BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25766_g1_i12 len=292 path=[16160:0-104 16265:105-291]

Length=292
                                                                      Score     E

ref|XP_009772309.1|  PREDICTED: glutamate receptor 3.6-like             136   3e-36   
ref|XP_006340926.1|  PREDICTED: glutamate receptor 3.6-like             138   3e-35   
ref|XP_009605827.1|  PREDICTED: glutamate receptor 3.6-like             136   9e-35   
ref|XP_010316484.1|  PREDICTED: glutamate receptor 3.6 isoform X2       133   2e-33   
ref|XP_004232576.1|  PREDICTED: glutamate receptor 3.6 isoform X1       132   2e-33   
ref|XP_010316485.1|  PREDICTED: glutamate receptor 3.6 isoform X3       132   2e-33   
emb|CDP01776.1|  unnamed protein product                                120   4e-29   
ref|XP_011100274.1|  PREDICTED: glutamate receptor 3.3                  114   5e-27   
ref|XP_010266353.1|  PREDICTED: glutamate receptor 3.6-like             112   4e-26   
ref|XP_007203997.1|  hypothetical protein PRUPE_ppa001054mg             111   6e-26   
ref|XP_002306436.1|  glutamate receptor family protein                  111   7e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010110512.1|  Glutamate receptor 3.6                             110   2e-25   
gb|KDO85164.1|  hypothetical protein CISIN_1g002309mg                   109   2e-25   
gb|KDO85161.1|  hypothetical protein CISIN_1g002309mg                   109   4e-25   
ref|XP_006435401.1|  hypothetical protein CICLE_v10000195mg             109   4e-25   
gb|KDO85163.1|  hypothetical protein CISIN_1g002309mg                   108   5e-25   
gb|KDO85160.1|  hypothetical protein CISIN_1g002309mg                   108   5e-25   
ref|XP_006473826.1|  PREDICTED: glutamate receptor 3.3-like isofo...    108   6e-25   
ref|XP_007203996.1|  hypothetical protein PRUPE_ppa000995mg             108   7e-25   
ref|XP_008337897.1|  PREDICTED: glutamate receptor 3.6-like             108   7e-25   
gb|ABO28526.1|  glutamate receptor                                      108   8e-25   Malus hupehensis
ref|XP_011022199.1|  PREDICTED: glutamate receptor 3.6-like isofo...    108   1e-24   
ref|XP_011022202.1|  PREDICTED: glutamate receptor 3.6-like isofo...    107   1e-24   
ref|XP_010266233.1|  PREDICTED: glutamate receptor 3.3-like isofo...    107   1e-24   
ref|XP_008241916.1|  PREDICTED: glutamate receptor 3.6-like isofo...    107   3e-24   
ref|XP_008241921.1|  PREDICTED: glutamate receptor 3.6-like isofo...    107   3e-24   
ref|XP_004134824.1|  PREDICTED: glutamate receptor 3.6-like             106   3e-24   
ref|XP_004158839.1|  PREDICTED: glutamate receptor 3.6-like             106   3e-24   
ref|XP_007203235.1|  hypothetical protein PRUPE_ppa001033mg             106   4e-24   
ref|XP_010266234.1|  PREDICTED: glutamate receptor 3.3-like isofo...    105   6e-24   
ref|XP_008245275.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    105   1e-23   
ref|XP_009359613.1|  PREDICTED: glutamate receptor 3.6-like isofo...    105   1e-23   
ref|XP_009359612.1|  PREDICTED: glutamate receptor 3.6-like isofo...    105   1e-23   
ref|XP_009359614.1|  PREDICTED: glutamate receptor 3.6-like isofo...    105   1e-23   
ref|XP_002276999.1|  PREDICTED: glutamate receptor 3.6                  105   1e-23   Vitis vinifera
emb|CBI21566.3|  unnamed protein product                                105   1e-23   
ref|XP_010266235.1|  PREDICTED: glutamate receptor 3.3-like isofo...    105   1e-23   
ref|XP_010266230.1|  PREDICTED: glutamate receptor 3.3-like isofo...    105   1e-23   
ref|XP_008337900.1|  PREDICTED: glutamate receptor 3.6-like             104   2e-23   
ref|XP_011034846.1|  PREDICTED: glutamate receptor 3.3-like isofo...    103   2e-23   
ref|XP_009369789.1|  PREDICTED: glutamate receptor 3.6-like             104   2e-23   
ref|XP_011034842.1|  PREDICTED: glutamate receptor 3.3-like isofo...    103   3e-23   
ref|XP_002521736.1|  glutamate receptor 3 plant, putative               103   3e-23   Ricinus communis
ref|XP_011034844.1|  PREDICTED: glutamate receptor 3.3-like isofo...    103   4e-23   
ref|XP_002301908.2|  Glutamate receptor 3.3 precursor family protein    103   4e-23   Populus trichocarpa [western balsam poplar]
gb|KHG10460.1|  Glutamate receptor 3.6 -like protein                    103   5e-23   
ref|XP_007203104.1|  hypothetical protein PRUPE_ppa023817mg             103   6e-23   
ref|XP_009392853.1|  PREDICTED: glutamate receptor 3.1-like isofo...    102   7e-23   
ref|XP_009359611.1|  PREDICTED: glutamate receptor 3.6-like             102   7e-23   
ref|XP_009392852.1|  PREDICTED: glutamate receptor 3.1-like isofo...    102   9e-23   
ref|XP_011034843.1|  PREDICTED: glutamate receptor 3.3-like isofo...    102   1e-22   
gb|KDP36767.1|  hypothetical protein JCGZ_08058                         102   1e-22   
ref|XP_011022201.1|  PREDICTED: glutamate receptor 3.6-like isofo...    100   4e-22   
gb|AET03597.2|  glutamate receptor 3.2                                  100   6e-22   
ref|XP_004289031.1|  PREDICTED: glutamate receptor 3.3-like           99.0    7e-22   
ref|XP_008786666.1|  PREDICTED: glutamate receptor 3.1                  100   7e-22   
ref|XP_008440927.1|  PREDICTED: glutamate receptor 3.6 isoform X2     99.8    8e-22   
ref|XP_008440920.1|  PREDICTED: glutamate receptor 3.6 isoform X1     99.8    9e-22   
ref|XP_002272859.2|  PREDICTED: glutamate receptor 3.3                99.8    9e-22   Vitis vinifera
emb|CBI40741.3|  unnamed protein product                              99.8    1e-21   
gb|KDP43782.1|  hypothetical protein JCGZ_22409                       99.8    1e-21   
ref|XP_009359749.1|  PREDICTED: glutamate receptor 3.6-like           99.4    1e-21   
ref|XP_010923968.1|  PREDICTED: glutamate receptor 3.4-like           99.0    1e-21   
