3 [Eucalyptus grandis]
Length=523

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 191/259 (74%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ++QGG IGI +   WF P++NS  D+ AAERA SF  +WFLDPI++G YP EM
Sbjct  250   IYRTNYQKEQGGIIGIVIHAAWFEPISNSLADELAAERAMSFFMSWFLDPIIFGKYPAEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFS +D EKLK G  DFIGINHYT+YY QDC+ S C+P   G T+ EG+  
Sbjct  310   IEILGSILPEFSRSDQEKLKKG-LDFIGINHYTSYYVQDCILSICEPG-KGITKTEGYYK  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IG+   L ++ VYP GME MVTY+KE+++N P+++TENGY +        E
Sbjct  368   QSSEKNGVPIGQPTDLEWLNVYPQGMEYMVTYVKERYNNTPMFITENGYGEKDDLKLKDE  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L D KRV++ A +L+AL +A+RKGADVRGYF WSL DNFEW FGYT+R GL+  +  T
Sbjct  428   KPLEDLKRVEYMASHLSALLSAVRKGADVRGYFAWSLLDNFEWQFGYTERFGLHHVNFTT  487

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPKLSA WYKQFIA++
Sbjct  488   LKRTPKLSASWYKQFIAEH  506



>ref|XP_006468000.1| PREDICTED: beta-glucosidase 47-like isoform X1 [Citrus sinensis]
Length=519

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 196/259 (76%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W  PM+NS  DK AAERA +F  NWFLDPI++G YPKEM
Sbjct  253   IYRTKYQKEQEGNIGIVMNTLWLEPMSNSLGDKLAAERAQAFYLNWFLDPIIFGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP  S  DLEKLK  G DFIGIN+Y+++Y +DC++S C+P   GN++ EG + 
Sbjct  313   YEILGSSLPSLSKYDLEKLK-NGLDFIGINYYSSFYVKDCIFSVCEPG-PGNSKTEGSIL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  +NG LIGE   + ++ VYP GM ++VTY+KE+++NIP+Y+TENG+ +   P+++IE
Sbjct  371   RTAKRNGVLIGEPTDVDWLFVYPQGMSEIVTYIKERYNNIPMYITENGFGERDNPHTSIE  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LNDT+RV++ +++L++LA A+R GADVRGYF WSL DNFEW  GYT R GL+  D  T
Sbjct  431   DLLNDTRRVRYMSNHLDSLAIAVRNGADVRGYFAWSLLDNFEWNDGYTIRFGLHHVDYAT  490

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LSA WYKQ+IAK+
Sbjct  491   LKRTKRLSANWYKQYIAKH  509



>ref|XP_007212382.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
 gb|EMJ13581.1| hypothetical protein PRUPE_ppa005194mg [Prunus persica]
Length=473

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 189/259 (73%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IG+ M   WF P++NS  DK AAERA SF  NW LDPI++G YP EM
Sbjct  207   IYRTKYQKKQGGSIGMVMNAVWFEPISNSLEDKLAAERAQSFYMNWLLDPIVHGRYPAEM  266

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG+ LP FS +D+E L+    DFIGINHYT++Y +DC++S C+P   G +R EGF  
Sbjct  267   HEILGADLPIFSESDVEMLRKNRLDFIGINHYTSFYVKDCIFSECEPG-PGASRTEGFTL  325

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   + ++ VYP GM+K+VTY+K++++N P+++TENG+ +T   NS  E
Sbjct  326   QTAEKDGVFLGEPTSVDWLYVYPQGMDKIVTYVKDRYNNTPIFITENGFGETEISNSTNE  385

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRV++   YL+ALA A+RKGADVRGYF+WSL DNFEWT GYT   GL+  D  T
Sbjct  386   ELLNDAKRVEYMRSYLHALAEAMRKGADVRGYFVWSLLDNFEWTSGYTVCFGLHHVDYAT  445

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LSA WYK FI+ +
Sbjct  446   LKRTQRLSAAWYKTFISNH  464



>ref|XP_008224797.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
 ref|XP_008224798.1| PREDICTED: beta-glucosidase 47-like [Prunus mume]
Length=519

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 189/259 (73%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IG+ M   WF P++NS  DK AAERA SF  NW LDPI++G YP EM
Sbjct  253   IYRTKYQKKQGGSIGMVMNAVWFEPISNSLEDKLAAERAQSFYMNWLLDPIVHGRYPAEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG+ LP FS +D+E L+    DFIGINHYT++Y +DC++S C+P   G +R EGF  
Sbjct  313   HEILGADLPIFSESDVEMLRKNRLDFIGINHYTSFYVKDCIFSACEPG-PGASRTEGFTL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  +GE   + ++ VYP GM+ +VTY+K++++N P+++TENG+ +T   NS  E
Sbjct  372   QTAEKDGVFLGEPTSVDWLYVYPQGMDNIVTYVKDRYNNTPIFITENGFGETEISNSTHE  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KR ++   YL+ALA A+RKGADVRGYF+WSL DNFEWT GYT R GL+  D  T
Sbjct  432   ELLNDAKRAEYMRSYLHALAEAMRKGADVRGYFVWSLLDNFEWTSGYTVRFGLHHVDYAT  491

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LSA WYK+FI+ +
Sbjct  492   LKRTQRLSAAWYKKFISNH  510



>ref|XP_007211830.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
 gb|EMJ13029.1| hypothetical protein PRUPE_ppa004523mg [Prunus persica]
Length=505

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 191/259 (74%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IG+ M   W+ P++NS  DK AAERA SF  NWFLDPI++G YP EM
Sbjct  239   IYRTQYQKKQGGSIGMIMNAVWYEPISNSLEDKLAAERAQSFYLNWFLDPIVHGKYPAEM  298

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG+ LP FS +D+E L+    DFIGINHYT++Y +DC++S C+P   G +R EGF  
Sbjct  299   REILGADLPIFSESDVEMLRKNRLDFIGINHYTSFYIKDCIFSECEPG-PGASRTEGFAL  357

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  +GE   + ++ VYP GM+K+VTY+K++++N P+++TENG+ +T   N   E
Sbjct  358   RTAEKDGVFLGEPTTVDWLYVYPQGMDKIVTYVKDRYNNTPIFITENGFGETEVSNFTNE  417

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KRVK+   YL+ALA A+RKGADVRGYF+WSL DNFEWT GYT R GL+  D  T
Sbjct  418   ELLNDVKRVKYMRSYLHALAEAMRKGADVRGYFVWSLLDNFEWTSGYTVRFGLHYVDYAT  477

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LS  WYKQFI+ +
Sbjct  478   LKRTQRLSVDWYKQFISNH  496



>ref|XP_010057961.1| PREDICTED: beta-glucosidase 46 isoform X1 [Eucalyptus grandis]
 ref|XP_010057963.1| PREDICTED: beta-glucosidase 46 isoform X2 [Eucalyptus grandis]
Length=524

 Score =   310 bits (794),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 191/260 (73%), Gaps = 3/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ++QGG IGI +   WF P++NS  D+ AAERA SF  +WFLDPI++G YP EM
Sbjct  250   IYRTNYQKEQGGIIGIVIHAAWFEPISNSLADELAAERAMSFFMSWFLDPIIFGKYPAEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFS +D EKLK G  DFIGINHYT+YY QDC+ S C+P   G T+ EG+  
Sbjct  310   IEILGSILPEFSRSDQEKLKKG-LDFIGINHYTSYYVQDCILSICEPG-KGITKTEGYYK  367

Query  773   QSLSKNGKLIGE-LAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             QS  KNG  IG+    L ++ VYP GME MVTY+KE+++N P+++TENGY +        
Sbjct  368   QSSEKNGVPIGQPQTDLEWLNVYPQGMEYMVTYVKERYNNTPMFITENGYGEKDDLKLKD  427

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+ L D KRV++ A +L+AL +A+RKGADVRGYF WSL DNFEW FGYT+R GL+  +  
Sbjct  428   EKPLEDLKRVEYMASHLSALLSAVRKGADVRGYFAWSLLDNFEWQFGYTERFGLHHVNFT  487

Query  416   TLKRTPKLSAKWYKQFIAKN  357
             TLKRTPKLSA WYKQFIA++
Sbjct  488   TLKRTPKLSASWYKQFIAEH  507



>gb|KCW75357.1| hypothetical protein EUGRSUZ_E04103 [Eucalyptus grandis]
Length=524

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 190/260 (73%), Gaps = 3/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQ-QQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKE  957
             IYR NYQ  +QGG IGI +   WF P++NS  D+ AAERA SF  +WFLDPI++G YP E
Sbjct  250   IYRTNYQHHEQGGIIGIVIHAAWFEPISNSLADELAAERAMSFFMSWFLDPIIFGKYPAE  309

Query  956   MKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFV  777
             M +ILGS LPEFS +D EKLK G  DFIGINHYT+YY QDC+ S C+P   G T+ EG+ 
Sbjct  310   MIEILGSILPEFSRSDQEKLKKG-LDFIGINHYTSYYVQDCILSICEPG-KGITKTEGYY  367

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              QS  KNG  IG+   L ++ VYP GME MVTY+KE+++N P+++TENGY +        
Sbjct  368   KQSSEKNGVPIGQPTDLEWLNVYPQGMEYMVTYVKERYNNTPMFITENGYGEKDDLKLKD  427

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+ L D KRV++ A +L+AL +A+RKGADVRGYF WSL DNFEW FGYT+R GL+  +  
Sbjct  428   EKPLEDLKRVEYMASHLSALLSAVRKGADVRGYFAWSLLDNFEWQFGYTERFGLHHVNFT  487

Query  416   TLKRTPKLSAKWYKQFIAKN  357
             TLKRTPKLSA WYKQFIA++
Sbjct  488   TLKRTPKLSASWYKQFIAEH  507



>gb|KHG29721.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=536

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 192/267 (72%), Gaps = 2/267 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ Q   IGI +   W+ P++NS  DK AAERA SF  NWFL+PI+YG YP+EM
Sbjct  261   VYRTKYQESQRASIGIVLHCMWYEPISNSVADKLAAERAQSFSINWFLEPIIYGRYPREM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEF++++ +KL  G  DFIG+NHYT++Y +DC++S C+P  +G ++ EGF  
Sbjct  321   QNILGSILPEFTTSEKQKLNQG-LDFIGVNHYTSFYVKDCMFSACEPG-SGTSKTEGFWA  378

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGE   L ++ VYP GM+K+VTYLK K+ NIP+ +TENGY D    +S I+
Sbjct  379   QSSQKNGIPIGEPTELSWLNVYPQGMDKIVTYLKHKYHNIPMIITENGYGDVIKADSTID  438

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+D KR+ F   +L+AL+TAI+KGA+V+GYF WSL DNFEW  GYT R GL+  D  T
Sbjct  439   ELLHDEKRIDFMDRHLDALSTAIKKGANVKGYFAWSLLDNFEWNSGYTVRFGLHHVDHKT  498

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             L R PK+SA WYK  IA++RK +   Q
Sbjct  499   LMRRPKMSATWYKNLIAEHRKCKGPDQ  525



>ref|XP_008384043.1| PREDICTED: beta-glucosidase 47-like [Malus domestica]
Length=522

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 193/264 (73%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG IGI M   WF P++NS  DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  256   VYRTKYQKIQGGSIGIVMNAPWFEPISNSLEDKLAAERAISFYMNWFLDPIVLGRYPAEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LG+ LP FS +D+E LK  G DFIG+NHYT+ Y++DC++S C+ S  G +R EG+  
Sbjct  316   QELLGADLPAFSKSDVEMLKKTGLDFIGLNHYTSCYSKDCMFSVCE-SGTGASRTEGYAL  374

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+VTY+KE+++N P+++TENG+ +    NS+  
Sbjct  375   RTFEKDGVFIGEPTTIDWLYVYPQGMEKIVTYVKERYNNTPMFITENGFGEIENSNSSSA  434

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+D KR+++   YL ALA A+RKGADVRGY +WSL DNFEWT GYT R GLY+ D  T
Sbjct  435   ELLHDVKRLEYMGSYLQALAKAMRKGADVRGYLVWSLLDNFEWTSGYTIRFGLYRVDYTT  494

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRT +LSA WYKQFI+ N  V++
Sbjct  495   LKRTQRLSAAWYKQFIS-NHTVQA  517



>ref|XP_011037698.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=405

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 183/268 (68%), Gaps = 2/268 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+QQGG IGI +   WF P +NST D  A +RA  F  NWFLDPI++G YP EM
Sbjct  136   IYRTKYQKQQGGSIGIVIHCAWFEPYSNSTADNLATDRAQDFFMNWFLDPIIFGKYPAEM  195

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP+FSS D E+LK G  DFIGINHYT +Y QDC +  C P   G +R EG   
Sbjct  196   TKILGSALPKFSSNDRERLKKG-LDFIGINHYTGFYIQDCSFVVCKPGQGG-SRTEGLAQ  253

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q   K+G  IG+ + + +I VYP GMEKM+TYLKE+++N P+ VTENG+   +  N  IE
Sbjct  254   QVQEKDGVPIGKSSEVDWIHVYPQGMEKMITYLKERYNNTPMIVTENGFGQESYLNRTIE  313

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L D +RV++ + YL++L TA+ KGADVRGYF WSL DNFEW  GYT+R GL+  D  T
Sbjct  314   EYLQDRERVEYMSGYLDSLMTAMLKGADVRGYFAWSLLDNFEWGHGYTRRFGLHHVDYTT  373

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQL  330
             LKR P+LSA W+K+FIA+ +      +L
Sbjct  374   LKRIPRLSATWFKEFIARYKITSHSCRL  401



>ref|XP_004486131.1| PREDICTED: beta-glucosidase 47-like [Cicer arietinum]
Length=496

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 190/260 (73%), Gaps = 2/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG+IGI M   W+ P +NS+ DK AAERA SF  NWFLDPI+ G YPKEM
Sbjct  232   VYRNKYQKNQGGKIGIVMNAVWYEPFSNSSEDKLAAERAQSFNMNWFLDPIILGKYPKEM  291

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              DILG  L  FS  DLEKLK+G  DF+GINHYT+YY +DC++STC+    G+++ EGF  
Sbjct  292   HDILGPDLLPFSKYDLEKLKSG-LDFVGINHYTSYYVKDCIFSTCEQG-KGSSKTEGFAL  349

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S   NG  IGE   L ++ V+P GMEK+VTY+K++++NIP+++TENG+  T       +
Sbjct  350   TSPQMNGLNIGEPTALAWLYVHPQGMEKIVTYIKDRYNNIPMFITENGFGMTENSYPTSK  409

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +VLND KRV++ + YL++LATAIRKGADVRGYF+WSL DNFEW  GY+ R GL+  D  T
Sbjct  410   DVLNDVKRVEYLSGYLDSLATAIRKGADVRGYFLWSLLDNFEWNHGYSIRFGLHHVDFET  469

Query  413   LKRTPKLSAKWYKQFIAKNR  354
             L RTP++SA WYK FI +++
Sbjct  470   LNRTPRVSAFWYKNFIVEHK  489



>ref|XP_004293271.1| PREDICTED: beta-glucosidase 47-like [Fragaria vesca subsp. vesca]
Length=514

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 187/260 (72%), Gaps = 3/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++Q G IGI M   W+ P+++S  DK AAERA SF  NWFLDPI++G YP EM
Sbjct  248   VYRTKYQKKQEGSIGIVMNAVWYEPISSSLEDKLAAERAQSFYINWFLDPIVHGRYPAEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LG  LPEFS  D+E LK  G DFIGINHYT++Y++DC+ S C+P   G +R EG+  
Sbjct  308   HELLGDDLPEFSMFDMEMLK-NGLDFIGINHYTSFYSKDCMISPCEPG-PGVSRTEGYAL  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ V+P GMEKMVTY+KE+++N P+++TENGY +    N+  E
Sbjct  366   RTAQKDGIYIGEPTAVDWLYVHPQGMEKMVTYIKERYNNTPMFITENGYAEEANSNTTNE  425

Query  593   EVLNDTKRVKFFADYLNALATAIR-KGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E  ND KRV++   YL ALA  +R KGADVRGYF+WSL DNFEWT GYT + GL+  D V
Sbjct  426   EQFNDVKRVEYMRSYLQALADTMRTKGADVRGYFVWSLLDNFEWTSGYTVQFGLHHVDNV  485

Query  416   TLKRTPKLSAKWYKQFIAKN  357
             TLKRTP+LSA WY+QFI  N
Sbjct  486   TLKRTPRLSADWYRQFIVNN  505



>ref|XP_002305594.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE86105.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=504

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 191/266 (72%), Gaps = 4/266 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI +   WF  ++NST DK AA+RA  F  NWFLDPI++G+YP EM
Sbjct  243   VYRTKYQKEQGGNIGIVLDCIWFEQISNSTADKLAADRAQDFFLNWFLDPIIFGNYPAEM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP+FSS D EKLK  G DFIGINHYT+ Y QDC++S C+P   G +R EG   
Sbjct  303   SKILGSTLPKFSSNDKEKLK-NGLDFIGINHYTSEYVQDCIFSVCEPG-TGASRTEGLAR  360

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  K+G  IG    + ++  YP GMEKMVTY+K++++N P+ +TENGY     PN  I 
Sbjct  361   RSQEKDGVPIGIPTDVDWLHFYPQGMEKMVTYIKKRYNNKPMIITENGYGQQNNPNLTI-  419

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              V +D +RV+F ++Y ++L TA+ KGADVRGYF WSL DNFEWT+GYT+R GLY  D  T
Sbjct  420   -VCHDIERVEFMSNYWDSLLTAMEKGADVRGYFAWSLLDNFEWTYGYTQRYGLYHVDFTT  478

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPKLSA W+K+FIA+ +  +S+M
Sbjct  479   LKRTPKLSAAWFKEFIARYKVDKSQM  504



>ref|XP_007026015.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
 gb|EOY28637.1| Beta-glucosidase 47 isoform 1 [Theobroma cacao]
Length=427

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 191/259 (74%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+QQ G IGI M   W+ P++NS  DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  163   IYRTKYQKQQRGSIGIVMNAIWYEPISNSFEDKQAAERAQSFYMNWFLDPIILGKYPLEM  222

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS+ D +KLK+G  DFIG+NHYT++Y +DC++S C+    G+++ EGF  
Sbjct  223   QEILGSDLPVFSNHDQKKLKSG-LDFIGVNHYTSFYIRDCMFSVCEQG-PGSSKTEGFAL  280

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   + ++ VYP GM+K+VTY+KE++++IP+++TENG+ +    +S  E
Sbjct  281   RTALKDGIFIGKSTAVDWLYVYPQGMDKIVTYIKERYNSIPMFITENGFGENDKADSPTE  340

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND  RV++ + YL+ LA A+RKGADVRGYF+WSL DNFEWT GYT R GL+  D  T
Sbjct  341   ESLNDVNRVEYISGYLDTLAAALRKGADVRGYFLWSLLDNFEWTSGYTIRFGLHHVDYAT  400

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTP+ SA WYKQFIA +
Sbjct  401   LERTPRASAIWYKQFIANH  419



>ref|XP_007026016.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
 gb|EOY28638.1| Beta-glucosidase 47 isoform 2 [Theobroma cacao]
Length=417

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 191/259 (74%), Gaps = 2/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+QQ G IGI M   W+ P++NS  DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  153   IYRTKYQKQQRGSIGIVMNAIWYEPISNSFEDKQAAERAQSFYMNWFLDPIILGKYPLEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS+ D +KLK+G  DFIG+NHYT++Y +DC++S C+    G+++ EGF  
Sbjct  213   QEILGSDLPVFSNHDQKKLKSG-LDFIGVNHYTSFYIRDCMFSVCEQG-PGSSKTEGFAL  270

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   + ++ VYP GM+K+VTY+KE++++IP+++TENG+ +    +S  E
Sbjct  271   RTALKDGIFIGKSTAVDWLYVYPQGMDKIVTYIKERYNSIPMFITENGFGENDKADSPTE  330

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND  RV++ + YL+ LA A+RKGADVRGYF+WSL DNFEWT GYT R GL+  D  T
Sbjct  331   ESLNDVNRVEYISGYLDTLAAALRKGADVRGYFLWSLLDNFEWTSGYTIRFGLHHVDYAT  390

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTP+ SA WYKQFIA +
Sbjct  391   LERTPRASAIWYKQFIANH  409



>ref|XP_002304951.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEE85462.2| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=515

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 188/264 (71%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI M   W  P+++S  DK A ERA++F  NWFLDPI+ G YP EM
Sbjct  252   VYRTKYQKKQGGSIGIVMNAIWHEPISDSLEDKLAVERANAFYMNWFLDPIILGKYPTEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ LGS LP FS  +LEKLK+G  DFIGIN YT++Y +DC++STC+    G ++ EG   
Sbjct  312   RETLGSDLPVFSKYELEKLKSG-VDFIGINQYTSFYVKDCMFSTCEQG-PGVSKTEGLYL  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   L ++ VYP GMEK+VTY K++++NIP+Y+TENGYCD    N   +
Sbjct  370   RTAQKDGFFIGQPTALDWLHVYPQGMEKLVTYFKDRYNNIPMYITENGYCDEENVNVTTK  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              VL D +RV++ + YL+AL TA+RKGADVRGYF WSL DNFEWT GYT R GLY  D  T
Sbjct  430   AVLKDVQRVEYMSSYLDALETAVRKGADVRGYFAWSLLDNFEWTSGYTIRFGLYHVDFST  489

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRT KLSA WYK +IA  + V +
Sbjct  490   LKRTRKLSATWYKDYIANYKAVRT  513



>gb|KEH36818.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=418

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 185/260 (71%), Gaps = 2/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG+IGI + F W+ P++NS  DK A ERA SF +NW LDPI++G YP  M
Sbjct  153   IYRTKYQAEQGGKIGIVLHFDWYEPISNSMADKLATERARSFTNNWLLDPIIFGEYPPVM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG  LP+FS+ + EKLK+G  DFIGINHY +YY +DC+YS C+P   G TR EG   
Sbjct  213   QKILGDILPKFSNNNKEKLKSG-LDFIGINHYASYYIKDCIYSKCEPG-PGITRTEGLFQ  270

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  K+G  IG+   + +  VYP GMEK+VTY+K +++N P+++TENGY +   PN+  E
Sbjct  271   QSAEKDGVPIGKPTSIDWQYVYPQGMEKIVTYVKTRYNNTPMFITENGYGELDNPNNTEE  330

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  R  + A +L +L  AIRKGADVRGYF WSL DNFEW  GYT R GL+  D  T
Sbjct  331   QYLNDFDRKNYMAGHLLSLLEAIRKGADVRGYFAWSLLDNFEWLQGYTVRFGLHHVDYAT  390

Query  413   LKRTPKLSAKWYKQFIAKNR  354
             LKRTP+LSA WYK+FIAK++
Sbjct  391   LKRTPRLSANWYKEFIAKHK  410



>ref|XP_010267720.1| PREDICTED: beta-glucosidase 46 isoform X3 [Nelumbo nucifera]
Length=522

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 188/270 (70%), Gaps = 2/270 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI M   WF P+TNS  D+ AAERA SF  NWFLDPI++G YP EM
Sbjct  251   IYRTRYQKKQGGSIGIVMNAIWFEPLTNSPADRLAAERAQSFYLNWFLDPIIFGKYPPEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFS  + E L+ G  DFIGINHYT+ Y +DC+ S C P   G ++ EG   
Sbjct  311   HEILGSILPEFSRNEWEILQTG-LDFIGINHYTSLYVKDCISSMCKPGTGG-SKTEGLAI  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE  G+ +  V+P GMEK++ Y+KE+++N P+++TENGY +    + + E
Sbjct  369   RTGRKDGVPIGEPTGMDWFYVHPQGMEKIIIYVKERYNNTPIFITENGYGEENNASFSTE  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
                 D KRV +   YL+AL  A+RKGADVRGYFIWSL DNFEW  GYTKR GLY  D  T
Sbjct  429   NFQYDIKRVNYLNGYLSALQRAMRKGADVRGYFIWSLLDNFEWICGYTKRFGLYHVDYKT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
             ++RTPKLSA WYKQFIA+ + +++ + L N
Sbjct  489   MERTPKLSATWYKQFIARQKPIKAIIPLSN  518



>ref|XP_010267719.1| PREDICTED: beta-glucosidase 46 isoform X2 [Nelumbo nucifera]
Length=544

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 188/270 (70%), Gaps = 2/270 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI M   WF P+TNS  D+ AAERA SF  NWFLDPI++G YP EM
Sbjct  273   IYRTRYQKKQGGSIGIVMNAIWFEPLTNSPADRLAAERAQSFYLNWFLDPIIFGKYPPEM  332

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFS  + E L+ G  DFIGINHYT+ Y +DC+ S C P   G ++ EG   
Sbjct  333   HEILGSILPEFSRNEWEILQTG-LDFIGINHYTSLYVKDCISSMCKPGTGG-SKTEGLAI  390

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE  G+ +  V+P GMEK++ Y+KE+++N P+++TENGY +    + + E
Sbjct  391   RTGRKDGVPIGEPTGMDWFYVHPQGMEKIIIYVKERYNNTPIFITENGYGEENNASFSTE  450

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
                 D KRV +   YL+AL  A+RKGADVRGYFIWSL DNFEW  GYTKR GLY  D  T
Sbjct  451   NFQYDIKRVNYLNGYLSALQRAMRKGADVRGYFIWSLLDNFEWICGYTKRFGLYHVDYKT  510

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
             ++RTPKLSA WYKQFIA+ + +++ + L N
Sbjct  511   MERTPKLSATWYKQFIARQKPIKAIIPLSN  540



>ref|XP_011037693.1| PREDICTED: beta-glucosidase 46-like [Populus euphratica]
Length=516

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 190/266 (71%), Gaps = 4/266 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI +   WF  ++NST DK AA+RA  F  NWFLDPI++G+YP EM
Sbjct  255   VYRTKYQKEQGGSIGIVLDCIWFEQISNSTADKLAADRAQDFFLNWFLDPIIFGNYPAEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP+FSS D EKLK  G DFIGINHYT+ Y QDC++S C+P   G +R EG   
Sbjct  315   SKILGSTLPKFSSNDKEKLK-NGLDFIGINHYTSEYVQDCIFSVCEPG-TGASRTEGLAR  372

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  K+G  IG    + ++  YP GMEKMVTY+K++++N P+ +TENGY     PN  I 
Sbjct  373   RSQEKDGAPIGIPTDVDWLHFYPQGMEKMVTYIKKRYNNKPMIITENGYGQLNNPNLTI-  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              V +D +RV+F + Y ++L +A+ KGADVRGYF WSL DNFEWT+GYT+R GLY  D  T
Sbjct  432   -VCHDIERVEFMSSYWDSLLSAMEKGADVRGYFSWSLLDNFEWTYGYTQRYGLYHVDFTT  490

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPKLSA W+K+FIA+ +  +S+M
Sbjct  491   LKRTPKLSATWFKEFIARYKVDKSQM  516



>ref|XP_003529622.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03066.1| Beta-glucosidase 46 [Glycine soja]
Length=524

 Score =   302 bits (773),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 184/261 (70%), Gaps = 2/261 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +   WF PM+NST DK A+ERA +F  NWFLDPI++G YP EM
Sbjct  248   IYRTKYQTEQKGSIGIVLQHEWFEPMSNSTADKLASERARAFNFNWFLDPIIFGKYPTEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP+FSS + EKLK G  DFIG+N+YT +Y QDC+YS C P   G +R EG   
Sbjct  308   ENVLGSLLPKFSSYEKEKLKRG-LDFIGVNYYTAFYVQDCMYSACKPG-PGISRTEGSYK  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  KNG  IGE     +  +YP GMEK VTY++++++N P+++TENGY +   PN   E
Sbjct  366   KSGEKNGVPIGEPTPFSWFNIYPDGMEKTVTYVRDRYNNTPIFLTENGYAEEVDPNFTSE  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND KR+K+  D++ AL  AIRKGADVRGYF W+L D+FEW +GYT R G +  D  T
Sbjct  426   EHLNDFKRIKYMVDHIEALLAAIRKGADVRGYFAWTLIDSFEWIYGYTVRYGFHHVDYAT  485

Query  413   LKRTPKLSAKWYKQFIAKNRK  351
             LKRTP+LSA WYKQ + + +K
Sbjct  486   LKRTPRLSASWYKQLLVQYKK  506



>ref|XP_003610400.1| Beta-glucosidase [Medicago truncatula]
 gb|AES92597.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 185/263 (70%), Gaps = 2/263 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +   W+ PM+NS  DK AAERA SF  NW LDPI++G YPKEM
Sbjct  250   IYRTKYQAEQKGRIGIVISHEWYEPMSNSNADKLAAERARSFTFNWILDPIIFGKYPKEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP+FSS + +KL  G  DFIGIN+YT++Y QDC+Y+ CD S +G +R EG   
Sbjct  310   ENVLGSLLPKFSSNEKKKLMKG-LDFIGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYM  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S  +NG  IGE     +  +YP GMEK VTY+K++++N P+++TENGY      N  +E
Sbjct  368   TSGYRNGVSIGEATPFTWFNIYPQGMEKTVTYVKDRYNNTPMFITENGYGQQDDQNLTLE  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND KR+K+   ++ AL+TAIRKGADVRGYF WSL DNFEW +GYT R G +  D  T
Sbjct  428   DQLNDFKRIKYMKSHIEALSTAIRKGADVRGYFAWSLLDNFEWIYGYTVRYGFHHVDYAT  487

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTP+LSA WYKQFI   ++ E
Sbjct  488   LKRTPRLSASWYKQFIVNYKQTE  510



>ref|XP_011037696.1| PREDICTED: beta-glucosidase 47-like [Populus euphratica]
Length=535

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 189/264 (72%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI M   W  P+++S  DK A ERA++F  NWFLDPI+ G YP +M
Sbjct  272   VYRTKYQKKQGGSIGIVMNAIWHEPISDSLEDKLAVERANAFYMNWFLDPIILGKYPTQM  331

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  +LEKLK+G +DFIGIN YT +Y +DC +STC+    G ++ EG   
Sbjct  332   REILGSDLPVFSKYELEKLKSG-ADFIGINQYTGFYVKDCAFSTCEQG-PGVSKTEGLYL  389

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   L ++ VYP GMEK+VTY K++++NIP+Y+TENGYC+    N   +
Sbjct  390   RTAQKDGFFIGQPTALDWLHVYPQGMEKLVTYFKDRYNNIPMYITENGYCEEENVNVTTK  449

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              VL D +RV++ + YL+AL TA+RKGADVRGYF WSL DNFEWT GYT R GLY  D  T
Sbjct  450   AVLKDIQRVEYMSSYLDALETAVRKGADVRGYFAWSLLDNFEWTSGYTIRFGLYHVDFST  509

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRT KLSA WYK +IA ++ V +
Sbjct  510   LKRTRKLSATWYKDYIAHHKVVRT  533



>gb|AFK46781.1| unknown [Medicago truncatula]
Length=521

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 185/263 (70%), Gaps = 2/263 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +   W+ PM+NS  DK AAERA SF  NW LDPI++G YPKEM
Sbjct  250   IYRTKYQAEQKGRIGIVISHEWYEPMSNSNADKLAAERARSFTFNWILDPIIFGKYPKEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP+FSS + +KL  G  DFIGIN+YT++Y QDC+Y+ CD S +G +R EG   
Sbjct  310   ENVLGSLLPKFSSNEKKKLMKG-LDFIGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYM  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S  +NG  IGE     +  +YP GMEK VTY+K++++N P+++TENGY      N  +E
Sbjct  368   TSGYRNGVSIGEATPFTWFNIYPQGMEKTVTYVKDRYNNTPMFITENGYGQQDDQNLTLE  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND KR+K+   ++ AL+TAIRKGADVRGYF WSL DNFEW +GYT R G +  D  T
Sbjct  428   DQLNDFKRIKYMKSHIEALSTAIRKGADVRGYFAWSLLDNFEWIYGYTVRYGFHHVDYAT  487

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTP+LSA WYKQFI   ++ E
Sbjct  488   LKRTPRLSASWYKQFIVNYKQTE  510



>gb|KEH36817.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 185/260 (71%), Gaps = 2/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG+IGI + F W+ P++NS  DK A ERA SF +NW LDPI++G YP  M
Sbjct  256   IYRTKYQAEQGGKIGIVLHFDWYEPISNSMADKLATERARSFTNNWLLDPIIFGEYPPVM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG  LP+FS+ + EKLK+G  DFIGINHY +YY +DC+YS C+P   G TR EG   
Sbjct  316   QKILGDILPKFSNNNKEKLKSG-LDFIGINHYASYYIKDCIYSKCEPG-PGITRTEGLFQ  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  K+G  IG+   + +  VYP GMEK+VTY+K +++N P+++TENGY +   PN+  E
Sbjct  374   QSAEKDGVPIGKPTSIDWQYVYPQGMEKIVTYVKTRYNNTPMFITENGYGELDNPNNTEE  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  R  + A +L +L  AIRKGADVRGYF WSL DNFEW  GYT R GL+  D  T
Sbjct  434   QYLNDFDRKNYMAGHLLSLLEAIRKGADVRGYFAWSLLDNFEWLQGYTVRFGLHHVDYAT  493

Query  413   LKRTPKLSAKWYKQFIAKNR  354
             LKRTP+LSA WYK+FIAK++
Sbjct  494   LKRTPRLSANWYKEFIAKHK  513



>gb|KHN33045.1| Beta-glucosidase 47 [Glycine soja]
Length=525

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 187/257 (73%), Gaps = 2/257 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG+IG+ M   WF P++NS  DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  256   LYRTKYQKKQGGKIGVVMNAIWFEPVSNSWKDKLAAERAQSFYMNWFLDPIIIGEYPAEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  LP FS  D+EKLK+G  DFIG+NHYT+ +A+DC++S C+    G++R EGF  
Sbjct  316   HEILGQDLPTFSRYDVEKLKSG-LDFIGVNHYTSAFAKDCIFSACEQGR-GSSRTEGFTL  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S   NG  IGE   L ++ V+P GMEK++TYLK +++NIP+++TENG       N   +
Sbjct  374   RSPQMNGISIGEPTALDWLYVHPQGMEKILTYLKHRYNNIPMFITENGIGMRENSNHATK  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +RV++   YL++LATAIRKGADVRGYF+WSL DNFEWT GY+ R GL+  D  T
Sbjct  434   EIINDVERVEYLRGYLDSLATAIRKGADVRGYFVWSLLDNFEWTDGYSIRFGLHHVDYAT  493

Query  413   LKRTPKLSAKWYKQFIA  363
             L RTP++SA WYK FIA
Sbjct  494   LNRTPRMSAFWYKNFIA  510



>ref|XP_010665547.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 46-like [Beta 
vulgaris subsp. vulgaris]
Length=573

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 189/270 (70%), Gaps = 2/270 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++Q G IGI     WF P++NS +DK AAERA SF  NW LDPIM+G YP+EM
Sbjct  296   LYRTKYQEKQRGSIGIVQNAIWFEPISNSPLDKLAAERAQSFFLNWILDPIMFGEYPEEM  355

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG +LP FS  + +K+     DFIGINHY++YYAQDC++S C     G +  EG   
Sbjct  356   RKILGPNLPRFSKKE-KKILNNALDFIGINHYSSYYAQDCMFSRCKAG-PGVSWTEGLYL  413

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++ SKNG LIGE   + ++ + P GMEKMVTY+KE+++N P+++TENGY   +  N  + 
Sbjct  414   RTPSKNGILIGEPTAMDWLYISPQGMEKMVTYVKERYNNTPMFITENGYAQESNQNCVLN  473

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKRV++ A YL++L  AI++GADVRGYF WSL DNFEW +GYTKR GLY  D  T
Sbjct  474   ELLSDTKRVEYMAGYLDSLLRAIKQGADVRGYFAWSLLDNFEWLYGYTKRFGLYHVDYHT  533

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
             LKR+PKLS  WY+ FIA +    +  Q GN
Sbjct  534   LKRSPKLSVAWYRNFIANHITQTTLKQRGN  563



>ref|XP_006391959.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
 gb|ESQ29245.1| hypothetical protein EUTSA_v10023411mg [Eutrema salsugineum]
Length=520

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 187/260 (72%), Gaps = 3/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P++NS  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  252   IYRTKYQKEQKGIIGIVVQTSWFEPVSNSIADKKAAERAQSFYSNWILDPVVYGRYPQEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              DILGS LP FSS ++  LK   SDF+GINHYT+Y+ QDC+ S C+ S  G ++ EGF  
Sbjct  312   VDILGSALPRFSSNEMMNLKRYKSDFLGINHYTSYFIQDCMTSACN-SGDGASKSEGFAL  370

Query  773   QSLSKNGKL-IGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             + L +NG + IGEL  + ++ + P G  KM+ YLK+++ NIP+++TENGY D   P + +
Sbjct  371   K-LDRNGNVSIGELTDVSWLHIDPEGFRKMLNYLKDRYPNIPMFITENGYGDLQKPETTV  429

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +E+LNDT+R+ + + YL+AL  A+R GA+V+GYF WSL DNFEW +GYT R GLY  D  
Sbjct  430   KELLNDTRRIHYMSGYLDALKDAMRDGANVKGYFAWSLLDNFEWLYGYTLRFGLYHVDYT  489