gb|EYU41186.1|  hypothetical protein MIMGU_mgv1a000937mg              99.0    2e-21   
ref|XP_006425257.1|  hypothetical protein CICLE_v10024813mg           99.0    2e-21   
ref|XP_006467103.1|  PREDICTED: glutamate receptor 3.6-like isofo...  98.6    2e-21   
gb|KDO71521.1|  hypothetical protein CISIN_1g002301mg                 98.6    3e-21   
gb|KDO71522.1|  hypothetical protein CISIN_1g002301mg                 98.6    3e-21   
gb|KHG26328.1|  Glutamate receptor 3.3 -like protein                  98.2    3e-21   
ref|XP_006425260.1|  hypothetical protein CICLE_v10024825mg           97.4    3e-21   
gb|KDO71523.1|  hypothetical protein CISIN_1g002301mg                 97.8    3e-21   
ref|NP_174978.1|  glutamate receptor 3.3                              97.8    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAR27949.1|  GLR3.3                                                97.8    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452999.1|  PREDICTED: glutamate receptor 3.3 isoform X1     97.8    4e-21   
ref|XP_006425259.1|  hypothetical protein CICLE_v10024825mg           97.1    4e-21   
gb|KDO71515.1|  hypothetical protein CISIN_1g002505mg                 97.1    4e-21   
ref|XP_007135963.1|  hypothetical protein PHAVU_009G006500g           97.8    5e-21   
gb|KDO71514.1|  hypothetical protein CISIN_1g002505mg                 97.8    5e-21   
gb|KDO71518.1|  hypothetical protein CISIN_1g002505mg                 96.7    5e-21   
ref|XP_004145549.1|  PREDICTED: glutamate receptor 3.3-like           97.4    5e-21   
ref|XP_006425261.1|  hypothetical protein CICLE_v10024825mg           97.4    5e-21   
ref|XP_007018099.1|  Glutamate receptor 3.3 isoform 6                 97.4    6e-21   
ref|XP_006467097.1|  PREDICTED: glutamate receptor 3.6-like isofo...  97.4    6e-21   
ref|XP_006467099.1|  PREDICTED: glutamate receptor 3.6-like isofo...  96.7    6e-21   
ref|XP_007018096.1|  Glutamate receptor 3.3 isoform 3                 97.4    6e-21   
ref|XP_007018094.1|  Glutamate receptor 3.3 isoform 1                 97.4    6e-21   
ref|XP_010266236.1|  PREDICTED: glutamate receptor 3.2-like           97.4    6e-21   
ref|XP_010530328.1|  PREDICTED: glutamate receptor 3.3                97.4    6e-21   
ref|XP_004287716.1|  PREDICTED: glutamate receptor 3.3-like           97.4    6e-21   
ref|XP_006425263.1|  hypothetical protein CICLE_v10024825mg           96.7    8e-21   
ref|XP_008804475.1|  PREDICTED: glutamate receptor 3.1-like isofo...  97.1    9e-21   
ref|XP_007046473.1|  Glutamate receptor 3.6                           97.1    9e-21   
ref|XP_007018097.1|  Glutamate receptor 3.3 isoform 4                 96.7    9e-21   
ref|XP_008804484.1|  PREDICTED: glutamate receptor 3.1-like isofo...  97.1    9e-21   
ref|XP_003533409.1|  PREDICTED: glutamate receptor 3.3-like isofo...  96.7    1e-20   
ref|XP_007203444.1|  hypothetical protein PRUPE_ppa022019mg           96.7    1e-20   
ref|XP_010918356.1|  PREDICTED: glutamate receptor 3.1                96.3    1e-20   
ref|XP_006383781.1|  hypothetical protein POPTR_0005s27520g           95.9    1e-20   
ref|XP_008235912.1|  PREDICTED: glutamate receptor 3.2-like           96.3    2e-20   
ref|XP_010103244.1|  Glutamate receptor 3.6                           96.3    2e-20   
ref|XP_008337899.1|  PREDICTED: glutamate receptor 3.6-like           96.3    2e-20   
ref|XP_007046475.1|  Glutamate receptor isoform 2                     95.5    2e-20   
ref|XP_008237957.1|  PREDICTED: glutamate receptor 3.3                95.9    2e-20   
ref|XP_010680624.1|  PREDICTED: glutamate receptor 3.6-like           95.9    2e-20   
emb|CDY70557.1|  BnaC08g46160D                                        95.1    2e-20   
ref|XP_006342151.1|  PREDICTED: glutamate receptor 3.3-like isofo...  95.9    2e-20   
ref|XP_007046474.1|  Glutamate receptor isoform 1                     95.9    2e-20   
ref|XP_010094542.1|  Glutamate receptor 3.3                           95.9    2e-20   
ref|XP_006383780.1|  hypothetical protein POPTR_0005s27520g           95.1    2e-20   
ref|XP_007202847.1|  hypothetical protein PRUPE_ppa014700mg           95.5    2e-20   
ref|XP_002891241.1|  predicted protein                                95.5    2e-20   
ref|XP_008803655.1|  PREDICTED: glutamate receptor 3.5-like           95.5    2e-20   
ref|XP_002306988.2|  Glutamate receptor 3.3 precursor family protein  95.5    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009786331.1|  PREDICTED: glutamate receptor 3.3 isoform X1     95.5    3e-20   
ref|XP_006403911.1|  hypothetical protein EUTSA_v10010111mg           95.1    3e-20   
ref|XP_009786332.1|  PREDICTED: glutamate receptor 3.3 isoform X2     94.7    3e-20   
ref|XP_007200076.1|  hypothetical protein PRUPE_ppa021130mg           95.1    3e-20   
gb|AFW69814.1|  hypothetical protein ZEAMMB73_405216                  95.1    4e-20   
ref|XP_006855692.1|  hypothetical protein AMTR_s00044p00137040        95.1    4e-20   
ref|XP_010680623.1|  PREDICTED: glutamate receptor 3.6-like           95.1    4e-20   
ref|XP_010240316.1|  PREDICTED: glutamate receptor 3.1-like           95.1    4e-20   
ref|XP_002510703.1|  glutamate receptor 3 plant, putative             95.1    4e-20   Ricinus communis
dbj|BAJ34460.1|  unnamed protein product                              93.6    5e-20   
ref|XP_008645171.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...  94.7    5e-20   
ref|XP_009618635.1|  PREDICTED: glutamate receptor 3.3-like           94.7    5e-20   
ref|XP_007156250.1|  hypothetical protein PHAVU_003G270600g           94.4    5e-20   
ref|XP_011041194.1|  PREDICTED: glutamate receptor 3.3-like           94.7    6e-20   
ref|XP_009107640.1|  PREDICTED: glutamate receptor 3.3 isoform X1     94.7    6e-20   
ref|XP_008241924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...  94.4    6e-20   
ref|XP_006306244.1|  hypothetical protein CARUB_v10012075mg           94.4    6e-20   
ref|XP_007043076.1|  Glutamate receptor 2 isoform 2                   94.4    6e-20   
ref|XP_007043075.1|  Glutamate receptor 2 isoform 1                   94.4    7e-20   
ref|XP_009107641.1|  PREDICTED: glutamate receptor 3.3 isoform X2     94.0    7e-20   
emb|CDY68928.1|  BnaA08g29720D                                        93.2    7e-20   
ref|XP_007203978.1|  hypothetical protein PRUPE_ppa025247mg           94.0    7e-20   
ref|XP_004161019.1|  PREDICTED: glutamate receptor 3.2-like           93.6    9e-20   
ref|XP_008373417.1|  PREDICTED: glutamate receptor 3.3                94.0    9e-20   
ref|XP_004144891.1|  PREDICTED: glutamate receptor 3.2-like           94.0    9e-20   
gb|KGN43348.1|  hypothetical protein Csa_7G025200                     94.0    9e-20   
ref|XP_010550509.1|  PREDICTED: glutamate receptor 3.6 isoform X2     93.6    1e-19   
ref|XP_004154082.1|  PREDICTED: glutamate receptor 3.2-like           93.6    1e-19   
ref|XP_007043077.1|  Glutamate receptor 2 isoform 3                   93.2    1e-19   
ref|XP_010550505.1|  PREDICTED: glutamate receptor 3.6 isoform X1     93.6    1e-19   
gb|AFW66756.1|  hypothetical protein ZEAMMB73_452909                  93.2    1e-19   
dbj|BAL15056.1|  glutamate receptor 3.3                               93.2    2e-19   
ref|XP_003527293.1|  PREDICTED: glutamate receptor 3.3-like isofo...  93.2    2e-19   
ref|XP_004238633.2|  PREDICTED: glutamate receptor 3.3                93.2    2e-19   
ref|XP_009372603.1|  PREDICTED: glutamate receptor 3.3-like           92.8    2e-19   
ref|XP_009418664.1|  PREDICTED: glutamate receptor 3.3-like           92.8    2e-19   
ref|XP_011087613.1|  PREDICTED: glutamate receptor 3.2-like isofo...  92.8    2e-19   
ref|XP_010923978.1|  PREDICTED: glutamate receptor 3.5-like           92.0    3e-19   
ref|XP_010478979.1|  PREDICTED: glutamate receptor 3.3-like           92.4    3e-19   
ref|XP_010500221.1|  PREDICTED: glutamate receptor 3.3                92.4    3e-19   
gb|KCW56490.1|  hypothetical protein EUGRSUZ_I02216                   92.0    4e-19   
ref|XP_010029575.1|  PREDICTED: glutamate receptor 3.6                92.0    4e-19   
ref|XP_008447826.1|  PREDICTED: glutamate receptor 3.2                92.0    4e-19   
ref|XP_010935350.1|  PREDICTED: glutamate receptor 3.1                91.7    5e-19   
ref|XP_011087614.1|  PREDICTED: glutamate receptor 3.2-like isofo...  91.7    6e-19   
ref|XP_004952125.1|  PREDICTED: glutamate receptor 3.1-like isofo...  91.7    6e-19   
ref|XP_004500848.1|  PREDICTED: glutamate receptor 3.3-like isofo...  91.3    7e-19   
gb|EEC72350.1|  hypothetical protein OsI_05591                        91.3    7e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010267710.1|  PREDICTED: glutamate receptor 3.5-like isofo...  91.3    8e-19   
ref|NP_001045687.1|  Os02g0117500                                     91.3    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115834.1|  PREDICTED: glutamate receptor 3.6 isoform X1     91.3    8e-19   
ref|XP_004952127.1|  PREDICTED: glutamate receptor 3.1-like isofo...  91.3    8e-19   
ref|XP_006396004.1|  hypothetical protein EUTSA_v10003614mg           90.9    1e-18   
gb|KEH36348.1|  glutamate receptor 3.2                                90.5    1e-18   
emb|CDX73718.1|  BnaC08g22850D                                        90.9    1e-18   
ref|XP_010267713.1|  PREDICTED: glutamate receptor 3.5-like isofo...  90.9    1e-18   
ref|XP_006577929.1|  PREDICTED: glutamate receptor 3.3-like           90.9    1e-18   
gb|KEH36347.1|  glutamate receptor 3.2                                90.5    1e-18   
ref|XP_009115836.1|  PREDICTED: glutamate receptor 3.6 isoform X2     90.9    1e-18   
ref|XP_010267711.1|  PREDICTED: glutamate receptor 3.5-like isofo...  90.9    1e-18   
ref|XP_010267709.1|  PREDICTED: glutamate receptor 3.5-like isofo...  90.5    1e-18   
ref|XP_004512282.1|  PREDICTED: glutamate receptor 3.6-like isofo...  90.5    1e-18   
ref|XP_004512281.1|  PREDICTED: glutamate receptor 3.6-like isofo...  90.5    2e-18   
ref|XP_007156252.1|  hypothetical protein PHAVU_003G270800g           90.5    2e-18   
ref|XP_010507397.1|  PREDICTED: glutamate receptor 3.6-like           89.7    2e-18   
ref|XP_003603849.1|  Glutamate-gated kainate-type ion channel rec...  90.1    2e-18   
gb|KEH36346.1|  glutamate receptor 3.2                                90.1    2e-18   
gb|KEH36349.1|  glutamate receptor 3.2                                89.7    2e-18   
gb|KHG21169.1|  Glutamate receptor 3.2 -like protein                  90.1    2e-18   
emb|CAN64711.1|  hypothetical protein VITISV_043726                   90.1    2e-18   Vitis vinifera
ref|XP_010686867.1|  PREDICTED: glutamate receptor 3.3                90.1    2e-18   
ref|XP_011092253.1|  PREDICTED: glutamate receptor 3.2-like           89.7    2e-18   
ref|XP_004290072.1|  PREDICTED: glutamate receptor 3.2-like           89.7    3e-18   
ref|XP_002279899.1|  PREDICTED: glutamate receptor 3.2                89.4    3e-18   Vitis vinifera
emb|CBI37733.3|  unnamed protein product                              89.7    3e-18   
ref|XP_008230073.1|  PREDICTED: glutamate receptor 3.4-like           89.4    3e-18   
gb|EEE56178.1|  hypothetical protein OsJ_05129                        89.0    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010426707.1|  PREDICTED: glutamate receptor 3.6-like isofo...  89.0    5e-18   
ref|XP_010496956.1|  PREDICTED: glutamate receptor 3.6-like           88.2    5e-18   
ref|XP_010090700.1|  Glutamate receptor 3.2                           89.0    5e-18   