Query  416   TLKRTPKLSAKWYKQFIAKN  357
             TLKRTPK SA WYK FI ++
Sbjct  490   TLKRTPKQSALWYKNFIEQH  509



>ref|XP_006468001.1| PREDICTED: beta-glucosidase 47-like isoform X2 [Citrus sinensis]
Length=509

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 190/259 (73%), Gaps = 12/259 (5%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI M   W  PM+NS  DK AAERA +F  NWFLDPI++G YPKEM
Sbjct  253   IYRTKYQKEQEGNIGIVMNTLWLEPMSNSLGDKLAAERAQAFYLNWFLDPIIFGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP  S  DLEKLK  G DFIGIN+Y+++Y +DC++S C+P   GN++ EG + 
Sbjct  313   YEILGSSLPSLSKYDLEKLK-NGLDFIGINYYSSFYVKDCIFSVCEPG-PGNSKTEGSIL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  +NG LIGE          P  M ++VTY+KE+++NIP+Y+TENG+ +   P+++IE
Sbjct  371   RTAKRNGVLIGE----------PVRMSEIVTYIKERYNNIPMYITENGFGERDNPHTSIE  420

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LNDT+RV++ +++L++LA A+R GADVRGYF WSL DNFEW  GYT R GL+  D  T
Sbjct  421   DLLNDTRRVRYMSNHLDSLAIAVRNGADVRGYFAWSLLDNFEWNDGYTIRFGLHHVDYAT  480

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRT +LSA WYKQ+IAK+
Sbjct  481   LKRTKRLSANWYKQYIAKH  499



>ref|XP_007147745.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
 gb|ESW19739.1| hypothetical protein PHAVU_006G151400g [Phaseolus vulgaris]
Length=451

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 188/257 (73%), Gaps = 3/257 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG+IG+ M   WF P++NS+ DK AAERA SF  NWFLDP++ G YP+EM
Sbjct  183   LYRTKYQKIQGGKIGLVMHTMWFEPISNSSEDKIAAERAQSFFMNWFLDPVIRGEYPREM  242

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP     +LEKLK    DFIG+NHYT+Y+ +DC++S C+P + G+TR EGF  
Sbjct  243   REILGEDLPPVP-YNLEKLKPA-IDFIGVNHYTSYFVKDCIHSVCEPGL-GSTRTEGFAL  299

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +    NG  IGE   L ++ VYP GMEK+VTY+KE+++NIP+++TENG       N   +
Sbjct  300   KLAKMNGMSIGEPTSLHWLYVYPQGMEKIVTYIKERYNNIPMFITENGVGMRENSNLTTK  359

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +RV++   YL++LATAIRKGADVRGYF+WSL DNFEWT G + R GL++ D  T
Sbjct  360   EMINDVERVEYLRAYLDSLATAIRKGADVRGYFLWSLLDNFEWTEGSSIRFGLHRVDYDT  419

Query  413   LKRTPKLSAKWYKQFIA  363
             L+RTP++SA WYK FIA
Sbjct  420   LQRTPRMSASWYKNFIA  436



>gb|AFK44109.1| unknown [Medicago truncatula]
Length=521

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 183/263 (70%), Gaps = 2/263 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +   W+ PM+NS  DK AAERA SF  NW LDPI++G YPKEM
Sbjct  250   IYRTKYQAEQKGRIGIVISHEWYEPMSNSNADKLAAERARSFTFNWILDPIIFGKYPKEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP+FSS + +KL  G  DFIGIN+YT++Y QDC+Y+ CD S +G +R EG   
Sbjct  310   ENVLGSLLPKFSSNEKKKLMKG-LDFIGINYYTSFYVQDCIYTKCD-SRSGTSRTEGSYM  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S  +NG  IGE     +  +YP GMEK VTY+K++++N P+++TENGY      N   E
Sbjct  368   TSGYRNGVSIGEATPFTWFNIYPQGMEKTVTYVKDRYNNTPMFITENGYGQQDDQNLTSE  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND KR+K+   ++ AL+TAIRKGADVRGYF WSL DN EW +GYT R G +  D  T
Sbjct  428   DQLNDFKRIKYMKSHIEALSTAIRKGADVRGYFAWSLLDNLEWIYGYTVRYGFHHVDYAT  487

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTP+LSA WYKQFI   ++ E
Sbjct  488   LKRTPRLSASWYKQFIVNYKQTE  510



>ref|XP_010430203.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 186/259 (72%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  Y+++Q G IGI +  +WF P+++ST DKAAAERA +F SNW LDP++YG YPKEM
Sbjct  255   LYRTKYKEEQKGIIGIVVQTSWFEPISDSTADKAAAERAQAFYSNWILDPVIYGKYPKEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP FS  ++E LK   SDF+GINHYT+Y+ QDCL S+C+    G ++ EG+  
Sbjct  315   VNILGSALPRFSKKEVEYLKESQSDFVGINHYTSYFIQDCLLSSCNIGF-GASKVEGYAL  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  KM+ YLK+++ NIP+++TENG+ D   P + ++
Sbjct  374   KLDRKGNLTIGELTDVNWQHIHPEGFRKMLNYLKDRYHNIPMFITENGFGDLQKPETTVK  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KR+++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GLY  D VT
Sbjct  434   ELLNDAKRIQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVT  493

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPK SA WY+ +I +N
Sbjct  494   LKRTPKRSASWYRNYIGEN  512



>ref|XP_006301036.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
 gb|EOA33934.1| hypothetical protein CARUB_v10021428mg [Capsella rubella]
Length=520

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 187/261 (72%), Gaps = 0/261 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++Q G IGI +  +WF P+++S  DK AAERA +F SNW LDP+++G YPKEM
Sbjct  256   LYRTKYQEEQKGIIGIVVQTSWFEPISDSIADKEAAERAQAFYSNWILDPVIHGKYPKEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP FS  ++E LK   SDF+GINHYT+Y+ QDCL S+C+ +  G ++ EG+  
Sbjct  316   VNLLGSALPRFSKKEVENLKESRSDFVGINHYTSYFIQDCLLSSCNNTGNGGSKVEGYAL  375

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  KM+ YLK+++ NIP+++TENG+ D   P + ++
Sbjct  376   KLNRKGNVTIGELTDVVWQHIHPEGFRKMLNYLKDRYHNIPMFITENGFGDLQKPETTVK  435

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+D+KRV++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GLY  D VT
Sbjct  436   ELLDDSKRVQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDNVT  495

Query  413   LKRTPKLSAKWYKQFIAKNRK  351
             LKRTPK SA WY+ +I +N +
Sbjct  496   LKRTPKRSASWYRNYIGENLR  516



>ref|XP_010267718.1| PREDICTED: beta-glucosidase 46 isoform X1 [Nelumbo nucifera]
Length=857

 Score =   304 bits (779),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 188/270 (70%), Gaps = 2/270 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI M   WF P+TNS  D+ AAERA SF  NWFLDPI++G YP EM
Sbjct  586   IYRTRYQKKQGGSIGIVMNAIWFEPLTNSPADRLAAERAQSFYLNWFLDPIIFGKYPPEM  645

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFS  + E L+ G  DFIGINHYT+ Y +DC+ S C P   G ++ EG   
Sbjct  646   HEILGSILPEFSRNEWEILQTG-LDFIGINHYTSLYVKDCISSMCKPGTGG-SKTEGLAI  703

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE  G+ +  V+P GMEK++ Y+KE+++N P+++TENGY +    + + E
Sbjct  704   RTGRKDGVPIGEPTGMDWFYVHPQGMEKIIIYVKERYNNTPIFITENGYGEENNASFSTE  763

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
                 D KRV +   YL+AL  A+RKGADVRGYFIWSL DNFEW  GYTKR GLY  D  T
Sbjct  764   NFQYDIKRVNYLNGYLSALQRAMRKGADVRGYFIWSLLDNFEWICGYTKRFGLYHVDYKT  823

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
             ++RTPKLSA WYKQFIA+ + +++ + L N
Sbjct  824   MERTPKLSATWYKQFIARQKPIKAIIPLSN  853



>ref|NP_974067.1| beta glucosidase 46 [Arabidopsis thaliana]
 gb|AEE33893.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=377

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 184/266 (69%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  111   IYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPVVYGKYPEEM  170

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FSS ++  L +  SDF+GINHYT+Y+ QDCL + C+ S  G ++ EG   
Sbjct  171   VNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGLAL  229

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK ++ NIP+Y+TENG+     P + +E
Sbjct  230   KLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQLQKPETTVE  289

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  290   ELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTT  349

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI +N  +E ++
Sbjct  350   LKRTPKQSATWYKNFIEQNVNIEDQI  375



>gb|KEH36812.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=420

 Score =   291 bits (744),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 183/262 (70%), Gaps = 2/262 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG+IGIAM   W+ P +NST DK AAER  SF  NWFLDPI+ G YP EM
Sbjct  153   VYRAKYQKNQGGKIGIAMNAIWYEPFSNSTEDKLAAERTQSFYMNWFLDPIILGKYPAEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  L  FS  D EK K  G DFIGINHYT+YY +DC++S C+    G+++ EGF  
Sbjct  213   HEILGPDLLVFSKYDKEKFK-NGLDFIGINHYTSYYVKDCIFSACEQG-KGSSKTEGFAL  270

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S   N K IGE   L +  V+P GME +VTY+K++++NIP+++TENG+  + +     E
Sbjct  271   TSAQMNDKSIGEPTALAWFYVHPQGMENIVTYIKDRYNNIPMFITENGFGTSESSYPTTE  330

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
               LND KRV++ + YL++LATAIRKGADV+GYF+WS+ DNFEW  GY+ R GL+  D  T
Sbjct  331   YELNDVKRVEYLSSYLDSLATAIRKGADVKGYFVWSILDNFEWNHGYSIRFGLHHVDFAT  390

Query  413   LKRTPKLSAKWYKQFIAKNRKV  348
             L RTP+ SA WYK FI++++ +
Sbjct  391   LNRTPRGSAFWYKNFISEHKNL  412



>gb|KHG29722.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=561

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 192/292 (66%), Gaps = 27/292 (9%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ Q   IGI +   W+ P++NS  DK AAERA SF  NWFL+PI+YG YP+EM
Sbjct  261   VYRTKYQESQRASIGIVLHCMWYEPISNSVADKLAAERAQSFSINWFLEPIIYGRYPREM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEF++++ +KL  G  DFIG+NHYT++Y +DC++S C+P  +G ++ EGF  
Sbjct  321   QNILGSILPEFTTSEKQKLNQG-LDFIGVNHYTSFYVKDCMFSACEPG-SGTSKTEGFWA  378

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENG------------  630
             QS  KNG  IGE   L ++ VYP GM+K+VTYLK K+ NIP+ +TENG            
Sbjct  379   QSSQKNGIPIGEPTELSWLNVYPQGMDKIVTYLKHKYHNIPMIITENGRRKTEALMHKET  438

Query  629   -------------YCDTTTPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIW  489
                          Y D    +S I+E+L+D KR+ F   +L+AL+TAI+KGA+V+GYF W
Sbjct  439   YLYTHNVSCFYIGYGDVIKADSTIDELLHDEKRIDFMDRHLDALSTAIKKGANVKGYFAW  498

Query  488   SLFDNFEWTFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             SL DNFEW  GYT R GL+  D  TL R PK+SA WYK  IA++RK +   Q
Sbjct  499   SLLDNFEWNSGYTVRFGLHHVDHKTLMRRPKMSATWYKNLIAEHRKCKGPDQ  550



>ref|XP_006391958.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
 gb|ESQ29244.1| hypothetical protein EUTSA_v10024134mg [Eutrema salsugineum]
Length=518

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 184/259 (71%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  D+ AAERA SF SNW LDPI+YG YPKEM
Sbjct  255   IYRIKYQEKQRGIIGIVVQTSWFEPISDSIEDREAAERAQSFYSNWILDPIIYGKYPKEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP FS  ++E ++  G DF+GINHYT+Y+ QDCL+STC+    G  + EGF  
Sbjct  315   VTILGSNLPRFSRMEMENIRKSGLDFVGINHYTSYFVQDCLFSTCNAG-DGAFKAEGFAL  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G +KM+ YLK ++ NI +++TENG+ D   P + ++
Sbjct  374   KLDRKGNVSIGELTDVNWQHIHPEGFQKMLNYLKNRYHNITMFITENGFGDLQKPETTVK  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL+AL +AIR GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  434   ELLNDTKRIQYMSGYLDALQSAIRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTT  493

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSA WYK +I ++
Sbjct  494   LERTPKLSASWYKNYIEEH  512



>ref|XP_009137214.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=520

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 185/259 (71%), Gaps = 7/259 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+ Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  259   LYRTKFQEDQRGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  318

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG  LPEF+  DL++ K  G DFIGIN YT+ YA+DCL++ C+P   G +R EGFV 
Sbjct  319   KDILGEDLPEFTKDDLKRSK-NGLDFIGINQYTSRYAKDCLHTACEPGQGG-SRAEGFVY  376

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  377   SNALKDGLPLGEPTGVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RV+F ++YL+AL TA+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  432   VLLNDYRRVEFMSNYLDALKTAMRKGADVRGYFTWSLLDNFEWISGYTIRFGMYHVDFDT  491

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTP+LSA WYK FI KN
Sbjct  492   LERTPRLSASWYKNFIFKN  510



>gb|KFK28775.1| hypothetical protein AALP_AA7G045800 [Arabis alpina]
Length=492

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNYQ++Q G+IGI M   WF P++ S  D+ A ERA +F   WFLDPI++G YP+EM
Sbjct  231   IYRKNYQEEQRGKIGIVMNTIWFEPVSESLADRLAVERAQAFYLTWFLDPIVFGRYPREM  290

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +DILG  LP+F+  DL+  K+G  DFIGIN YT+ YA+DCL+S C+P   G TR EGFV 
Sbjct  291   QDILGKDLPKFTKDDLKSSKSG-LDFIGINQYTSRYAKDCLHSKCEPGKGG-TRVEGFVY  348

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  +YP GMEKM+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  349   ANAHKDGLPLGEPTGVDWFNIYPQGMEKMLMYATERYKNIPLYVTENGFGE-----NNTG  403

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RV F + YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R GLY  D  T
Sbjct  404   VLLNDYRRVNFMSSYLDALKRAMRKGADVRGYFTWSLLDNFEWISGYTIRFGLYHVDFDT  463

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LSA WYK FI ++R
Sbjct  464   QERTPRLSASWYKNFIFQHR  483



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   303 bits (775),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 187/257 (73%), Gaps = 2/257 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG+IG+ M   WF P++NS  DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  660   LYRTKYQKKQGGKIGVVMNAIWFEPVSNSWKDKLAAERAQSFYMNWFLDPIIIGEYPAEM  719

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  LP FS  D+EKLK+G  DFIG+NHYT+ +A+DC++S C+    G++R EGF  
Sbjct  720   HEILGQDLPTFSRYDVEKLKSG-LDFIGVNHYTSAFAKDCIFSACEQGR-GSSRTEGFTL  777

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S   NG  IGE   L ++ V+P GMEK++TYLK +++NIP+++TENG       N   +
Sbjct  778   RSPQMNGISIGEPTALDWLYVHPQGMEKILTYLKHRYNNIPMFITENGIGMRENSNHATK  837

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +RV++   YL++LATAIRKGADVRGYF+WSL DNFEWT GY+ R GL+  D  T
Sbjct  838   EIINDVERVEYLRGYLDSLATAIRKGADVRGYFVWSLLDNFEWTDGYSIRFGLHHVDYAT  897

Query  413   LKRTPKLSAKWYKQFIA  363
             L RTP++SA WYK FIA
Sbjct  898   LNRTPRMSAFWYKNFIA  914



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   305 bits (780),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 185/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG IGI +   W+ P++NST DK A ERA SF  NWFLDPI++G YPKEM
Sbjct  260   IYRTKYQAEQGGRIGIVLQHEWYEPISNSTADKLATERARSFTFNWFLDPIIFGKYPKEM  319

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP+FS+ + +KL  G  DFIGIN+YT  Y QDC+Y+TCD S  G +R EG   
Sbjct  320   ENILGCLLPKFSTNEKKKLNKG-LDFIGINYYTASYVQDCIYTTCD-SRFGISRTEGSYM  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  KNG  IGE     +  +YP GMEK VTY+K++++N P+++TENGY     PN  +E
Sbjct  378   KSGGKNGVSIGEQTAFSWFNIYPQGMEKTVTYVKDRYNNTPMFITENGYAQQDDPNFTLE  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L+D  R+K+ +++L AL+TAIRKGADVRGYF WSL DNFEW +GYT R G +  D  T
Sbjct  438   DQLHDFTRIKYMSNHLEALSTAIRKGADVRGYFAWSLLDNFEWIYGYTVRYGFHYVDFAT  497

Query  413   LKRTPKLSAKWYKQFIA  363
             LKRTP+LSA WYKQFIA
Sbjct  498   LKRTPRLSASWYKQFIA  514



>ref|XP_010430204.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Camelina sativa]
Length=518

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 187/268 (70%), Gaps = 1/268 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP+++G YP+EM
Sbjct  250   IYRTKYQKEQRGSIGIVVQTSWFEPVSDSIADKKAAERAQSFYSNWILDPVVFGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LPEFSS ++  LK   SDF+GINHYT+Y+ QDCL + C+ S  G ++ EGF  
Sbjct  310   VKILGSALPEFSSNEMNNLKNYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G +KM+ YLK ++ NIP+Y+TENG+     P + ++
Sbjct  369   KLDRKGNVSIGELTDVDWQHIDPDGFKKMLNYLKNRYHNIPMYITENGFGQLQKPETTVK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+++DTKR+++ ++YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  429   ELMHDTKRIQYLSEYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYAT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQL  330
             LKRTPK SA WYK FI ++  +E+ + +
Sbjct  489   LKRTPKQSASWYKNFIEQHVNIENHIDI  516



>ref|XP_010418158.1| PREDICTED: beta-glucosidase 45-like [Camelina sativa]
Length=518

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 185/259 (71%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  Y+++Q G IGI +  +WF P+++S  DKAAAERA +F SNW LDP++YG YPKEM
Sbjct  255   LYRTKYKEEQKGIIGIVVQTSWFEPISDSIADKAAAERAQAFYSNWILDPVIYGKYPKEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP FS  ++E LK   SDF+GINHYT+Y+ QDCL S+C+  + G ++ EG+  
Sbjct  315   VNILGSALPRFSRKEVECLKESQSDFVGINHYTSYFIQDCLLSSCNIGV-GASKVEGYAL  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGE   + +  ++P G  KM+ YLK+++ NIP+++TENG+ D   P + ++
Sbjct  374   KLDRKGNLTIGEPTDINWQHIHPEGFRKMLNYLKDRYHNIPMFITENGFGDLQKPETTVK  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LND KR+++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GLY  D VT
Sbjct  434   ELLNDAKRIQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLYHVDPVT  493

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPK SA WY+ +I +N
Sbjct  494   LKRTPKRSASWYRNYIGEN  512



>emb|CDO99725.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 187/263 (71%), Gaps = 2/263 (1%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             YR  Y+++QGG IGI M   WF P TNS+ DK AAERA SF  NWFLDPI+ G YP EM+
Sbjct  236   YRTKYKEKQGGSIGIVMNAIWFEPFTNSSEDKLAAERAQSFFLNWFLDPIICGRYPAEMQ  295

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
              ILGS LP F   ++ ++K G  DFIGINHYT++YA+DC+YSTC+    G +R EG+  +
Sbjct  296   QILGSQLPNFQRQEVSEIKLG-LDFIGINHYTSFYAKDCIYSTCEQG-PGVSRSEGYYLR  353

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             +  K+G  IGE   + ++ V+P GM K+V Y+K++++N P+++TENGY +    NS++++
Sbjct  354   TAFKDGVPIGETTAVDWLYVHPQGMYKIVMYIKDRYNNTPMFITENGYGELNKLNSSVKD  413

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
              + D +RV++   YL +LA AIR GA+VRGYF WSL DNFEWT GYT R GL+  D  TL
Sbjct  414   FIKDYRRVEYMNSYLASLALAIRNGANVRGYFAWSLLDNFEWTSGYTIRFGLHHVDFATL  473

Query  410   KRTPKLSAKWYKQFIAKNRKVES  342
             +RTPKLSA W+KQ I+ +R + S
Sbjct  474   ERTPKLSADWFKQLISYHRSLSS  496



>ref|XP_008441244.1| PREDICTED: beta-glucosidase 47 [Cucumis melo]
Length=522

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 184/257 (72%), Gaps = 3/257 (1%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             YR  YQ +QGG IGI +   WF P+++S  D  A ERA SF  NWFLDPI++G+YP  M+
Sbjct  254   YRSKYQAKQGGLIGIVINAVWFEPISDSFEDILATERAFSFYMNWFLDPIVFGNYPAVME  313

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             +ILG  LP FS+ D +KLK  G+DFIGINHYT+YYA+DCL+S C+P   G+++ EGF   
Sbjct  314   EILGLDLPHFSTEDQKKLK-NGADFIGINHYTSYYAKDCLHSFCEPGQ-GSSKIEGFTFW  371

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             + +K    IGE   + +I VYP GM KMVTY+KE++ N+P++VTENGY     PN+  E+
Sbjct  372   TPTKEETSIGEPTEISWIYVYPQGMNKMVTYIKERY-NVPIFVTENGYGQKNKPNNQTED  430

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
             +L+DT+RV +   YL AL T++R+GADVRGYF WSL DNFEW  GYT+R GL   D  TL
Sbjct  431   LLDDTRRVDYMRSYLGALETSMREGADVRGYFAWSLLDNFEWMNGYTERFGLCHVDYTTL  490

Query  410   KRTPKLSAKWYKQFIAK  360
             KRTPKLS  WYK FIA+
Sbjct  491   KRTPKLSTFWYKNFIAQ  507



>gb|AAU05454.1| At1g61820 [Arabidopsis thaliana]
 gb|AAU45206.1| At1g61820 [Arabidopsis thaliana]
Length=425

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 184/266 (69%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  159   IYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPVVYGKYPEEM  218

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FSS ++  L +  SDF+GINHYT+Y+ QDCL + C+ S  G ++ EG   
Sbjct  219   VNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGLAL  277

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK ++ NIP+Y+TENG+     P + +E
Sbjct  278   KLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQLQKPETTVE  337

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  338   ELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTT  397

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI +N  +E ++
Sbjct  398   LKRTPKQSATWYKNFIEQNVNIEDQI  423



>emb|CDX98704.1| BnaA03g44890D [Brassica napus]
Length=505

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 184/259 (71%), Gaps = 7/259 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+ Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  244   LYRTKFQEDQRGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  303

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG  LPEF+  DL++ K  G DFIGIN YT+ YA+DCL++ C+P   G +R EGFV 
Sbjct  304   KDILGEDLPEFTKDDLKRSK-NGLDFIGINQYTSRYAKDCLHTACEPGQGG-SRAEGFVY  361

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  362   SNALKDGLPLGEPTGVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  416

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RV+F ++YL+AL TA+RKGADVRGYF WSL DNFEW  GYT R G+Y  D   
Sbjct  417   VLLNDYRRVEFMSNYLDALKTAMRKGADVRGYFTWSLLDNFEWISGYTIRFGMYHVDFDN  476

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTP+LSA WYK FI KN
Sbjct  477   LERTPRLSASWYKNFIFKN  495



>gb|KEH36806.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=521

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 183/262 (70%), Gaps = 2/262 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ+ QGG+IGIAM   W+ P +NST DK AAER  SF  NWFLDPI+ G YP EM
Sbjct  254   VYRAKYQKNQGGKIGIAMNAIWYEPFSNSTEDKLAAERTQSFYMNWFLDPIILGKYPAEM  313

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  L  FS  D EK K  G DFIGINHYT+YY +DC++S C+    G+++ EGF  
Sbjct  314   HEILGPDLLVFSKYDKEKFK-NGLDFIGINHYTSYYVKDCIFSACEQG-KGSSKTEGFAL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S   N K IGE   L +  V+P GME +VTY+K++++NIP+++TENG+  + +     E
Sbjct  372   TSAQMNDKSIGEPTALAWFYVHPQGMENIVTYIKDRYNNIPMFITENGFGTSESSYPTTE  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
               LND KRV++ + YL++LATAIRKGADV+GYF+WS+ DNFEW  GY+ R GL+  D  T
Sbjct  432   YELNDVKRVEYLSSYLDSLATAIRKGADVKGYFVWSILDNFEWNHGYSIRFGLHHVDFAT  491

Query  413   LKRTPKLSAKWYKQFIAKNRKV  348
             L RTP+ SA WYK FI++++ +
Sbjct  492   LNRTPRGSAFWYKNFISEHKNL  513



>emb|CDX94055.1| BnaC07g36890D [Brassica napus]
Length=519

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 181/259 (70%), Gaps = 7/259 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+ Q G+IGI M   WF P+++S  D  AAERA +F   WFLDP+++G YP+EM
Sbjct  258   LYRTKFQEDQRGKIGIVMNTIWFEPVSDSVADSLAAERAQAFYLTWFLDPVVFGRYPREM  317

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG  LPEF+  DL+  K  G DFIGIN YT+ YA+DCL++ C+P   G +R EGFV 
Sbjct  318   KDILGEDLPEFTKDDLKSSK-NGLDFIGINQYTSRYAKDCLHTACEPGQGG-SRAEGFVY  375

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  KNG  +GE   + +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  376   SNALKNGLPLGERTRVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  431   VLLNDYRRVKFMSNYLDALKRAMRKGADVRGYFTWSLLDNFEWISGYTIRFGMYHVDFDT  490

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTP+LSA WYK FI KN
Sbjct  491   LERTPRLSASWYKNFIFKN  509



>ref|XP_004145176.1| PREDICTED: beta-glucosidase 47-like [Cucumis sativus]
 gb|KGN64542.1| hypothetical protein Csa_1G064150 [Cucumis sativus]
Length=523

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 185/257 (72%), Gaps = 3/257 (1%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             YR  YQ +QGG IGI +   WF P+++S  D  A+ERA SF  NWFLDPI++G+YP  M+
Sbjct  254   YRSKYQAKQGGLIGIVINAVWFEPISDSFKDILASERALSFYMNWFLDPIVFGNYPAVME  313

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             +ILG  LP FS+ D +KLK  G+DFIGINHYT+YYA+DCL+S+C+P   G+++ EGFV  
Sbjct  314   EILGLDLPNFSTEDQKKLK-NGADFIGINHYTSYYAKDCLHSSCEPGQ-GSSKIEGFVFW  371

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             +  K   LIGE   + +I V P GM KMVTY+KE++ N+P++VTENGY     PN+  E+
Sbjct  372   TPMKEEILIGEPTEISWIYVNPQGMNKMVTYIKERY-NVPIFVTENGYGQKNKPNNQTED  430

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
             +L+DT R+ +   YL AL T++R+GADVRGYF WSL DNFEW  GYT+R GL   D  TL
Sbjct  431   LLDDTGRIDYMRSYLGALETSMREGADVRGYFAWSLLDNFEWMNGYTERFGLCHVDYTTL  490

Query  410   KRTPKLSAKWYKQFIAK  360
             KRTPKLS  WYK FIA+
Sbjct  491   KRTPKLSTFWYKNFIAQ  507



>ref|XP_010473402.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 186/266 (70%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP+++G YP+EM
Sbjct  250   IYQTKYQKEQRGSIGIVVQTSWFEPVSDSIADKKAAERAQSFYSNWILDPVVFGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFSS ++  LK   SDF+GINHYT+Y+ QDCL + C+ S  G ++ EGF  
Sbjct  310   VNILGSALPEFSSNEMNNLKNYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G +KM+ YLK ++ NIP+Y+TENG+     P + I+
Sbjct  369   KLDRKGNVSIGELTDVDWQHIDPDGFKKMLNYLKNRYHNIPMYITENGFGQLQKPETTIK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+++DTKR+++ ++YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  429   ELMHDTKRIQYLSEYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYTT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI ++  +E  +
Sbjct  489   LKRTPKKSASWYKNFIEQHVNIEDHI  514



>emb|CDY68226.1| BnaCnng58130D, partial [Brassica napus]
Length=438

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 186/265 (70%), Gaps = 7/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q++Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YPKEM
Sbjct  178   LYREVFQEKQKGKIGIVMNAIWFEPVSDSLADRLAAERAQAFYLTWFLDPLVFGRYPKEM  237

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  238   QKILGKDLPKFTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVH  295

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GM++M+ Y  E++ NIPLYVTENG+ + +T      
Sbjct  296   SNAIKDGLALGEPTGVNWFNVYPQGMKEMLMYATERYKNIPLYVTENGFGENSTG-----  350

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RV+F ++YL+A   A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  351   VLLNDYRRVQFMSNYLDAFKRAMRKGADVRGYFTWSLLDNFEWISGYTVRFGMYHVDSNT  410

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTP+LSA WYK FI K+   +SK
Sbjct  411   LERTPRLSASWYKNFIFKHTSSQSK  435



>ref|XP_009105279.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Brassica rapa]
Length=406

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 183/256 (71%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  Y+++Q G IGI +  +WF P+++ST DK AAERA SF SNW LDP++YG YP+EM
Sbjct  139   IYQTKYKKEQKGSIGIVVQTSWFEPISDSTADKNAAERAQSFYSNWILDPVVYGKYPEEM  198

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FS  +++ LK   SDF+GINHYT+Y+ QDCL S C+ S  G +R EGF  
Sbjct  199   VNLLGSALPKFSIKEMKNLKRYKSDFLGINHYTSYFIQDCLISACN-SGDGASRSEGFAL  257

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             + + K    +GE+  + ++ + P G  KM+ YL +++ NIP+++TENG  +   P + ++
Sbjct  258   KLIQKGNVSVGEVTDVSWLNIDPEGFRKMLNYLTDRYPNIPMFITENGLGELQKPETTVK  317

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKRV++ + YL+AL TA+R GA+V+GYF WSL DNFEW +GY  R G++  D  T
Sbjct  318   ELLNDTKRVRYLSGYLDALQTAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTT  377

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPK SA WYK FI
Sbjct  378   LKRTPKQSAYWYKNFI  393



>gb|KFK40642.1| hypothetical protein AALP_AA2G023000 [Arabis alpina]
Length=516

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 180/259 (69%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ+ Q G IGI    +WF P++NS  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  254   IYKTKYQKAQRGIIGIVAQTSWFEPISNSLADKKAAERAQSFYSNWILDPVVYGRYPKEM  313

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP+FSS ++  LK   SDF+GINHYT+Y+ +DCL S C  S  G ++ EGF  
Sbjct  314   VHILGSALPQFSSNEMNNLKNLKSDFLGINHYTSYFIRDCLSSAC-ISGDGASKIEGFAL  372

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  KM+ YLK+++ NIP+++TENGY  T  P + +E
Sbjct  373   KLDRKGNVSIGELTDVDWQHIHPEGFRKMLNYLKDRYPNIPIFITENGYGQTQKPETAVE  432

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR++F + YL+AL  A+R GA+V+GYF WSL D FEW +GY  R GL+  D  T
Sbjct  433   EILNDTKRIQFMSGYLDALQGAMRDGANVKGYFAWSLLDGFEWFYGYKLRFGLFHVDYTT  492

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPK SA WYK+FI ++
Sbjct  493   LKRTPKQSASWYKKFIEQH  511



>gb|KFK40644.1| hypothetical protein AALP_AA2G023300 [Arabis alpina]
Length=518

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 182/263 (69%), Gaps = 1/263 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  252   IYRTKYQKAQRGIIGIVVQTSWFEPISDSIADKKAAERAQSFYSNWILDPVVYGRYPEEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  LP+FS+ ++  L    SDF+GINHYT+Y+ QDCL S C+ S  G ++ EGF  
Sbjct  312   VNILGPDLPQFSNNEINNLMNSKSDFLGINHYTSYFIQDCLSSACN-SGDGASKSEGFAL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G +KM+ YL  ++ NIP+++TENGY     P + I+
Sbjct  371   KLDRKGNVSIGELTDVSWQHIHPEGFQKMLNYLTVRYPNIPMFITENGYGQLQKPETTIK  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR++F + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  431   ELLNDTKRIQFMSGYLDALQGAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTT  490

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTPK SA WYK+FI ++ K E
Sbjct  491   LKRTPKQSASWYKKFIEQHVKTE  513



>ref|NP_850968.1| beta glucosidase 46 [Arabidopsis thaliana]
 sp|O80690.2|BGL46_ARATH RecName: Full=Beta-glucosidase 46; Short=AtBGLU46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33892.1| beta glucosidase 46 [Arabidopsis thaliana]
Length=516

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 184/266 (69%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  250   IYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPVVYGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FSS ++  L +  SDF+GINHYT+Y+ QDCL + C+ S  G ++ EG   
Sbjct  310   VNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGLAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK ++ NIP+Y+TENG+     P + +E
Sbjct  369   KLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQLQKPETTVE  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  429   ELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI +N  +E ++
Sbjct  489   LKRTPKQSATWYKNFIEQNVNIEDQI  514



>gb|AAC28502.1| Similar to F4I1.26 putative beta-glucosidase gi|3128187 from 
A. thaliana BAC gb|AC004521. ESTs gb|N97083, gb|F19868 and gb|F15482 
come from this gene [Arabidopsis thaliana]
Length=527

 Score =   290 bits (741),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 184/266 (69%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YP+EM
Sbjct  261   IYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPVVYGKYPEEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FSS ++  L +  SDF+GINHYT+Y+ QDCL + C+ S  G ++ EG   
Sbjct  321   VNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGLAL  379

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK ++ NIP+Y+TENG+     P + +E
Sbjct  380   KLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQLQKPETTVE  439

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  440   ELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDFTT  499

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI +N  +E ++
Sbjct  500   LKRTPKQSATWYKNFIEQNVNIEDQI  525



>ref|XP_009105752.1| PREDICTED: beta-glucosidase 45-like [Brassica rapa]
Length=516

 Score =   289 bits (740),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 181/259 (70%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +  +WF P+++S  D+ AAERA SF SNW LDPI+YG YPKEM
Sbjct  253   IYRSKYQVKQRGIIGIVVQTSWFEPISDSIADREAAERAQSFYSNWILDPIIYGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP FS  ++E LK    DFIGINHYT+Y+ QDCL+STC+    G ++ +GF  
Sbjct  313   VNVLGSALPRFSRKEMENLKQLRLDFIGINHYTSYFIQDCLFSTCNAG-DGASKAQGFAL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  K + YLK ++ NIP+++TENG+ D   P + + 
Sbjct  372   KLDRKGNVSIGELTDVNWQHIHPEGFRKTLNYLKNRYHNIPMFITENGFGDLQKPETTLT  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  +
Sbjct  432   ELLNDTKRIQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTS  491

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPKLSA WYK +I ++
Sbjct  492   LKRTPKLSASWYKNYIGEH  510



>ref|XP_007026018.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
 gb|EOY28640.1| Beta glucosidase 46 isoform 2, partial [Theobroma cacao]
Length=497

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 171/230 (74%), Gaps = 2/230 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF  ++NS  DK AAERA SF   WFLDPI++G YP EM
Sbjct  212   IYRTKYQETQGGSIGIVLHCFWFESISNSLADKLAAERAQSFTMKWFLDPIIFGRYPPEM  271

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEFS+T+ EKL  G  DFIG+NHY++YY +DC++S C+P   G ++ EGF G
Sbjct  272   QNILGSILPEFSTTEKEKLNKG-LDFIGVNHYSSYYVKDCMFSVCEPG-TGTSKTEGFWG  329

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGEL  L ++ VYP GMEK+VTYLKE + NIP+ +TENGY + +  NS  E
Sbjct  330   QSSQKNGIPIGELTDLDWLNVYPQGMEKIVTYLKETYHNIPMIITENGYGEVSKANSTTE  389

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKR  444
             E L+D KRV++ A YL+ L+TAIRKGADVRGYF+WSL DNFEW FGYT +
Sbjct  390   EFLHDVKRVEYLAGYLDQLSTAIRKGADVRGYFVWSLLDNFEWNFGYTVK  439



>ref|XP_006413734.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 ref|XP_006413736.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55187.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55189.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=524

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 183/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+QQ G+IGI M   WF P++++  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  264   IYRTKYQEQQRGKIGIVMNAIWFEPVSDALADRLAAERAQAFYLTWFLDPVVFGRYPREM  323

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++I G  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  324   QEIFGEDLPQFTKDDLKSSK-NGLDFIGINQYTSRYAKDCLHSACEPGQGG-SRAEGFVN  381

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  382   ANALKDGLALGEPTGVDWFNVYPQGMEEMLMYATERYKNIPLYVTENGFGE-----NNTG  436

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              ++ND +RVK+ + YL+AL  A+RKGAD+RGYF WSL DNFEW  GYT R GLY  D  T
Sbjct  437   VLVNDYRRVKYMSSYLDALKRAMRKGADIRGYFTWSLLDNFEWISGYTIRFGLYHVDFNT  496

Query  413   LKRTPKLSAKWYKQFIAKNR  354
             L+RTP+LSA WYK FI ++R
Sbjct  497   LERTPRLSASWYKNFIFQHR  516



>ref|XP_007153925.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
 gb|ESW25919.1| hypothetical protein PHAVU_003G076700g [Phaseolus vulgaris]
Length=517

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG+IGI +    F P++NST DK A ERA SF +NW LDPI++G YPKEM
Sbjct  235   IYRNKYQNEQGGKIGIVLHCDSFEPLSNSTADKLATERAQSFSTNWILDPILFGKYPKEM  294