ref|XP_010426717.1|  PREDICTED: glutamate receptor 3.6-like isofo...  89.0    5e-18   
ref|XP_008241922.1|  PREDICTED: glutamate receptor 3.6-like           89.0    5e-18   
ref|XP_009340816.1|  PREDICTED: glutamate receptor 3.2-like           88.2    5e-18   
ref|XP_010530965.1|  PREDICTED: glutamate receptor 3.2-like           89.0    6e-18   
ref|XP_007156251.1|  hypothetical protein PHAVU_003G270800g           88.6    6e-18   
ref|XP_007204033.1|  hypothetical protein PRUPE_ppa020695mg           88.6    7e-18   
ref|XP_003533408.1|  PREDICTED: glutamate receptor 3.3-like           88.6    7e-18   
gb|EMT17124.1|  Glutamate receptor 3.1                                88.6    7e-18   
emb|CAB63012.1|  putative glutamate receptor                          88.6    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292183.1|  hypothetical protein CARUB_v10018389mg           88.6    8e-18   
ref|XP_010515560.1|  PREDICTED: glutamate receptor 3.6-like isofo...  88.2    8e-18   
ref|XP_003545055.1|  PREDICTED: glutamate receptor 3.2-like isofo...  88.6    8e-18   
ref|XP_010515561.1|  PREDICTED: glutamate receptor 3.6-like isofo...  88.2    8e-18   
ref|XP_003573352.1|  PREDICTED: glutamate receptor 3.1 isoform X1     88.2    8e-18   
gb|KDP47011.1|  hypothetical protein JCGZ_10738                       88.2    8e-18   
ref|NP_190716.3|  glutamate receptor 3.6                              88.2    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006595634.1|  PREDICTED: glutamate receptor 3.2-like isofo...  88.2    9e-18   
ref|XP_006364369.1|  PREDICTED: glutamate receptor 3.2-like           88.2    1e-17   
ref|XP_006595635.1|  PREDICTED: glutamate receptor 3.2-like isofo...  87.8    1e-17   
ref|XP_010270508.1|  PREDICTED: glutamate receptor 3.3-like isofo...  87.8    1e-17   
ref|XP_010270507.1|  PREDICTED: glutamate receptor 3.3-like isofo...  87.8    1e-17   
ref|XP_007217063.1|  hypothetical protein PRUPE_ppa001079mg           87.8    1e-17   
emb|CDP07274.1|  unnamed protein product                              87.8    1e-17   
ref|XP_008353536.1|  PREDICTED: glutamate receptor 3.4-like           87.4    2e-17   
gb|KDP43780.1|  hypothetical protein JCGZ_22407                       87.4    2e-17   
ref|XP_006646788.1|  PREDICTED: glutamate receptor 3.1-like           87.0    2e-17   
ref|XP_002451391.1|  hypothetical protein SORBIDRAFT_04g001290        86.7    3e-17   Sorghum bicolor [broomcorn]
ref|XP_010270512.1|  PREDICTED: glutamate receptor 3.2-like isofo...  86.7    3e-17   
gb|EMT06987.1|  Glutamate receptor 3.3                                86.7    3e-17   
ref|XP_010907850.1|  PREDICTED: glutamate receptor 3.4-like           86.7    3e-17   
ref|XP_011022198.1|  PREDICTED: glutamate receptor 3.6-like           86.7    3e-17   
ref|XP_010063139.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...  86.7    3e-17   
ref|XP_008666833.1|  PREDICTED: glutamate receptor 3.1-like           86.3    3e-17   
ref|XP_006657772.1|  PREDICTED: glutamate receptor 3.4-like           86.7    4e-17   
ref|XP_009121143.1|  PREDICTED: glutamate receptor 3.1 isoform X2     86.3    4e-17   
ref|XP_009353274.1|  PREDICTED: glutamate receptor 3.4-like isofo...  86.3    5e-17   
ref|XP_009108612.1|  PREDICTED: glutamate receptor 3.2-like isofo...  86.3    5e-17   
ref|XP_010270514.1|  PREDICTED: glutamate receptor 3.2-like isofo...  85.9    5e-17   
ref|XP_009353273.1|  PREDICTED: glutamate receptor 3.4-like isofo...  86.3    5e-17   
ref|XP_002306435.2|  hypothetical protein POPTR_0005s10560g           85.9    5e-17   Populus trichocarpa [western balsam poplar]
emb|CDX76331.1|  BnaA08g10690D                                        85.9    6e-17   
ref|XP_009108616.1|  PREDICTED: glutamate receptor 3.2-like isofo...  85.9    6e-17   
ref|XP_008667839.1|  PREDICTED: hypothetical protein isoform X2       85.9    6e-17   
ref|XP_009121142.1|  PREDICTED: glutamate receptor 3.1 isoform X1     85.9    6e-17   
ref|XP_009108617.1|  PREDICTED: glutamate receptor 3.2-like isofo...  85.9    6e-17   
ref|XP_008667836.1|  PREDICTED: hypothetical protein isoform X1       85.9    6e-17   
ref|XP_002520606.1|  glutamate receptor 3 plant, putative             85.5    7e-17   Ricinus communis
ref|XP_010548165.1|  PREDICTED: glutamate receptor 3.1-like isofo...  85.5    7e-17   
ref|XP_010426704.1|  PREDICTED: glutamate receptor 3.6 isoform X1     85.5    8e-17   
emb|CAN72607.1|  hypothetical protein VITISV_021339                   85.5    8e-17   Vitis vinifera
ref|XP_004509455.1|  PREDICTED: glutamate receptor 3.6-like isofo...  85.5    8e-17   
ref|XP_007142574.1|  hypothetical protein PHAVU_008G292200g           85.5    8e-17   
emb|CDY65624.1|  BnaCnng48020D                                        85.5    8e-17   
dbj|BAK04480.1|  predicted protein                                    85.1    9e-17   
ref|XP_009403107.1|  PREDICTED: glutamate receptor 3.5-like           85.1    1e-16   
emb|CDY24327.1|  BnaA07g02520D                                        85.1    1e-16   
gb|KEH39012.1|  glutamate receptor 3.2                                84.7    1e-16   
ref|XP_010426706.1|  PREDICTED: glutamate receptor 3.6 isoform X2     84.7    1e-16   
ref|XP_009401867.1|  PREDICTED: glutamate receptor 3.1-like           85.1    1e-16   
ref|XP_002876089.1|  ATGLR3.6                                         84.7    1e-16   
gb|EMT06356.1|  Glutamate receptor 3.1                                84.7    1e-16   
ref|XP_006486565.1|  PREDICTED: glutamate receptor 3.2-like isofo...  84.7    1e-16   
ref|XP_006422390.1|  hypothetical protein CICLE_v10027770mg           84.7    1e-16   
ref|XP_008379927.1|  PREDICTED: glutamate receptor 3.4-like           84.7    1e-16   
ref|XP_003596996.1|  Glutamate receptor 3.4                           84.7    2e-16   
gb|KGN48998.1|  hypothetical protein Csa_6G509670                     84.3    2e-16   
gb|KDO68418.1|  hypothetical protein CISIN_1g002211mg                 84.0    2e-16   
ref|XP_006422387.1|  hypothetical protein CICLE_v10027770mg           84.0    2e-16   
ref|XP_010515556.1|  PREDICTED: glutamate receptor 3.6-like isofo...  84.3    2e-16   
gb|KDO68407.1|  hypothetical protein CISIN_1g002211mg                 84.7    2e-16   
ref|XP_010503841.1|  PREDICTED: glutamate receptor 3.6-like isofo...  84.3    2e-16   
ref|XP_007156253.1|  hypothetical protein PHAVU_003G270900g           84.3    2e-16   
ref|XP_009341487.1|  PREDICTED: glutamate receptor 3.2-like           84.3    2e-16   
gb|EMS53869.1|  Glutamate receptor 3.3                                84.3    2e-16   
ref|XP_009333813.1|  PREDICTED: glutamate receptor 3.2-like           84.3    2e-16   
gb|KEH39010.1|  glutamate receptor 3.2                                84.0    2e-16   
ref|XP_010515558.1|  PREDICTED: glutamate receptor 3.6-like isofo...  84.0    2e-16   
ref|XP_008382743.1|  PREDICTED: glutamate receptor 3.2-like           84.0    2e-16   
ref|XP_010515559.1|  PREDICTED: glutamate receptor 3.6-like isofo...  84.0    3e-16   
ref|XP_011000874.1|  PREDICTED: glutamate receptor 3.2                84.0    3e-16   
gb|KDO68413.1|  hypothetical protein CISIN_1g002211mg                 84.0    3e-16   
ref|XP_006409331.1|  hypothetical protein EUTSA_v10022533mg           84.0    3e-16   
ref|XP_010503844.1|  PREDICTED: glutamate receptor 3.6-like isofo...  84.0    3e-16   
ref|XP_002313575.2|  Glutamate receptor 3.1 precursor family protein  84.0    3e-16   Populus trichocarpa [western balsam poplar]
dbj|BAK06938.1|  predicted protein                                    84.0    3e-16   
gb|EMS57750.1|  Glutamate receptor 3.3                                84.0    3e-16   
ref|XP_006858062.1|  hypothetical protein AMTR_s00062p00050250        83.6    4e-16   
gb|EMT00479.1|  Glutamate receptor 3.1                                84.0    4e-16   
ref|XP_003608170.1|  Glutamate receptor 3.6                           82.4    4e-16   
emb|CDY52597.1|  BnaCnng22760D                                        83.2    5e-16   
ref|XP_008348134.1|  PREDICTED: glutamate receptor 3.4-like           83.2    5e-16   
gb|KEH20344.1|  glutamate receptor 3.2                                82.4    6e-16   
ref|XP_003612376.1|  Glutamate receptor 3.6                           82.8    7e-16   
gb|KEH27628.1|  glutamate receptor 3.2                                82.8    7e-16   
ref|XP_009353269.1|  PREDICTED: glutamate receptor 3.4-like           82.8    8e-16   
ref|XP_003629123.1|  Glutamate receptor 3.6                           77.8    8e-16   
gb|EMT02755.1|  Glutamate receptor 3.3                                82.4    9e-16   
gb|KGN63257.1|  hypothetical protein Csa_2G418920                     82.4    9e-16   
ref|XP_008812265.1|  PREDICTED: glutamate receptor 3.4 isoform X1     82.4    9e-16   
gb|KHG05232.1|  Glutamate receptor 3.2 -like protein                  82.4    1e-15   
ref|XP_008377883.1|  PREDICTED: glutamate receptor 3.2-like           82.4    1e-15   
emb|CDX69127.1|  BnaC01g03260D                                        82.4    1e-15   
gb|KEH20342.1|  glutamate receptor 3.2                                82.0    1e-15   
emb|CDP16877.1|  unnamed protein product                              82.0    1e-15   
gb|AET03581.2|  glutamate receptor 3.2                                82.0    1e-15   
ref|XP_006412122.1|  hypothetical protein EUTSA_v10024351mg           82.0    1e-15   
ref|XP_009416682.1|  PREDICTED: glutamate receptor 3.4-like           82.0    1e-15   
ref|XP_009417233.1|  PREDICTED: glutamate receptor 3.4-like           82.0    1e-15   
ref|XP_003608177.1|  Glutamate receptor 3.1                           77.0    1e-15   
ref|XP_008455863.1|  PREDICTED: glutamate receptor 3.7-like           81.6    2e-15   
gb|KEH20343.1|  glutamate receptor 3.2                                81.3    2e-15   
emb|CAA18740.1|  putative protein                                     81.3    2e-15   
ref|XP_006296930.1|  hypothetical protein CARUB_v10012924mg           81.3    2e-15   
ref|XP_003563418.1|  PREDICTED: glutamate receptor 3.4                81.3    2e-15   
ref|XP_008379630.1|  PREDICTED: glutamate receptor 3.4                81.3    3e-15   
emb|CDP11785.1|  unnamed protein product                              80.9    3e-15   
gb|AAF21901.1|AF109392_1  ligand gated channel-like protein           80.9    3e-15   
ref|XP_010467485.1|  PREDICTED: glutamate receptor 3.1-like isofo...  80.9    3e-15   
ref|XP_010690551.1|  PREDICTED: glutamate receptor 3.2-like           80.9    3e-15   
ref|XP_010467484.1|  PREDICTED: glutamate receptor 3.1-like isofo...  80.9    3e-15   
pir||A84550  probable ligand-gated ion channel protein [imported]...  80.9    4e-15
gb|AAK13248.1|AF159498_1  putative glutamate receptor like-protein    80.5    4e-15   
ref|XP_009763348.1|  PREDICTED: glutamate receptor 3.2-like           80.5    4e-15   
ref|NP_567981.1|  glutamate receptor 3.2                              80.5    4e-15   
ref|XP_009608800.1|  PREDICTED: glutamate receptor 3.2-like           80.5    4e-15   
gb|AAL24126.1|  unknown protein                                       80.5    5e-15   
ref|XP_007045627.1|  Glutamate receptor isoform 1                     80.5    5e-15   
ref|NP_028351.2|  glutamate receptor                                  80.5    5e-15   
ref|XP_002524179.1|  glutamate receptor 3 plant, putative             80.1    6e-15   
ref|XP_009419590.1|  PREDICTED: glutamate receptor 3.5-like           80.1    6e-15   
sp|Q7XJL2.2|GLR31_ARATH  RecName: Full=Glutamate receptor 3.1; Sh...  79.7    7e-15   