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG+ LP+FSS D  KL+ G  DFIGIN+Y +YY +DC+ S C     G T+ EG   
Sbjct  295   EMILGTILPKFSSNDKAKLRRG-LDFIGINYYASYYVRDCISSVCGYG-KGVTKTEGSYE  352

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q++ KNG  IGEL    ++ VYP GM+ ++ YLK++++N P+++TENGY     P+   E
Sbjct  353   QTVLKNGVPIGELTPFDWLNVYPQGMKNVLIYLKDRYNNTPMFITENGYATLYDPDVTEE  412

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND KR++F + +L+ L  AI++GADVRGYF+WSL DNFEW +G++ + GL+  D VT
Sbjct  413   EYLNDYKRIEFMSGHLDNLMAAIKEGADVRGYFVWSLLDNFEWKYGFSAKFGLHHIDHVT  472

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPKLSA WYK+FI
Sbjct  473   LKRTPKLSASWYKRFI  488



>ref|XP_006300409.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
 gb|EOA33307.1| hypothetical protein CARUB_v10021331mg [Capsella rubella]
Length=516

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 187/266 (70%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA +F SNW LDP+++G YP+EM
Sbjct  250   IYRTKYQKEQRGSIGIVVQTSWFEPVSDSIADKKAAERAQAFYSNWILDPVVFGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LP+FSS+++  LK   SDF+GINHYT+Y+ QDC+ + C+ S  G ++ EGF  
Sbjct  310   VNILGSDLPQFSSSEMNNLKNYKSDFLGINHYTSYFIQDCMITACN-SGEGASKSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G +KM+ YLK ++ NIP+Y+TENG+     P + +E
Sbjct  369   KLDRKGNVSIGELTDVNWQHIDPDGFKKMLHYLKIRYHNIPMYITENGFGQLQKPETTVE  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+ + + YL+AL  A+R GA+V+GYF WSL DN+EW +GY  R GL+  D  T
Sbjct  429   ELLHDTKRIHYLSGYLDALKAAMRDGANVKGYFEWSLLDNYEWLYGYKVRFGLFHVDYTT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI ++  +E+++
Sbjct  489   LKRTPKQSASWYKNFIEQHVNIENQI  514



>ref|XP_009135228.1| PREDICTED: beta-glucosidase 47 isoform X3 [Brassica rapa]
Length=508

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 187/265 (71%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q+Q GG+IGI M   WF P+++S  D  AAERA +F   WFLDPI++G YP+EM
Sbjct  249   LYRERFQEQ-GGKIGIVMNAIWFEPVSDSLADSLAAERAQAFYLTWFLDPIVFGRYPREM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  308   QEILGQDLPKFTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVH  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ + +T      
Sbjct  366   SNALKDGLALGEPTGVNWFNVYPQGMEEMLMYATEQYKNIPLYVTENGFGENSTG-----  420

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADV GYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  421   VLLNDYRRVKFMSNYLDALKRAMRKGADVGGYFTWSLLDNFEWISGYTVRFGMYHVDFNT  480

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTP+LSA WYK FI+K+   +SK
Sbjct  481   LERTPRLSASWYKNFISKHMSSQSK  505



>emb|CDY47163.1| BnaA01g22890D [Brassica napus]
Length=516

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 180/259 (69%), Gaps = 1/259 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +  +WF P+++S  D+ AAERA SF SNW LDPI+YG YPKEM
Sbjct  253   IYRSKYQVKQRGIIGIVVQTSWFEPISDSIADREAAERAQSFYSNWILDPIIYGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP FS  ++E LK    DFIGINHYT+Y+ QDCL+STC+    G +  +GF  
Sbjct  313   VNVLGSALPRFSRKEMENLKQLRLDFIGINHYTSYFIQDCLFSTCNAG-DGASEAQGFAL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  K + YLK ++ NIP+++TENG+ D   P + + 
Sbjct  372   KLDRKGNVSIGELTDVNWQHIHPEGFRKTLNYLKNRYHNIPMFITENGFGDLQKPETTLT  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  +
Sbjct  432   ELLNDTKRIQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTS  491

Query  413   LKRTPKLSAKWYKQFIAKN  357
             LKRTPKLSA WYK +I ++
Sbjct  492   LKRTPKLSASWYKNYIGEH  510



>ref|XP_006383935.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
 gb|ERP61732.1| hypothetical protein POPTR_0004s01890g [Populus trichocarpa]
Length=503

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 178/266 (67%), Gaps = 14/266 (5%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+QQGG IGI +   WF P +NST D  A +RA  FL NWFLDPI++G YP EM
Sbjct  252   IYRTKYQKQQGGSIGIVIHCPWFEPYSNSTADNLATDRAQDFLMNWFLDPIIFGKYPAEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS +P+FSS D EKL  G  DFIGINHYT +Y QDC +  C P   G +R EG   
Sbjct  312   TKILGSAIPKFSSNDREKLNKG-LDFIGINHYTGFYIQDCSFVVCKPGQGG-SRTEGLAQ  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS             + +I VYP GMEK++TYLKE+++N P+ +TENG+   +  N  IE
Sbjct  370   QS------------EVDWIHVYPQGMEKIITYLKERYNNTPMIITENGFGQESYLNRTIE  417

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E L D  RV++ + YL++L TA+ KGADVRGYF WSL DNFEW  GYT+R GL+  D  T
Sbjct  418   EYLQDRDRVEYMSGYLDSLMTAMLKGADVRGYFAWSLLDNFEWGRGYTRRFGLHHVDYTT  477

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKR P+LSA W+K+FIA+ +  +S+M
Sbjct  478   LKRIPRLSATWFKEFIARYKVDKSQM  503



>ref|XP_002518516.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF43903.1| beta-glucosidase, putative [Ricinus communis]
Length=511

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 186/264 (70%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG IGI M   W+ P++NS  DK A ERA +F   WFLDPI+ G YP EM
Sbjct  248   VYRTKYQKEQGGCIGIVMNAIWYEPISNSLEDKLAVERAQAFYLYWFLDPIILGKYPSEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  LP FS+ +LEKLK+   DFIGINHY+++Y +DC++S C+    G T+ EGF  
Sbjct  308   HEILGVDLPAFSNHELEKLKSA-LDFIGINHYSSFYIKDCIFSVCNQG-PGITKAEGFAL  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+   IGE   + ++ +YP GME +VTY+KE+++NIP+++TENG+ +    ++++ 
Sbjct  366   RTAEKDSFFIGEPTSIDWLYIYPKGMENIVTYIKERYNNIPMFITENGFGEKENHSTSMN  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND KRV++ + YL +L TA+RKGAD+RGYF WSL DNFEW  GYT R GLY  D  T
Sbjct  426   FLLNDVKRVEYLSSYLESLETAVRKGADIRGYFAWSLLDNFEWRDGYTVRFGLYHVDFST  485

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRT KLSA WYK +I+ +R   S
Sbjct  486   LKRTQKLSATWYKDYISTHRANNS  509



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   299 bits (765),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 180/260 (69%), Gaps = 2/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG+IGI +   WF P +NS  DK AAERA SF  NW LDPI +G YPKEM
Sbjct  735   IYRNRYQAEQGGQIGIVVHVDWFEPYSNSVADKLAAERAQSFSMNWILDPIFFGKYPKEM  794

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP+FSS D  KL  G  DFIGINHY  YY +DC+ S C+ S  G +  EG   
Sbjct  795   EVILGSTLPKFSSNDKAKLNRG-LDFIGINHYAGYYVKDCISSVCE-SGPGTSATEGLYQ  852

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  IGEL    ++ VYP GM+K +TY+K++++N P+++TENGY +   PN+  E
Sbjct  853   QTAQKDGVPIGELTPFDFLNVYPQGMKKTLTYVKDRYNNTPMFITENGYGNFYDPNNTKE  912

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND KR+ + + +LN L  +IR+GADVRGYF WSL DNFEW +G+T R GLY  D  T
Sbjct  913   EYLNDIKRINYMSGHLNNLGESIREGADVRGYFAWSLLDNFEWLYGFTVRFGLYHVDFAT  972

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              KRTPKLSA WYK FI K++
Sbjct  973   QKRTPKLSASWYKHFIEKHK  992



>ref|XP_010418157.1| PREDICTED: beta-glucosidase 46 [Camelina sativa]
Length=519

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 185/266 (70%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP+++G YP+EM
Sbjct  250   IYQTKYQKEQRGSIGIVVQTSWFEPVSDSIADKKAAERAQSFYSNWILDPVVFGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILGS LPEFSS ++  LK   SDF+GINHYT+Y+ QDCL + C+ S  G ++ EGF  
Sbjct  310   VNILGSALPEFSSNEMINLKNYKSDFLGINHYTSYFIQDCLITACN-SGDGASKTEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G +KM+ YLK ++ NIP+Y+TENG+     P + ++
Sbjct  369   KLDLKGNVSIGELTDVNWQHIDPDGFKKMLNYLKNRYHNIPMYITENGFGQLQKPETTVK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  429   ELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYAT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI ++  +E  +
Sbjct  489   LKRTPKQSASWYKNFIEQHVNIEDHI  514



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   299 bits (765),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 180/260 (69%), Gaps = 2/260 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG+IGI +   WF P +NS  DK AAERA SF  NW LDPI +G YPKEM
Sbjct  757   IYRNRYQAEQGGQIGIVVHVDWFEPYSNSVADKLAAERAQSFSMNWILDPIFFGKYPKEM  816

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP+FSS D  KL  G  DFIGINHY  YY +DC+ S C+ S  G +  EG   
Sbjct  817   EVILGSTLPKFSSNDKAKLNRG-LDFIGINHYAGYYVKDCISSVCE-SGPGTSATEGLYQ  874

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             Q+  K+G  IGEL    ++ VYP GM+K +TY+K++++N P+++TENGY +   PN+  E
Sbjct  875   QTAQKDGVPIGELTPFDFLNVYPQGMKKTLTYVKDRYNNTPMFITENGYGNFYDPNNTKE  934

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND KR+ + + +LN L  +IR+GADVRGYF WSL DNFEW +G+T R GLY  D  T
Sbjct  935   EYLNDIKRINYMSGHLNNLGESIREGADVRGYFAWSLLDNFEWLYGFTVRFGLYHVDFAT  994

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              KRTPKLSA WYK FI K++
Sbjct  995   QKRTPKLSASWYKHFIEKHK  1014



>ref|XP_009135212.1| PREDICTED: beta-glucosidase 47 isoform X1 [Brassica rapa]
Length=528

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 187/265 (71%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q+Q GG+IGI M   WF P+++S  D  AAERA +F   WFLDPI++G YP+EM
Sbjct  269   LYRERFQEQ-GGKIGIVMNAIWFEPVSDSLADSLAAERAQAFYLTWFLDPIVFGRYPREM  327

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  328   QEILGQDLPKFTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVH  385

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ + +T      
Sbjct  386   SNALKDGLALGEPTGVNWFNVYPQGMEEMLMYATEQYKNIPLYVTENGFGENSTG-----  440

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADV GYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  441   VLLNDYRRVKFMSNYLDALKRAMRKGADVGGYFTWSLLDNFEWISGYTVRFGMYHVDFNT  500

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTP+LSA WYK FI+K+   +SK
Sbjct  501   LERTPRLSASWYKNFISKHMSSQSK  525



>ref|XP_009135219.1| PREDICTED: beta-glucosidase 47 isoform X2 [Brassica rapa]
Length=522

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 187/265 (71%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q+Q GG+IGI M   WF P+++S  D  AAERA +F   WFLDPI++G YP+EM
Sbjct  263   LYRERFQEQ-GGKIGIVMNAIWFEPVSDSLADSLAAERAQAFYLTWFLDPIVFGRYPREM  321

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  322   QEILGQDLPKFTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVH  379

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ + +T      
Sbjct  380   SNALKDGLALGEPTGVNWFNVYPQGMEEMLMYATEQYKNIPLYVTENGFGENSTG-----  434

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADV GYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  435   VLLNDYRRVKFMSNYLDALKRAMRKGADVGGYFTWSLLDNFEWISGYTVRFGMYHVDFNT  494

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTP+LSA WYK FI+K+   +SK
Sbjct  495   LERTPRLSASWYKNFISKHMSSQSK  519



>emb|CDX98706.1| BnaA03g44910D [Brassica napus]
Length=296

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 182/259 (70%), Gaps = 10/259 (4%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +Y+K +Q+ Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  32    LYQKKFQEDQRGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  91

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL++TC+    G +R EGFV 
Sbjct  92    KDILGEDLPKFTKDDLKSSK-NGLDFIGINQYTSRYAKDCLHTTCELGQGG-SRAEGFVY  149

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  150   SNALKDGLPLGEPTGVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  204

Query  593   EVLNDTKRVKFFADYL---NALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFD  423
              +LND +RVKF ++YL   +AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D
Sbjct  205   VLLNDYRRVKFMSNYLGPVHALKRAMRKGADVRGYFTWSLLDNFEWISGYTIRFGMYHVD  264

Query  422   RVTLKRTPKLSAKWYKQFI  366
               TL+RTP+LSA WYK FI
Sbjct  265   FDTLERTPRLSASWYKNFI  283



>ref|XP_007026019.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
 gb|EOY28641.1| Beta glucosidase 46 isoform 3, partial [Theobroma cacao]
Length=540

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 171/230 (74%), Gaps = 2/230 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI +   WF  ++NS  DK AAERA SF   WFLDPI++G YP EM
Sbjct  255   IYRTKYQETQGGSIGIVLHCFWFESISNSLADKLAAERAQSFTMKWFLDPIIFGRYPPEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LPEFS+T+ EKL  G  DFIG+NHY++YY +DC++S C+P   G ++ EGF G
Sbjct  315   QNILGSILPEFSTTEKEKLNKG-LDFIGVNHYSSYYVKDCMFSVCEPG-TGTSKTEGFWG  372

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             QS  KNG  IGEL  L ++ VYP GMEK+VTYLKE + NIP+ +TENGY + +  NS  E
Sbjct  373   QSSQKNGIPIGELTDLDWLNVYPQGMEKIVTYLKETYHNIPMIITENGYGEVSKANSTTE  432

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKR  444
             E L+D KRV++ A YL+ L+TAIRKGADVRGYF+WSL DNFEW FGYT +
Sbjct  433   EFLHDVKRVEYLAGYLDQLSTAIRKGADVRGYFVWSLLDNFEWNFGYTVK  482



>ref|XP_009105270.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Brassica rapa]
Length=517

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 183/256 (71%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  Y+++Q G IGI +  +WF P+++ST DK AAERA SF SNW LDP++YG YP+EM
Sbjct  250   IYQTKYKKEQKGSIGIVVQTSWFEPISDSTADKNAAERAQSFYSNWILDPVVYGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FS  +++ LK   SDF+GINHYT+Y+ QDCL S C+ S  G +R EGF  
Sbjct  310   VNLLGSALPKFSIKEMKNLKRYKSDFLGINHYTSYFIQDCLISACN-SGDGASRSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             + + K    +GE+  + ++ + P G  KM+ YL +++ NIP+++TENG  +   P + ++
Sbjct  369   KLIQKGNVSVGEVTDVSWLNIDPEGFRKMLNYLTDRYPNIPMFITENGLGELQKPETTVK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKRV++ + YL+AL TA+R GA+V+GYF WSL DNFEW +GY  R G++  D  T
Sbjct  429   ELLNDTKRVRYLSGYLDALQTAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTT  488

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPK SA WYK FI
Sbjct  489   LKRTPKQSAYWYKNFI  504



>ref|XP_006343294.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=499

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 185/256 (72%), Gaps = 2/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P +NS+ D  A +RA SF+ NWFLDPI+YG YP+EM
Sbjct  233   IYRTKYQKRQGGMIGISLNTQWYEPFSNSSQDNYATQRARSFVYNWFLDPIIYGKYPEEM  292

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG +LP FS  D++KLK  G DFIG+NHYT  Y +DCLYS C+     ++  EG   
Sbjct  293   QKILGKNLPIFSRNDIKKLK-NGLDFIGLNHYTAAYIKDCLYSVCEHGQY-SSWSEGSYF  350

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+V Y+K++F+N P+ +TENG  ++  PNS++E
Sbjct  351   RATEKDGVYIGEPTAVDWLFVYPQGMEKLVMYMKDRFNNTPVIITENGIAESDHPNSSLE  410

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LNDT+RV++  +YLN+LA A+R+GADVRGYF WSL DNFEW  GYTKR GL+  +   
Sbjct  411   DALNDTQRVEYMHNYLNSLANAMREGADVRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTN  470

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YK+ I
Sbjct  471   LQRTPKLSATRYKELI  486



>ref|XP_007147744.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
 gb|ESW19738.1| hypothetical protein PHAVU_006G151300g [Phaseolus vulgaris]
Length=521

 Score =   287 bits (734),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 185/257 (72%), Gaps = 3/257 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ++QGG+IG+A+   WF P++NS+ DK AAERA +F  NWFLDP + G YP+EM
Sbjct  253   LYRTKYQKKQGGKIGLAVHTMWFEPISNSSEDKIAAERAQAFYMNWFLDPAIRGEYPREM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP     +LEKLK    DFIG+NHYT+Y+ +DC++S C+P + G+TR EG+  
Sbjct  313   REILGKDLPPVP-YELEKLKPS-IDFIGVNHYTSYFVKDCIHSECEPGL-GSTRTEGYAL  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                  NG  IG+   L ++ +YP G+EK+VTY+KE+F+NIP+Y+TENG       N   +
Sbjct  370   TWAHINGMTIGKPTSLEWLFIYPEGLEKIVTYIKERFNNIPIYLTENGVGGKENANMTTK  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND  R+ +   YL++LA AIRKGADVRGYF+WSL DNFEWT G + R GL++ D  T
Sbjct  430   EIINDVDRIDYLRAYLDSLARAIRKGADVRGYFLWSLLDNFEWTDGSSIRFGLHRVDYDT  489

Query  413   LKRTPKLSAKWYKQFIA  363
             L+RTP++SA WYK FIA
Sbjct  490   LQRTPRMSASWYKNFIA  506



>ref|NP_176374.1| beta-glucosidase 45 [Arabidopsis thaliana]
 sp|O80689.1|BGL45_ARATH RecName: Full=Beta-glucosidase 45; Short=AtBGLU45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28501.1| Similar to beta-glucosidase BGQ60 precursor gb|L41869 from Hordeum 
vulgare [Arabidopsis thaliana]
 gb|AEE33890.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=520

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 183/263 (70%), Gaps = 3/263 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  253   IYKTKYQKEQKGSIGIVVQTSWFEPISDSNADKEAAERAQSFYSNWILDPVIYGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              DILG  LP+FSS +++ L+   +DF+GINHYT+Y+ QDCL S C+ +  G  + EG+  
Sbjct  313   VDILGPALPQFSSNEVKNLEKSRADFVGINHYTSYFIQDCLTSACN-TGHGAFKAEGYAL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK+++ N+P+++TENG+ D   P +  +
Sbjct  372   KLDRKGNVTIGELTDVNWQHIDPTGFHKMLNYLKDRYPNMPMFITENGFGDLQKPETTDK  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL AL  A+R GA+V+GYF+WSL DNFEW FGY  R GL+  D  T
Sbjct  432   ELLNDTKRIQYMSGYLEALQAAMRDGANVKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTT  491

Query  413   LKRTPKLSAKWYKQFIAK--NRK  351
             LKR+PK SA WYK +I +  NR+
Sbjct  492   LKRSPKQSASWYKNYIEEHVNRR  514



>ref|XP_009137215.1| PREDICTED: beta-glucosidase 47-like [Brassica rapa]
Length=521

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 182/256 (71%), Gaps = 7/256 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +Y+K +Q+ Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  260   LYQKKFQEDQRGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  319

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL++TC+    G +R EGFV 
Sbjct  320   KDILGEDLPKFTKDDLKSSK-NGLDFIGINQYTSRYAKDCLHTTCELGQGG-SRAEGFVY  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  378   SNALKDGLPLGEPTGVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  432

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  433   VLLNDYRRVKFMSNYLDALKRAMRKGADVRGYFTWSLLDNFEWISGYTIRFGMYHVDFDT  492

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTP+LSA WYK FI
Sbjct  493   LERTPRLSASWYKNFI  508



>emb|CDY55219.1| BnaA01g36270D [Brassica napus]
Length=517

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 182/256 (71%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  Y+++Q G IGI +  +WF P+++ST DK AAERA SF SNW LDP++YG YP+EM
Sbjct  250   IYQTKYKKEQKGSIGIVVQTSWFEPISDSTADKNAAERAQSFYSNWILDPVVYGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP+FS  +++ LK   SDF+GINHYT+Y+ QDCL S C+ S  G +R EGF  
Sbjct  310   VNLLGSALPKFSIKEMKNLKRYKSDFLGINHYTSYFIQDCLISACN-SGDGASRSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             + + K    +GE+  + ++ + P G  KM+ YL +++ NIP+++TENG  +   P + ++
Sbjct  369   KLIQKGNVSVGEVTDVSWLNIDPEGFRKMLNYLTDRYPNIPMFITENGLGELQKPETTVK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKRV++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R G++  D  T
Sbjct  429   ELLNDTKRVRYLSGYLDALQRAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGIFHVDYTT  488

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPK SA WYK FI
Sbjct  489   LKRTPKQSAYWYKNFI  504



>ref|XP_007153927.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
 gb|ESW25921.1| hypothetical protein PHAVU_003G076800g [Phaseolus vulgaris]
Length=528

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 184/264 (70%), Gaps = 2/264 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +   W+ P++NST DK AAERA SF  NWFLDPI+ G YP EM
Sbjct  252   IYRTKYQTEQKGSIGIVLQHEWYEPLSNSTADKLAAERARSFTFNWFLDPIILGKYPTEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++LGS LP+ SS + EKLK G  DFIG+N+YT +Y QDC+YS C     GN+R EG   
Sbjct  312   ENLLGSLLPKISSKEKEKLKKG-LDFIGVNYYTAFYVQDCMYSRCKTGQ-GNSRTEGLYM  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  +NG  IGE     +  +YP GMEK VTY+K++++N P+++TENGY     PN  +E
Sbjct  370   KSGVRNGFPIGEPTTFSWFNIYPDGMEKAVTYVKDRYNNTPMFITENGYGQEDDPNFTLE  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND+KR+K+  D++ A+  AIRKGADVRGY  WSL D+FEW +GYT R G +  D  T
Sbjct  430   EHLNDSKRIKYMVDHIEAMVAAIRKGADVRGYLAWSLLDSFEWIYGYTVRYGFHHVDFAT  489

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRTP+LSA W+KQF+ K ++  S
Sbjct  490   LKRTPRLSASWFKQFLVKYKETFS  513



>ref|XP_009770584.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=538

 Score =   285 bits (729),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 185/258 (72%), Gaps = 4/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P +NS+ DK AA+RA SF+ NWFLDPI++G YP+EM
Sbjct  275   IYRTKYQERQGGMIGISLNTQWYEPFSNSSEDKYAAQRARSFVYNWFLDPIIFGRYPEEM  334

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG++LP FSS DL+KL   G DFIGINHYT  Y +DCLYS C+    G +  EG   
Sbjct  335   QQILGNNLPVFSSNDLKKLN-NGLDFIGINHYTAAYIKDCLYSACE---HGTSWSEGSYF  390

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   + ++ VYP GMEK+V Y+K++F+N P+ +TENG  ++  PNS++ 
Sbjct  391   RTTEKDGVYIGQPTTMDWLFVYPQGMEKLVMYMKDRFNNTPIIITENGIAESDNPNSSLA  450

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LNDT RV++   +LN+LA AIR+GADVRGYF WSL DNFEW  GYTKR GL+  +   
Sbjct  451   DSLNDTPRVEYMHSHLNSLANAIREGADVRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTN  510

Query  413   LKRTPKLSAKWYKQFIAK  360
             L+RTPKLSA   K+ ++ 
Sbjct  511   LQRTPKLSATRCKELMSN  528



>ref|XP_002888064.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64323.1| BGLU46 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 183/263 (70%), Gaps = 1/263 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S VDK AAERA SF SNW LDP++YG YP+EM
Sbjct  250   IYRTKYQKEQRGIIGIVVQTSWFEPISDSIVDKNAAERAQSFYSNWILDPVVYGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDP-SMAGNTREEGFV  777
              +ILGS LP FSS ++  +K   SDF+GINHYT+Y+ QDCL + C+  S  G ++ EGF 
Sbjct  310   VNILGSALPRFSSNEMNSIKNYKSDFLGINHYTSYFIQDCLITACNSGSGNGASKSEGFA  369

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              +   K    IGEL  + +  + P G +KM+ YLK ++ N+P+++TENG+     P + +
Sbjct  370   LKLDRKGNVSIGELTDVNWQHIDPDGFKKMLNYLKNRYHNMPMFITENGFGTLQKPETTV  429

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +E+L+DTKR+++ + YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  
Sbjct  430   KELLDDTKRIQYMSGYLDALKEAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYT  489

Query  416   TLKRTPKLSAKWYKQFIAKNRKV  348
             TLKRTPK SA WYK FI ++  +
Sbjct  490   TLKRTPKQSASWYKNFIEQHGNI  512



>gb|KHG29724.1| Beta-glucosidase 46 [Gossypium arboreum]
Length=236

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  1007  LSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLY  828
             L+  FL+PI+YG YP++M++ILGS LPEFS+T+ +KLK G  DFIGINHYT+YY QDC++
Sbjct  12    LTYRFLEPILYGRYPRQMQNILGSILPEFSATEKQKLKQG-LDFIGINHYTSYYVQDCMF  70

Query  827   STCDPSMAGNTREEGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPL  648
             S C+P   G ++ EG+  QS  KNG  IGE   L    VYP G+EK+VTYLK ++ NIP+
Sbjct  71    SACEPG-PGTSKMEGYCAQSSQKNGTPIGEPTELAGKNVYPEGIEKIVTYLKNRYHNIPI  129

Query  647   YVTENGYCDTTTPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFE  468
              +TENGY D   PNS  E  L+D KRV++FA YL+AL+TAIRKGADVRGYFIWSL DNFE
Sbjct  130   IITENGYGDMNKPNSTTEARLHDEKRVEYFARYLDALSTAIRKGADVRGYFIWSLLDNFE  189

Query  467   WTFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             W  GYT R GL+  D  TLKRTPK SA WYK FI+++   E K++
Sbjct  190   WNNGYTVRYGLHHVDYETLKRTPKSSATWYKNFISQHMVKEPKVE  234



>ref|XP_002869865.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46124.1| beta-glucosidase 47 [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 183/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+QQ G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  265   LYRTKFQEQQSGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  324

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LPEF++ DL+  K    DFIGIN YT+ YA+DCL S C+P   G +R EGFV 
Sbjct  325   REILGEDLPEFTTDDLKSSK-NTLDFIGINQYTSRYAEDCLDSVCEPGKGG-SRAEGFVY  382

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 K+G  +GE  G+ + +VYP GME+M+ Y  +++ NIPLYVTENG+ +     +N  
Sbjct  383   AKALKDGLPLGEPTGVNWFSVYPQGMEEMLMYATKRYKNIPLYVTENGFGE-----NNTG  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +R+KF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  438   VLLNDYRRLKFMSNYLDALKRAMRKGADVRGYFAWSLLDNFEWISGYTIRFGMYHVDFNT  497

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LSA WYK FI ++R
Sbjct  498   QERTPRLSASWYKNFIFQHR  517



>ref|XP_009599228.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=388

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 180/257 (70%), Gaps = 8/257 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI M F W+ P++NS+ D AA  RA SF  +WFLDPI+ G+YPKEM
Sbjct  125   IYRTRYQKSQGGMIGITMGFEWYEPLSNSSEDIAATHRARSFYDSWFLDPIILGTYPKEM  184

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LPEFS  DL KL   G DFIGINHY+  Y +DCLYS C+    GN+  EG   
Sbjct  185   VQILGSNLPEFSMNDLSKLSY-GLDFIGINHYSACYIKDCLYSACE---NGNSWSEGSYF  240

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  ++G  IGE   + +  VYP G+EK+V YLKEKF+N P+++TENG+   +   S+IE
Sbjct  241   RTTQRDGIYIGEPGEVDWQFVYPQGIEKVVMYLKEKFNNTPMFITENGFAGNS---SSIE  297

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV-  417
             ++LND +RVK+    LN+LA AIRKGADVRGYF+WSL DNFEW  GYT R GLY  +   
Sbjct  298   DILNDVRRVKYLHSNLNSLANAIRKGADVRGYFVWSLLDNFEWLDGYTIRFGLYYVNYTN  357

Query  416   TLKRTPKLSAKWYKQFI  366
              L+RTPKLSA  Y++ +
Sbjct  358   NLQRTPKLSATKYQELM  374



>ref|XP_010449006.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 182/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+QQ G+IGI M   WF P+++S  DK A ERA +F   WFLDP+++G YPKEM
Sbjct  265   LYRTKFQEQQRGKIGIVMNTIWFEPVSDSLADKLATERAQAFFVTWFLDPVVFGRYPKEM  324

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++IL   LPEF+  DL K  +   DFIGIN YT+ YA+DCL+STC+P   G +R EG+V 
Sbjct  325   QEILNEDLPEFTKDDL-KSSSNKLDFIGINQYTSRYAKDCLHSTCEPGKGG-SRAEGYVN  382

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ + + YP GME+M+ Y  E++ +IPLYVTENG+ +     +N  
Sbjct  383   ANALKDGLHLGEPTGVNWFSTYPQGMEEMLMYATERYKDIPLYVTENGFGE-----NNTG  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+A+  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D +T
Sbjct  438   VLLNDYRRVKFMSNYLDAVKRAMRKGADVRGYFAWSLLDNFEWISGYTIRFGMYHVDFIT  497

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LSA WYK FI  +R
Sbjct  498   QERTPRLSAFWYKNFIFYHR  517



>ref|XP_006302139.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
 gb|EOA35037.1| hypothetical protein CARUB_v10020143mg [Capsella rubella]
Length=522

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 178/256 (70%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP +YG YPKEM
Sbjct  257   IYQTKYQKEQKGSIGIVVQTSWFEPISDSNADKEAAERAQSFYSNWILDPAIYGKYPKEM  316

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG+ LP+FSS +++ LK   +DFIG+NHYT+Y+ QDCL STC+ +  G  + EGF  
Sbjct  317   VNILGAALPQFSSNEVKNLKNSRADFIGVNHYTSYFIQDCLISTCN-TGNGAYKAEGFAL  375

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YL +++ NIP+++TENG+ D   P +  +
Sbjct  376   KLDRKGNVSIGELTDVVWQHIDPEGFHKMLNYLTDRYPNIPMFITENGFGDLQKPETTDK  435

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  436   ELLHDTKRIQYMSGYLEALQAAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTT  495

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPK SA WYK FI
Sbjct  496   LKRTPKQSASWYKNFI  511



>ref|XP_010439426.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 182/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +++QQ G+IGI M   WF P+++S  DK A ERA +F   WFLDP+++G YP+EM
Sbjct  265   LYRTKFKEQQRGKIGIVMNTIWFEPVSDSLADKLATERAQAFFVTWFLDPVVFGRYPREM  324

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LP+F+  DL+   +   DFIGIN YT+ YA+DCL+S C+P   G +R EG+V 
Sbjct  325   QEILGEDLPQFTKDDLKSF-SNKLDFIGINQYTSRYAKDCLHSACEPGKGG-SRAEGYVN  382

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ + A YP GME+M+ Y  E++ +IPLYVTENG+ +     +N  
Sbjct  383   ANALKDGLHLGEPTGVNWFATYPQGMEEMLMYATERYKDIPLYVTENGFGE-----NNTG  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+A+  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D +T
Sbjct  438   ALLNDYRRVKFMSNYLDAVKRAMRKGADVRGYFAWSLLDNFEWISGYTVRFGMYHVDFIT  497

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LSA WYK FI  +R
Sbjct  498   QERTPRLSAFWYKNFIFHHR  517



>emb|CDX94056.1| BnaC07g36900D [Brassica napus]
Length=529

 Score =   281 bits (719),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 179/256 (70%), Gaps = 7/256 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q++Q G+IGI M   WF P+++S  D+ AAERA +F   WFLDP+++G YP+EM
Sbjct  268   LYRTKFQEEQRGKIGIVMNTIWFEPVSDSLADRLAAERAQAFYLTWFLDPVVFGRYPREM  327

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             KDILG +LP+F+    +  K  G DFIGIN YT+ YA+DCL++ C P   G +R EGFV 
Sbjct  328   KDILGEYLPKFTKDGFKSSK-NGLDFIGINQYTSRYAKDCLHTACKPGQGG-SRAEGFVY  385

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     +N  
Sbjct  386   SNALKDGLPLGEPTGVNWFKVYPQGMEEMLMYATERYRNIPLYVTENGFGE-----NNTG  440

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND + VKF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  441   VLLNDYRSVKFMSNYLDALKRAMRKGADVRGYFTWSLLDNFEWISGYTVRFGMYHVDFDT  500

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTP+LSA WYK FI
Sbjct  501   LERTPRLSASWYKNFI  516



>gb|KFK40645.1| hypothetical protein AALP_AA2G023400 [Arabis alpina]
Length=523

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 177/266 (67%), Gaps = 1/266 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY   YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDPI+YG YPKEM
Sbjct  251   IYGTKYQKEQNGSIGIVVQTSWFEPISDSFEDKEAAERAQSFYSNWILDPIIYGEYPKEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILG  LP+FSS +++ LK   +DFIGINHYT+Y+ QDCL STC     G ++ EGF  
Sbjct  311   ATILGPALPQFSSNEVKNLKNYRADFIGINHYTSYFIQDCLISTCTTGY-GASKAEGFAL  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK ++ NIP+++TENG+     P + ++
Sbjct  370   KLDRKGNVSIGELTDVDWQHIDPKGFRKMLNYLKHRYPNIPMFITENGFGHLQKPETTVK  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL AL  A+R GA+V+GYF WSL DNFEW +G+  R GL+  D  T
Sbjct  430   ELLHDTKRIQYMSGYLEALQAAMRDGANVKGYFAWSLLDNFEWLYGHKLRFGLFHVDYTT  489

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKM  336
             LKRTPK SA WYK FI +       M
Sbjct  490   LKRTPKQSASWYKNFIEEQVNTRDLM  515



>ref|XP_004234482.1| PREDICTED: beta-glucosidase 46-like [Solanum lycopersicum]
Length=517

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ +QGG IGI++   W+ P +NS+ D  A +RA SF+ NWFLDPI++G YP+EM
Sbjct  252   IYKTKYQVRQGGMIGISLNTQWYEPFSNSSEDNYATQRARSFVYNWFLDPIIFGKYPEEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG++LP+FS  D++KLK  G DFIG+NHYT  Y +DCL+S C+     ++  EG   
Sbjct  312   QKILGNNLPKFSRNDIKKLK-NGLDFIGLNHYTAAYIKDCLFSVCEHGQY-SSWSEGSYF  369

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IGE   + ++ VYP GMEK+V Y+K++F+N P+ +TENG  ++  PNS++E
Sbjct  370   RATEKDGVYIGEPTTMDWLFVYPQGMEKLVMYMKDRFNNTPIIITENGIAESDNPNSSLE  429

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LNDT+RV++  +YLN+LA A+R+GA+VRGYF WSL DNFEW  GYTKR GL+  +   
Sbjct  430   DALNDTQRVEYMHNYLNSLANAMREGANVRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTN  489

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YK+ I
Sbjct  490   LQRTPKLSATRYKELI  505



>ref|XP_004976202.1| PREDICTED: probable inactive beta-glucosidase 14-like [Setaria 
italica]
Length=521

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 185/272 (68%), Gaps = 6/272 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ +QGG IGI+M   W+ P +N+TVD  A ERA +F   WFLDPI++G YP +M
Sbjct  245   IYRKKYQGKQGGHIGISMCSRWYEPFSNTTVDILAVERALAFDGPWFLDPIIFGDYPTKM  304

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             ++ILG +LPEF+S   +KLKA   DFIG++HYTT Y +DC++S C  DP + G+ R    
Sbjct  305   REILGPNLPEFTSQQKKKLKATKLDFIGLSHYTTLYTKDCIFSPCEIDP-IDGDAR---V  360

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
                 + ++G LIGE+ G  +    P GMEK+V Y  ++++NIP Y+TENGY   +  +  
Sbjct  361   FSSGVGEDGVLIGEVTGSPFFYSVPEGMEKVVMYYMQRYNNIPTYITENGYAQASNSSMT  420

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
              ++  NDT RV +  DYL  LA+AIRKGADVRGYF+WSL D FEWT GYT+RLGLY  D 
Sbjct  421   AKDFTNDTGRVDYIRDYLTFLASAIRKGADVRGYFVWSLLDCFEWTSGYTQRLGLYHVDL  480

Query  419   VTLKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
              TL+RTPKLSAKW+ +F+     V ++ +  N
Sbjct  481   KTLERTPKLSAKWFSEFLKGGSLVGTRPRKEN  512



>ref|XP_010533828.1| PREDICTED: beta-glucosidase 45-like isoform X2 [Tarenaya hassleriana]
Length=421