gb|AAB92421.1|  ligand gated channel-like protein                     79.7    7e-15   
gb|AAR88099.1|  putative glutamate receptor ion channel               79.7    8e-15   
ref|XP_010423149.1|  PREDICTED: glutamate receptor 3.1-like           77.8    8e-15   
ref|XP_009103268.1|  PREDICTED: glutamate receptor 3.2                79.7    8e-15   
emb|CBI28943.3|  unnamed protein product                              79.7    9e-15   
emb|CDX75490.1|  BnaA01g02120D                                        79.0    9e-15   
emb|CAN66741.1|  hypothetical protein VITISV_021644                   79.3    1e-14   
ref|XP_002273744.3|  PREDICTED: glutamate receptor 3.4 isoform X1     79.3    1e-14   
ref|XP_004289164.1|  PREDICTED: glutamate receptor 3.4-like           79.3    1e-14   
gb|KCW55682.1|  hypothetical protein EUGRSUZ_I01532                   79.3    1e-14   
ref|XP_002884045.1|  predicted protein                                79.0    1e-14   
ref|XP_006447547.1|  hypothetical protein CICLE_v10014190mg           79.0    1e-14   
ref|XP_004487403.1|  PREDICTED: glutamate receptor 3.4-like isofo...  79.0    1e-14   
gb|KHG01323.1|  Glutamate receptor 3.4 -like protein                  79.0    1e-14   
ref|XP_010690549.1|  PREDICTED: glutamate receptor 3.2-like           79.0    1e-14   
ref|XP_010028854.1|  PREDICTED: glutamate receptor 3.2-like isofo...  79.0    1e-14   
ref|XP_002869097.1|  hypothetical protein ARALYDRAFT_491120           79.0    2e-14   
dbj|BAK00799.1|  predicted protein                                    78.6    2e-14   
ref|XP_003517130.1|  PREDICTED: glutamate receptor 3.6-like isofo...  78.6    2e-14   
ref|XP_010657305.1|  PREDICTED: glutamate receptor 3.4 isoform X2     78.6    2e-14   
ref|XP_010657306.1|  PREDICTED: glutamate receptor 3.4 isoform X3     78.6    2e-14   
gb|EYU33298.1|  hypothetical protein MIMGU_mgv1a001051mg              78.6    2e-14   
gb|KHG17978.1|  Glutamate receptor 3.4 -like protein                  78.6    2e-14   
ref|XP_010028859.1|  PREDICTED: glutamate receptor 3.2-like isofo...  78.2    2e-14   
ref|XP_004976611.1|  PREDICTED: glutamate receptor 3.1-like           78.2    3e-14   
ref|XP_010276019.1|  PREDICTED: glutamate receptor 3.7-like isofo...  78.2    3e-14   
ref|XP_010276026.1|  PREDICTED: glutamate receptor 3.7-like isofo...  77.8    3e-14   
ref|XP_010276025.1|  PREDICTED: glutamate receptor 3.7-like isofo...  77.8    3e-14   
dbj|BAJ91183.1|  predicted protein                                    77.8    4e-14   
ref|XP_006467098.1|  PREDICTED: glutamate receptor 3.6-like isofo...  77.8    4e-14   
ref|XP_008230072.1|  PREDICTED: glutamate receptor 3.7                77.8    4e-14   
gb|KHN41219.1|  Glutamate receptor 3.4                                77.8    4e-14   
ref|XP_008341999.1|  PREDICTED: glutamate receptor 3.7-like           77.4    4e-14   
ref|XP_003527492.1|  PREDICTED: glutamate receptor 3.4-like isofo...  77.4    5e-14   
ref|XP_007158021.1|  hypothetical protein PHAVU_002G117500g           77.4    5e-14   
ref|XP_002460792.1|  hypothetical protein SORBIDRAFT_02g034960        77.4    6e-14   
gb|KDP25838.1|  hypothetical protein JCGZ_22868                       77.0    6e-14   
ref|XP_004289032.1|  PREDICTED: glutamate receptor 3.6-like           77.0    6e-14   
gb|AAQ02674.1|  glutamate receptor                                    77.0    7e-14   
ref|XP_004966221.1|  PREDICTED: glutamate receptor 3.5-like           77.0    7e-14   
gb|AGN92471.1|  glutamate receptor 1                                  77.0    7e-14   
ref|XP_007158020.1|  hypothetical protein PHAVU_002G117500g           77.0    7e-14   
ref|XP_002273713.1|  PREDICTED: glutamate receptor 3.7                77.0    7e-14   
ref|NP_001059814.1|  Os07g0522600                                     76.3    8e-14   
gb|KHN12498.1|  Glutamate receptor 3.6                                76.6    9e-14   
ref|XP_010237639.1|  PREDICTED: glutamate receptor 3.5-like isofo...  76.6    9e-14   
gb|KHN33784.1|  Glutamate receptor 3.3                                76.6    9e-14   
ref|XP_003547880.2|  PREDICTED: glutamate receptor 3.6-like           76.6    9e-14   
ref|XP_010276016.1|  PREDICTED: glutamate receptor 3.4-like           76.6    1e-13   
gb|AFW69063.1|  hypothetical protein ZEAMMB73_044126                  76.6    1e-13   
ref|XP_008644923.1|  PREDICTED: glutamate receptor 3.4-like isofo...  76.6    1e-13   
ref|XP_003563011.1|  PREDICTED: glutamate receptor 3.4-like isofo...  76.3    1e-13   
ref|XP_002524180.1|  glutamate receptor 3 plant, putative             76.3    1e-13   
gb|KHN35947.1|  Glutamate receptor 3.6                                76.3    1e-13   
ref|XP_010109511.1|  Glutamate receptor 3.4                           76.3    1e-13   
ref|XP_010237634.1|  PREDICTED: glutamate receptor 3.4-like isofo...  76.3    1e-13   
ref|XP_010432300.1|  PREDICTED: glutamate receptor 3.2                76.3    1e-13   
ref|XP_008644922.1|  PREDICTED: glutamate receptor 3.4-like isofo...  76.3    1e-13   
ref|XP_003539503.1|  PREDICTED: glutamate receptor 3.4-like isofo...  75.9    2e-13   
ref|NP_001058687.1|  Os07g0103100                                     75.9    2e-13   
ref|XP_008242065.1|  PREDICTED: glutamate receptor 3.6-like           75.9    2e-13   
gb|EAZ02474.1|  hypothetical protein OsI_24580                        75.9    2e-13   
ref|XP_010440065.1|  PREDICTED: glutamate receptor 3.2-like           72.0    2e-13   
gb|KHN41809.1|  Glutamate receptor 3.6                                75.9    2e-13   
ref|XP_009589003.1|  PREDICTED: glutamate receptor 3.4 isoform X1     75.5    2e-13   
ref|XP_006590755.1|  PREDICTED: glutamate receptor 3.6-like isofo...  75.5    2e-13   
gb|EAZ38031.1|  hypothetical protein OsJ_22375                        75.5    2e-13   