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 175/265 (66%), Gaps = 1/265 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P++ ST DK AAERA SF SNW LDP +YG YP EM
Sbjct  153   IYRTKYQKEQSGSIGIVVQTSWFEPISESTADKLAAERAQSFYSNWILDPAIYGKYPDEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LG  LPEFS    + LK  G DF+GINHYT+Y+ +DC +S+C     G++R EGF  
Sbjct  213   VELLGPALPEFSVDQAKDLKKLGVDFVGINHYTSYFVKDCYFSSCQRG-DGSSRTEGFAL  271

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  VYP G  K++ Y+K ++ N P++VTENGY D    ++ +E
Sbjct  272   KFDRKGNVSIGELTDVDWQHVYPRGFRKVLDYIKNRYHNTPIFVTENGYGDLEKQDTTVE  331

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND KR ++   +LNAL  A+R GA+V+GYF WSL DN+EW +GY  R GL+  D  T
Sbjct  332   ELVNDIKRREYMRGHLNALQAAMRNGANVKGYFAWSLLDNYEWLYGYRLRFGLFHVDFTT  391

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L RTPKLSA WYK FI  +    S+
Sbjct  392   LNRTPKLSASWYKYFINYHTNTSSR  416



>ref|XP_006348092.1| PREDICTED: beta-glucosidase 47-like [Solanum tuberosum]
Length=517

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 176/256 (69%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGIA+   W+ P +NS+ D AA ERA SF  NWFLDPI+ G YPKEM
Sbjct  252   IYRTRYQKRQGGMIGIALDIQWYEPFSNSSEDIAATERARSFYVNWFLDPIILGRYPKEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    GNT  EG   
Sbjct  312   VQILGSNLPDFSKNDLSKLSYG-LDFIGINYYTANYIKDCLYSACE---HGNTWSEGSYF  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              ++ K+G  IG+  G+ ++ +YP GM+K+V Y+K+KF+N P+ +TENG  +    N +I 
Sbjct  368   ATIEKDGVFIGQPTGVEWLFLYPQGMKKIVMYMKDKFNNTPMVITENGIAENDNLNPSIT  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YLN+LA AIR+GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  428   DTLNDIHRVNYMHSYLNSLANAIREGADVRGYFVWSLLDNFEWLDGYKLRFGLHFVNYTN  487

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YKQ +
Sbjct  488   LQRTPKLSATRYKQLM  503



>ref|XP_010431678.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45-like [Camelina 
sativa]
Length=449

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 183/264 (69%), Gaps = 5/264 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  183   IYKTKYQKEQKGSIGIVVQTSWFEPISDSIADKEAAERAQSFYSNWILDPVIYGKYPKEM  242

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG+ LP+FSS +++ L     DF+GINHYT+Y+ QDCL S+C+    G  + EGF  
Sbjct  243   VNILGTALPQFSSNEVKNLNNSRVDFMGINHYTSYFIQDCLTSSCNAGY-GAFKAEGFAL  301

Query  773   QSLSKNGKL-IGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             + L + G + IGEL  + +  + P G  KM+ YL +++ NIP+++TENG+ D   P +  
Sbjct  302   K-LDRIGNVSIGELTDVDWQHIDPEGFHKMLNYLTDRYPNIPMFITENGFGDLQKPETTD  360

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +E+L+DTKR+++ + YL AL  A+R GA+V+GYF+WSL DNFEW  GY  R GL+  D  
Sbjct  361   KELLHDTKRIQYISGYLEALQAAMRDGANVKGYFVWSLLDNFEWLDGYKLRFGLFHVDYT  420

Query  416   TLKRTPKLSAKWYKQFIAK--NRK  351
             TLKRTPK SA WYK FI +  NR+
Sbjct  421   TLKRTPKESASWYKNFIEEHVNRR  444



>ref|XP_010316607.1| PREDICTED: beta-glucosidase 18 isoform X2 [Solanum lycopersicum]
Length=425

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 176/256 (69%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   WF P +NS+ D AAAERA SF  NWFLDPI+ G YPKEM
Sbjct  160   IYRTRYQKRQGGMIGISLDTQWFEPFSNSSEDIAAAERARSFYVNWFLDPIILGRYPKEM  219

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL + G DFIGIN+YT  Y +DCLYS C+    GNT  EG   
Sbjct  220   VQILGSNLPDFSKNDLSKL-SYGLDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSYL  275

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+  G  +I +YP GM+K+V Y++E+F+N P+ +TENG  +    N +I 
Sbjct  276   ATTEKDGVYIGQPTGAPWIFLYPQGMKKIVMYMRERFNNTPVVITENGIAENDNLNPSIT  335

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND+ RV +    LN+LA AIR+GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  336   DTLNDSHRVNYLYSCLNSLANAIREGADVRGYFVWSLLDNFEWLHGYKLRFGLHYVNYTN  395

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YKQ +
Sbjct  396   LQRTPKLSATRYKQLM  411



>ref|XP_002888065.1| hypothetical protein ARALYDRAFT_475148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64324.1| hypothetical protein ARALYDRAFT_475148 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 175/256 (68%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P++ S  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  244   IYQTKYQKEQKGSIGIVVQTSWFEPISESNADKEAAERAQSFYSNWILDPVIYGKYPKEM  303

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG  LP+FSS +++ L+   +DFIGINHYT+Y+ QDCL S C+    G  + EGF  
Sbjct  304   VNILGPALPQFSSNEVKNLENSRADFIGINHYTSYFIQDCLTSACNTG-HGAFKAEGFAH  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  +   G  KM+ YLK+++ NI +++TENG+ D   P +  +
Sbjct  363   KLDRKGNVSIGELTDVDWQHIDLEGFHKMLNYLKDRYPNIRIFITENGFGDLQKPETTDK  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L+DTKR+++ + YL AL  A+R GA+V+GYF+WSL DNFEW FGY  R GL+  D  T
Sbjct  423   ELLHDTKRIQYMSGYLEALQAAMRDGANVKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTT  482

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPK SA WYK FI
Sbjct  483   LKRTPKQSASWYKNFI  498



>ref|XP_008669177.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Zea 
mays]
 tpg|DAA36953.1| TPA: hypothetical protein ZEAMMB73_881817 [Zea mays]
Length=509

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 183/274 (67%), Gaps = 6/274 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNY+ +QGG +GI +   W+ P+ N T D  A  RA SF + WFLDP+ +G YP +M
Sbjct  239   IYRKNYKSKQGGSVGITIHMRWYEPLRNITEDHLAVSRALSFEAPWFLDPLFFGDYPHQM  298

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG +LP+F++ + EKL     DFIG+NHY T+Y +DC+YS CD         E  V 
Sbjct  299   RQILGPNLPKFTAGE-EKLLKNQIDFIGVNHYQTFYVKDCIYSLCD---IDPYTSEALVS  354

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  +NG  IG+L       V P  MEK+V YLKE+++NIPLY+TENGY      ++ +E
Sbjct  355   ESTERNGIPIGKLTQDANTYVVPSSMEKLVMYLKERYNNIPLYITENGYAQIPNISTTVE  414

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++NDT+R+ +  DYL  L+ AIRKGADVRGYF+WSL D+FEW  GYT + GL+  +  +
Sbjct  415   EIINDTERINYIRDYLTYLSFAIRKGADVRGYFVWSLMDSFEWISGYTIKYGLFHVNFKS  474

Query  413   LKRTPKLSAKWYKQFIAKNRKVE--SKMQLGNMI  318
             LKRTPKLSAKWY +FI    ++E  S+  L +M+
Sbjct  475   LKRTPKLSAKWYNKFIKGYEQIEIASEESLEHMV  508



>ref|XP_009803936.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=517

 Score =   278 bits (712),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 177/256 (69%), Gaps = 7/256 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI M F WF P++NS+ D AA  RA SF  +WFLDPI+ G YPKEM
Sbjct  255   IYRTRYQKSQGGMIGITMGFEWFEPLSNSSEDIAATHRARSFYDSWFLDPIILGRYPKEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LPE S  DL KL   G DFIGINHY+  Y +DCLYS C+    GN+  EG   
Sbjct  315   VQILGSNLPELSMNDLSKLSY-GLDFIGINHYSAVYIKDCLYSACE---HGNSWSEGSYF  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  ++G  IGE   + +  VYP G+EK+V YLK+KF+N P+++TENG+   +   S+IE
Sbjct  371   RTTQRDGIYIGEPGEVDWQFVYPQGIEKVVMYLKDKFNNTPMFITENGFAGNS---SSIE  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND +RVK+    LN+LA AIRKGADVRGYF+WSL DNFEW  GY+ R GLY  +   
Sbjct  428   DALNDVRRVKYLHSNLNSLANAIRKGADVRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTN  487

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  Y++ +
Sbjct  488   LQRTPKLSATKYQELM  503



>ref|XP_006413735.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
 gb|ESQ55188.1| hypothetical protein EUTSA_v10024896mg [Eutrema salsugineum]
Length=528

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 183/264 (69%), Gaps = 11/264 (4%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFL----SNWFLDPIMYGSY  966
             IYR  YQ+QQ G+IGI M   WF P++++  D+ AAERA +F     +  FLDP+++G Y
Sbjct  264   IYRTKYQEQQRGKIGIVMNAIWFEPVSDALADRLAAERAQAFYLTCENCRFLDPVVFGRY  323

Query  965   PKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREE  786
             P+EM++I G  LP+F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R E
Sbjct  324   PREMQEIFGEDLPQFTKDDLKSSK-NGLDFIGINQYTSRYAKDCLHSACEPGQGG-SRAE  381

Query  785   GFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPN  606
             GFV  +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG+ +     
Sbjct  382   GFVNANALKDGLALGEPTGVDWFNVYPQGMEEMLMYATERYKNIPLYVTENGFGE-----  436

Query  605   SNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQF  426
             +N   ++ND +RVK+ + YL+AL  A+RKGAD+RGYF WSL DNFEW  GYT R GLY  
Sbjct  437   NNTGVLVNDYRRVKYMSSYLDALKRAMRKGADIRGYFTWSLLDNFEWISGYTIRFGLYHV  496

Query  425   DRVTLKRTPKLSAKWYKQFIAKNR  354
             D  TL+RTP+LSA WYK FI ++R
Sbjct  497   DFNTLERTPRLSASWYKNFIFQHR  520



>ref|XP_010533827.1| PREDICTED: beta-glucosidase 46-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 175/265 (66%), Gaps = 1/265 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P++ ST DK AAERA SF SNW LDP +YG YP EM
Sbjct  250   IYRTKYQKEQSGSIGIVVQTSWFEPISESTADKLAAERAQSFYSNWILDPAIYGKYPDEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LG  LPEFS    + LK  G DF+GINHYT+Y+ +DC +S+C     G++R EGF  
Sbjct  310   VELLGPALPEFSVDQAKDLKKLGVDFVGINHYTSYFVKDCYFSSCQRG-DGSSRTEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  VYP G  K++ Y+K ++ N P++VTENGY D    ++ +E
Sbjct  369   KFDRKGNVSIGELTDVDWQHVYPRGFRKVLDYIKNRYHNTPIFVTENGYGDLEKQDTTVE  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND KR ++   +LNAL  A+R GA+V+GYF WSL DN+EW +GY  R GL+  D  T
Sbjct  429   ELVNDIKRREYMRGHLNALQAAMRNGANVKGYFAWSLLDNYEWLYGYRLRFGLFHVDFTT  488

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L RTPKLSA WYK FI  +    S+
Sbjct  489   LNRTPKLSASWYKYFINYHTNTSSR  513



>ref|XP_006285457.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
 gb|EOA18355.1| hypothetical protein CARUB_v10006876mg [Capsella rubella]
Length=514

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 181/260 (70%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+QQ G+IGI M   WF P+++S  D  A ERA +F   WFLDP+++G YP+EM
Sbjct  256   LYRTKFQEQQRGKIGIVMNTIWFEPVSDSLADILAVERAQAFYLTWFLDPVVFGRYPREM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  L EF+  DL++ K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  316   QEILGEDLLEFTKDDLKRSK-NGLDFIGINQYTSRYAKDCLHSACEPGKGG-SRAEGFVY  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ + + YP GME+M+ Y  +++ +IPLYVTENG+ +     +N  
Sbjct  374   ANALKDGSHLGEPTGVNWFSTYPQGMEEMLMYAAKRYKDIPLYVTENGFGE-----NNTG  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  429   VLLNDHRRVKFMSNYLDALKRAMRKGADVRGYFAWSLLDNFEWISGYTIRFGMYHVDFKT  488

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LSA WYK FI  +R
Sbjct  489   QERTPRLSAFWYKNFIFHHR  508



>ref|XP_010316605.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
 ref|XP_010316606.1| PREDICTED: beta-glucosidase 18 isoform X1 [Solanum lycopersicum]
Length=520

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 175/256 (68%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   WF P +NS+ D AAAERA SF  NWFLDPI+ G YPKEM
Sbjct  255   IYRTRYQKRQGGMIGISLDTQWFEPFSNSSEDIAAAERARSFYVNWFLDPIILGRYPKEM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    GNT  EG   
Sbjct  315   VQILGSNLPDFSKNDLSKLSYG-LDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSYL  370

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+  G  +I +YP GM+K+V Y++E+F+N P+ +TENG  +    N +I 
Sbjct  371   ATTEKDGVYIGQPTGAPWIFLYPQGMKKIVMYMRERFNNTPVVITENGIAENDNLNPSIT  430

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND+ RV +    LN+LA AIR+GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  431   DTLNDSHRVNYLYSCLNSLANAIREGADVRGYFVWSLLDNFEWLHGYKLRFGLHYVNYTN  490

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YKQ +
Sbjct  491   LQRTPKLSATRYKQLM  506



>ref|XP_010430205.1| PREDICTED: beta-glucosidase 46-like isoform X2 [Camelina sativa]
Length=498

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 175/249 (70%), Gaps = 1/249 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP+++G YP+EM
Sbjct  250   IYRTKYQKEQRGSIGIVVQTSWFEPVSDSIADKKAAERAQSFYSNWILDPVVFGKYPEEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LPEFSS ++  LK   SDF+GINHYT+Y+ QDCL + C+ S  G ++ EGF  
Sbjct  310   VKILGSALPEFSSNEMNNLKNYKSDFLGINHYTSYFIQDCLITACN-SGDGASKSEGFAL  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G +KM+ YLK ++ NIP+Y+TENG+     P + ++
Sbjct  369   KLDRKGNVSIGELTDVDWQHIDPDGFKKMLNYLKNRYHNIPMYITENGFGQLQKPETTVK  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+++DTKR+++ ++YL+AL  A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  T
Sbjct  429   ELMHDTKRIQYLSEYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFGLFHVDYAT  488

Query  413   LKRTPKLSA  387
             LKRTPK SA
Sbjct  489   LKRTPKQSA  497



>ref|XP_010273571.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=513

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 177/262 (68%), Gaps = 4/262 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ +QGG+IGI M  +W+ P+ ++  D  A +RA +F + WFLDPI+YG YP EM
Sbjct  240   IYRKKYQVKQGGKIGIVMCSSWYEPLRDTPTDNFAVQRALAFDTAWFLDPIIYGEYPPEM  299

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  D +KL     DFIG+NHYTT Y +DC++S C+ S +         G
Sbjct  300   RQILGSRLPTFSLEDKKKL-GNKLDFIGVNHYTTLYVKDCMFSQCESSTSLGEASVYITG  358

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K+G  IG    +  + V P GMEK++ Y KE+++NIP+++TENGY   + PN++  
Sbjct  359   E---KDGHPIGHPTAMPSLYVVPYGMEKIIMYFKERYNNIPMFITENGYAQASNPNTSKR  415

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND  RV++   YL ++  A++ GADVRGYFIWSL DNFEW +GYT R G+Y  D  T
Sbjct  416   DILNDNGRVEYLKSYLASVNLAMKHGADVRGYFIWSLIDNFEWLYGYTLRFGIYYVDYNT  475

Query  413   LKRTPKLSAKWYKQFIAKNRKV  348
             L+RTPKLSA WYKQF+A   K+
Sbjct  476   LERTPKLSAMWYKQFLAGREKI  497



>ref|XP_006858057.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
 gb|ERN19524.1| hypothetical protein AMTR_s00062p00043120 [Amborella trichopoda]
Length=537

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/280 (49%), Positives = 178/280 (64%), Gaps = 23/280 (8%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR+ YQ++QGG IGI +   WF P+ ++ VD+ AA+RA +F S WFLDPI++G YP EM
Sbjct  243   IYRRKYQEKQGGSIGIVICSYWFEPLKDTPVDRIAAQRALAFESAWFLDPIVFGDYPPEM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  +  KL+  G DFIGINHYT+ Y +DCL+S C     G +  EGF  
Sbjct  303   RQILGSRLPRFSKEERRKLQ-NGLDFIGINHYTSLYVKDCLFSEC---TYGMSSIEGFYS  358

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
               L + G  IGE   +    VYP GMEK+V Y+KE+++N+P+++TENGY   +TP +  E
Sbjct  359   MILEREGIPIGEPTAMTTFYVYPQGMEKIVMYMKERYNNLPMFITENGYAQGSTPKAKAE  418

Query  593   EVLNDTKRVKFFADYLNALATAIR-------------------KGADVRGYFIWSLFDNF  471
             E ++D +RVK+   YL +LA AIR                   KGA+V+GY +WSL DNF
Sbjct  419   EFVDDAERVKYLGSYLESLANAIRSLSLSLSQQRDLPCACVRMKGANVKGYMVWSLLDNF  478

Query  470   EWTFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNRK  351
             EW  GY  R GLY  D  T KRTPKLSA WYK FI   +K
Sbjct  479   EWLNGYNMRFGLYHVDFSTFKRTPKLSADWYKGFIQNYKK  518



>ref|XP_010069050.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW57267.1| hypothetical protein EUGRSUZ_H00071 [Eucalyptus grandis]
Length=515

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 178/266 (67%), Gaps = 8/266 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG IGI +   +++P+TN+  DK AAERA +F   WFLDPIMYG YP EM
Sbjct  245   IYRNKYQAKQGGMIGIVISAPYYVPLTNTPADKLAAERALAFQIAWFLDPIMYGDYPPEM  304

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               I+G+ LP FS+ + +KL +   DFIGIN YT  YA+DC++S C    +  +  E  V 
Sbjct  305   HQIIGARLPVFSAEERKKL-SNKLDFIGINQYTAAYAKDCMFSPC---TSAYSLGESMVY  360

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G LIG+   + Y  V P  +E  V Y+KE+++N P+++TENGY  +  P   I 
Sbjct  361   VTGEKDGTLIGDTTAVSYFYVVPSALEMAVMYVKERYNNTPMFITENGYAQSNAP---IA  417

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LNDTKRV++F  YL+AL  A+RKGADVRGYFIWSL DNFEW  GYT R GLY  D  T
Sbjct  418   DSLNDTKRVEYFKSYLSALVNAMRKGADVRGYFIWSLLDNFEWLDGYTIRFGLYHVDFDT  477

Query  413   LKRTPKLSAKWYKQFIA-KNRKVESK  339
             LKRTP+ SAKWYK F+A  N   ESK
Sbjct  478   LKRTPRQSAKWYKNFLADSNSTTESK  503



>ref|XP_010434129.1| PREDICTED: beta-glucosidase 47-like [Camelina sativa]
Length=523

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 180/260 (69%), Gaps = 7/260 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q++Q G+IGI M   WF P+++S  D+ A ERA +F   WFLDP+++G YP+EM
Sbjct  265   LYRTKFQERQRGKIGIVMNTIWFEPVSDSLADRLATERAQAFFMTWFLDPVVFGRYPREM  324

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LPEF+  DL+   +   DFIGIN YT+ YA+DCL+S C+P   G +R EG+V 
Sbjct  325   QEILGEDLPEFTKDDLKSF-SNKLDFIGINQYTSRYAKDCLHSACEPGKGG-SRAEGYVN  382

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ + + YP GME+M+ Y  E++ +IPLYVTENG+ +     +N  
Sbjct  383   ANALKDGLRLGEPTGVNWFSTYPQGMEEMLMYATERYKDIPLYVTENGFGE-----NNTG  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+A+  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  438   VLLNDYRRVKFMSNYLDAVKRAMRKGADVRGYFAWSLLDNFEWISGYTIRFGMYHVDFKT  497

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTP+LS  WYK FI  +R
Sbjct  498   QERTPRLSVFWYKNFIFHHR  517



>ref|XP_006348091.1| PREDICTED: probable inactive beta-glucosidase 14-like [Solanum 
tuberosum]
Length=517

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 175/256 (68%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P +NS+ D AAAERA SF  NWFLDPI+ G YPKEM
Sbjct  252   IYRTRYQKRQGGMIGISLDTQWYEPFSNSSEDIAAAERARSFYVNWFLDPIILGRYPKEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCL+S C+    GNT  EG   
Sbjct  312   VQILGSNLPDFSKNDLSKLSYG-LDFIGINYYTAKYIKDCLFSACE---HGNTWSEGSYL  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+  G  +I +YP GM+K+V Y++++F+N PL +TENG  +    N +I 
Sbjct  368   ATTEKDGVYIGQPTGAPWIFLYPQGMKKIVMYMRDRFNNTPLVITENGVSENDNLNPSIT  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YLN+LA AIR+GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  428   DTLNDIHRVNYLHSYLNSLANAIREGADVRGYFVWSLLDNFEWLNGYKLRFGLHYVNYTN  487

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YKQ +
Sbjct  488   LQRTPKLSATRYKQLM  503



>ref|XP_009608375.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=512

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI M   W+ P +NS+ D AA  RA SF  NWFLDPI+ G YPKEM
Sbjct  250   IYRTRYQKCQGGMIGITMGIEWYEPFSNSSEDIAATHRARSFYGNWFLDPIILGRYPKEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LPEFS +DL  L  G  DFIGINHY+  Y +DCLYS C+    GN+  EG   
Sbjct  310   VQILGSNLPEFSMSDLSLLSYG-LDFIGINHYSAVYIKDCLYSACE---HGNSWSEGSYL  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE   + +  VYP G+EK+V Y+KE+F+N P+++TENG+   +   S+IE
Sbjct  366   TTTQRDGIYIGEPGEVDWQFVYPQGIEKVVMYMKERFNNTPMFITENGFAGNS---SSIE  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RVK+   YL +LA AI+KGADVRGYFIWSL DNFEW  GYT R GLY  +   
Sbjct  423   DTLNDVHRVKYLHSYLYSLANAIKKGADVRGYFIWSLLDNFEWLDGYTIRFGLYYVNYTN  482

Query  413   LKRTPKLSAKWYKQFIAK  360
             L+RTPKLSA  Y+Q I  
Sbjct  483   LQRTPKLSATKYQQLICN  500



>ref|XP_003529623.1| PREDICTED: beta-glucosidase 46 [Glycine max]
 gb|KHN03065.1| Beta-glucosidase 46 [Glycine soja]
Length=554

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 181/264 (69%), Gaps = 8/264 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ +QGGEIGI +    F P++NST DK A ERA SF  NW LDPI++G YPKEM
Sbjct  266   LYRNKYQTEQGGEIGIVLHCDSFEPLSNSTADKLATERAQSFSINWILDPILFGKYPKEM  325

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG+ LP+FSS D  KL+ G  DFIGINHY +YY +DC+ S C+ S  G +  EG   
Sbjct  326   EMILGTTLPKFSSNDKAKLRQG-LDFIGINHYASYYVRDCISSVCE-SGPGVSTTEGLYQ  383

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++       IGEL    +++VYP GM+ ++ YLK++++N P+++TENGY +   P+   E
Sbjct  384   RTT------IGELTPFDWLSVYPLGMKSILMYLKDRYNNTPMFITENGYGNLYDPDLTEE  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E LND KR++F + +L+ L  AIR+GADVRGYF WSL DNFEW +G++ R GL+  D  T
Sbjct  438   EYLNDFKRIEFMSGHLDNLMAAIREGADVRGYFAWSLLDNFEWLYGFSVRFGLHHVDFST  497

Query  413   LKRTPKLSAKWYKQFIAKNRKVES  342
             LKRTPKLSA WY+ FI   +  +S
Sbjct  498   LKRTPKLSAIWYEHFIENYKLTDS  521



>ref|XP_009617373.1| PREDICTED: beta-glucosidase 18-like [Nicotiana tomentosiformis]
Length=531

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 183/258 (71%), Gaps = 4/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P ++S+ DK+AA+RA SF+ NWFLDPI++G YP+EM
Sbjct  267   IYRTKYQERQGGMIGISLNTQWYEPFSDSSEDKSAAQRARSFVYNWFLDPIIFGRYPEEM  326

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG++LP FSS DL+KL   G DFIGIN YT  Y +DCLYS C+    G +  EG   
Sbjct  327   QQILGTNLPAFSSNDLKKLN-NGLDFIGINLYTAAYIKDCLYSACE---NGTSWSEGSYF  382

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++  K+G  IG+   + ++ VYP GMEK+V Y+K++F+N P+ +TENG  ++  PNS++ 
Sbjct  383   RTTEKDGVYIGKPTTMDWLFVYPQGMEKIVMYMKDRFNNTPIIITENGIAESDNPNSSLA  442

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L DT+RV++   +L  LA A+R+GADVRGYF WSL DNFEW  GYTKR GL+  +   
Sbjct  443   DALIDTQRVEYMHSHLKFLANAMREGADVRGYFAWSLLDNFEWLEGYTKRFGLHYVNFTN  502

Query  413   LKRTPKLSAKWYKQFIAK  360
             L+RTPKLSA  YK+  + 
Sbjct  503   LQRTPKLSATRYKELTSN  520



>ref|XP_009774064.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=509

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 175/258 (68%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ+ QGG IGI M   W+ P +NS+ D AA +RA SF +NWFLDPI+ G YP+EM
Sbjct  247   IYRTRYQKCQGGMIGITMGVEWYEPFSNSSEDIAATQRARSFYTNWFLDPIILGRYPEEM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LPEFS +DL  L  G  DFIGINHY+  Y +DCLYS C+    GN+  EG   
Sbjct  307   VQILGSNLPEFSVSDLRMLSYG-LDFIGINHYSAVYIKDCLYSACE---HGNSWSEGSYL  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE   + +  VYP G+EK+V Y+K++F+N P+++TENG+   +   S+IE
Sbjct  363   TTTQRDGVYIGEPGEVDWQFVYPQGIEKVVMYIKDRFNNTPMFITENGFAGNS---SSIE  419

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RVK+   YLN+LA AIRKGADVRGYF WSL DNFEW  GYT R GLY  +   
Sbjct  420   DALNDVHRVKYMHSYLNSLANAIRKGADVRGYFAWSLLDNFEWLDGYTIRFGLYYVNYTN  479

Query  413   LKRTPKLSAKWYKQFIAK  360
             L+RTPKLSA  Y + +  
Sbjct  480   LQRTPKLSATKYPELMCN  497



>ref|XP_010023761.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Eucalyptus grandis]
Length=419

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 179/265 (68%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ++QGG IGI +   WF P  +S  D+ A +R+ +F   WF+DP++YG YP EM
Sbjct  153   IYRKYYQEKQGGMIGIVISAPWFEPYDDSPADRLAVQRSLAFYIAWFVDPLVYGDYPPEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC-DPSMAGNTREEGFV  777
             + +LGS LP +S+ + +KL  G  DFIG+NHYTT Y +DC++S+C  P   G    + FV
Sbjct  213   RQVLGSRLPTYSAEERKKLLEGKLDFIGVNHYTTLYVKDCMFSSCASPYSLG----DAFV  268

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  K+G  IGE   +    V P GME +VTY+KE+++N P+++TENGY     P   I
Sbjct  269   YLTGEKDGAYIGERTAMPLFFVVPRGMEGIVTYVKERYNNTPMFITENGYAQ---PAGAI  325

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             ++ LNDTKR+++  +YL  L+  +RKGADVRGYFIWSL DNFEW +GY  R GL+  D  
Sbjct  326   KDSLNDTKRIEYHENYLAVLSEVVRKGADVRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQ  385

Query  416   TLKRTPKLSAKWYKQFIAKNRKVES  342
             TLKRTPK SA WY +F++++ K+ +
Sbjct  386   TLKRTPKWSATWYTEFLSEDNKIRA  410



>ref|XP_010316603.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Solanum lycopersicum]
Length=431

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 173/255 (68%), Gaps = 4/255 (2%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             YR  YQ++QGG IGI++   W+ P +NS  D AA ERA SF  NWFLDPI+ G YPKEM 
Sbjct  167   YRTRYQKRQGGMIGISLDTQWYEPFSNSPEDIAATERARSFYVNWFLDPIILGRYPKEMV  226

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             +ILGS+LP+FS  DL KL + G DFIGIN+YT  Y +DCLYS C+    GNT  EG   +
Sbjct  227   EILGSNLPDFSKNDLSKL-SYGLDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSFFE  282

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I +
Sbjct  283   TREKDGVYIGQPTEVDWLFLYPQGMKKIVMYMKDRFNNTPMVITENGIAENDNLNPSITD  342

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
              LND  RV +   YLN+LA AI  GADVRGYF+WSL DNFEW  GY  R GL+  +   L
Sbjct  343   TLNDIHRVNYMHSYLNSLANAITDGADVRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNL  402

Query  410   KRTPKLSAKWYKQFI  366
             +RTPKLSA  YKQ +
Sbjct  403   QRTPKLSATMYKQLM  417



>emb|CDY25326.1| BnaC01g29950D [Brassica napus]
Length=691

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 174/249 (70%), Gaps = 1/249 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +Q G IGI +  +WF P+++S  D+ AAERA SF SNW LDPI+YG YPKEM
Sbjct  428   IYRSKYQVKQRGIIGIVVQTSWFEPISDSIADREAAERAQSFYSNWILDPIIYGKYPKEM  487

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP FS  ++E LK    DFIGINHYT+Y+ QDCL++TC+    G ++ +GF  
Sbjct  488   VNVLGSALPRFSRKEVENLKQLRLDFIGINHYTSYFIQDCLFTTCNAG-DGASKAQGFAL  546

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  ++P G  K + YLK ++ NIP+++TENG+ D   P + + 
Sbjct  547   KLDRKGNVSIGELTDVNWQHIHPEGFRKTLNYLKNRYHNIPMFITENGFGDLQKPETTLT  606

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL+AL +A+R GA+V+GYF WSL DNFEW +GY  R GL+  D  +
Sbjct  607   ELLNDTKRIQYMSGYLDALQSAMRDGANVKGYFAWSLLDNFEWLYGYKLRFGLFHVDYTS  666

Query  413   LKRTPKLSA  387
             LKRTPKLSA
Sbjct  667   LKRTPKLSA  675



>gb|KCW60131.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=497

 Score =   270 bits (690),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 179/265 (68%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ++QGG IGI +   WF P  +S  D+ A +R+ +F   WF+DP++YG YP EM
Sbjct  231   IYRKYYQEKQGGMIGIVISAPWFEPYDDSPADRLAVQRSLAFYIAWFVDPLVYGDYPPEM  290

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC-DPSMAGNTREEGFV  777
             + +LGS LP +S+ + +KL  G  DFIG+NHYTT Y +DC++S+C  P   G    + FV
Sbjct  291   RQVLGSRLPTYSAEERKKLLEGKLDFIGVNHYTTLYVKDCMFSSCASPYSLG----DAFV  346

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  K+G  IGE   +    V P GME +VTY+KE+++N P+++TENGY     P   I
Sbjct  347   YLTGEKDGAYIGERTAMPLFFVVPRGMEGIVTYVKERYNNTPMFITENGYAQ---PAGAI  403

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             ++ LNDTKR+++  +YL  L+  +RKGADVRGYFIWSL DNFEW +GY  R GL+  D  
Sbjct  404   KDSLNDTKRIEYHENYLAVLSEVVRKGADVRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQ  463

Query  416   TLKRTPKLSAKWYKQFIAKNRKVES  342
             TLKRTPK SA WY +F++++ K+ +
Sbjct  464   TLKRTPKWSATWYTEFLSEDNKIRA  488



>ref|XP_010023759.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Eucalyptus grandis]
 gb|KCW60130.1| hypothetical protein EUGRSUZ_H02856 [Eucalyptus grandis]
Length=514

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 179/265 (68%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ++QGG IGI +   WF P  +S  D+ A +R+ +F   WF+DP++YG YP EM
Sbjct  248   IYRKYYQEKQGGMIGIVISAPWFEPYDDSPADRLAVQRSLAFYIAWFVDPLVYGDYPPEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC-DPSMAGNTREEGFV  777
             + +LGS LP +S+ + +KL  G  DFIG+NHYTT Y +DC++S+C  P   G    + FV
Sbjct  308   RQVLGSRLPTYSAEERKKLLEGKLDFIGVNHYTTLYVKDCMFSSCASPYSLG----DAFV  363

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  K+G  IGE   +    V P GME +VTY+KE+++N P+++TENGY     P   I
Sbjct  364   YLTGEKDGAYIGERTAMPLFFVVPRGMEGIVTYVKERYNNTPMFITENGYAQ---PAGAI  420

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             ++ LNDTKR+++  +YL  L+  +RKGADVRGYFIWSL DNFEW +GY  R GL+  D  
Sbjct  421   KDSLNDTKRIEYHENYLAVLSEVVRKGADVRGYFIWSLLDNFEWLYGYLIRFGLHYVDFQ  480

Query  416   TLKRTPKLSAKWYKQFIAKNRKVES  342
             TLKRTPK SA WY +F++++ K+ +
Sbjct  481   TLKRTPKWSATWYTEFLSEDNKIRA  505



>ref|XP_009763871.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=374

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/250 (53%), Positives = 172/250 (69%), Gaps = 7/250 (3%)
 Frame = -2

Query  1115  QQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGS  936
             ++ Q G IGI M F W+ P++NS+ D AA  RA SF  +WFLDPI+ G YPKEM  ILGS
Sbjct  118   EKSQRGMIGITMGFEWYEPLSNSSEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGS  177

Query  935   HLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQSLSKN  756
             +LPE S  DL KL  G  DFIGINHY+  Y +DCLYS C+    GN+  EG   ++  ++
Sbjct  178   NLPELSMNDLSKLSYG-LDFIGINHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRD  233

Query  755   GKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEEVLNDT  576
             G  IGE   + +  VYP G+EK+V YLK+KF+N P+++TENG+   +   S+IE+ LND 
Sbjct  234   GIYIGEPGEVDWQFVYPQGIEKVVMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDV  290

Query  575   KRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTLKRTPK  396
             +RVK+    LN+LA AIRKGADVRGYF+WSL DNFEW  GY+ R GLY  +   L+RTPK
Sbjct  291   RRVKYLHSNLNSLANAIRKGADVRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPK  350

Query  395   LSAKWYKQFI  366
             LSA  Y++ +
Sbjct  351   LSATKYQELM  360



>ref|XP_002448170.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
 gb|EES12498.1| hypothetical protein SORBIDRAFT_06g022420 [Sorghum bicolor]
Length=817

 Score =   277 bits (708),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 177/264 (67%), Gaps = 6/264 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNY+ +QGG IGI++   W+ P+ N T D  A  RA SF + WFLDP+ +G YP +M
Sbjct  547   IYRKNYKVKQGGSIGISLYMRWYEPLRNITEDHLAVSRALSFQAPWFLDPLFFGDYPHQM  606

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFV  777
             + ILG +LP+F+  + + LK    DFIGINHY T Y +DC++S CD  + AG    +  V
Sbjct  607   RQILGPNLPKFTKGEKQLLK-NQIDFIGINHYETLYIKDCIHSLCDLDTYAG----DALV  661

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              +S  +NG LIG+   +    V P  MEK+V YLK+++ +IPLY+TENGY      ++  
Sbjct  662   TESAERNGILIGKPTPVANTCVVPSSMEKLVMYLKQRYKSIPLYITENGYAQIGNSSTTT  721

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             EE++NDT+R  +  DYL  L+ AIRKGADVRGYF+WSL DNFEW  GYT + GLY  D  
Sbjct  722   EELINDTERSSYIHDYLTYLSLAIRKGADVRGYFVWSLMDNFEWLSGYTTKYGLYYVDFK  781

Query  416   TLKRTPKLSAKWYKQFIAKNRKVE  345
             +LKRTPKLSAKWY +FI  N  +E
Sbjct  782   SLKRTPKLSAKWYSKFIKGNEHIE  805



>ref|XP_008669176.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Zea 
mays]
Length=510

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 182/275 (66%), Gaps = 7/275 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNW-FLDPIMYGSYPKE  957
             IYRKNY+ +QGG +GI +   W+ P+ N T D  A  RA SF +   FLDP+ +G YP +
Sbjct  239   IYRKNYKSKQGGSVGITIHMRWYEPLRNITEDHLAVSRALSFEAPCRFLDPLFFGDYPHQ  298

Query  956   MKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFV  777
             M+ ILG +LP+F++ + EKL     DFIG+NHY T+Y +DC+YS CD         E  V
Sbjct  299   MRQILGPNLPKFTAGE-EKLLKNQIDFIGVNHYQTFYVKDCIYSLCD---IDPYTSEALV  354

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              +S  +NG  IG+L       V P  MEK+V YLKE+++NIPLY+TENGY      ++ +
Sbjct  355   SESTERNGIPIGKLTQDANTYVVPSSMEKLVMYLKERYNNIPLYITENGYAQIPNISTTV  414

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             EE++NDT+R+ +  DYL  L+ AIRKGADVRGYF+WSL D+FEW  GYT + GL+  +  
Sbjct  415   EEIINDTERINYIRDYLTYLSFAIRKGADVRGYFVWSLMDSFEWISGYTIKYGLFHVNFK  474

Query  416   TLKRTPKLSAKWYKQFIAKNRKVE--SKMQLGNMI  318
             +LKRTPKLSAKWY +FI    ++E  S+  L +M+
Sbjct  475   SLKRTPKLSAKWYNKFIKGYEQIEIASEESLEHMV  509



>ref|NP_193907.2| beta-glucosidase 47 [Arabidopsis thaliana]
 sp|Q9SVS1.2|BGL47_ARATH RecName: Full=Beta-glucosidase 47; Short=AtBGLU47; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE84500.1| beta-glucosidase 47 [Arabidopsis thaliana]
Length=535

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 178/262 (68%), Gaps = 17/262 (6%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  +Q+QQ G+IGI M   WF P+++S  D+ AA+RA +F   WFLDP+++G YP+EM
Sbjct  273   LYRTKFQEQQRGQIGIVMNTIWFEPISDSLADRLAADRAQAFYLTWFLDPVVFGRYPREM  332

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILG  LPEF+  DL+  K    DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  333   REILGDDLPEFTKDDLKSSK-NALDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVY  390

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE          P GME+M+ Y  E++ NI LYVTENG+ +     +N  
Sbjct  391   ANALKDGLRLGE----------PVGMEEMLMYATERYKNITLYVTENGFGE-----NNTG  435

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKGADVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  436   VLLNDYQRVKFMSNYLDALKRAMRKGADVRGYFAWSLLDNFEWISGYTIRFGMYHVDFST  495

Query  413   LKRTPKLSAKWYKQFIAKNRKV  348
              +RTP+LSA WYK FI ++R +
Sbjct  496   QERTPRLSASWYKNFIFQHRAL  517



>ref|XP_010316604.1| PREDICTED: beta-glucosidase 18-like [Solanum lycopersicum]
Length=516

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 172/256 (67%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   WF P +NS+ D AAAERA SF  NWFLDPI+ G YPKEM
Sbjct  251   IYRTRYQKRQGGMIGISLDTQWFEPFSNSSEDIAAAERARSFYVNWFLDPIILGRYPKEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    G T  EG   
Sbjct  311   VQILGSNLPDFSKNDLSKLSYG-LDFIGINYYTAAYIKDCLYSACE---HGRTWSEGSFL  366

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I 
Sbjct  367   DTREKDGVYIGQPTEVDWLFLYPQGMKKIVMYMKDRFNNTPMVITENGIAENDNLNPSII  426

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YLN+LA AI  GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  427   DTLNDFHRVDYMRSYLNSLANAITDGADVRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTN  486

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YKQ +
Sbjct  487   LQRTPKLSATRYKQLM  502



>ref|XP_010316602.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Solanum lycopersicum]
Length=520

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 172/255 (67%), Gaps = 4/255 (2%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             YR  YQ++QGG IGI++   W+ P +NS  D AA ERA SF  NWFLDPI+ G YPKEM 
Sbjct  256   YRTRYQKRQGGMIGISLDTQWYEPFSNSPEDIAATERARSFYVNWFLDPIILGRYPKEMV  315

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             +ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    GNT  EG   +
Sbjct  316   EILGSNLPDFSKNDLSKLSYG-LDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSFFE  371

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I +
Sbjct  372   TREKDGVYIGQPTEVDWLFLYPQGMKKIVMYMKDRFNNTPMVITENGIAENDNLNPSITD  431

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
              LND  RV +   YLN+LA AI  GADVRGYF+WSL DNFEW  GY  R GL+  +   L
Sbjct  432   TLNDIHRVNYMHSYLNSLANAITDGADVRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTNL  491

Query  410   KRTPKLSAKWYKQFI  366
             +RTPKLSA  YKQ +
Sbjct  492   QRTPKLSATMYKQLM  506



>ref|XP_010240133.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X3 [Brachypodium 
distachyon]
Length=425

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ +QGG+IGI +   W+ P  N+TVD  A +RA SF + WFLDPI+ G YP EM
Sbjct  153   IYRNNYQGKQGGQIGITVSARWYEPFRNTTVDLLAVQRAISFNAPWFLDPIILGDYPPEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + +LG++LP F+S +  KL+A   DFIG+NHYTT Y +DC++S C  DP + G+ R    
Sbjct  213   RQMLGANLPNFTSKEKRKLQATKLDFIGLNHYTTVYLKDCIFSPCAVDP-IDGDAR----  267

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V     ++G LIGE  G  Y    P GMEK+V + K++++N P Y+TENGY   +  +  
Sbjct  268   VVSLAERDGVLIGEPTGTPYFYDVPHGMEKVVMHYKQRYNNTPTYITENGYAQASNHSMA  327

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
               + +ND  R+ +   YL  LA+AIRKGAD+RGYF+WSL D+FEWT GYT+R GLY  D 
Sbjct  328   ANDFINDAGRIHYIRGYLTFLASAIRKGADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDF  387

Query  419   VTLKRTPKLSAKWYKQFI  366
              T KRTPKLSA WY++F+
Sbjct  388   KTQKRTPKLSAGWYRKFL  405



>ref|XP_010240132.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Brachypodium 
distachyon]
Length=431

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ +QGG+IGI +   W+ P  N+TVD  A +RA SF + WFLDPI+ G YP EM
Sbjct  159   IYRNNYQGKQGGQIGITVSARWYEPFRNTTVDLLAVQRAISFNAPWFLDPIILGDYPPEM  218

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + +LG++LP F+S +  KL+A   DFIG+NHYTT Y +DC++S C  DP + G+ R    
Sbjct  219   RQMLGANLPNFTSKEKRKLQATKLDFIGLNHYTTVYLKDCIFSPCAVDP-IDGDAR----  273

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V     ++G LIGE  G  Y    P GMEK+V + K++++N P Y+TENGY   +  +  
Sbjct  274   VVSLAERDGVLIGEPTGTPYFYDVPHGMEKVVMHYKQRYNNTPTYITENGYAQASNHSMA  333

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
               + +ND  R+ +   YL  LA+AIRKGAD+RGYF+WSL D+FEWT GYT+R GLY  D 
Sbjct  334   ANDFINDAGRIHYIRGYLTFLASAIRKGADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDF  393

Query  419   VTLKRTPKLSAKWYKQFI  366
              T KRTPKLSA WY++F+
Sbjct  394   KTQKRTPKLSAGWYRKFL  411



>ref|NP_001053302.1| Os04g0513100 [Oryza sativa Japonica Group]
 sp|Q7XPY7.2|BGL14_ORYSJ RecName: Full=Probable inactive beta-glucosidase 14; Short=Os4bglu14; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE03397.2| OSJNBa0004N05.21 [Oryza sativa Japonica Group]
 dbj|BAF15216.1| Os04g0513100 [Oryza sativa Japonica Group]
 dbj|BAG90635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77631.1| hypothetical protein OsI_16623 [Oryza sativa Indica Group]
Length=516

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 178/273 (65%), Gaps = 10/273 (4%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQ +QGG+IGIA+  TW+ P  N+T+D  A +RA SF ++WFLDPI+ G YP EM
Sbjct  243   VYRNKYQGKQGGQIGIALSITWYEPFRNTTIDLLAVKRALSFGASWFLDPILLGDYPTEM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             +++LG  LP+F+S    +L++   DFIG+NHYTT Y +DC++S C  DP  A     +  
Sbjct  303   REVLGQSLPKFTSKQKNRLQSTKLDFIGLNHYTTCYVKDCIFSPCEIDPVNA-----DAR  357

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V     ++G  IG+  G  +    P GME+ VTY K++++N P Y+TENGY   +  N  
Sbjct  358   VFSLYERDGVPIGKATGAPFFHDVPRGMEEAVTYYKQRYNNTPTYITENGYSQASNSNMT  417

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
              ++  NDT R+ +   YL +LA+AIRKGADVRGYF+WSL D+FEW FGYT R GLY    
Sbjct  418   AKDFTNDTGRITYIQGYLISLASAIRKGADVRGYFVWSLLDDFEWNFGYTLRFGLYHVHY  477

Query  419   VTLKRTPKLSAKWYKQFIAKN---RKVESKMQL  330
              TLKRTPKLS  WY++F+  +   RK   + QL
Sbjct  478   KTLKRTPKLSVDWYRKFLTGSLLRRKFRDESQL  510



>gb|KDP39385.1| hypothetical protein JCGZ_01142 [Jatropha curcas]
Length=422

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 178/264 (67%), Gaps = 7/264 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG+IGI +   W+ P+ +   D  AA+RA SF + WF+DPI+YG YP EM
Sbjct  153   IYRDRYQEKQGGKIGIVLSAYWYEPLRDIPADHFAAQRALSFFTAWFMDPIIYGEYPPEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + I+G  LP FS  +  KLK    DFIGINHY+T YA+DC++S C+ S   +   + FV 
Sbjct  213   RQIVGERLPTFSVEEKRKLK-NKLDFIGINHYSTLYAKDCMFSPCNSST--DLLADSFVY  269

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNS-NI  597
              +  ++G LIG+   +    V P  MEK+V Y K++++N P+++TENGY     PNS +I
Sbjct  270   NTGDRDGNLIGKPTAMPTFYVVPNSMEKIVMYFKDRYNNTPMFITENGYAQ---PNSGDI  326

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +E+L+D  R+++   YL +LA AIRKGADVRGYF WSL DNFEW++GY+   GLY  DR 
Sbjct  327   KEMLSDAGRIEYMEGYLTSLAAAIRKGADVRGYFGWSLIDNFEWSYGYSICFGLYHVDRT  386

Query  416   TLKRTPKLSAKWYKQFIAKNRKVE  345
             TLKRTPK SA W++QF+  N  + 
Sbjct  387   TLKRTPKQSALWFQQFLRNNNNLR  410



>ref|XP_010920389.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=439

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 174/263 (66%), Gaps = 4/263 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+K YQ +QGG IGIA+   W+ P+ +   D  A +RA +F   WFLDP+++G YP EM
Sbjct  168   IYKKKYQVKQGGSIGIAISARWYEPLRDIPADCLAVQRALAFDIAWFLDPVIFGEYPPEM  227

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +L   LP FSS D  KL+    DFIGINHYT+ Y +DC++S C+    G T    FV 
Sbjct  228   RQVLSLRLPTFSSEDRRKLQHK-LDFIGINHYTSKYVKDCIFSPCE---GGKTESTAFVM  283

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  IG    +    V+P GMEK++ Y+ ++++NIP+++TENGY   +T N    
Sbjct  284   STGERNGIPIGTPTSMPDNYVFPDGMEKIIMYIMQRYNNIPMFITENGYAQGSTSNDPTT  343

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LNDT RV++   YL +L  A+R+GADVRGYFIWSL DNFEW +GYT+R GLY  +  T
Sbjct  344   DMLNDTSRVEYLHGYLTSLTRAVRQGADVRGYFIWSLLDNFEWLYGYTQRFGLYHVNFET  403

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
              +RTP+LSAKW+K+F+     +E
Sbjct  404   QERTPRLSAKWFKEFLEGPEVIE  426



>ref|XP_006348093.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=518

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 171/256 (67%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P +NS+ D AA ERA SF  NWFLDPI+ G YPKEM
Sbjct  253   IYRTRYQKRQGGMIGISLDTQWYEPFSNSSEDIAATERARSFYVNWFLDPIILGRYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    GNT  EG   
Sbjct  313   VQILGSNLPDFSKNDLSKLSYG-LDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSYF  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I 
Sbjct  369   VTTEKDGVYIGQSTEVEWLFLYPQGMKKIVMYMKDRFNNTPMVITENGIAENDNLNPSIT  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YLN+LA AI  GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  429   DTLNDIHRVNYMHSYLNSLANAITDGADVRGYFVWSLLDNFEWLDGYKLRFGLHYVNYTN  488

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLSA  YKQ +
Sbjct  489   LQRIPKLSATMYKQLM  504



>ref|NP_001185287.1| beta-glucosidase 45 [Arabidopsis thaliana]
 gb|AEE33891.1| beta-glucosidase 45 [Arabidopsis thaliana]
Length=543

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 170/244 (70%), Gaps = 1/244 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++Q G IGI +  +WF P+++S  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  253   IYKTKYQKEQKGSIGIVVQTSWFEPISDSNADKEAAERAQSFYSNWILDPVIYGKYPKEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              DILG  LP+FSS +++ L+   +DF+GINHYT+Y+ QDCL S C+ +  G  + EG+  
Sbjct  313   VDILGPALPQFSSNEVKNLEKSRADFVGINHYTSYFIQDCLTSACN-TGHGAFKAEGYAL  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K    IGEL  + +  + P G  KM+ YLK+++ N+P+++TENG+ D   P +  +
Sbjct  372   KLDRKGNVTIGELTDVNWQHIDPTGFHKMLNYLKDRYPNMPMFITENGFGDLQKPETTDK  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+LNDTKR+++ + YL AL  A+R GA+V+GYF+WSL DNFEW FGY  R GL+  D  T
Sbjct  432   ELLNDTKRIQYMSGYLEALQAAMRDGANVKGYFVWSLLDNFEWLFGYKVRFGLFHVDLTT  491

Query  413   LKRT  402
             LKR+
Sbjct  492   LKRS  495



>ref|XP_004976200.1| PREDICTED: probable inactive beta-glucosidase 14-like isoform 
X1 [Setaria italica]
Length=533

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 169/258 (66%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ +QGG IGI +   W+ P  N+T D  A ER  SF   WFLDP++ G YP EM
Sbjct  252   IYRKKYQVKQGGHIGINVCSRWYEPFHNTTADILAVERVLSFNGPWFLDPLILGEYPLEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + ILGS+LPEF+S   +KL+A   DFIG+NHYTT Y +DC++S C  DP        E  
Sbjct  312   RKILGSNLPEFTSKQKKKLQATKLDFIGLNHYTTSYLKDCIFSPCELDP-----VEGEAQ  366

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V  S  ++G  IG+  G       P GMEK+V Y K++++N P+Y+TENGY   +  +  
Sbjct  367   VLTSAERDGIFIGKRTGSPIFYSVPYGMEKLVMYYKQRYNNTPIYITENGYAQASNSSMI  426

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
              ++  NDT RV +   YL  LA+AIRKGADVRGYF+WSL DNFEW  GYT+R GLY  D 
Sbjct  427   TKDFTNDTGRVDYLQGYLTFLASAIRKGADVRGYFVWSLLDNFEWNSGYTQRFGLYHVDF  486

Query  419   VTLKRTPKLSAKWYKQFI  366
              T KRTPKLSAKWY++F+
Sbjct  487   KTQKRTPKLSAKWYREFL  504



>ref|XP_009413740.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 175/260 (67%), Gaps = 5/260 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNYQ +QGG IGI +   W+ P+TNST D  A +RA SF   W LDPI+ G YP EM
Sbjct  217   IYRKNYQVKQGGSIGIVITSKWYEPLTNSTADCLATQRALSFEGPWILDPILLGDYPSEM  276

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP F+  + +KL     DFIGINHY+T Y  DC+ S+CD  + G  R+   + 
Sbjct  277   HEVLGSRLPIFTYEE-KKLLLNKLDFIGINHYSTNYVMDCMLSSCD--LDGYMRD-ALIA  332

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G LIGE   L      P G+EKMV Y+ E+++N+P+Y+TENGY   ++  +  +
Sbjct  333   TTGYKDGVLIGEPTALPTYYAVPYGIEKMVRYIMERYNNVPMYITENGYAQGSS-GAFTK  391

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++NDT+R+KF   YL  L+ AI +GADVRGYF WSL DNFEW FGYT R GL+  D  T
Sbjct  392   ELINDTERIKFMHSYLTFLSAAISQGADVRGYFSWSLLDNFEWAFGYTVRFGLFHVDYKT  451

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTPKLSAKWYK+F++  +
Sbjct  452   QRRTPKLSAKWYKKFLSGKK  471



>gb|EMS60351.1| Beta-glucosidase 16 [Triticum urartu]
Length=530

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 177/267 (66%), Gaps = 2/267 (1%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+KNYQ  QGG IGI +   W+ P+TN+T D  AA RA SF  +WFL+PI +G YP+EM 
Sbjct  262   YKKNYQATQGGSIGIVIAMKWYEPLTNTTEDILAARRALSFEVDWFLEPIFFGDYPREMH  321

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             ++L S+LP+F+S +   L+   +DFIG+NHYTT Y +DC+ S CD +          V  
Sbjct  322   ELLASNLPKFTSEEKSLLQKNKADFIGVNHYTTIYVKDCISSPCDLNTYEAYEGNALVLA  381

Query  770   SLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEE  591
             +  ++G  IG+        V P GME++V Y+ ++++N P+YVTENGY   +  N+ ++E
Sbjct  382   TGERDGVAIGKPTAFDGYYVVPEGMEQIVKYVNQRYTNTPVYVTENGYSQYS--NNTMDE  439

Query  590   VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTL  411
             ++ND +RV +   YL  L++AIRKGA+VRGYF+WS+ DNFEWTFG+T R GLY  D  T 
Sbjct  440   LMNDGERVNYLQGYLTFLSSAIRKGANVRGYFVWSIIDNFEWTFGFTVRFGLYHVDYETQ  499

Query  410   KRTPKLSAKWYKQFIAKNRKVESKMQL  330
             KRTPK+SAKWY+ F+  +R  +    L
Sbjct  500   KRTPKMSAKWYRDFLMGSRPTDQVQTL  526



>ref|XP_002448166.1| hypothetical protein SORBIDRAFT_06g022385 [Sorghum bicolor]
 gb|EES12494.1| hypothetical protein SORBIDRAFT_06g022385 [Sorghum bicolor]
Length=378

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 170/263 (65%), Gaps = 5/263 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNY+ +QGG IGI +   W+ P+ N T D  A  RA SF + WFLDP+ +G YP++M
Sbjct  109   IYRKNYKAKQGGSIGITLHMRWYEPLRNITEDHLAVSRALSFEAQWFLDPLFFGEYPQQM  168

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILG +LP+F+  + + LK    DFIG+NHY TYY +DC+YS CD  +         V 
Sbjct  169   HKILGPNLPKFTEGEKQLLKKQ-IDFIGVNHYETYYVKDCIYSQCDLDLYTCV---ALVS  224

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +S  +NG  IG+L       V P  MEK+V YL++++ +IPLY+TENGY      ++  E
Sbjct  225   ESSERNGMPIGKLTPANSYVV-PSSMEKLVMYLEQRYKSIPLYITENGYAQIGNSSTTTE  283

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND  R  +  DYL  L+ AIRKGADVRGYF+WSL D FEW  GYT + GL+  D  +
Sbjct  284   ELINDNGRSGYIGDYLTYLSFAIRKGADVRGYFVWSLMDTFEWNSGYTAKYGLFHVDFKS  343

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTP+LSAKWY +FI    ++E
Sbjct  344   LKRTPRLSAKWYSKFIKGYEQIE  366



>ref|XP_010920356.1| PREDICTED: beta-glucosidase 18-like [Elaeis guineensis]
Length=510

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+K YQ +QGG IG+ +   WF P+ +   D+ A +RA +F + WFLDP+++G YP EM
Sbjct  243   IYKKKYQVKQGGSIGLVISTNWFEPLRHIPADRLAVQRALAFDTAWFLDPVIFGEYPPEM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LG  LP FSS D  KL+    DFIGINHYT+ Y +DC++S C+    G+T    FV 
Sbjct  303   RQVLGLRLPTFSSEDRRKLQYK-LDFIGINHYTSKYVKDCMFSPCN---EGSTESTAFVI  358

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  IG    +    V+P GMEKMV Y  ++++NIP+++TENGY   +T NS   
Sbjct  359   STGERNGIPIGTPTSMPDNYVFPDGMEKMVMYAMQRYNNIPMFITENGYAQGSTGNSPTT  418

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV++   YL +L  A+R+GADVRGYFIWSL DNFEW FGY++R GLY  +  T
Sbjct  419   DTLNDRGRVEYLHGYLTSLTRAMRQGADVRGYFIWSLLDNFEWLFGYSQRFGLYHVNFKT  478

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
              +RTPKLSAKW K+F+   + +E
Sbjct  479   QERTPKLSAKWVKKFLGGPQVIE  501



>ref|XP_010245701.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=512

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 177/272 (65%), Gaps = 7/272 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+K YQ +QGG+IGI M  TW+ P+ ++  D  A +RA +F + WFLDPI YG YP EM
Sbjct  240   IYKKKYQVKQGGKIGIVMSSTWYEPLRDTLTDNLAVQRALAFDTAWFLDPIFYGEYPPEM  299

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  D +KL     DFIG+NHY+T Y +DC+ S C+ S +         G
Sbjct  300   RQILGSRLPMFSVEDKKKL-GNKLDFIGVNHYSTLYVKDCMLSQCESSTSFGEASVYITG  358

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +   K+G  IG+   +    V P GMEK++ Y K++++N P+++TENGY   + PN +  
Sbjct  359   E---KDGHPIGDPTAMPSFYVVPYGMEKILMYFKDRYNNTPMFITENGYAQASNPNVSKR  415

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND  R+++   YL +L  A+R GADVRGYF+WSL DNFEW +GYT R G+Y  D  T
Sbjct  416   DLLNDAGRIEYLKSYLTSLNLAMRHGADVRGYFVWSLIDNFEWLYGYTMRFGIYYVDYKT  475

Query  413   LKRTPKLSAKWYKQFIAK---NRKVESKMQLG  327
             L+RTPK SA WY+QF+A+   +RKV S    G
Sbjct  476   LERTPKHSAMWYRQFLAREKTHRKVLSSPVAG  507



>ref|XP_002448169.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
 gb|EES12497.1| hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
Length=510

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 173/264 (66%), Gaps = 6/264 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+KNY+ +QGG +GI +   W+ P+ N T D  A  RA SF + WFLDP+ +G YP +M
Sbjct  240   IYKKNYKTKQGGSVGITVYMRWYEPLRNITDDHLAVSRAQSFEAPWFLDPLFFGDYPHQM  299

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFV  777
             + ILG +LPEF+  + ++L     DFIG+NHY T Y +DC+YS CD  + AG    +  V
Sbjct  300   RQILGPNLPEFTEGE-KQLMKNQIDFIGVNHYKTLYVKDCVYSLCDLDTYAG----DALV  354

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              +S  +NG  IG+   +    V P  MEK+V YL +++ +IPLY+TENGY      ++  
Sbjct  355   SESAERNGIPIGKPTPVANNYVVPSSMEKLVMYLTQRYKSIPLYITENGYAQIGNSSTTT  414

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             EE++NDT+R  +  DYL  L+ AIRKGADVRGYF+WSL DNFEW  GYT + GLY  D  
Sbjct  415   EELINDTERSSYIRDYLTYLSFAIRKGADVRGYFVWSLMDNFEWLSGYTIKYGLYHVDFK  474

Query  416   TLKRTPKLSAKWYKQFIAKNRKVE  345
             +LKRTPKLSAKWY  FI    ++E
Sbjct  475   SLKRTPKLSAKWYSNFIKGYEQIE  498



>ref|XP_003581423.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X1 [Brachypodium 
distachyon]
Length=518

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ +QGG+IGI +   W+ P  N+TVD  A +RA SF + WFLDPI+ G YP EM
Sbjct  246   IYRNNYQGKQGGQIGITVSARWYEPFRNTTVDLLAVQRAISFNAPWFLDPIILGDYPPEM  305

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + +LG++LP F+S +  KL+A   DFIG+NHYTT Y +DC++S C  DP + G+ R    
Sbjct  306   RQMLGANLPNFTSKEKRKLQATKLDFIGLNHYTTVYLKDCIFSPCAVDP-IDGDAR----  360

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V     ++G LIGE  G  Y    P GMEK+V + K++++N P Y+TENGY   +  +  
Sbjct  361   VVSLAERDGVLIGEPTGTPYFYDVPHGMEKVVMHYKQRYNNTPTYITENGYAQASNHSMA  420

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
               + +ND  R+ +   YL  LA+AIRKGAD+RGYF+WSL D+FEWT GYT+R GLY  D 
Sbjct  421   ANDFINDAGRIHYIRGYLTFLASAIRKGADIRGYFVWSLLDDFEWTSGYTQRYGLYHVDF  480

Query  419   VTLKRTPKLSAKWYKQFI  366
              T KRTPKLSA WY++F+
Sbjct  481   KTQKRTPKLSAGWYRKFL  498



>ref|XP_009413739.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 175/260 (67%), Gaps = 5/260 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNYQ +QGG IGI +   W+ P+TNST D  A +RA SF   W LDPI+ G YP EM
Sbjct  242   IYRKNYQVKQGGSIGIVITSKWYEPLTNSTADCLATQRALSFEGPWILDPILLGDYPSEM  301

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              ++LGS LP F+  + +KL     DFIGINHY+T Y  DC+ S+CD  + G  R+   + 
Sbjct  302   HEVLGSRLPIFTYEE-KKLLLNKLDFIGINHYSTNYVMDCMLSSCD--LDGYMRD-ALIA  357

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G LIGE   L      P G+EKMV Y+ E+++N+P+Y+TENGY   ++  +  +
Sbjct  358   TTGYKDGVLIGEPTALPTYYAVPYGIEKMVRYIMERYNNVPMYITENGYAQGSS-GAFTK  416

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++NDT+R+KF   YL  L+ AI +GADVRGYF WSL DNFEW FGYT R GL+  D  T
Sbjct  417   ELINDTERIKFMHSYLTFLSAAISQGADVRGYFSWSLLDNFEWAFGYTVRFGLFHVDYKT  476

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTPKLSAKWYK+F++  +
Sbjct  477   QRRTPKLSAKWYKKFLSGKK  496



>ref|XP_009794052.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=521

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 173/256 (68%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG IGI++   W+ P +NS+ D AA +RA SF  NWFLDPI+ G YPKEM
Sbjct  256   IYRTRYQKRQGGMIGISLDIQWYEPYSNSSEDIAATQRARSFYVNWFLDPIILGRYPKEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    G T  EG   
Sbjct  316   VQILGSNLPDFSVNDLSKLSYG-LDFIGINYYTAKYIKDCLYSACE---HGKTWSEGSYF  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I 
Sbjct  372   VTTEKDGVYIGQPTEVDWLFLYPQGMKKIVMYMKDRFNNTPMVITENGIAENENLNPSIT  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YL++LA AIR+GADVRGYF+WSL DNFEW  GY  R GL+  +   
Sbjct  432   DTLNDVHRVNYMHSYLDSLANAIREGADVRGYFVWSLLDNFEWLDGYRLRFGLHYVNFTN  491

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPKLSA  YK+ +
Sbjct  492   LERTPKLSATRYKELM  507



>ref|XP_002448173.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
 gb|EES12501.1| hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
Length=515

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 175/270 (65%), Gaps = 3/270 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +QGG IGI +L  W+ P  N   D  A +R  SF + WFLDPI+ G YP  M
Sbjct  243   IYKEKYQGKQGGYIGITVLSRWYEPFRNIPTDILAVDRGLSFGAPWFLDPIILGDYPSPM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LG +LPEF+S   + L+    DFIG+NHY+T Y +DC+YS+  P        +  + 
Sbjct  303   RKMLGPNLPEFTSKQKKILQPSKLDFIGLNHYSTSYLKDCIYSS--PCELDPFDGDAQIS  360

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S+ ++G LIGE  G  Y+ V P GMEK+V Y K +++N P+Y+TENGY   +  N + +
Sbjct  361   TSIDRDGILIGERTGSPYLNVVPYGMEKVVMYFKRRYNNTPMYITENGYAQASNSNMSAK  420

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +  NDT RV +   YL  LA+AIRKGADVRGYF+WSL DNFEW  GYT+R GLY  D  T
Sbjct  421   DFTNDTGRVDYLQGYLTFLASAIRKGADVRGYFVWSLLDNFEWNSGYTQRFGLYHVDFKT  480

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGN  324
              KRTPKLSAKWY +F+ K   + ++ Q GN
Sbjct  481   QKRTPKLSAKWYSEFL-KGSPLRTRPQNGN  509



>gb|EMS59801.1| putative inactive beta-glucosidase 14 [Triticum urartu]
Length=552

 Score =   266 bits (680),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 181/274 (66%), Gaps = 8/274 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ++QGG IGIA+   W+ P+ N+T+D+ A ERA SF   WFLDPI+ G YP EM
Sbjct  279   IYRNNYQERQGGYIGIAVSARWYEPLRNTTIDQLAVERAISFNVPWFLDPIILGDYPAEM  338

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + ILG  LPEF+    +KL A   DFIG+NHY+T+YA+DC++S C  DP M G+ R    
Sbjct  339   RKILGPTLPEFTLKQKKKLHATKLDFIGLNHYSTWYAKDCIFSPCEMDP-MDGDAR----  393

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
             V   + ++G  IG+  G  +    P GMEK V Y K++++N P Y+TENGY   +  +  
Sbjct  394   VLSLVERDGVPIGKETGAPFFYDVPHGMEKAVMYYKQRYNNTPTYITENGYAQASNSSMT  453

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
              ++   DT+R+ + + YL  L +AIRKGADVRGYF+WS+ D+FEWT GY  R GLY  D 
Sbjct  454   AKDFTGDTERIDYISGYLTYLVSAIRKGADVRGYFVWSILDDFEWTSGYKDRFGLYHVDF  513

Query  419   VTLKRTPKLSAKWYKQFIAKNRKVESKMQLGNMI  318
              T KRTPKLSA+W+++F+ K   V  + Q G+ +
Sbjct  514   KTQKRTPKLSAEWFREFL-KGSLVSREFQNGSQL  546



>gb|EMT31288.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=555

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 174/268 (65%), Gaps = 4/268 (1%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+KNYQ  QGG IGI +   W+ P+TN+T D  AA RA SF  +WFL+PI +G YP+EM 
Sbjct  287   YKKNYQATQGGSIGIVIAMKWYEPLTNTTEDILAARRALSFEVDWFLEPIFFGDYPREMH  346

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
              +L S+LP+F+S +   L+   +DFIGINHYTT Y +DC+ S CD            V  
Sbjct  347   KLLSSNLPKFTSEEKSLLQKNKADFIGINHYTTIYVKDCISSPCDLKAYEAYEANALVLA  406

Query  770   SLSKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +  ++G  IG      GY  V P GME++V Y+ +++ N PLYVTENGY   +  N  ++
Sbjct  407   TGERDGVAIGRPTAFDGYYDV-PEGMEQIVKYVNQRYKNTPLYVTENGYSQHS--NDTMD  463

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++ND +RV +   YL  L++A+RKGA+VRGYF+WS+ DNFEWTFG+T R GLY  D  T
Sbjct  464   KLINDVERVNYLHGYLTCLSSAVRKGANVRGYFVWSIIDNFEWTFGFTVRFGLYHVDYGT  523

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQL  330
              KRTPK+SAKWY+ F+  +R  +    L
Sbjct  524   QKRTPKMSAKWYRDFLMGSRPTDQVQML  551



>ref|XP_006464712.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Citrus sinensis]
Length=418

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 172/259 (66%), Gaps = 3/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q++QGG +GI +    + P+ +   D+ A  RA +F   W LDP+++G YP EM
Sbjct  153   LYRKHFQEKQGGSMGIVLHSMMYEPLRDEDSDRQAVSRALAFNVGWMLDPLVFGDYPAEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ LGS LP FS  + + +K G  DFIGINHY+T YA+DC++S C   +  N    GFV 
Sbjct  213   REYLGSQLPRFSKEETKYVK-GSLDFIGINHYSTLYAKDCIHSVC--VLGSNHAIRGFVY  269

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G +IGE  G     V P GMEK+V Y+K+ + NIP+YVTENGY      N   +
Sbjct  270   TTGERDGIMIGEPTGNPRFFVVPEGMEKIVDYVKDTYKNIPMYVTENGYSPPKQKNQRSQ  329

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +++D KR+++ + YL+ALA AIR GADVRGYFIWSL DNFEW  GY+   GLY  DR T
Sbjct  330   NLVDDVKRIEYHSGYLSALARAIRNGADVRGYFIWSLMDNFEWLDGYSVVFGLYYIDRQT  389

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSA W+K F+  N
Sbjct  390   LERTPKLSATWFKNFLTDN  408



>ref|XP_006451937.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
 gb|ESR65177.1| hypothetical protein CICLE_v10007996mg [Citrus clementina]
Length=523

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 174/259 (67%), Gaps = 3/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q++QGG +GI +    + P+ +   D+ A  RA +F   W LDP+++G YP EM
Sbjct  258   LYRKHFQEKQGGSMGIVLHSMMYEPLRDEDSDRQAVSRALAFNVGWMLDPLVFGDYPAEM  317

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ LGS LP FS  + + +K G  DFIGINHY+T YA+DC++S C   +  N    GFV 
Sbjct  318   REYLGSQLPRFSKEETKYVK-GSLDFIGINHYSTLYAKDCIHSVC--VLGSNHAIRGFVY  374

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G +IGE  G     V P GMEK+V Y+K+++ NIP+YVTENGY      N   +
Sbjct  375   TTGERDGIMIGEPTGNPRFFVVPEGMEKIVDYVKDRYKNIPMYVTENGYSPPKQKNQRSQ  434

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++++D KR+++ + YL+ALA AIR GADVRGYFIWSL DNFEW  GY+   GLY  DR T
Sbjct  435   DLVDDVKRIEYHSGYLSALARAIRNGADVRGYFIWSLMDNFEWLDGYSVMFGLYYIDRQT  494

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSA W+K F+  N
Sbjct  495   LERTPKLSATWFKNFLTDN  513



>gb|EMT09723.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=508

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 179/274 (65%), Gaps = 8/274 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR NYQ+ QGG IGIA+   W+ P+ N+TVD+ A ERA SF   WFLDPI+ G YP EM
Sbjct  235   IYRNNYQETQGGYIGIAVAARWYEPLRNTTVDQLAVERAISFNVPWFLDPIILGDYPAEM  294

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC--DPSMAGNTREEGF  780
             + ILG  LPEF+    +KL A   DFIG+NHY+T+Y +DC++S+C  DP M G+ R    
Sbjct  295   RKILGPTLPEFTLKQKKKLHATKLDFIGLNHYSTWYLKDCIFSSCEMDP-MDGDARALSL  353

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSN  600
                   ++G  IG+  G  +    P GMEK+V Y K++++N P Y+TENGY   +  +  
Sbjct  354   A----ERDGVPIGKQTGAPFFYDVPHGMEKVVMYYKQRYNNTPTYITENGYAQASNSSMT  409

Query  599   IEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDR  420
              ++   DT+R+ + + YL  L +A+RKGADVRGYF+WS+ D+FEWT GY  R GLY  D 
Sbjct  410   AKDFTGDTERIDYISGYLTYLVSAMRKGADVRGYFVWSILDDFEWTSGYKDRFGLYHVDF  469

Query  419   VTLKRTPKLSAKWYKQFIAKNRKVESKMQLGNMI  318
              T KRTPKLSA+W+++F+ K   V  + Q G+ +
Sbjct  470   KTQKRTPKLSAEWFREFL-KGSLVSREFQNGSQL  502



>ref|XP_008801279.1| PREDICTED: beta-glucosidase 18-like, partial [Phoenix dactylifera]
Length=265

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 167/255 (65%), Gaps = 4/255 (2%)
 Frame = -2

Query  1109  QQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHL  930
             +QGG IGI +  +WF P+ +   D+ A +RA +F + WFLDPI++G YP EM+ ILG  L
Sbjct  2     KQGGSIGIVISSSWFEPLRDIPADRLAVQRALAFETAWFLDPIVFGEYPPEMRQILGLRL  61

Query  929   PEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQSLSKNGK  750
             P FSS D  KL+    DFIGINHYT++YA+DC++S C+    G+T    FV  +  +NG 
Sbjct  62    PTFSSEDRRKLQYK-LDFIGINHYTSHYAKDCMFSPCEEGSTGST---AFVISTSERNGI  117

Query  749   LIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEEVLNDTKR  570
              IG    +    V P GMEK+V Y  ++++NI + VTENG    +T N     +LND  R
Sbjct  118   PIGTPTSMPSNYVVPEGMEKIVMYTMQRYNNITMVVTENGCAQGSTRNDPTTNMLNDKDR  177

Query  569   VKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTLKRTPKLS  390
             V+F   YL AL  A+R+GADVRGYFIWSL DNFEW +GYT+R GLY  +  T +RTPKLS
Sbjct  178   VEFLHSYLTALTRAMRQGADVRGYFIWSLLDNFEWLYGYTQRFGLYHVNFETQERTPKLS  237

Query  389   AKWYKQFIAKNRKVE  345
             AKW+K+F+     +E
Sbjct  238   AKWFKEFLEGPEVIE  252



>ref|XP_010023758.1| PREDICTED: beta-glucosidase 18-like [Eucalyptus grandis]
 gb|KCW60129.1| hypothetical protein EUGRSUZ_H02855 [Eucalyptus grandis]
Length=518

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 175/259 (68%), Gaps = 9/259 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNYQ++QGG IGI +   W+ P +++  D+ A +RA +F   WF+DP +YG YP EM
Sbjct  253   IYRKNYQEKQGGMIGIVISAAWYEPYSDTPADRLAVQRALAFDFAWFVDPFVYGDYPPEM  312