gb|EAZ02098.1|  hypothetical protein OsI_24185                        75.5    3e-13   
gb|EEE67292.1|  hypothetical protein OsJ_24491                        75.5    3e-13   
ref|XP_009399220.1|  PREDICTED: glutamate receptor 3.5-like           75.5    3e-13   
dbj|BAJ99508.1|  predicted protein                                    75.1    3e-13   
ref|XP_006652702.1|  PREDICTED: glutamate receptor 3.1-like isofo...  75.1    3e-13   
ref|XP_011079011.1|  PREDICTED: glutamate receptor 3.7                75.1    3e-13   
ref|XP_003540841.1|  PREDICTED: glutamate receptor 3.4-like isofo...  75.1    3e-13   
ref|XP_010437494.1|  PREDICTED: glutamate receptor 3.2-like           74.7    4e-13   
ref|XP_002437456.1|  hypothetical protein SORBIDRAFT_10g027420        74.7    4e-13   
ref|XP_009765706.1|  PREDICTED: glutamate receptor 3.7 isoform X1     74.7    5e-13   
ref|XP_008455424.1|  PREDICTED: glutamate receptor 3.7 isoform X1     74.3    6e-13   
emb|CDY49512.1|  BnaC05g03240D                                        74.3    6e-13   
ref|XP_004158559.1|  PREDICTED: glutamate receptor 3.4-like           73.9    7e-13   
ref|XP_004151885.1|  PREDICTED: glutamate receptor 3.4-like           73.9    7e-13   
ref|XP_010689636.1|  PREDICTED: glutamate receptor 3.4-like           73.9    7e-13   
ref|XP_004966219.1|  PREDICTED: glutamate receptor 3.4-like           73.9    8e-13   
ref|XP_002459199.1|  hypothetical protein SORBIDRAFT_02g000430        73.9    8e-13   
ref|XP_003596995.1|  Glutamate receptor 3.7                           73.9    9e-13   
ref|XP_007149971.1|  hypothetical protein PHAVU_005G114900g           73.9    9e-13   
ref|XP_009353277.1|  PREDICTED: glutamate receptor 3.7 isoform X2     73.6    9e-13   
ref|XP_008670454.1|  PREDICTED: glutamate receptor 3.4-like           73.6    1e-12   
ref|XP_004144586.1|  PREDICTED: glutamate receptor 3.7-like           73.6    1e-12   
ref|XP_010267707.1|  PREDICTED: glutamate receptor 3.7-like isofo...  73.6    1e-12   
ref|XP_010267706.1|  PREDICTED: glutamate receptor 3.7-like isofo...  73.6    1e-12   
gb|KHG04010.1|  Glutamate receptor 3.7 -like protein                  73.6    1e-12   
ref|XP_009118614.1|  PREDICTED: glutamate receptor 3.4-like           73.6    1e-12   
emb|CDY10044.1|  BnaC08g44070D                                        73.6    1e-12   
ref|XP_007045625.1|  Glutamate receptor isoform 6                     73.2    1e-12   
gb|KHN38860.1|  Glutamate receptor 3.6                                73.6    1e-12   
ref|XP_003533407.2|  PREDICTED: glutamate receptor 3.6-like isofo...  73.2    1e-12   
ref|XP_010475194.1|  PREDICTED: glutamate receptor 3.4-like isofo...  73.2    1e-12   
ref|XP_004957886.1|  PREDICTED: glutamate receptor 3.4-like           73.2    1e-12   
ref|XP_006367285.1|  PREDICTED: glutamate receptor 3.4-like isofo...  72.8    2e-12   
ref|XP_006657254.1|  PREDICTED: glutamate receptor 3.5-like           72.8    2e-12   
ref|XP_004487409.1|  PREDICTED: glutamate receptor 3.7-like           72.8    2e-12   
ref|XP_007045621.1|  Glutamate receptor isoform 2                     72.8    2e-12   
ref|XP_009765170.1|  PREDICTED: glutamate receptor 3.4                72.8    2e-12   
ref|XP_009119183.1|  PREDICTED: glutamate receptor 3.4                72.8    2e-12   
ref|XP_007045624.1|  Glutamate receptor isoform 5                     72.8    2e-12   
ref|XP_007045620.1|  Glutamate receptor isoform 1                     72.8    2e-12   
ref|XP_004243468.1|  PREDICTED: glutamate receptor 3.4 isoform X1     72.8    2e-12   
gb|EEC82165.1|  hypothetical protein OsI_26240                        72.8    2e-12   
ref|XP_009625694.1|  PREDICTED: glutamate receptor 3.4-like isofo...  72.4    2e-12   
ref|XP_009353276.1|  PREDICTED: glutamate receptor 3.7 isoform X1     72.4    3e-12   
gb|KDP43779.1|  hypothetical protein JCGZ_22406                       72.4    3e-12   
ref|XP_009589001.1|  PREDICTED: glutamate receptor 3.7 isoform X1     72.4    3e-12   
emb|CAH66856.1|  H0307D04.1                                           72.4    3e-12   
dbj|BAL15055.1|  glutamate receptor 3.2                               72.4    3e-12   
emb|CDY46839.1|  BnaA10g03230D                                        72.4    3e-12   
pir||T51137  ionotropic glutamate receptor homolog GLR4 [imported...  72.4    3e-12
ref|XP_003541946.1|  PREDICTED: glutamate receptor 3.7-like isofo...  72.0    3e-12   
gb|KDP25837.1|  hypothetical protein JCGZ_22867                       72.0    3e-12   
gb|KHN36533.1|  Glutamate receptor 3.7                                72.0    3e-12   
ref|XP_006594897.1|  PREDICTED: glutamate receptor 3.7-like isofo...  72.0    4e-12   
dbj|BAK02402.1|  predicted protein                                    72.0    4e-12   
dbj|BAH57236.1|  AT1G05200                                            71.6    4e-12   
emb|CDP11784.1|  unnamed protein product                              72.0    4e-12   
ref|XP_010463180.1|  PREDICTED: glutamate receptor 3.3-like           72.0    4e-12   
ref|XP_011008408.1|  PREDICTED: glutamate receptor 3.4 isoform X2     71.6    4e-12   
dbj|BAC42828.1|  putative ligand-gated ion channel protein            71.6    4e-12   
ref|NP_172012.2|  glutamate receptor 3.4                              71.6    5e-12   
gb|AAB71458.1|  Similar to Arabidopsis putative ion-channel PID:g...  71.6    5e-12   
dbj|BAC10393.1|  glutamate receptor, ionotropic kainate 5 precurs...  71.2    7e-12   
ref|XP_004987272.1|  PREDICTED: glutamate receptor 3.4-like           71.2    7e-12   
ref|XP_011008405.1|  PREDICTED: glutamate receptor 3.4 isoform X1     71.2    8e-12   
gb|EMS61084.1|  Glutamate receptor 3.4                                71.2    8e-12   
ref|XP_002437454.1|  hypothetical protein SORBIDRAFT_10g027370        70.9    9e-12   