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC-DPSMAGNTREEGFV  777
             + I+GS LP FS+ +  +L A   DFIGINHYTT YA+DC++STC  P   G    E FV
Sbjct  313   RQIVGSRLPTFSAEERNRLDAK-LDFIGINHYTTKYAKDCMFSTCTSPYSLG----EAFV  367

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  K+G  IGE   +    + P G+E +VTY+KE+++N P+++TENGY     P   I
Sbjct  368   YVTGEKDGVYIGERTAMSDFFIVPRGIEGIVTYVKERYNNTPMFITENGYAQFAGP---I  424

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             ++ LNDTKR+++   YL  L+  +RKGADVRGYFIWSL DNFEW  GY  R GL+  D  
Sbjct  425   DDSLNDTKRIEYHEGYLAVLSEVVRKGADVRGYFIWSLLDNFEWLHGYLVRFGLHYVDFQ  484

Query  416   TLKRTPKLSAKWYKQFIAK  360
             TLKRTPK SA WYK+F+++
Sbjct  485   TLKRTPKWSATWYKEFLSE  503



>ref|XP_009624454.1| PREDICTED: beta-glucosidase 18 [Nicotiana tomentosiformis]
Length=521

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 4/253 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ++QGG +GI++   W+ P +NS+ D AA +RA SF  NWFLDPI+ G YPKEM
Sbjct  256   IYRTRYQKRQGGMVGISLDIQWYEPYSNSSEDIAATQRARSFYVNWFLDPIILGRYPKEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS+LP+FS  DL KL  G  DFIGIN+YT  Y +DCLYS C+    GNT  EG   
Sbjct  316   VQILGSNLPDFSVNDLRKLSYG-LDFIGINYYTAKYIKDCLYSACE---HGNTWSEGSYF  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+   + ++ +YP GM+K+V Y+K++F+N P+ +TENG  +    N +I 
Sbjct  372   VTTQKDGVDIGQPTEVDWLFLYPQGMKKIVIYMKDRFNNTPMVITENGIAENENLNPSIT  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + LND  RV +   YL +LA AIR+GADVRGYF+WSL DNFEW  GY+ R GL+  +   
Sbjct  432   DTLNDVHRVNYMHSYLTSLANAIREGADVRGYFVWSLLDNFEWLDGYSLRFGLHYVNFTN  491

Query  413   LKRTPKLSAKWYK  375
             L+R PKLSA  YK
Sbjct  492   LQRIPKLSATSYK  504



>gb|KDP39384.1| hypothetical protein JCGZ_01141 [Jatropha curcas]
Length=488

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 174/256 (68%), Gaps = 5/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ++QGG+IGI +   WF P+ +  VD  A +RA +F + WF+DPIMYG YP EM
Sbjct  226   IYKNKYQEKQGGQIGIVLHVYWFEPLRDIPVDFFATQRALAFYAAWFMDPIMYGEYPPEM  285

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + I+G  LP+FS  D +KL++   DFIGINHY+T YA+DCL S+C+  +  +   + F  
Sbjct  286   QQIVGLRLPKFSVEDRKKLESK-LDFIGINHYSTLYAKDCLVSSCN--ITTDIIADSFAY  342

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G LIG+   +    V P  MEK + Y K +++N P+++TENGY   ++    IE
Sbjct  343   ITGERDGVLIGQPTAMPTFYVVPNSMEKTIMYFKNRYNNTPMFITENGYAQPSS--KAIE  400

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LNDT R+++   YL +LA A+RKGADVRGYF WSL DNFEW +GYT   GLY  DR T
Sbjct  401   DMLNDTSRIEYMQSYLTSLAAALRKGADVRGYFHWSLIDNFEWRYGYTICFGLYYVDRTT  460

Query  413   LKRTPKLSAKWYKQFI  366
             L+RTPK SAKW+ QF+
Sbjct  461   LQRTPKQSAKWFHQFL  476



>ref|XP_008669175.1| PREDICTED: probable inactive beta-glucosidase 14 [Zea mays]
Length=517

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 170/263 (65%), Gaps = 4/263 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNY+ +QGG +GI++   W+ P+ N T D  A  RA SF + W LDP+ +G YP +M
Sbjct  247   IYRKNYKSKQGGFVGISLHLRWYEPLRNITEDHLAVSRALSFDAPWILDPLFFGDYPHQM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG +LP+F+  + +KL     DFIG+NHY T+Y +DC+YS CD         E  V 
Sbjct  307   RQILGPNLPKFTEGE-KKLLKNQIDFIGVNHYQTFYVKDCIYSLCD---MDAYPSEALVS  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S  +NG  IG+   +    V P  MEK+V YLK+++ +IPLY+TENGY      ++  E
Sbjct  363   ISTERNGIPIGKPTPVANTYVVPSSMEKLVMYLKQRYKSIPLYITENGYAQIANISTTAE  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +R  +  DYL  L+ AIRKGADVRGYF+WSL DNFEW  GYT + GL   +  +
Sbjct  423   EIINDIERSTYIRDYLTYLSFAIRKGADVRGYFVWSLMDNFEWISGYTVKYGLCHVNFKS  482

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
             LKRTPKLSAKWY +FI    ++E
Sbjct  483   LKRTPKLSAKWYSKFIKGYEQIE  505



>ref|XP_006464710.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Citrus sinensis]
Length=523

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 172/259 (66%), Gaps = 3/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q++QGG +GI +    + P+ +   D+ A  RA +F   W LDP+++G YP EM
Sbjct  258   LYRKHFQEKQGGSMGIVLHSMMYEPLRDEDSDRQAVSRALAFNVGWMLDPLVFGDYPAEM  317

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ LGS LP FS  + + +K G  DFIGINHY+T YA+DC++S C   +  N    GFV 
Sbjct  318   REYLGSQLPRFSKEETKYVK-GSLDFIGINHYSTLYAKDCIHSVC--VLGSNHAIRGFVY  374

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G +IGE  G     V P GMEK+V Y+K+ + NIP+YVTENGY      N   +
Sbjct  375   TTGERDGIMIGEPTGNPRFFVVPEGMEKIVDYVKDTYKNIPMYVTENGYSPPKQKNQRSQ  434

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +++D KR+++ + YL+ALA AIR GADVRGYFIWSL DNFEW  GY+   GLY  DR T
Sbjct  435   NLVDDVKRIEYHSGYLSALARAIRNGADVRGYFIWSLMDNFEWLDGYSVVFGLYYIDRQT  494

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSA W+K F+  N
Sbjct  495   LERTPKLSATWFKNFLTDN  513



>ref|XP_009397666.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 183/265 (69%), Gaps = 4/265 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +Y+  YQ +QGG IGI M  TWF P+ +   D+AAA RA SF   WFLDPI+YG YP  M
Sbjct  241   VYKTKYQAKQGGSIGIVMATTWFEPLRDVPADRAAARRAQSFYVPWFLDPIIYGDYPPAM  300

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS++D +KL+   SDFIG+NHYT+ YA+DC++S C+    G +  +  V 
Sbjct  301   RQILGSRLPRFSTSDKKKLQHK-SDFIGVNHYTSSYAKDCMFSPCE---GGGSEGDASVL  356

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  IG+   +    V P GMEK+V Y+K+++ NIP+++TENGY   +  N++++
Sbjct  357   TTGERNGLAIGKPTAMPNFYVVPRGMEKIVMYIKKRYKNIPMFITENGYPQGSDHNTSVK  416

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND  RV++   YL++L  A+R+GADVRGYF+WSL DNFEW +GYT R GLY  +  T
Sbjct  417   DLLNDKDRVEYLRSYLSSLHKAMRQGADVRGYFVWSLIDNFEWLYGYTLRFGLYHVNYET  476

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
              +RTPKLSA WY++F+  ++ +  K
Sbjct  477   QERTPKLSATWYQEFLEDSQVLIQK  501



>ref|XP_010473401.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 45 [Camelina 
sativa]
Length=552

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 173/254 (68%), Gaps = 3/254 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ +Q G IGI +  + F P+++S  DK AAERA SF SNW LDP++YG YPKEM
Sbjct  254   IYKTKYQNEQKGSIGIVVQTSXFEPISDSIADKEAAERAQSFYSNWILDPVIYGKYPKEM  313

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
              +ILG+ LP+FSS +++ L     DFIGINHYT+Y+ QDCL S+C+    G  + EGF  
Sbjct  314   VNILGTALPQFSSNEVKNLNNSRVDFIGINHYTSYFIQDCLTSSCNAGY-GAFKAEGFAL  372

Query  773   QSLSKNGKL-IGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             + L + G + IGEL  + +  + P G  KM+ YL +++ NIP+++TENG+ D   P +  
Sbjct  373   K-LDRIGNVSIGELTDVDWQHIDPEGFHKMLNYLTDRYPNIPMFITENGFGDLQKPETTY  431

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +E+L+DTKR+++ + YL AL  A+R GA+V+GYF+WSL DNFEW  GY  R GL+  D  
Sbjct  432   KELLHDTKRIQYISGYLEALQAAMRDGANVKGYFVWSLLDNFEWLDGYKLRFGLFHVDYT  491

Query  416   TLKRTPKLSAKWYK  375
             TLKRTPK SA   K
Sbjct  492   TLKRTPKESASXSK  505



>ref|XP_006653596.1| PREDICTED: beta-glucosidase 16-like, partial [Oryza brachyantha]
Length=503

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 170/260 (65%), Gaps = 5/260 (2%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+ NYQ +QG  IGI +   W+ P+TNST D  AA RA SF   WFLDPI +G YP+EM+
Sbjct  234   YKTNYQAKQGSSIGIVIAMKWYDPLTNSTEDVRAARRALSFEVEWFLDPIFFGDYPREMR  293

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREE-GFVG  774
             +IL  +LPEF++ + + L     DF+GINHYT+ YA+DC+YS C      NT E    V 
Sbjct  294   EILSLNLPEFTAEEKKLLWTNKVDFVGINHYTSIYAKDCIYSPCKL----NTYESNALVY  349

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 +NG  IG+        V P G+E  V Y+ +++ +  +Y+TENGY      ++N+E
Sbjct  350   APSERNGVKIGKPTAFDVFFVVPQGIESAVMYVTDRYKDTIIYITENGYSQRIHNDTNME  409

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +RV +  DYL  L++AIRKGA+V GYF+WSL DNFEWTFGYT + GLY  D  T
Sbjct  410   ELINDVERVSYLHDYLKYLSSAIRKGANVGGYFVWSLMDNFEWTFGYTVKFGLYHVDFDT  469

Query  413   LKRTPKLSAKWYKQFIAKNR  354
              +RTPK+SAKWYK F+  +R
Sbjct  470   QERTPKMSAKWYKDFLMGSR  489



>ref|XP_006652510.1| PREDICTED: beta-glucosidase 16-like [Oryza brachyantha]
Length=518

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 176/264 (67%), Gaps = 8/264 (3%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+ NYQ +QGG IGI +   W+ P+TN+T D  AA RA SF  +WFLDPI +G YP++M+
Sbjct  250   YKANYQAKQGGSIGIVIAMKWYEPLTNTTEDVRAARRAQSFEVDWFLDPIFFGDYPRDMR  309

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVG  774
             +I+ S+LP+F+  + + L+    DFIGINHYT+ YA+DC+YS C   +  GN      V 
Sbjct  310   EIISSNLPKFTPQEKKLLQMNKVDFIGINHYTSIYAKDCIYSPCKLDTYEGN----ALVY  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NGK IG         V P G+E  V Y+ +++ N  +Y+TENGY   +  ++NI+
Sbjct  366   TTARRNGKQIGGSTAFDTYFVVPKGIESAVMYVHDRYKNTAIYITENGYSQHS--DTNIK  423

Query  593   E-VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E ++ND +RV +  DYL+ L++AIRKGADVRGYF+WS+ DNFEWTFGYT + GLY  D  
Sbjct  424   ELIINDVERVNYLHDYLSYLSSAIRKGADVRGYFVWSIVDNFEWTFGYTVKFGLYHVDFD  483

Query  416   TLKRTPKLSAKWYKQFIAKNRKVE  345
             T +R P++SA WYK F+   R+ +
Sbjct  484   TQERIPRMSATWYKDFLTGCRQAD  507



>ref|XP_010644219.1| PREDICTED: beta-glucosidase 18 isoform X1 [Vitis vinifera]
 emb|CBI20346.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 171/259 (66%), Gaps = 3/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  YQ +QGG IGI        P+ +  +D+ AA+RA +F   W LDP+++G YP EM
Sbjct  250   IYRHKYQLKQGGFIGIIANTLMCEPLRDIELDREAAKRALAFYIAWMLDPLVFGDYPPEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +   G+ LP F+S +  KL     DFIGINHYTT YA+DC++STC  S  G+   +GFV 
Sbjct  310   RQYHGNELPRFTSEET-KLLTQSLDFIGINHYTTLYAKDCIHSTC--SSDGDRAIQGFVY  366

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE  G+    + P GMEK++ Y+KE+++N+P++VTENGY      +   E
Sbjct  367   LTGERHGVPIGERTGMRRFFIVPRGMEKIIEYVKERYNNMPMFVTENGYSPPEKEDEQEE  426

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++ D KR++F   YL ALA AIR GADVRGYFIWSL DNFEW +GY  R GLY  DR T
Sbjct  427   DLVQDAKRIEFHKAYLAALARAIRNGADVRGYFIWSLMDNFEWVYGYNTRFGLYYVDRQT  486

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSA+WY  F+  +
Sbjct  487   LRRTPKLSARWYANFLTNS  505



>ref|XP_009794795.1| PREDICTED: beta-glucosidase 46-like, partial [Nicotiana sylvestris]
Length=239

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 162/232 (70%), Gaps = 7/232 (3%)
 Frame = -2

Query  1061  PMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGS  882
             P++NS+ D AA  RA SF  +WFLDPI+ G YPKEM  ILGS+LPE S  DL KL + G 
Sbjct  1     PLSNSSEDIAATHRARSFYDSWFLDPIILGRYPKEMVQILGSNLPELSMNDLSKL-SYGL  59

Query  881   DFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQSLSKNGKLIGELAGLGYIAVYPP  702
             DFIGINHY+  Y +DCLYS C+    GN+  EG   ++  ++G  IGE   + +  VYP 
Sbjct  60    DFIGINHYSAVYIKDCLYSACE---HGNSWSEGSYFRTTQRDGIYIGEPGEVDWQFVYPQ  116

Query  701   GMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEEVLNDTKRVKFFADYLNALATAIR  522
             G+EK+V YLK+KF+N P+++TENG+   +   S+IE+ LND +RVK+    LN+LA AIR
Sbjct  117   GIEKVVMYLKDKFNNTPMFITENGFAGNS---SSIEDALNDVRRVKYLHSNLNSLANAIR  173

Query  521   KGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFI  366
             KGADVRGYF+WSL DNFEW  GY+ R GLY  +   L+RTPKLSA  Y++ +
Sbjct  174   KGADVRGYFVWSLLDNFEWLDGYSIRFGLYYVNYTNLQRTPKLSATKYQELM  225



>gb|EMS46231.1| Beta-glucosidase 16 [Triticum urartu]
Length=509

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 180/269 (67%), Gaps = 10/269 (4%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y++NYQ  QGG IGI +   W+ P+TNST D  AA RA SF  +WFLDPI +G YP+EM+
Sbjct  245   YKRNYQATQGGSIGIVIAMKWYEPLTNSTKDILAARRALSFEVDWFLDPIFFGDYPREMR  304

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVG  774
             ++L S+LP+F+S + ++L    +DFIG+NHYT  YA+DC+ S CD  +  GN   +  VG
Sbjct  305   EMLSSNLPKFTSEE-KRLLQSKADFIGVNHYTAIYAKDCISSPCDIKTYEGNAMVQA-VG  362

Query  773   QSLSKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             +   ++G  IG      GY  V P GME +V Y+ +++ N P+Y+TENGY   +  ++++
Sbjct  363   E---RDGVAIGRPTAFHGYYDV-PEGMELIVKYVNQRYENTPVYITENGYSQLS--DNSM  416

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             EE++ND  RV +   YL  +++A+RKGA+V GYF+WSL DNFEW FG+T R G+Y  D  
Sbjct  417   EELINDVGRVNYLQGYLTCISSAVRKGANVHGYFVWSLMDNFEWGFGFTVRFGIYHVDFE  476

Query  416   TLKRTPKLSAKWYKQFIAKNRKVESKMQL  330
             T +RTPK+S KWY+ F+  +R V+    L
Sbjct  477   TQERTPKMSGKWYRDFLTGSRPVDQAQTL  505



>gb|AID16401.1| monolignol beta-glucosidase, partial [synthetic construct]
Length=498

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 173/256 (68%), Gaps = 7/256 (3%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+ NYQ +QGG IGI +   W+ P+TNST D  AA RA +F  +WFLDPI +G YP+EM+
Sbjct  231   YKTNYQAKQGGSIGIVIAVKWYEPLTNSTEDVRAARRALAFEVDWFLDPIFFGDYPREMR  290

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVG  774
             +IL S+LP+F+  + + L+    DFIGINHYT  YA+DC+YS C   +  GN      V 
Sbjct  291   EILSSNLPKFTPEEKKLLQNNKVDFIGINHYTAIYAKDCIYSPCTLDTYEGN----ALVY  346

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 +NGK+IG+   L    V P  MEK+V Y+ +++ N  +Y+TENGY   +  ++++E
Sbjct  347   AIGRRNGKIIGKPTALHGYFVVPEAMEKVVMYVNDRYRNTTIYITENGYSQHS--DTSME  404

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++ND +RV +  DYL  L++AIRKGA+V GYF WS+ DNFEW +GYT + GLYQ D  T
Sbjct  405   DLINDVERVNYMHDYLKYLSSAIRKGANVGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDT  464

Query  413   LKRTPKLSAKWYKQFI  366
              +R P++SAKWY+ F+
Sbjct  465   QERIPRMSAKWYRDFL  480



>gb|ABC55715.1| beta-mannosidase 4 [Oncidium hybrid cultivar]
Length=498

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ +QGG IGI    TWF P  ++ +D  AA RA +F   WFLDPI+YGSYP +M
Sbjct  240   IYRKKYQIRQGGWIGIVASTTWFEPYEDTPMDAMAAARALAFEVGWFLDPIIYGSYPPDM  299

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               +LGS LP FS +D  KL++   DFIG+NHY++ Y +DCL+S+C     G     G V 
Sbjct  300   IQLLGSVLPTFSGSDKRKLRSS-LDFIGVNHYSSLYPKDCLFSSC---YLGPFVSNGSVL  355

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 KNG  IG   G+  + V P G EK+V Y+KE++ N P+++TENGY   ++ N   +
Sbjct  356   GLGYKNGVPIGPKTGMPNLFVTPNGTEKIVLYVKERYKNKPMFLTENGYGQNSSDNLLTK  415

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++LND  RV+F   YL +L+ AIRKGADVRGYFIWSL DNFEW  GY++R GLY  D +T
Sbjct  416   DILNDEVRVEFLKSYLTSLSNAIRKGADVRGYFIWSLLDNFEWVHGYSERFGLYYVDYLT  475

Query  413   LKRTPKLSAKWYKQFIAKNRKVE  345
              KRTPK SAKWYK+F+ + +  E
Sbjct  476   QKRTPKQSAKWYKKFLIEKKSNE  498



>sp|Q7XSK2.2|BGL16_ORYSJ RecName: Full=Beta-glucosidase 16; Short=Os4bglu16; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54544.1| OSJNBa0004N05.24 [Oryza sativa Japonica Group]
 emb|CAE01908.2| OSJNBb0070J16.1 [Oryza sativa Japonica Group]
 gb|EEC77634.1| hypothetical protein OsI_16626 [Oryza sativa Indica Group]
Length=516

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 173/256 (68%), Gaps = 7/256 (3%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+ NYQ +QGG IGI +   W+ P+TNST D  AA RA +F  +WFLDPI +G YP+EM+
Sbjct  249   YKTNYQAKQGGSIGIVIAVKWYEPLTNSTEDVRAARRALAFEVDWFLDPIFFGDYPREMR  308

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVG  774
             +IL S+LP+F+  + + L+    DFIGINHYT  YA+DC+YS C   +  GN      V 
Sbjct  309   EILSSNLPKFTPEEKKLLQNNKVDFIGINHYTAIYAKDCIYSPCTLDTYEGN----ALVY  364

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 +NGK+IG+   L    V P  MEK+V Y+ +++ N  +Y+TENGY   +  ++++E
Sbjct  365   AIGRRNGKIIGKPTALHGYFVVPEAMEKVVMYVNDRYRNTTIYITENGYSQHS--DTSME  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++ND +RV +  DYL  L++AIRKGA+V GYF WS+ DNFEW +GYT + GLYQ D  T
Sbjct  423   DLINDVERVNYMHDYLKYLSSAIRKGANVGGYFAWSIVDNFEWVYGYTVKFGLYQVDFDT  482

Query  413   LKRTPKLSAKWYKQFI  366
              +R P++SAKWY+ F+
Sbjct  483   QERIPRMSAKWYRDFL  498



>ref|XP_004976206.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Setaria italica]
Length=414

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 169/257 (66%), Gaps = 4/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IGI M  TW+ P+T++  D+ AAERA +F   WF+DPI+YG YP EM
Sbjct  153   IYKRKYQSKQKGLIGIVMYTTWYEPLTDTPEDRLAAERALAFSVPWFVDPIVYGDYPPEM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LGS LP FS  +  KL     DFIGINHYTT YA+DC++S+  P   G   +     
Sbjct  213   RQVLGSRLPTFSPEERRKL-GYKLDFIGINHYTTLYARDCMFSSGCP--LGQGTQHALAA  269

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDT-TTPNSNI  597
              +  +NG  IG   G     V P G+EKMVTY+  +++N+P++VTENGY D     + + 
Sbjct  270   VTGERNGVPIGPPTGRPMFYVVPDGIEKMVTYIMRRYNNLPMFVTENGYPDGGEAGHDHA  329

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +++L+D  R+++   YL  +A AIR GADVRGYF+WSL DNFEW +GYT R GLY  D  
Sbjct  330   KDLLHDQGRIQYLDGYLTKVAKAIRDGADVRGYFVWSLMDNFEWLYGYTLRYGLYYVDYQ  389

Query  416   TLKRTPKLSAKWYKQFI  366
             TL+R PK SA WYK+F+
Sbjct  390   TLERKPKSSALWYKRFL  406



>gb|ACJ83780.1| unknown [Medicago truncatula]
Length=241

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 156/227 (69%), Gaps = 3/227 (1%)
 Frame = -2

Query  1001  NWFLDPIMYGSYPKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYST  822
             NW LDPI +G YPKEM+ ILGS LP+FSS D  KL  G  DFIGINHY  YY +DC+ S 
Sbjct  2     NWILDPIFFGKYPKEMEVILGSTLPKFSSNDKAKLNRG-LDFIGINHYAGYYVKDCISSV  60

Query  821   CDPSMAGNTREEGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYV  642
             C+ S  G +  EG   Q+  K+G  IGEL    ++ VYP GM+K +TY+K++++N P+++
Sbjct  61    CE-SGPGTSATEGLYQQTAQKDGVPIGELTPFDFLNVYPQGMKKTLTYVKDRYNNTPMFI  119

Query  641   TENGYCDTTTPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWT  462
             TENGY +   PN+  EE LND KR+ + + +LN L  +IR+GADVRGYF WSL DNFEW 
Sbjct  120   TENGYGNFYDPNNTKEEYLNDIKRINYMSGHLNNLGESIREGADVRGYFAWSLLDNFEWL  179

Query  461   FGYTKRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNRKVESKMQLGNM  321
             +G+T R GLY  D  T KRTPKLSA WYK FI K+ K ES +   +M
Sbjct  180   YGFTVRFGLYHVDFATQKRTPKLSASWYKHFIEKH-KTESIIPEHDM  225



>gb|AFO12647.1| beta-glucosidase, partial [Cucumis sativus]
Length=337

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 175/277 (63%), Gaps = 8/277 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q++QGG IGI      + P+T+   D  AA+RA  F+  W  DPI+YG YPKEM
Sbjct  60    LYRTHFQKKQGGSIGIVAYCHMYEPLTDHEYDIKAAQRALIFIFAWVYDPIVYGDYPKEM  119

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAG-NTREEGFV  777
             ++ILGS LP FS  + + ++ G  DFI +NHYTT+Y +DCL+S C     G N    G++
Sbjct  120   REILGSQLPSFSDVEKDIIR-GSLDFICVNHYTTFYTKDCLHSAC---FGGRNHPVTGYL  175

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  ++G  IG+  G+    V P G+ K++ Y+KE++ N P++VTENGY    +  +  
Sbjct  176   NTTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYPNKPIFVTENGYSSPQSEGNET  235

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E ++ DTKRV +  +YL +LA A+R GADVRGYF+WSL DNFEW  GY  R GL   DR 
Sbjct  236   EVLIKDTKRVNYHKNYLASLANAMRDGADVRGYFVWSLIDNFEWADGYDTRFGLLYVDRK  295

Query  416   TLKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILHQN  306
             TL+R PKLSA W+  F+  N    +K    + I+H+N
Sbjct  296   TLERRPKLSAHWFSSFLGGNLHELTKY---SSIVHKN  329



>ref|XP_008454703.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=480

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 170/260 (65%), Gaps = 5/260 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +Y  ++Q++QGG IGI      + P+T+   D  AAERA  F+  W  DPI+YG YPKEM
Sbjct  203   LYCTHFQKKQGGSIGIVAYGHMYEPLTDHEYDIKAAERAFIFIFAWVYDPIVYGDYPKEM  262

Query  953   KDILGSHLPEFSSTDLEK-LKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFV  777
             ++ILGS LP FS  D+EK +  G  DF+ +NHYTT+Y +DCL+S C  S  G+    G++
Sbjct  263   QEILGSQLPSFS--DIEKNIIRGSLDFVCVNHYTTFYTKDCLHSPC--SDGGDHAITGYL  318

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  ++G  IG+  G+    V P G+ K++ Y+KE++ N P++VTENGY       +N+
Sbjct  319   NTTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYPNKPIFVTENGYSMPQAEGNNV  378

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+++ DTKRV +  DYL +LA A+R GADVRGYF+WSL DNFEW  GY  R GL   DR 
Sbjct  379   EDLIKDTKRVNYHKDYLASLAKAMRDGADVRGYFVWSLIDNFEWADGYDTRFGLLYVDRK  438

Query  416   TLKRTPKLSAKWYKQFIAKN  357
             TL+R PKLSA W+  F+  N
Sbjct  439   TLERRPKLSAHWFSSFLGGN  458



>ref|XP_002448179.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
 gb|EES12507.1| hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Length=516

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 167/256 (65%), Gaps = 2/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IGI M   W +P+T++ VD+ A ERA +F + WFLDPI+YG YP EM
Sbjct  256   IYKRKYQSKQKGMIGIVMSALWLVPLTDTPVDRLATERALAFDAPWFLDPIIYGDYPPEM  315

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LGS LP FS  +  KL     DFIGINHYTT YA+DC++S+  PS +G         
Sbjct  316   RQLLGSKLPTFSPEERRKL-GYKLDFIGINHYTTLYAKDCMFSSGCPS-SGQEIHHALAA  373

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  IG    +      P G+EKMVTY+ ++++N+P+++TENGY       +N+E
Sbjct  374   FTGERNGIPIGPPTAMPKFYFVPDGIEKMVTYIMKRYNNLPMFITENGYAQGGDSYTNVE  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L+D  R+++   YL  LA  IR GADVRGYF+WSL DNFEW +GYT R GL+  D  T
Sbjct  434   DWLDDQGRIQYLDGYLTKLAKVIRDGADVRGYFVWSLIDNFEWLYGYTLRFGLHYVDYQT  493

Query  413   LKRTPKLSAKWYKQFI  366
              +R PK SA WYK+F+
Sbjct  494   QERKPKSSALWYKRFL  509



>ref|XP_004976205.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Setaria italica]
Length=508

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 169/257 (66%), Gaps = 4/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IGI M  TW+ P+T++  D+ AAERA +F   WF+DPI+YG YP EM
Sbjct  247   IYKRKYQSKQKGLIGIVMYTTWYEPLTDTPEDRLAAERALAFSVPWFVDPIVYGDYPPEM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LGS LP FS  +  KL     DFIGINHYTT YA+DC++S+  P   G   +     
Sbjct  307   RQVLGSRLPTFSPEERRKL-GYKLDFIGINHYTTLYARDCMFSSGCP--LGQGTQHALAA  363

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDT-TTPNSNI  597
              +  +NG  IG   G     V P G+EKMVTY+  +++N+P++VTENGY D     + + 
Sbjct  364   VTGERNGVPIGPPTGRPMFYVVPDGIEKMVTYIMRRYNNLPMFVTENGYPDGGEAGHDHA  423

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +++L+D  R+++   YL  +A AIR GADVRGYF+WSL DNFEW +GYT R GLY  D  
Sbjct  424   KDLLHDQGRIQYLDGYLTKVAKAIRDGADVRGYFVWSLMDNFEWLYGYTLRYGLYYVDYQ  483

Query  416   TLKRTPKLSAKWYKQFI  366
             TL+R PK SA WYK+F+
Sbjct  484   TLERKPKSSALWYKRFL  500



>ref|XP_004976204.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Setaria italica]
Length=510

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 169/257 (66%), Gaps = 4/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IGI M  TW+ P+T++  D+ AAERA +F   WF+DPI+YG YP EM
Sbjct  249   IYKRKYQSKQKGLIGIVMYTTWYEPLTDTPEDRLAAERALAFSVPWFVDPIVYGDYPPEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + +LGS LP FS  +  KL     DFIGINHYTT YA+DC++S+  P   G   +     
Sbjct  309   RQVLGSRLPTFSPEERRKL-GYKLDFIGINHYTTLYARDCMFSSGCP--LGQGTQHALAA  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDT-TTPNSNI  597
              +  +NG  IG   G     V P G+EKMVTY+  +++N+P++VTENGY D     + + 
Sbjct  366   VTGERNGVPIGPPTGRPMFYVVPDGIEKMVTYIMRRYNNLPMFVTENGYPDGGEAGHDHA  425

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             +++L+D  R+++   YL  +A AIR GADVRGYF+WSL DNFEW +GYT R GLY  D  
Sbjct  426   KDLLHDQGRIQYLDGYLTKVAKAIRDGADVRGYFVWSLMDNFEWLYGYTLRYGLYYVDYQ  485

Query  416   TLKRTPKLSAKWYKQFI  366
             TL+R PK SA WYK+F+
Sbjct  486   TLERKPKSSALWYKRFL  502



>ref|XP_002448174.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
 gb|EES12502.1| hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
Length=522

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 164/256 (64%), Gaps = 1/256 (0%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+K YQ +QGG IGI +   W+ P  N+  D    ERA SF + WFLDPI+ G YP  M
Sbjct  244   IYKKKYQGKQGGRIGITVQSRWYEPFRNTPTDILGVERALSFGAPWFLDPIILGHYPSAM  303

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG +LPEF+    + L+    DFIG+NHY+T Y +D + S+  P        +  + 
Sbjct  304   RKILGPNLPEFTLKQKKILQTSKLDFIGLNHYSTNYLKDSI-SSSSPCELDQYDGDAQIS  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              S  ++G LIGE  G  YI   P G+EK+VTYL  +++N P+YVTENGY   +  + + +
Sbjct  363   TSAERDGILIGERTGSPYINTVPYGIEKVVTYLNTRYNNTPIYVTENGYAQASNSSMSAK  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +  NDT RV +   YL +LA+AIRKGADV GYF+WSL DNFEW  GYT+R GLY  D  T
Sbjct  423   DFTNDTGRVNYLQGYLTSLASAIRKGADVHGYFVWSLLDNFEWNNGYTQRFGLYYVDYNT  482

Query  413   LKRTPKLSAKWYKQFI  366
              KRTPKLS KWY++F+
Sbjct  483   QKRTPKLSTKWYREFL  498



>ref|XP_003580124.2| PREDICTED: beta-glucosidase 16-like [Brachypodium distachyon]
Length=554

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 177/268 (66%), Gaps = 10/268 (4%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+KNYQ +QGG IGI +   W+ P+TN T D  AA RA SF   WFLDPI +G YP+EM+
Sbjct  289   YKKNYQAKQGGSIGIVVAMKWYEPLTNRTEDIRAARRALSFEVEWFLDPIFFGDYPREMR  348

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDP-SMAGNTREEGFVG  774
             ++L ++LP+F+  + +KL     DFIGIN YT  YA+DC+   C+  +  GN      V 
Sbjct  349   EMLSANLPKFTPEE-KKLMQNKVDFIGINQYTAIYARDCISLPCNIMTYEGNA----MVL  403

Query  773   QSLSKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              +  ++G LIG+     GY  V P GME+ V Y+ E++ N P+YVTENGY   +  ++++
Sbjct  404   ATGERDGVLIGKPTAFKGYYDV-PQGMEQAVKYVNERYENTPVYVTENGYSQQS--DNSV  460

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+++ND  RV +   YL ++++A+RKGA+VRGYF+WSL DNFEW FGYT R GLY  D  
Sbjct  461   EDLINDVGRVNYLQGYLTSISSAVRKGANVRGYFVWSLIDNFEWGFGYTVRFGLYHVDFE  520

Query  416   TLKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             T KR PK SAKWY+ F+A    V+ ++Q
Sbjct  521   TQKRIPKTSAKWYRGFLAGAGPVDDQVQ  548



>ref|XP_002448178.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
 gb|EES12506.1| hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
Length=510

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 169/257 (66%), Gaps = 5/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ++Q G IGI M   WF+P+T++ VD+ A ERA +F   W+LDPI+YG YP EM
Sbjct  251   IYKRKYQRKQKGMIGIVMAAFWFVPLTDTPVDRMATERALAFSVPWYLDPIVYGDYPPEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGS-DFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFV  777
             + +LGS LP FS   +EK K G   DFIGINHYTT Y +DC++++  PS  G   +    
Sbjct  311   RQLLGSKLPTFSP--VEKRKLGYKLDFIGINHYTTLYVKDCMFTSGCPS--GQDIQYALA  366

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  +NG  IG    +      P G+EKMVTY+ ++++N+P+++TENGY       + +
Sbjct  367   AYTGERNGIPIGPPTAMPLFFDVPDGIEKMVTYIMKRYNNLPMFITENGYAQGGVGYNQV  426

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+ L+D  R+++   YL  LA  IR GADVRGYFIWSL DNFEWT+GYT R GL+  D  
Sbjct  427   EDWLDDQSRIQYLDGYLTKLAKVIRDGADVRGYFIWSLIDNFEWTYGYTLRFGLHYVDYQ  486

Query  416   TLKRTPKLSAKWYKQFI  366
             T +R PK SA WYK+F+
Sbjct  487   TQERKPKSSALWYKRFL  503



>emb|CDX79092.1| BnaA01g11590D [Brassica napus]
Length=470

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 170/265 (64%), Gaps = 28/265 (11%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q+Q GG+IGI M   WF P+++S  D  AAERA +F   WFLDPI         
Sbjct  231   LYRERFQEQ-GGKIGIVMNAIWFEPVSDSLADSLAAERAQAFYLTWFLDPI---------  280

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
                       F+  DL+  K  G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  281   ----------FTRDDLKSSK-NGLDFIGINQYTSRYAKDCLHSVCEPGKGG-SRAEGFVH  328

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  +GE  G+ +  VYP GME+M+ Y  E++ NIPLYVTENG  ++T       
Sbjct  329   SNALKDGLPLGEPTGVNWFNVYPQGMEEMLMYATERYRNIPLYVTENGKDNSTGV-----  383

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LND +RVKF ++YL+AL  A+RKG DVRGYF WSL DNFEW  GYT R G+Y  D  T
Sbjct  384   -LLNDYRRVKFMSNYLDALKRAMRKGEDVRGYFTWSLLDNFEWISGYTVRFGMYHVDFNT  442

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTP+LSA WYK FI+K+   +SK
Sbjct  443   LERTPRLSASWYKNFISKHISSQSK  467



>dbj|BAJ92008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 177/269 (66%), Gaps = 9/269 (3%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y++NYQ  QGG IGI +   W+ P+TNST D  AA RA SF  +WFL+PI +G YP+EM 
Sbjct  242   YKRNYQATQGGSIGIVIAMKWYEPLTNSTEDILAARRALSFEVDWFLEPIFFGDYPREMH  301

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             ++L S+L +F+S +   L+   +DFIGINHYT  YA+DC+ S C+      T E   + Q
Sbjct  302   EMLSSNLLKFTSEEKRLLQKNKADFIGINHYTAIYAKDCISSPCNVE----TYEGNALVQ  357

Query  770   SL-SKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             +L  ++G  IG    L GY  V P GME +V Y+ +++ N P+YVTENGY   +  N+++
Sbjct  358   ALGERDGVEIGRPTALHGYYDV-PEGMELIVKYVNQRYKNTPVYVTENGYSQFS--NNSM  414

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E ++ND  RV +   YL ++++A+R+GA+V GYF+WSL DNFEW FG+T R GLY  D  
Sbjct  415   EGLINDVGRVNYLQGYLTSISSAVRRGANVSGYFVWSLMDNFEWFFGFTVRFGLYHVDFE  474

Query  416   TLKRTPKLSAKWYKQFIAKNRKVESKMQL  330
             T +RTPK+S KWY+ F+  +R V+    L
Sbjct  475   TCERTPKMSGKWYRDFLTCSRPVDQARTL  503



>gb|KGN59900.1| hypothetical protein Csa_3G852490 [Cucumis sativus]
Length=545

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 175/276 (63%), Gaps = 6/276 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q++QGG IGI      + P+T+   D  AA+RA  F+  W  DPI+YG YPKEM
Sbjct  268   LYRTHFQKKQGGSIGIVAYCHMYEPLTDHEYDIKAAQRALIFIFAWVYDPIVYGDYPKEM  327

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  + + ++ G  DFI +NHYTT+Y +DCL+S C     GN    G++ 
Sbjct  328   REILGSQLPSFSDVEKDIIR-GSLDFICVNHYTTFYTKDCLHSAC--FGGGNHPVTGYLN  384

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G+    V P G+ K++ Y+KE++ N P++VTENGY    +  +  E
Sbjct  385   TTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYPNKPIFVTENGYSSPQSEGNETE  444

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              ++ DTKRV +  +YL +LA A+R GADVRGYF+WSL DNFEW  GY  R GL   DR T
Sbjct  445   VLIKDTKRVNYHKNYLASLANAMRDGADVRGYFVWSLIDNFEWADGYDTRFGLLYVDRKT  504

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILHQN  306
             L+R PKLSA W+  F+  N    +K    + I+H+N
Sbjct  505   LERRPKLSAHWFSSFLGGNLHELTKY---SSIVHKN  537



>ref|XP_006370302.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
 gb|ERP66871.1| hypothetical protein POPTR_0001s41440g [Populus trichocarpa]
Length=522

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 171/259 (66%), Gaps = 6/259 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+++Q +QGG IGI     +F P+ ++ +D+ A  RA +F + W  D +++G YP EM
Sbjct  246   LYREHFQLKQGGSIGIVGFTEYFEPLRDNELDRQAVSRALAFTNAWLFDAVVFGDYPAEM  305

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTRE-EGFV  777
             +  LGS LP FS  +   +K G  DFIG+N YT+ YA+DC++S C   ++G  R   GFV
Sbjct  306   RLYLGSALPTFSPEETSYVK-GSLDFIGMNFYTSLYAKDCIHSAC---ISGGDRPIRGFV  361

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  ++G+ IG   G     V P GMEK+V Y+KE+++N+P++VTENG+      N  +
Sbjct  362   HTTGERDGEPIGGRCGNPRFFVVPEGMEKIVNYMKERYNNMPMFVTENGFSPPQQ-NDQV  420

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             + +L DT RV F   YL ALA AIR GADVRGYF+WSL DNFEW  GY++R GLY  DR 
Sbjct  421   QALLQDTNRVNFHKSYLAALARAIRNGADVRGYFVWSLVDNFEWIDGYSQRYGLYYVDRQ  480

Query  416   TLKRTPKLSAKWYKQFIAK  360
             TL+R PKLSAKWYK F+A 
Sbjct  481   TLERVPKLSAKWYKNFLAN  499



>ref|XP_004147832.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=557

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 175/276 (63%), Gaps = 6/276 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q++QGG IGI      + P+T+   D  AA+RA  F+  W  DPI+YG YPKEM
Sbjct  280   LYRTHFQKKQGGSIGIVAYCHMYEPLTDHEYDIKAAQRALIFIFAWVYDPIVYGDYPKEM  339

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  + + ++ G  DFI +NHYTT+Y +DCL+S C     GN    G++ 
Sbjct  340   REILGSQLPSFSDVEKDIIR-GSLDFICVNHYTTFYTKDCLHSAC--FGGGNHPVTGYLN  396

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G+    V P G+ K++ Y+KE++ N P++VTENGY    +  +  E
Sbjct  397   TTAYRDGVSIGDPTGIDVFFVVPRGLGKVINYIKERYPNKPIFVTENGYSSPQSEGNETE  456

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              ++ DTKRV +  +YL +LA A+R GADVRGYF+WSL DNFEW  GY  R GL   DR T
Sbjct  457   VLIKDTKRVNYHKNYLASLANAMRDGADVRGYFVWSLIDNFEWADGYDTRFGLLYVDRKT  516

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILHQN  306
             L+R PKLSA W+  F+  N    +K    + I+H+N
Sbjct  517   LERRPKLSAHWFSSFLGGNLHELTKY---SSIVHKN  549



>gb|KFK28774.1| hypothetical protein AALP_AA7G045600 [Arabis alpina]
Length=509

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 176/272 (65%), Gaps = 25/272 (9%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRKNYQ++Q G+IGI M   WF P+++S  D+ A     +F  NWFLDP+++G YPKEM
Sbjct  243   IYRKNYQEEQRGKIGIVMNTIWFEPVSDSLADRLA----QAFYMNWFLDPVVFGRYPKEM  298

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++I G  LPEF+  D  K+   G DFIGIN YT+ YA+DCL+S C+P   G +R EGFV 
Sbjct  299   QEIFGEDLPEFTK-DERKMSKKGLDFIGINQYTSNYAKDCLHSPCEPGKGG-SRVEGFVD  356

Query  773   QSLSKNGKLIGE-LAGLGYIAVYPPGMEKMVTYLKEK-----------FSNIPLYVTENG  630
              +  K+G  +GE +    +   +     K+V+YL  +             NIPLY+TENG
Sbjct  357   PNALKDGLPLGETVFSETFFEFF--DWSKLVSYLSSRNGEDVDVCNKAIQNIPLYLTENG  414

Query  629   YCDTTTPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYT  450
             Y +     +N   +LND  RVKF + YL+AL  A+RKGADVRGYF WSL DNFEWT GYT
Sbjct  415   YGE-----NNTRIMLNDYPRVKFMSCYLDALKRAMRKGADVRGYFTWSLLDNFEWTLGYT  469

Query  449   KRLGLYQFDRVTLKRTPKLSAKWYKQFIAKNR  354
              + GLY  D  TL+RTP+LSA WYK+FI ++R
Sbjct  470   IQFGLYHVDFNTLERTPRLSASWYKKFIFQHR  501



>gb|KHN28048.1| Beta-glucosidase 18 [Glycine soja]
Length=546

 Score =   250 bits (639),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 160/256 (63%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      F P+ +   D+ A  RA +FL  W LDP+++G YP EM
Sbjct  261   LYRKHFQAKQGGTIGIVAHSVMFEPLRDEECDRQAVNRALAFLIPWVLDPLVFGEYPAEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP FS  +   LK G  DFIGINHY + Y +DC  S C  S+  +    GFV 
Sbjct  321   HSILGSQLPVFSLKEKSLLK-GSIDFIGINHYGSLYVKDCSLSAC--SLEADHPITGFVE  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G  +  V P GM+K+V Y+K ++ NIP+Y+TENGYC    P+  + 
Sbjct  378   VTGIRDGVPIGDQTGFSWFYVVPRGMQKLVDYVKIRYHNIPMYITENGYCSPLKPDETMH  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KR+ +   YL AL  AIRKGADVRGY IWSL DNFEW  GY  R GLY  +R T
Sbjct  438   DLLQDVKRIDYHKAYLAALLRAIRKGADVRGYMIWSLLDNFEWANGYEIRYGLYHVNRDT  497

Query  413   LKRTPKLSAKWYKQFI  366
              +R PKLS +W+  F+
Sbjct  498   HERIPKLSVQWFSSFL  513



>ref|XP_003541849.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=532

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 161/256 (63%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      F P+ +   D+ AA RA +F     LDP+++G YP EM
Sbjct  251   LYRKHFQAKQGGTIGIVADSLMFEPLRDEECDRQAASRALTFELARVLDPLVFGEYPAEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  + + L  G  DFIGINHY T YA+DC  STC  S+  +    GFV 
Sbjct  311   RSILGSKLPVFSPKE-KSLIKGSLDFIGINHYGTLYAKDCTLSTC--SLGADHPIRGFVE  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              + ++NG  IGE  G+    V P G+EK+  Y+K ++ NIP+Y+TENGY     P+  I 
Sbjct  368   TTATRNGVPIGEPTGIAQFFVVPRGVEKLADYIKMRYHNIPMYITENGYSPPPKPDVTIH  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L D KR+ +   YL AL  +IRKGADVRGY IWSL DNFEW  GY  R GLY  DR T
Sbjct  428   DSLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIWSLMDNFEWASGYDIRFGLYYVDRQT  487

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  488   LERIPKLSVQWFSSFL  503



>ref|XP_004976207.1| PREDICTED: beta-glucosidase 18-like [Setaria italica]
Length=594

 Score =   251 bits (642),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 166/256 (65%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IGI M  TWF PMT++ VD+ A ERA +F   WFLDPI+YG YP EM
Sbjct  335   IYKRKYQSEQKGLIGIVMSTTWFKPMTDAPVDRLATERALAFDVPWFLDPIVYGDYPPEM  394

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  +  KL     DFIG+NHYTT YA+DC++S   P   G   +     
Sbjct  395   RQILGSRLPAFSPDERRKL-GYKLDFIGVNHYTTLYARDCMFSPGCP--LGQETQHALAA  451

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  +G    +    V P G+EK+VTY+ ++++N+P+++TENGY       +++E
Sbjct  452   VTGERNGLPVGPPTAMPTFYVVPEGIEKIVTYIMKRYNNLPMFITENGYAQGGDGYAHVE  511

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + L+D  R+++   YL  LA  IR GADVRGYF+WSL DNFEW +GYT R GL+  D  T
Sbjct  512   DWLDDQGRIEYLDGYLTKLAKVIRDGADVRGYFVWSLIDNFEWLYGYTLRFGLHYVDYQT  571

Query  413   LKRTPKLSAKWYKQFI  366
              +R PK SA WY++F+
Sbjct  572   QERKPKSSALWYQRFL  587



>ref|XP_010644221.1| PREDICTED: beta-glucosidase 18-like [Vitis vinifera]
 emb|CBI20347.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 170/261 (65%), Gaps = 4/261 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR+ YQ +QGG IG+ +    + P+++   D+ AA RA +F   W LDP++ G YP EM
Sbjct  247   IYRERYQLKQGGSIGVVVHAFMYEPISDQECDREAASRALAFNIAWVLDPLLNGDYPPEM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               +LG ++P+FS  +L+K+K G  DFIGINHY++ YA++C YS   PS  G    +GFV 
Sbjct  307   YRLLGENMPKFSPDELKKIK-GSIDFIGINHYSSLYAENCSYS---PSKLGCQAIKGFVY  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE   +    V P G+EK++ YLK +++N P++VTENG      P     
Sbjct  363   TTGERDGVPIGEETAIPRFYVVPSGLEKLIDYLKTRYNNKPIFVTENGLSQMDQPEERNR  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +LNDTKRV++   YL +LA AIRKGADVRGYF+WSL DNFEWT GY+ R GLY  D  T
Sbjct  423   VLLNDTKRVEYHKGYLASLAQAIRKGADVRGYFVWSLLDNFEWTNGYSIRFGLYYVDYKT  482

Query  413   LKRTPKLSAKWYKQFIAKNRK  351
             L R PK S+KWY  F++ N +
Sbjct  483   LCRIPKFSSKWYTSFLSYNSQ  503



>ref|XP_006593298.1| PREDICTED: beta-glucosidase 18-like [Glycine max]
Length=536

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 160/256 (63%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      + P+ +   D+ A  RA +FL  W LDP+++G YP EM
Sbjct  251   LYRKHFQAKQGGTIGIVAHSVMYEPLRDEECDRQAVNRALAFLIPWVLDPLVFGEYPAEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP FS  +   LK G  DFIGINHY + Y +DC  S C  S+  +    GFV 
Sbjct  311   HSILGSQLPVFSLKEKSLLK-GSIDFIGINHYGSLYVKDCSLSAC--SLEADHPITGFVE  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G  +  V P GM+K+V Y+K ++ NIP+Y+TENGYC    P+  + 
Sbjct  368   VTGIRDGVPIGDQTGFSWFYVVPRGMQKLVDYVKIRYHNIPMYITENGYCSPLKPDETMH  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KR+ +   YL AL  AIRKGADVRGY IWSL DNFEW  GY  R GLY  +R T
Sbjct  428   DLLQDVKRIDYHKAYLAALLRAIRKGADVRGYMIWSLLDNFEWANGYEIRYGLYHVNRDT  487

Query  413   LKRTPKLSAKWYKQFI  366
              +R PKLS +W+  F+
Sbjct  488   HERIPKLSVQWFSSFL  503



>ref|XP_006594785.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=543

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 164/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      + P+ +   D+ A  R  +F   W LDP+++G YP EM
Sbjct  261   LYRKHFQAKQGGTIGIVAFSFMYDPLRDEECDRQAVSRGLAFDIAWVLDPLVFGEYPPEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS +P FS  + + L  G  DFIGINHY T YA+DC  STC  S+  +    GF+ 
Sbjct  321   RSILGSKMPVFSPVE-KSLIKGSLDFIGINHYGTLYAKDCSLSTC--SLGADHPIAGFLE  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++ +++G  IG+  G+    V P GMEK+V Y+K ++ N+P+Y+TENGY     P+  I 
Sbjct  378   RTATRDGIPIGDPTGVPDFFVVPRGMEKLVEYIKIRYRNMPMYITENGYSQPPKPDVTIH  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KR+ +   YL AL  +IRKGADVRGY IWSL DNFEWT GY  R GLY  DR T
Sbjct  438   DLLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIWSLLDNFEWTSGYDIRFGLYYVDRGT  497

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  498   LERIPKLSVQWFSSFL  513



>ref|XP_003541851.2| PREDICTED: beta-glucosidase 18-like isoform X1 [Glycine max]
Length=537

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 164/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      + P+ +   D+ A  R  +F   W LDP+++G YP EM
Sbjct  261   LYRKHFQAKQGGTIGIVAFSFMYDPLRDEECDRQAVSRGLAFDIAWVLDPLVFGEYPPEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS +P FS  + + L  G  DFIGINHY T YA+DC  STC  S+  +    GF+ 
Sbjct  321   RSILGSKMPVFSPVE-KSLIKGSLDFIGINHYGTLYAKDCSLSTC--SLGADHPIAGFLE  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             ++ +++G  IG+  G+    V P GMEK+V Y+K ++ N+P+Y+TENGY     P+  I 
Sbjct  378   RTATRDGIPIGDPTGVPDFFVVPRGMEKLVEYIKIRYRNMPMYITENGYSQPPKPDVTIH  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KR+ +   YL AL  +IRKGADVRGY IWSL DNFEWT GY  R GLY  DR T
Sbjct  438   DLLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIWSLLDNFEWTSGYDIRFGLYYVDRGT  497

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  498   LERIPKLSVQWFSSFL  513



>ref|XP_009382650.1| PREDICTED: beta-glucosidase 18-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 165/259 (64%), Gaps = 14/259 (5%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYRK YQ +Q G IGI +   WF P+ N+++D   A +  SF + WFLDPI++G YP EM
Sbjct  236   IYRKRYQVKQQGMIGIVIFMCWFEPLRNNSLDFLVARQVMSFQAAWFLDPIIHGDYPPEM  295

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +  LGS LP FS  +  KL+    DFIGINHYT+ Y +DC +S C  S          +G
Sbjct  296   RQALGSKLPTFSIKERRKLQYK-LDFIGINHYTSLYVRDCTFSPCKSSRN--------IG  346

Query  773   QSL---SKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNS  603
             +S     +NG  IG+   +    V P G+E++V Y   +++N P+++TENGY   +  NS
Sbjct  347   ESFIYTERNGIPIGKPTAMPNYYVVPYGIEEVVLYTMRRYNNTPMFITENGYAQHS--NS  404

Query  602   NIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFD  423
             ++ E+LND+ RV     YL  L  A+RKGADVRGYF+WSL DNFEW +GYT R GL+  D
Sbjct  405   SMTELLNDSDRVDAMRQYLTYLNNAMRKGADVRGYFVWSLMDNFEWLYGYTMRFGLHHVD  464

Query  422   RVTLKRTPKLSAKWYKQFI  366
               T KRTPKLSA+WYKQF+
Sbjct  465   YNTQKRTPKLSARWYKQFL  483



>ref|NP_001053305.1| Os04g0513900 [Oryza sativa Japonica Group]
 dbj|BAF15219.1| Os04g0513900, partial [Oryza sativa Japonica Group]
Length=253

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 160/271 (59%), Gaps = 18/271 (7%)
 Frame = -2

Query  1115  QQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGS  936
             Q +Q G IG+ +  TW+ P+ +   D+ A ERA +F + WFLDP++YG YP EM+ ILG 
Sbjct  1     QSKQRGMIGMVLYSTWYEPLRDVPEDRLATERALAFETPWFLDPLVYGDYPPEMRQILGG  60

Query  935   HLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQSLSKN  756
              LP FS  D  KL+    DFIG+NHYTT YA+DC++S C     G   +      +   N
Sbjct  61    RLPSFSPEDRRKLRYK-LDFIGVNHYTTLYARDCMFSDCP---QGQETQHALAAVTGESN  116

Query  755   GKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEEVLNDT  576
             G  IG    +    V P G+EKMV Y   +++N+P+++TENGY       ++ E+ ++D 
Sbjct  117   GLPIGTPTAMPTFYVVPDGIEKMVKYFMRRYNNLPMFITENGYAQGGDSYTDAEDWIDDE  176

Query  575   KRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTLKRTPK  396
              R+++   YL  LA  IR GADVRGYF WS+ DNFEW FGYT R GLY  D  T +R+PK
Sbjct  177   DRIEYLEGYLTKLAKVIRDGADVRGYFAWSVVDNFEWLFGYTLRFGLYYIDYRTQERSPK  236

Query  395   LSAKWYKQFIAKNRKVESKMQLGNMILHQNQ  303
             LSA WYK+F+                LH+NQ
Sbjct  237   LSALWYKEFLQN--------------LHENQ  253



>gb|KEH38761.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=529

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 165/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK YQ +QGG IGI      + P+ +   D+ AA RA +F+  W LDP+++G YP +M
Sbjct  251   LYRKQYQAKQGGTIGIVAHTFMYEPLRDEECDRQAANRALAFVIGWLLDPLVFGEYPADM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FSS +   L+ G  DFIGIN+Y   YA+DC  STC    A   +  GF+ 
Sbjct  311   RSILGSQLPRFSSKEKSLLR-GSLDFIGINNYGALYAKDCYLSTCPLEAARPIK--GFLQ  367

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G+ +  V P GMEK+V Y+K K+ N+P+Y+TENGY         + 
Sbjct  368   TTGMRDGIPIGDQTGMKWFFVVPKGMEKIVDYIKIKYHNMPMYITENGYSSPLNAGMTMN  427

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L+D KR+++   YL AL  A+RKGADVRGY +WSLFDNFEW  GY K+ GLY  DR T
Sbjct  428   DLLHDFKRIEYHKAYLAALLRAMRKGADVRGYMVWSLFDNFEWNSGYDKKFGLYYVDRQT  487

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  488   LERIPKLSVEWFSSFL  503



>dbj|BAJ93784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 178/269 (66%), Gaps = 10/269 (4%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y++NYQ  QGG IGI +   W+ P+TNST D  AA RA +F  +WFLDPI +G YP+EM+
Sbjct  245   YKRNYQATQGGSIGIVIAMKWYEPLTNSTEDILAARRALAFEVDWFLDPIFFGDYPREMR  304

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVG  774
             ++L S+LP F+S + ++L    +DFIG+NHYT  YA+DC+ S C+  S  GN   +  VG
Sbjct  305   EMLSSNLPTFTSEE-KRLLQSKADFIGVNHYTAIYAKDCIASPCNIKSYEGNALVQA-VG  362

Query  773   QSLSKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
             +   ++G  IG      GY  V P GME +V Y+ +++ N P+YVTENG+   +  ++++
Sbjct  363   E---RDGVAIGRPTAFPGYYDV-PEGMELIVKYVNQRYENAPVYVTENGFSQFS--DNSM  416

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             E+++ND  RV     YL  +++A+R+GA+VRGYF+WSL DNFEW FG+T R GLY  D  
Sbjct  417   EDLINDVGRVNCLQGYLTCISSAVRRGANVRGYFVWSLMDNFEWGFGFTVRFGLYYVDFE  476

Query  416   TLKRTPKLSAKWYKQFIAKNRKVESKMQL  330
             T +RTPK+S KWY+ F+  +  V+    L
Sbjct  477   TQERTPKMSGKWYRDFLTGSVLVDQAQTL  505



>sp|Q7XSK0.2|BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE54546.1| OSJNBa0004N05.26 [Oryza sativa Japonica Group]
 emb|CAE01910.2| OSJNBb0070J16.3 [Oryza sativa Japonica Group]
 emb|CAH67620.1| OSIGBa0140J09.1 [Oryza sativa Indica Group]
Length=505

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 165/277 (60%), Gaps = 18/277 (6%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY++ YQ +Q G IG+ +  TW+ P+ +   D+ A ERA +F + WFLDP++YG YP EM
Sbjct  247   IYKRKYQSKQRGMIGMVLYSTWYEPLRDVPEDRLATERALAFETPWFLDPLVYGDYPPEM  306

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG  LP FS  D  KL+    DFIG+NHYTT YA+DC++S C     G   +     
Sbjct  307   RQILGGRLPSFSPEDRRKLRYK-LDFIGVNHYTTLYARDCMFSDCP---QGQETQHALAA  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +   NG  IG    +    V P G+EKMV Y   +++N+P+++TENGY       ++ E
Sbjct  363   VTGESNGLPIGTPTAMPTFYVVPDGIEKMVKYFMRRYNNLPMFITENGYAQGGDSYTDAE  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             + ++D  R+++   YL  LA  IR GADVRGYF WS+ DNFEW FGYT R GLY  D  T
Sbjct  423   DWIDDEDRIEYLEGYLTKLAKVIRDGADVRGYFAWSVVDNFEWLFGYTLRFGLYYIDYRT  482

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILHQNQ  303
              +R+PKLSA WYK+F+                LH+NQ
Sbjct  483   QERSPKLSALWYKEFLQN--------------LHENQ  505



>ref|XP_011042496.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Populus euphratica]
Length=537

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 171/259 (66%), Gaps = 6/259 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+++Q +QGG IGI     +F P+ +S +D+ A  RA +F + W  D +++G YP EM
Sbjct  251   LYREHFQLEQGGYIGIVGFTEYFEPLRDSELDRQAVRRALAFTNAWLFDAVVFGDYPAEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTRE-EGFV  777
             +  LGS LP FS  +   LK G  DFIG+N YT+ YA+DC++S C   ++G  R   GFV
Sbjct  311   RLYLGSALPTFSLEETCYLK-GSLDFIGMNFYTSLYAKDCIHSAC---ISGGDRPIRGFV  366

Query  776   GQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
               +  ++G+ IG   G     V P GMEK+V Y+KE+++N+P++VTENG+      N  +
Sbjct  367   YTTGERDGEPIGGRCGNPRFFVVPEGMEKIVNYMKERYNNMPMFVTENGFSPPQQ-NDQV  425

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
             + +L DT RV F   YL ALA AIR GA+VRGYF+WSL DNFEW  GY+ R GLY  DR 
Sbjct  426   QALLQDTSRVNFHKSYLAALARAIRNGANVRGYFVWSLVDNFEWIDGYSLRYGLYYVDRQ  485

Query  416   TLKRTPKLSAKWYKQFIAK  360
             TL+R PKLSAKWYK+F+A 
Sbjct  486   TLERVPKLSAKWYKKFLAN  504



>ref|XP_006594784.1| PREDICTED: beta-glucosidase 18-like isoform X3 [Glycine max]
Length=507

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 161/257 (63%), Gaps = 4/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      F P+ +   D+ AA RA +F     LDP+++G YP EM
Sbjct  225   LYRKHFQAKQGGTIGIVADSLMFEPLRDEECDRQAASRALTFELARVLDPLVFGEYPAEM  284

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  + + L  G  DFIGINHY T YA+DC  STC  S+  +    GFV 
Sbjct  285   RSILGSKLPVFSPKE-KSLIKGSLDFIGINHYGTLYAKDCTLSTC--SLGADHPIRGFVE  341

Query  773   QSLSKNGKLIGE-LAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              + ++NG  IGE   G+    V P G+EK+  Y+K ++ NIP+Y+TENGY     P+  I
Sbjct  342   TTATRNGVPIGEPQTGIAQFFVVPRGVEKLADYIKMRYHNIPMYITENGYSPPPKPDVTI  401

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
              + L D KR+ +   YL AL  +IRKGADVRGY IWSL DNFEW  GY  R GLY  DR 
Sbjct  402   HDSLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIWSLMDNFEWASGYDIRFGLYYVDRQ  461

Query  416   TLKRTPKLSAKWYKQFI  366
             TL+R PKLS +W+  F+
Sbjct  462   TLERIPKLSVQWFSSFL  478



>ref|XP_006594783.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Glycine max]
Length=533

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 161/257 (63%), Gaps = 4/257 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      F P+ +   D+ AA RA +F     LDP+++G YP EM
Sbjct  251   LYRKHFQAKQGGTIGIVADSLMFEPLRDEECDRQAASRALTFELARVLDPLVFGEYPAEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP FS  + + L  G  DFIGINHY T YA+DC  STC  S+  +    GFV 
Sbjct  311   RSILGSKLPVFSPKE-KSLIKGSLDFIGINHYGTLYAKDCTLSTC--SLGADHPIRGFVE  367

Query  773   QSLSKNGKLIGE-LAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNI  597
              + ++NG  IGE   G+    V P G+EK+  Y+K ++ NIP+Y+TENGY     P+  I
Sbjct  368   TTATRNGVPIGEPQTGIAQFFVVPRGVEKLADYIKMRYHNIPMYITENGYSPPPKPDVTI  427

Query  596   EEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV  417
              + L D KR+ +   YL AL  +IRKGADVRGY IWSL DNFEW  GY  R GLY  DR 
Sbjct  428   HDSLQDFKRIDYHKAYLAALLRSIRKGADVRGYMIWSLMDNFEWASGYDIRFGLYYVDRQ  487

Query  416   TLKRTPKLSAKWYKQFI  366
             TL+R PKLS +W+  F+
Sbjct  488   TLERIPKLSVQWFSSFL  504



>ref|XP_004487691.1| PREDICTED: beta-glucosidase 18-like [Cicer arietinum]
Length=525

 Score =   245 bits (625),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 163/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR +YQ +QGG IGI      + P+     D+ AA RA +F+  W LDP+++G YP EM
Sbjct  248   LYRNHYQAKQGGTIGIVAHTFMYEPLREEECDRQAANRALAFVIGWLLDPLVFGEYPVEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG  LP+FS  +   L+ G  DFIGIN+Y   YA+DC +S C    A   R  GFV 
Sbjct  308   RSILGHQLPKFSLKEKSLLR-GSLDFIGINNYGALYAKDCYFSNCPIEAAQPIR--GFVE  364

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  K+G  IG+  G+    V P G+EK+V ++K ++ N+P+Y+TENGY     PN  + 
Sbjct  365   TTGMKDGIPIGDKVGMPRFFVVPNGVEKIVDHIKIRYHNMPMYITENGYSSLLNPNMTMH  424

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L+D KR+++   YL AL  AIRKGADVRGY +WSLFDNFEW+ GY    GLY  DR T
Sbjct  425   DLLHDFKRIEYHKAYLTALRRAIRKGADVRGYMVWSLFDNFEWSSGYDITFGLYYVDRQT  484

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  485   LERIPKLSVQWFSSFL  500



>ref|XP_009605774.1| PREDICTED: probable inactive beta-glucosidase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=434

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 166/261 (64%), Gaps = 6/261 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+++Q + GG IGI +    + P+ N   D+ AA RA  F + W  DP++YG YP+EM
Sbjct  153   LYREHFQPKHGGMIGIVVHAFMYKPLRNDDFDRDAANRALVFTAAWVFDPLVYGYYPREM  212

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSM-----AGNTRE  789
             ++ LGS LP F+S D  KL     DFIG+NHY T Y +DC+YS+C  S       G+   
Sbjct  213   REYLGSSLPTFTS-DERKLIKDSIDFIGVNHYGTLYVKDCIYSSCVCSNSSCIAGGDHPI  271

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              G++     K+G  IGE  G+    V P GME++V Y+K+++ N P++VTENGY      
Sbjct  272   HGYLITLGEKDGVPIGEPTGMPRFFVVPRGMEEIVDYMKKRYPNKPMFVTENGYSSLNPT  331

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
              +   E+ +D KRV+F   YL +LA AIRKGADVRGYFIWSL DNFEWT GY  + GLY 
Sbjct  332   TAQAAELQHDIKRVEFHKSYLASLARAIRKGADVRGYFIWSLMDNFEWTSGYEVKFGLYY  391

Query  428   FDRVTLKRTPKLSAKWYKQFI  366
              DR TL R PKLSAKWY+ F+
Sbjct  392   VDRSTLDRVPKLSAKWYRDFL  412



>ref|XP_004141366.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
 gb|KGN55151.1| hypothetical protein Csa_4G638400 [Cucumis sativus]
Length=523

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 168/274 (61%), Gaps = 3/274 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  +Q++QGG IG+      + P+TN+  D  A +RA  F   W  DPI+YG YPKEM
Sbjct  249   IYRTQFQKKQGGSIGLVAYCHMYEPLTNNEFDLQAVDRALIFSFAWVYDPIVYGDYPKEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++ GS LP FS+T+   +K G  D+I +NHYTT YA+DCL+S C  S  G+   +GF+ 
Sbjct  309   REVFGSQLPSFSNTEKNIIK-GSLDYICVNHYTTLYAKDCLHSPC--SNGGDRPIKGFLD  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
                 +N   IG+  G+    V P G+EK + Y+ +++ N P++VTENGY    +  + +E
Sbjct  366   TMGYRNSVSIGDPTGMDRFFVVPRGLEKTINYINQRYPNKPIFVTENGYSTPPSDGNKVE  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++NDTKRV F  +YL +L  A+R GADVRGYF+WSL DN EW  G+  R GL   D  T
Sbjct  426   DIINDTKRVNFHRNYLASLVRAMRNGADVRGYFVWSLMDNLEWIHGFNTRFGLVYVDFQT  485

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILH  312
             L+R PKLSA W+   +  N +  S +   N   H
Sbjct  486   LERRPKLSAHWFASLLGGNLQHSSSILNKNTFDH  519



>gb|EMS66653.1| Beta-glucosidase 16 [Triticum urartu]
Length=538

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 175/261 (67%), Gaps = 9/261 (3%)
 Frame = -2

Query  1106  QGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMKDILGSHLP  927
             QGG IGI +   W+ P+TNST D  AA RA SF  +WFLDPI +G YP+EM ++L S+LP
Sbjct  281   QGGSIGIVIAMKWYEPLTNSTEDILAARRALSFEVDWFLDPIFFGDYPREMCEMLSSNLP  340

Query  926   EFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCD-PSMAGNTREEGFVGQSLSKNGK  750
             +F+S +   L+   +DFIG+NHYT+ YA+DC+ S CD  +  GN   +  VG+   ++G 
Sbjct  341   KFTSEEKRLLRKNNADFIGLNHYTSIYAKDCISSPCDLETYEGNALVQA-VGE---RDGV  396

Query  749   LIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIEEVLNDTK  573
              IG+   + GY  V P GME +V Y+ +++ N P+YVTENGY   +  ++++E+++ND  
Sbjct  397   TIGKPTAIHGYYDV-PEGMELIVKYVNQRYKNTPVYVTENGYSQFS--DNSMEDLINDVG  453

Query  572   RVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVTLKRTPKL  393
             RV +   YL ++++A+R+GA+V GYF+WSL DNFEW FG+T R GLY  D  T +RTPK+
Sbjct  454   RVNYLQGYLTSISSAVRRGANVSGYFVWSLMDNFEWRFGFTVRFGLYHVDFETRERTPKM  513

Query  392   SAKWYKQFIAKNRKVESKMQL  330
             S  WY+ F+  +R V+    L
Sbjct  514   SGNWYRDFLTGSRPVDQAHTL  534



>ref|XP_008453064.1| PREDICTED: beta-glucosidase 18-like, partial [Cucumis melo]
Length=546

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 167/259 (64%), Gaps = 3/259 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q++QGG IGI  +   + P+TN   D  A +RA  F   W  DPI+YG YPKEM
Sbjct  268   LYRTHFQKKQGGSIGITAVGHMYEPLTNHEFDIEAVDRALIFNFAWVYDPIVYGDYPKEM  327

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +++ GS LP FS T+   +K G  D+I +NHYTT Y +DCL+S C  S  G+   +GF+ 
Sbjct  328   REVFGSQLPSFSKTEKSIIK-GSLDYICVNHYTTLYTKDCLHSPC--SNGGDRPIKGFLD  384

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++   IG+  G+    V P G+EK++ Y+++++ N P+ VTENGY    +    +E
Sbjct  385   TTGYRDSVSIGDPTGVDRFFVVPRGLEKIINYIRQRYPNNPIVVTENGYSMPPSDGKTLE  444

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++NDTKRV F  +YL +L  A+R GADVRGYF+WSL DNFEW  G+T R GL+  D  T
Sbjct  445   DIINDTKRVNFHKNYLASLVRAMRNGADVRGYFVWSLMDNFEWIDGFTTRFGLWYVDFQT  504

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+R PKLSA W+  F+  N
Sbjct  505   LERRPKLSAHWFASFLGGN  523



>ref|XP_004154892.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=507

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 163/258 (63%), Gaps = 5/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q +QGG IGI +    + P+   + D  A +R  +F   W  DPI+YG YPKEM
Sbjct  242   LYRTHFQVKQGGSIGITISIQMYEPLDQQS-DTQAVDRILAFYVGWIYDPIVYGDYPKEM  300

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  D   +K G  DFI INHYTT YA+DC +S+C   +  N     FV 
Sbjct  301   REILGSELPSFSDEDKRYIK-GSLDFISINHYTTKYAKDCFHSSCPDEV--NRPINAFVE  357

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG LIG+  G+  + V P GMEK++ Y+K ++ N  ++VTENGY    +  + +E
Sbjct  358   TTPYRNGILIGDPMGIPGLYVVPRGMEKVINYIKRRYPNHSIFVTENGYSMPPSDGNKVE  417

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV-  417
              +LND KR+KF   YL ALA A+R G DVRGYFIWSL DNFEW  GY  R GL+  D + 
Sbjct  418   TILNDCKRIKFHKSYLAALARAMRNGGDVRGYFIWSLMDNFEWIRGYDTRFGLFYVDHLK  477

Query  416   TLKRTPKLSAKWYKQFIA  363
             TL+R PKLSA W+  F+ 
Sbjct  478   TLERRPKLSAHWFASFLG  495



>gb|EAZ31331.1| hypothetical protein OsJ_15448 [Oryza sativa Japonica Group]
Length=471

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 167/256 (65%), Gaps = 8/256 (3%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+ NYQ +QGG IGI +   W+ P+TNST D  AA RA +F  +WFLDPI +G YP+EM+
Sbjct  205   YKTNYQAKQGGSIGIVVAMKWYEPLTNSTEDVRAARRALAFEVDWFLDPIFFGEYPREMR  264

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTRE-EGFVG  774
             +IL S+LP+F+  + +KL     DFIGIN YT  YA+DC+YS C    A NT E    V 
Sbjct  265   EILSSNLPKFTPEE-KKLLQNKVDFIGINQYTAIYAKDCIYSPC----ALNTYEGNALVY  319

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG  IG+        V P  +E  V Y+  ++ +  +Y+TENGY   +  ++N+E
Sbjct  320   TTGVRNGAKIGKPTAFSTYFVVPESIESAVMYVNGRYKDTTIYITENGYSQHS--DTNME  377

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             +++ND +RV +   YL  L++A+RKGA+V GYF+WSL DNFEW FGYT + GLY  D  T
Sbjct  378   DLINDVERVNYLQGYLKYLSSAVRKGANVGGYFMWSLIDNFEWVFGYTIKFGLYHVDFDT  437

Query  413   LKRTPKLSAKWYKQFI  366
              +R PK+SAKWY+ F+
Sbjct  438   QERIPKMSAKWYRDFL  453



>ref|XP_007021332.1| Beta-glucosidase 45, putative [Theobroma cacao]
 gb|EOY12857.1| Beta-glucosidase 45, putative [Theobroma cacao]
Length=617

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 165/251 (66%), Gaps = 5/251 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q +QGG +G+      + P+ +   D  A +RA +F   W +DP+++G YP EM
Sbjct  259   LYREQFQPEQGGSLGLIAHSHMYEPLRDGEADLQAVKRALAFTVGWAIDPLVFGDYPPEM  318

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +   GS LP FS  + E +K G  DFIGINHY+T YA+DC++S C  ++ G+    GF  
Sbjct  319   RQYHGSELPRFSPEETEYVK-GSIDFIGINHYSTLYAKDCIHSHC--ALGGDHFIRGFAY  375

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G LIGE  G+    V P GMEK+V Y+ ++++N+P+YVTENGY    T    + 
Sbjct  376   TTGERDGILIGEPTGVERFYVVPRGMEKIVDYVSKRYNNMPIYVTENGYSPPQT--EQVP  433

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L+D  R+KF   YL ALA AIR GADVRGYF+WSL DNFEWT GY+   G+Y  DR T
Sbjct  434   DLLHDVNRIKFHRSYLAALARAIRNGADVRGYFVWSLMDNFEWTGGYSVTFGVYYVDRQT  493

Query  413   LKRTPKLSAKW  381
             LKRTPKLSAKW
Sbjct  494   LKRTPKLSAKW  504



>gb|EYU26405.1| hypothetical protein MIMGU_mgv1a004080mg [Erythranthe guttata]
Length=545

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/267 (48%), Positives = 172/267 (64%), Gaps = 9/267 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  ++ +  G + IA+    + P+T++  DK AA+RA +F   W LDP++YG YP+EM
Sbjct  261   LYRDQFKSKVDGLMSIAVCAFMYTPLTDNMYDKEAAKRALAFNVAWTLDPLVYGDYPQEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC---DPSMA-GNTRE-  789
             K+  GS LP FSS + E LK    DFIGINHY   YA+DC++S+C   D S   G+ R  
Sbjct  321   KNYHGSELPSFSSEEKELLK-DSIDFIGINHYGVLYAKDCVHSSCPCNDSSCTQGSDRPI  379

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              GFV  +  +NG  IGE  G+    V P GME +V Y+KE+++N  ++VTENGY   ++P
Sbjct  380   RGFVYTTGERNGIPIGERTGMSRFFVVPSGMEDIVDYVKERYNNKTMFVTENGY---SSP  436

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
             N   +   +D KR+++   YL  LA AIRKGADVRGYFIWSL DNFEW+ GY  + GLY 
Sbjct  437   NDEDDIYEHDVKRIQYHRSYLEYLAQAIRKGADVRGYFIWSLMDNFEWSSGYAIKFGLYH  496

Query  428   FDRVTLKRTPKLSAKWYKQFIAKNRKV  348
              DR+TL R PKLSA WY+ F+  +  V
Sbjct  497   IDRLTLNRIPKLSANWYRDFLGNSSIV  523



>gb|KGN59899.1| hypothetical protein Csa_3G852480 [Cucumis sativus]
Length=518

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 164/258 (64%), Gaps = 5/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q +QGG IGI +    + P+   + D  A +R  +F   W  DPI+YG YPKEM
Sbjct  253   LYRTHFQVKQGGSIGITISIQMYEPLDQQS-DTQAVDRILAFYVGWIYDPIVYGDYPKEM  311

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  D   +K G  DFI INHYTT YA+DC +S+C   +  N     FV 
Sbjct  312   REILGSELPSFSDEDKRYIK-GSLDFISINHYTTKYAKDCFHSSCPDEV--NRPINAFVE  368

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG LIG+  G+  + V P GMEK++ Y+K+++ N  ++VTENGY    +  + +E
Sbjct  369   TTPYRNGILIGDPMGIPGLYVVPRGMEKVINYIKQRYPNHSIFVTENGYSMRPSDGNKVE  428

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV-  417
              +LND KR+KF   YL ALA A+R G DVRGYFIWSL DNFEW  GY  R GL+  D + 
Sbjct  429   TILNDWKRIKFHKSYLAALARAMRNGGDVRGYFIWSLMDNFEWIRGYDTRFGLFYVDHLK  488

Query  416   TLKRTPKLSAKWYKQFIA  363
             TL+R PKLSA W+  F+ 
Sbjct  489   TLERRPKLSAHWFASFLG  506



>ref|XP_004147833.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=514

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 164/258 (64%), Gaps = 5/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q +QGG IGI +    + P+   + D  A +R  +F   W  DPI+YG YPKEM
Sbjct  249   LYRTHFQVKQGGSIGITISIQMYEPLDQQS-DTQAVDRILAFYVGWIYDPIVYGDYPKEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  D   +K G  DFI INHYTT YA+DC +S+C   +  N     FV 
Sbjct  308   REILGSELPSFSDEDKRYIK-GSLDFISINHYTTKYAKDCFHSSCPDEV--NRPINAFVE  364

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG LIG+  G+  + V P GMEK++ Y+K+++ N  ++VTENGY    +  + +E
Sbjct  365   TTPYRNGILIGDPMGIPGLYVVPRGMEKVINYIKQRYPNHSIFVTENGYSMRPSDGNKVE  424

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV-  417
              +LND KR+KF   YL ALA A+R G DVRGYFIWSL DNFEW  GY  R GL+  D + 
Sbjct  425   TILNDWKRIKFHKSYLAALARAMRNGGDVRGYFIWSLMDNFEWIRGYDTRFGLFYVDHLK  484

Query  416   TLKRTPKLSAKWYKQFIA  363
             TL+R PKLSA W+  F+ 
Sbjct  485   TLERRPKLSAHWFASFLG  502



>gb|EMT03996.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=471

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 168/268 (63%), Gaps = 17/268 (6%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y+KNYQ  QGG IGI +   W+ P+TN+T D  AA RA SF  +WFLDPI +G YP+EM 
Sbjct  216   YKKNYQGTQGGSIGIVIAMKWYEPLTNTTDDILAARRALSFEVDWFLDPIFFGDYPREMH  275

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVGQ  771
             ++L S+LP+F+S +   L+    DFIG+NHYT  Y +DC+ S C+            V  
Sbjct  276   ELLSSNLPKFTSEEKILLQKNHVDFIGVNHYTAIYVKDCISSPCNLETYETYEGNALVQA  335

Query  770   SLSKNGKLIGELAGL-GYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
             +  ++G  IG+     GY  V P GME++V Y+ +++ N P+YVTENGY   +  N+ ++
Sbjct  336   TGERDGVAIGKPTAFNGYYDV-PEGMEQIVKYVNQRYKNTPVYVTENGYSQHS--NNTMD  392

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E++ND +RV +   YL  L++A+RKGA+VRGYF+WS+ DNFEWT+G+T            
Sbjct  393   ELMNDGERVNYLQGYLTCLSSAVRKGANVRGYFVWSIIDNFEWTYGFT------------  440

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQL  330
              KRTPK+SAKWY+ F+  +R       L
Sbjct  441   -KRTPKMSAKWYRDFLVGSRPTNQVQTL  467



>ref|XP_006348229.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=538

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 166/264 (63%), Gaps = 6/264 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+++Q + GG IGI +    + P+ N+  D+ AA RA  F + W  DP+++G YP EM
Sbjct  251   LYREHFQPKHGGLIGIVVHSFMYKPLRNNDFDRDAANRAVLFTAAWVFDPLVHGDYPPEM  310

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSM-----AGNTRE  789
             +  L   LP F+S D  KL     DF+GINHY T YA+DC+YS+C  S       G+   
Sbjct  311   RKYLLDALPRFTS-DERKLIKDSIDFMGINHYGTLYAKDCIYSSCVCSNSSCIAGGDHPI  369

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              G++     K+G  IGE  G+    V P GME++V Y+K+++ N P++VTENGY      
Sbjct  370   HGYLITLAEKDGVSIGEPTGMSRFFVVPNGMEEIVDYMKKRYHNKPMFVTENGYASLNPT  429

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
              +  +E+ NDTKRV+F   YL +LA AIRKGADVRGYFIWSL DNFEWT GY  + GLY 
Sbjct  430   TAQADELQNDTKRVEFHKSYLASLARAIRKGADVRGYFIWSLMDNFEWTSGYELKFGLYY  489

Query  428   FDRVTLKRTPKLSAKWYKQFIAKN  357
              DR TL R PKLSAKWY  F+  N
Sbjct  490   VDRATLDRVPKLSAKWYTDFLTNN  513



>gb|KHN28049.1| Beta-glucosidase 18 [Glycine soja]
Length=529

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 167/267 (63%), Gaps = 5/267 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q +QGG IGI      + P+ +   D+ A +RA +F+  W LDP+++G YP EM
Sbjct  248   LYRKHFQAKQGGIIGIVTHTFMYEPLRDEECDRQAVKRALAFVVAWSLDPLVFGDYPPEM  307

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILGS LP FS  + + L  G  DFIGIN+Y T YA+DC  + C   +  +    GFV 
Sbjct  308   HSILGSQLPRFSPEE-KSLIKGSIDFIGINNYGTLYAKDCSLTAC--PLGTDRPIRGFVE  364

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              + +++G  IG+L G     V P G+EK+V Y+K ++ N+P+Y+TENGY     PN  ++
Sbjct  365   ATGTRDGIPIGDLTGNPRFFVVPRGLEKIVDYIKIRYHNMPMYITENGYSSPHKPNVTMD  424

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KR+ +   YL AL  AIRKGADVRGY IWSL DNFEWT GY  R GLY  DR T
Sbjct  425   DLLQDFKRIDYHKAYLAALLRAIRKGADVRGYMIWSLMDNFEWTSGYGVRYGLYYVDRHT  484

Query  413   LKRTPKLSAKWYKQFIAKNRKVESKMQ  333
             L+R PK S +W+  F+  N  + S  Q
Sbjct  485   LERIPKRSVQWFSSFL--NDTIHSNKQ  509



>ref|XP_009378508.1| PREDICTED: beta-glucosidase 18-like [Pyrus x bretschneideri]
Length=516

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 168/265 (63%), Gaps = 8/265 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  +  +Q G IGI      + P+ +   D+ AA+RA +F   W LDP++YG YP EM
Sbjct  249   IYRSFFWPKQQGFIGIVSSAFMYEPLRDEERDRLAADRALAFNVAWMLDPLIYGDYPAEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +   G  LP+FS+ + ++L  G  DFIG+NHY+T Y +DC+ STC PS  G+    GF+ 
Sbjct  309   RQCHGLALPKFSANE-KRLLRGSIDFIGVNHYSTLYVKDCINSTC-PS-GGDRPIRGFLN  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE  G  Y+ V P GME+++ YLK ++ N+P++VTENGY   T P    E
Sbjct  366   TTSYRDGVPIGEPTGTSYLFVVPRGMEEIIDYLKRRYHNVPMFVTENGY---TLPAQQNE  422

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
               L D  R+ F   YL +LA AIRKGA+VRGYFIWSL DNFEW  GYT R GLY  DR T
Sbjct  423   --LQDMGRINFHKAYLVSLARAIRKGANVRGYFIWSLMDNFEWLSGYTSRFGLYYVDRQT  480

Query  413   LKRTPKLSAKWYKQFIAKNRKVESK  339
             L+RTPKLSAKW+  F+  N   E +
Sbjct  481   LERTPKLSAKWFASFLKNNNHNEKE  505



>ref|XP_009605773.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 166/261 (64%), Gaps = 6/261 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+++Q + GG IGI +    + P+ N   D+ AA RA  F + W  DP++YG YP+EM
Sbjct  250   LYREHFQPKHGGMIGIVVHAFMYKPLRNDDFDRDAANRALVFTAAWVFDPLVYGYYPREM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSM-----AGNTRE  789
             ++ LGS LP F+S D  KL     DFIG+NHY T Y +DC+YS+C  S       G+   
Sbjct  310   REYLGSSLPTFTS-DERKLIKDSIDFIGVNHYGTLYVKDCIYSSCVCSNSSCIAGGDHPI  368

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              G++     K+G  IGE  G+    V P GME++V Y+K+++ N P++VTENGY      
Sbjct  369   HGYLITLGEKDGVPIGEPTGMPRFFVVPRGMEEIVDYMKKRYPNKPMFVTENGYSSLNPT  428

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
              +   E+ +D KRV+F   YL +LA AIRKGADVRGYFIWSL DNFEWT GY  + GLY 
Sbjct  429   TAQAAELQHDIKRVEFHKSYLASLARAIRKGADVRGYFIWSLMDNFEWTSGYEVKFGLYY  488

Query  428   FDRVTLKRTPKLSAKWYKQFI  366
              DR TL R PKLSAKWY+ F+
Sbjct  489   VDRSTLDRVPKLSAKWYRDFL  509



>ref|XP_007149593.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21587.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=530

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 163/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q++QGG IGI      + P+ +   D+ A +R  SF+ +W LDP+++G YP EM
Sbjct  249   LYRKHFQEKQGGVIGIVAHTFMYEPLRDEEYDRQAVKRVLSFVVSWCLDPLVFGEYPAEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP+FS  + + L  G SDFIGIN+Y T YA+DC  S C   +  +    GFV 
Sbjct  309   RSILGSQLPKFSHEE-KNLIKGSSDFIGINNYGTLYAKDCSLSAC--PIGADRPIRGFVE  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G     V P G+EK+V Y+K ++ N P+Y+TENGY     P+  + 
Sbjct  366   TTGIRDGIPIGDQTGNPRFFVVPSGLEKIVDYIKIRYHNRPMYITENGYSSPPKPDETVN  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KRV F   YL AL  AIRKGADVRGY IWSL DNFEW  GY  R GLY  +R T
Sbjct  426   DLLQDFKRVDFHKAYLAALLRAIRKGADVRGYMIWSLMDNFEWASGYGIRYGLYYVNRDT  485

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  486   LERIPKLSVQWFSSFL  501



>ref|NP_001148165.1| beta-glucosidase precursor [Zea mays]
 gb|ACG29990.1| beta-glucosidase [Zea mays]
Length=510

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 166/266 (62%), Gaps = 7/266 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ +Q G IGI M   WF+P+T++  D+ A ERA +F   WFLDPI+YG YP EM
Sbjct  249   IYKTKYQSKQKGLIGIVMSTVWFVPLTDAPADRLATERALAFDVPWFLDPIIYGDYPPEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYST--CDPSMAGNTREEGF  780
             + +LGS LP FS  +  KL  G  DFIGINHYTT YA+DC++S   C PS  G    +  
Sbjct  309   RRLLGSRLPTFSPEERRKLSYG-LDFIGINHYTTLYARDCMFSPGYC-PS--GQEFHQSL  364

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP-NS  603
                +  ++G  IG    +    V P G+EKMVTY+  ++SN+P+++TENGY        +
Sbjct  365   AAYTGERDGIPIGPPTAMPTFYVVPDGIEKMVTYIMNRYSNLPMFITENGYAQGGDGYTT  424

Query  602   NIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFD  423
               E+ L+D  R+++   YL  LA  I  GADVRGYFIWSL DNFEW +GYT R GL+  D
Sbjct  425   RAEDWLDDQGRIQYLEGYLAKLAKVISDGADVRGYFIWSLIDNFEWLYGYTLRFGLHYVD  484

Query  422   RVTLKRTPKLSAKWYKQFIAKNRKVE  345
               T +R PK SA WYK+F+  + + +
Sbjct  485   YQTQERKPKSSALWYKRFLQSSLEAQ  510



>ref|XP_007149594.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
 gb|ESW21588.1| hypothetical protein PHAVU_005G082900g [Phaseolus vulgaris]
Length=526

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 158/256 (62%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK +Q +QGG IGI      + P  N   D+ A +R  +F+  W LDP+++G YP EM
Sbjct  261   LYRKQFQAKQGGTIGIVAHTFMYEPFRNEECDRQAVKRVLAFVIAWVLDPLVFGEYPAEM  320

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
               ILG+ LP FS  + ++L  G  DFIGINHY + YA+DC  S C  S   +    GFV 
Sbjct  321   HSILGNQLPVFSPEE-KRLIKGSLDFIGINHYGSLYAKDCSLSAC--SQGADHPITGFVE  377

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G+    V P GMEK+V Y+K ++ N+P+Y+TENGYC     +  + 
Sbjct  378   TTGIRDGIPIGDQTGMPLFFVVPMGMEKIVDYIKIRYHNMPMYITENGYCLPLKQDVTVN  437

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +L D KR+ +   YL AL  AIRKGADVRGY IWSL DNFEW  GY  R GLY  DR T
Sbjct  438   YLLQDFKRIDYHKAYLAALLRAIRKGADVRGYMIWSLLDNFEWARGYDMRFGLYYVDRNT  497

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  498   LERIPKLSVQWFSSFL  513



>gb|KEH38756.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=528

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 163/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK+YQ +Q G +GI      + P+ +   D+ A  RA +F+  W LDP+++G YP EM
Sbjct  249   LYRKHYQAKQAGTVGIVAHTFMYEPLRDEECDRQATNRALAFVIGWLLDPLVFGEYPAEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILG+ LP+ S+ +   L+ G  DFIGIN+Y   YA+DC  STC    A   R  GF+ 
Sbjct  309   RSILGNRLPKISTKEKSLLR-GSLDFIGINNYGALYAKDCYLSTCPLEAARPIR--GFLE  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G+    V P GMEK+V Y+K K+ N+P+Y+TENGY      +  + 
Sbjct  366   TTGMRDGIPIGDQTGMPRFFVVPKGMEKIVDYIKIKYQNLPMYITENGYSSPLNASMTMH  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L+D KR+++   YL AL  AIRKGADVRGY +WSLFDNFEW  GY  R GLY  DR T
Sbjct  426   DLLHDFKRIEYHKAYLAALLRAIRKGADVRGYMVWSLFDNFEWNSGYNVRFGLYYVDRQT  485

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  486   LERIPKLSVEWFSSFL  501



>ref|XP_007149591.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 ref|XP_007149592.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21585.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
 gb|ESW21586.1| hypothetical protein PHAVU_005G082800g [Phaseolus vulgaris]
Length=532

 Score =   242 bits (618),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 163/256 (64%), Gaps = 3/256 (1%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YRK++Q++QGG IGI      + P+ +   D+ A +R  SF+ +W LDP+++G YP EM
Sbjct  249   LYRKHFQEKQGGVIGIVAHTFMYEPLRDEEYDRQAVKRVLSFVVSWCLDPLVFGEYPAEM  308

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             + ILGS LP+FS  + + L  G SDFIGIN+Y T YA+DC  S C   +  +    GFV 
Sbjct  309   RSILGSQLPKFSHEE-KNLIKGSSDFIGINNYGTLYAKDCSLSAC--PIGADRPIRGFVE  365

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IG+  G     V P G+EK+V Y+K ++ N P+Y+TENGY     P+  + 
Sbjct  366   TTGIRDGIPIGDQTGNPRFFVVPSGLEKIVDYIKIRYHNRPMYITENGYSSPPKPDETVN  425

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             ++L D KRV F   YL AL  AIRKGADVRGY IWSL DNFEW  GY  R GLY  +R T
Sbjct  426   DLLQDFKRVDFHKAYLAALLRAIRKGADVRGYMIWSLMDNFEWASGYGIRYGLYYVNRDT  485

Query  413   LKRTPKLSAKWYKQFI  366
             L+R PKLS +W+  F+
Sbjct  486   LERIPKLSVQWFSSFL  501



>ref|XP_004976203.1| PREDICTED: beta-glucosidase 16-like [Setaria italica]
Length=518

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 167/258 (65%), Gaps = 10/258 (4%)
 Frame = -2

Query  1130  YRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEMK  951
             Y++NYQ +QGG IGI +   W+ P+TN+T D  AA RA SF   WFLDPI +G YP  M+
Sbjct  248   YKENYQAKQGGSIGIVIAMKWYEPLTNTTEDILAARRAQSFELEWFLDPIFFGDYPSHMR  307

Query  950   DILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSM-AGNTREEGFVG  774
             +IL S+LP F+S + +KL    SDFIG+N YT  YA+DC++S CD S   GN      V 
Sbjct  308   EILRSNLPTFTSEE-KKLLQYKSDFIGLNLYTAIYAKDCIHSPCDLSTYEGN----ALVF  362

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G +IG    LG   V P  +E  + Y+ +++ + P+YV+ENGY   +  +   E
Sbjct  363   ATGERDGVMIGGDTALGGFYVVPQAVEPAIMYVNQRYKDTPVYVSENGYSQWS--DVGRE  420

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ--FDR  420
             E++ND +R+ +   Y+  L+ AIR GADVRGYF+W+L DNFEWTFGYT R GLY   FD 
Sbjct  421   ELINDVERLNYLQGYVTHLSRAIRNGADVRGYFVWTLMDNFEWTFGYTVRFGLYHVDFDT  480

Query  419   VTLKRTPKLSAKWYKQFI  366
                 RTP++SA+WY+ F+
Sbjct  481   PERTRTPRMSARWYRSFL  498



>ref|XP_009768487.1| PREDICTED: beta-glucosidase 18-like [Nicotiana sylvestris]
Length=530

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 164/261 (63%), Gaps = 6/261 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q + GG IGI +    + P+ N   D+ AA RA  F + W  DP++YG YP+EM
Sbjct  250   LYRERFQSKHGGLIGIVVHAFMYKPLRNDDFDRDAANRALVFTAAWVFDPLVYGYYPREM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSM-----AGNTRE  789
             +  LGS LP F+S D  KL     DFIG+NHY T YA+DC+YS+C  S       G+   
Sbjct  310   RQYLGSSLPRFTS-DERKLIKDSIDFIGVNHYGTLYAKDCIYSSCVCSNSSCIAGGDHPI  368

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              G++     K+G  IGE  G+    V P GME++V Y+K+++ N P++VTENGY      
Sbjct  369   HGYLITLGEKDGVPIGEPTGMPRFFVVPRGMEEIVDYMKKRYPNKPMFVTENGYSSLNPT  428

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
              +   E+ +D KRV+F   YL +LA AIRKGADVRGYFIWSL DNFEW  GY  + GLY 
Sbjct  429   TAQAAELQHDIKRVEFHKSYLASLARAIRKGADVRGYFIWSLMDNFEWASGYELKFGLYY  488

Query  428   FDRVTLKRTPKLSAKWYKQFI  366
              DR TL R PKLSAKWY+ F+
Sbjct  489   VDRSTLNRVPKLSAKWYRDFL  509



>emb|CDP05879.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 165/264 (63%), Gaps = 9/264 (3%)
 Frame = -2

Query  1133  IYRKNYQQ---QQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYP  963
             +YR+ +Q    +QGG IG+ +    + P+T+  +D+ AA R  +F   W  DP+++G YP
Sbjct  262   LYREQFQASRAKQGGTIGLVVSTHMYEPLTDDELDREAASRGLAFYVGWSFDPVVFGDYP  321

Query  962   KEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTC-----DPSMAGN  798
              EM+   GS LP F+S D  +L    SDF+G+NHY T YA+DC++S+C       S  G+
Sbjct  322   PEMRRYHGSELPTFTS-DERQLMRDSSDFLGLNHYATLYAKDCIHSSCTCFVQSCSPGGD  380

Query  797   TREEGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDT  618
                 GFV  +  ++G  IGE  G     V P GME+ V Y+KE++ N P+++TENGY   
Sbjct  381   RAIRGFVSTTGFRDGVAIGEPTGNPRFFVVPRGMEEAVDYIKERYHNKPMFITENGYSSP  440

Query  617   TTPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLG  438
                   ++++ +D KRV +   YL+ALA AIR GADVRGYFIWSL DNFEWT GY  + G
Sbjct  441   KGQQEQVDDLQHDIKRVAYHKSYLSALARAIRNGADVRGYFIWSLIDNFEWTDGYDIKFG  500

Query  437   LYQFDRVTLKRTPKLSAKWYKQFI  366
             LY  DRVT+ R PK SAKWY+ F+
Sbjct  501   LYAVDRVTMDRIPKSSAKWYRDFL  524



>dbj|BAO04172.1| hypothetical protein [Delphinium grandiflorum]
Length=525

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 157/256 (61%), Gaps = 4/256 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+KNYQ +Q G I I    + ++P+T+S  D+ AA RA +F + W LDP++ G YP EM
Sbjct  244   IYKKNYQAKQRGFISIVPNASMYVPLTDSKEDREAANRALAFCAPWILDPLILGKYPSEM  303

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +  LG  LP+FS  +   LK    DFI INHY T YA+DC++S+CD    G    +GFV 
Sbjct  304   RKYLGDQLPKFSPEEKAMLK-DSLDFISINHYVTLYAKDCIHSSCD---TGGHAVQGFVY  359

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  KNG  IGE        + P G+   + Y+K +++N PLYV ENG C    P     
Sbjct  360   TTGEKNGIPIGERTAFYRFFIIPDGIRMAIEYIKARYNNRPLYVLENGICQENEPLELNG  419

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
             E+L D +RV +   YL A+  AIR GADVR YF+WSL DNFEW  GYT R GLY  D  T
Sbjct  420   ELLQDRQRVNYHKAYLAAVNRAIRDGADVRSYFVWSLLDNFEWASGYTYRYGLYYVDYKT  479

Query  413   LKRTPKLSAKWYKQFI  366
             LKRTPKLSAKWY  F+
Sbjct  480   LKRTPKLSAKWYSNFL  495



>ref|XP_009605772.1| PREDICTED: beta-glucosidase 18-like isoform X2 [Nicotiana tomentosiformis]
Length=436

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 169/266 (64%), Gaps = 9/266 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q +QGG IG+      + PMT+   D  AA RA +F   W LDP++YG YP EM
Sbjct  162   LYRRQFQTEQGGMIGMVASAYMYKPMTDDEADTKAATRALAFHVAWLLDPLVYGDYPIEM  221

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPS------MAGNTR  792
             ++  G  LP+FSS + ++L    +DFIG+NHYTT++ +DCL+S C  +        G  R
Sbjct  222   REYHGKKLPKFSSEE-KRLIKNSTDFIGLNHYTTWFVKDCLHSNCTCTDTDVLCTHGENR  280

Query  791   E-EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTT  615
                GF+  +  K+G  IG+  G+  + V P GME++V Y+ ++++N P++VTENGY    
Sbjct  281   AIGGFLLITGQKDGASIGDPMGMPGVYVVPQGMEEIVDYVNKRYNNTPIFVTENGYASNE  340

Query  614   TPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGL  435
                   + +  D KR+K+   YL +LA +IR GADVRGYFIWSL DNFEW FGYT + GL
Sbjct  341   NQGGGYD-LDQDMKRIKYHKAYLASLARSIRNGADVRGYFIWSLMDNFEWRFGYTIKFGL  399

Query  434   YQFDRVTLKRTPKLSAKWYKQFIAKN  357
             Y  D +TL R+PKLSA+WYK F+  +
Sbjct  400   YHVDPLTLDRSPKLSAQWYKNFLTNS  425



>ref|XP_008454668.1| PREDICTED: beta-glucosidase 18-like [Cucumis melo]
Length=519

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 167/258 (65%), Gaps = 5/258 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR ++Q++QGG IGI +    + P+ +  +D+ AA+R  +F   W  DPI+YG YPK+M
Sbjct  256   LYRTHFQEKQGGSIGITISMQMYEPL-DQQLDRKAADRFLAFHVGWIYDPIVYGDYPKKM  314

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             ++ILGS LP FS  D + +K G  DFI INHYTT Y +DC +S+C  +   N     F  
Sbjct  315   REILGSELPSFSDEDKKYIK-GSLDFISINHYTTKYVKDCFHSSC--TDEANRPINAFTE  371

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  +NG LIG+  G+  + V P GMEK++ Y+K+K+ N  ++VTENGY   T+  + +E
Sbjct  372   TTPYRNGILIGDQMGMPGLYVVPRGMEKVINYIKQKYPNQSIFVTENGYSMPTSDGNKVE  431

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRV-  417
             +++ND KR+KF   YL ALA A+R G  VRGYF WSL DNFEW  GY  R GL+  D + 
Sbjct  432   DIVNDWKRIKFHKSYLAALAKAMRNGGHVRGYFAWSLMDNFEWIRGYDTRFGLFYVDHLK  491

Query  416   TLKRTPKLSAKWYKQFIA  363
             TL+R PKLSA W+  F+ 
Sbjct  492   TLERRPKLSAHWFTSFLG  509



>ref|XP_010274443.1| PREDICTED: beta-glucosidase 18-like [Nelumbo nucifera]
Length=522

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 166/259 (64%), Gaps = 4/259 (2%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR  YQQ+QGG IGI +    + P+ +  VD+ A  RA +F  +  LDP+++G YP EM
Sbjct  243   LYRSRYQQKQGGSIGIVVNTAMYEPLRDEAVDREAVSRALAFYVSGVLDPLIHGDYPPEM  302

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREEGFVG  774
             +  LG+ LP+FS  + + L  G  DFIGINHY++ YA+DC+ S C P+   +    GFV 
Sbjct  303   RHHLGARLPKFSVEESKALN-GSIDFIGINHYSSLYAKDCINSPC-PTGESHAFL-GFVY  359

Query  773   QSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPNSNIE  594
              +  ++G  IGE   +    + P G+EKMV Y+K +++N P +VTENG      P    E
Sbjct  360   TTGFRDGVAIGEPTPMPRFFIVPDGLEKMVEYIKTRYNNKPTFVTENGIAQLDQPGQR-E  418

Query  593   EVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFDRVT  414
              +L+D KRV+F   YL +LA AIR GADVRGYF+WSL DNFEWT G+  R GLY  D  T
Sbjct  419   VLLHDNKRVEFLKGYLASLARAIRNGADVRGYFVWSLMDNFEWTNGFRMRFGLYYVDYQT  478

Query  413   LKRTPKLSAKWYKQFIAKN  357
             L+RTPKLSAKWY+ F+  N
Sbjct  479   LERTPKLSAKWYRDFLTPN  497



>ref|XP_004160619.1| PREDICTED: beta-glucosidase 18-like [Cucumis sativus]
Length=527

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 168/278 (60%), Gaps = 7/278 (3%)
 Frame = -2

Query  1133  IYRKNYQ----QQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSY  966
             IYR  +Q    ++QGG IG+      + P+TN+  D  A +RA  F   W  DPI+YG Y
Sbjct  249   IYRTQFQVYVVEKQGGSIGLVAYCHMYEPLTNNEFDLQAVDRALIFSFAWVYDPIVYGDY  308

Query  965   PKEMKDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPSMAGNTREE  786
             PKEM+++ GS LP FS+T+   +K G  D+I +NHYTT YA+DCL+S C  S  G+   +
Sbjct  309   PKEMREVFGSQLPSFSNTEKNIIK-GSLDYICVNHYTTLYAKDCLHSPC--SNGGDRPIK  365

Query  785   GFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTPN  606
             GF+     +N   IG+  G+    V P G+EK + Y+ +++ N P++VTENGY    +  
Sbjct  366   GFLDTMGYRNSVSIGDPTGMDRFFVVPRGLEKTINYINQRYPNKPIFVTENGYSTPPSDG  425

Query  605   SNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQF  426
             + +E+++NDTKRV F  +YL +L  A+R GADVRGYF+WSL DN EW  G+  R GL   
Sbjct  426   NKVEDIINDTKRVNFHRNYLASLVRAMRNGADVRGYFVWSLMDNLEWIHGFNTRFGLVYV  485

Query  425   DRVTLKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILH  312
             D  TL+R PKLSA W+   +  N +  S +   N   H
Sbjct  486   DFQTLERRPKLSAHWFASLLGGNLQHSSSILNKNTFDH  523



>ref|XP_011098338.1| PREDICTED: beta-glucosidase 18-like [Sesamum indicum]
Length=549

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 171/281 (61%), Gaps = 9/281 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ ++ +  G I I +L   + P+T    DK AA RA +F   W LDP+++G YP EM
Sbjct  270   LYRERFKSKVNGVISITVLAFMYTPLTEDEADKEAANRALAFNVAWVLDPLVFGDYPPEM  329

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDP-----SMAGNTRE  789
             K I GS LP FS  + E L+    D+IGINHY T YA+DC++STC       +  G+   
Sbjct  330   KRIHGSELPRFSLEERELLR-DSVDYIGINHYGTLYAKDCIHSTCSCNESSCTQGGDRPI  388

Query  788   EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP  609
              GFV  +  ++G  IGE  G+    V P G+E +V Y+K+++ N P+ VTENGY   ++P
Sbjct  389   RGFVATTGVRDGVTIGEPTGMSRFFVVPRGLEDIVRYIKDRYHNKPMIVTENGY---SSP  445

Query  608   NSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQ  429
              +  +   +D KR+ +   YL  LA A+R GADVRGYFIWSL DNFEW+ GYT + G+Y+
Sbjct  446   GNEDDIYKHDVKRIHYHQSYLAHLAQAVRNGADVRGYFIWSLLDNFEWSNGYTAKFGIYR  505

Query  428   FDRVTLKRTPKLSAKWYKQFIAKNRKVESKMQLGNMILHQN  306
              DR TL R PKLSA WY+ F+  +  ++  +      +H++
Sbjct  506   VDRQTLNRIPKLSAVWYRDFLRNSSLIDVHLSSTVSGVHRD  546



>ref|NP_001140717.1| beta-glucosidase precursor [Zea mays]
 gb|ACF84449.1| unknown [Zea mays]
 gb|AFW58838.1| beta-glucosidase [Zea mays]
Length=511

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 164/266 (62%), Gaps = 7/266 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IY+  YQ +Q G IGI M   WF+P+T++  D+ A ERA +F   WFLDPI+YG YP EM
Sbjct  250   IYKTKYQSKQKGLIGIVMSTVWFVPLTDAPADRLATERALAFDVPWFLDPIIYGDYPPEM  309

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYST--CDPSMAGNTREEGF  780
             + +LGS LP FS  +   L  G  DFIGINHYTT YA+DC+ S   C PS  G    +  
Sbjct  310   RRLLGSRLPTFSPEERRTLGYG-LDFIGINHYTTLYARDCMISPGYC-PS--GQEFHQSL  365

Query  779   VGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTTTP-NS  603
                +  ++G  IG    +    V P G+EKMVTY+  ++SN+P+++TENGY        +
Sbjct  366   AAYTGERDGIPIGPPTAMPTFYVVPDGIEKMVTYIMNRYSNLPMFITENGYAQGGDGYTT  425

Query  602   NIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGLYQFD  423
               E+ L+D  R+++   YL  LA  I  GADVRGYFIWSL DNFEW +GYT R GL+  D
Sbjct  426   RAEDWLDDQGRIQYLEGYLAKLAKVISDGADVRGYFIWSLIDNFEWLYGYTLRFGLHYVD  485

Query  422   RVTLKRTPKLSAKWYKQFIAKNRKVE  345
               T +R PK SA WYK+F+  + + +
Sbjct  486   YQTQERKPKSSALWYKRFLQSSLEAQ  511



>ref|XP_006348383.1| PREDICTED: beta-glucosidase 18-like [Solanum tuberosum]
Length=458

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 167/265 (63%), Gaps = 14/265 (5%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             IYR  +Q++QGG IG+      + PMT++  D  A  RA +F   W LDP++YG YP EM
Sbjct  185   IYRDQFQEKQGGTIGMVASAYMYKPMTDNEADNKATNRALAFHVAWLLDPLVYGDYPIEM  244

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDP-------SMAGNT  795
             +  LG+ LP FSS + + L    +DFIG+NHYTT++ +DCL S C         +   N 
Sbjct  245   RHYLGTKLPIFSSEE-KILIKNSTDFIGLNHYTTWFVKDCLNSNCTCMESDVLCTHGENR  303

Query  794   REEGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTT  615
                G+V  +  K+G  IG+  G+  + V P GME +V Y+ ++++N+P++VTENGY    
Sbjct  304   AIRGYVLITGQKDGAYIGDQMGMPGVYVVPQGMEDIVDYVNKRYNNLPIFVTENGYAS--  361

Query  614   TPNSNIEE--VLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRL  441
               N N EE  +  D KR+K+   YL +LA +IR GADVRGYF+WSL DNFEW FG+T + 
Sbjct  362   --NENQEEYDMDQDRKRIKYHKAYLASLARSIRNGADVRGYFVWSLMDNFEWRFGHTVKF  419

Query  440   GLYQFDRVTLKRTPKLSAKWYKQFI  366
             GLY  DR +L R+PKLSA W++ F+
Sbjct  420   GLYHVDRFSLNRSPKLSAHWFRDFL  444



>ref|XP_009605771.1| PREDICTED: beta-glucosidase 18-like isoform X1 [Nicotiana tomentosiformis]
Length=531

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 169/266 (64%), Gaps = 9/266 (3%)
 Frame = -2

Query  1133  IYRKNYQQQQGGEIGIAMLFTWFLPMTNSTVDKAAAERAHSFLSNWFLDPIMYGSYPKEM  954
             +YR+ +Q +QGG IG+      + PMT+   D  AA RA +F   W LDP++YG YP EM
Sbjct  257   LYRRQFQTEQGGMIGMVASAYMYKPMTDDEADTKAATRALAFHVAWLLDPLVYGDYPIEM  316

Query  953   KDILGSHLPEFSSTDLEKLKAGGSDFIGINHYTTYYAQDCLYSTCDPS------MAGNTR  792
             ++  G  LP+FSS + ++L    +DFIG+NHYTT++ +DCL+S C  +        G  R
Sbjct  317   REYHGKKLPKFSSEE-KRLIKNSTDFIGLNHYTTWFVKDCLHSNCTCTDTDVLCTHGENR  375

Query  791   E-EGFVGQSLSKNGKLIGELAGLGYIAVYPPGMEKMVTYLKEKFSNIPLYVTENGYCDTT  615
                GF+  +  K+G  IG+  G+  + V P GME++V Y+ ++++N P++VTENGY    
Sbjct  376   AIGGFLLITGQKDGASIGDPMGMPGVYVVPQGMEEIVDYVNKRYNNTPIFVTENGYASNE  435

Query  614   TPNSNIEEVLNDTKRVKFFADYLNALATAIRKGADVRGYFIWSLFDNFEWTFGYTKRLGL  435
                   + +  D KR+K+   YL +LA +IR GADVRGYFIWSL DNFEW FGYT + GL
Sbjct  436   NQGGGYD-LDQDMKRIKYHKAYLASLARSIRNGADVRGYFIWSLMDNFEWRFGYTIKFGL  494

Query  434   YQFDRVTLKRTPKLSAKWYKQFIAKN  357
             Y  D +TL R+PKLSA+WYK F+  +
Sbjct  495   YHVDPLTLDRSPKLSAQWYKNFLTNS  520



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2725021258018