sp|Q7XP59.1|GLR31_ORYSJ  RecName: Full=Glutamate receptor 3.1; Al...  70.9    9e-12   
ref|XP_010522331.1|  PREDICTED: glutamate receptor 3.4                70.9    9e-12   
ref|XP_010469597.1|  PREDICTED: glutamate receptor 3.5 isoform X3     70.5    1e-11   
ref|XP_008651910.1|  PREDICTED: glutamate receptor 3.4-like           70.5    1e-11   
ref|XP_010469595.1|  PREDICTED: glutamate receptor 3.5 isoform X1     70.5    1e-11   
ref|XP_006356918.1|  PREDICTED: glutamate receptor 3.4-like isofo...  70.1    1e-11   
ref|XP_006303896.1|  hypothetical protein CARUB_v10008205mg           70.1    2e-11   
ref|XP_006356916.1|  PREDICTED: glutamate receptor 3.4-like isofo...  70.1    2e-11   
ref|XP_010469598.1|  PREDICTED: glutamate receptor 3.5 isoform X4     70.1    2e-11   
ref|XP_002301627.1|  Glutamate receptor 3.5 precursor family protein  70.1    2e-11   
ref|XP_006303897.1|  hypothetical protein CARUB_v10008205mg           70.1    2e-11   
ref|XP_010515365.1|  PREDICTED: glutamate receptor 3.1                69.7    2e-11   
ref|XP_008644925.1|  PREDICTED: glutamate receptor 3.5-like isofo...  69.7    2e-11   
ref|XP_007217061.1|  hypothetical protein PRUPE_ppa001093mg           69.7    2e-11   
ref|XP_003540305.1|  PREDICTED: glutamate receptor 3.7-like isofo...  69.7    2e-11   
gb|KHN44876.1|  Glutamate receptor 3.7                                69.7    2e-11   
gb|KHN44877.1|  Glutamate receptor 3.4                                69.3    3e-11   
ref|XP_010446945.1|  PREDICTED: glutamate receptor 3.2-like           69.3    3e-11   
ref|XP_007132553.1|  hypothetical protein PHAVU_011G104300g           68.9    4e-11   
gb|AFW69068.1|  hypothetical protein ZEAMMB73_591659                  68.9    4e-11   
gb|EYU35042.1|  hypothetical protein MIMGU_mgv1a001148mg              68.9    4e-11   
ref|XP_011079012.1|  PREDICTED: glutamate receptor 3.4                68.6    5e-11   
gb|AAD47833.1|AF167355_1  ligand-gated channel-like protein precu...  68.2    7e-11   
ref|XP_011005110.1|  PREDICTED: glutamate receptor 3.4 isoform X2     68.2    8e-11   
sp|Q9SW97.2|GLR35_ARATH  RecName: Full=Glutamate receptor 3.5; Al...  68.2    9e-11   
gb|KHN36534.1|  hypothetical protein glysoja_001265                   66.2    9e-11   
ref|NP_001189655.1|  glutamate receptor 3.5                           67.8    1e-10   
ref|XP_004243469.1|  PREDICTED: glutamate receptor 3.7 isoform X1     67.8    1e-10   
ref|XP_003541945.1|  PREDICTED: glutamate receptor 3.4-like isofo...  67.4    1e-10   
ref|XP_009794414.1|  PREDICTED: glutamate receptor 3.4-like isofo...  67.4    1e-10   
ref|XP_010414004.1|  PREDICTED: glutamate receptor 3.5-like           67.4    2e-10   
ref|XP_010548171.1|  PREDICTED: glutamate receptor 3.1-like isofo...  67.0    2e-10   
ref|XP_007149970.1|  hypothetical protein PHAVU_005G114800g           67.0    2e-10   
ref|XP_002321123.2|  hypothetical protein POPTR_0014s15030g           67.0    2e-10   
ref|XP_011008403.1|  PREDICTED: glutamate receptor 3.7                67.0    2e-10   
ref|XP_004966220.1|  PREDICTED: glutamate receptor 3.5-like           67.0    2e-10   
gb|EYU43117.1|  hypothetical protein MIMGU_mgv1a000935mg              67.0    2e-10   
ref|XP_010510025.1|  PREDICTED: glutamate receptor 3.5-like isofo...  66.6    3e-10   
gb|KFK31128.1|  hypothetical protein AALP_AA6G071500                  66.6    3e-10   
ref|XP_010522333.1|  PREDICTED: glutamate receptor 3.7                66.6    3e-10   
ref|XP_010510026.1|  PREDICTED: glutamate receptor 3.5-like isofo...  66.6    3e-10   
ref|XP_002889538.1|  ATGLR3.4                                         66.2    3e-10   



>ref|XP_009772309.1| PREDICTED: glutamate receptor 3.6-like, partial [Nicotiana sylvestris]
Length=335

 Score =   136 bits (342),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 64/95 (67%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY GY  EGVNSTLSARP V+N+GC+L+  + VGK+TK+ +E AV+DINSNP+VLGGTKL
Sbjct  12   LYNGYSSEGVNSTLSARPKVVNVGCMLSFNTAVGKVTKVAVEAAVEDINSNPSVLGGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            ++  +D ++SG LGIVEAIR+METD +AIIGPQSS
Sbjct  72   NVISLDSNSSGFLGIVEAIRFMETDIMAIIGPQSS  106



>ref|XP_006340926.1| PREDICTED: glutamate receptor 3.6-like [Solanum tuberosum]
Length=976

 Score =   138 bits (347),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VLY GY  EGVNSTLSARP V+NIGC+L+  + VGKITK+  E AV+DINSNP V+GGTK
Sbjct  50   VLYNGYSSEGVNSTLSARPKVVNIGCMLSFSTLVGKITKIAAEAAVEDINSNPDVIGGTK  109

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++  +D + SG LGIVEAIR+METDT+AI+GPQSS
Sbjct  110  LNMITLDSNGSGFLGIVEAIRFMETDTMAIVGPQSS  145



>ref|XP_009605827.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605828.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605829.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
Length=936

 Score =   136 bits (343),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/95 (66%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G+  EGVNSTLSARP ++N+GC+L+  + VGKITK+ +E AV+DINSNP+VLGGTKL
Sbjct  12   LYNGHSSEGVNSTLSARPKIVNVGCMLSFNTVVGKITKVAVEAAVEDINSNPSVLGGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            ++  +D ++SG LGIVEAIR+METD +AIIGPQSS
Sbjct  72   NVATLDSNSSGFLGIVEAIRFMETDIMAIIGPQSS  106



>ref|XP_010316484.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Solanum lycopersicum]
Length=951

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VLY G   EGVNSTLSARP V+NIGC+++  + VGK+TK+  E AV+DINSNP VLGGTK
Sbjct  25   VLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEAAVEDINSNPDVLGGTK  84

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++  +D + SG LGIVEAIR+METDT+AI+GPQSS
Sbjct  85   LNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSS  120



>ref|XP_004232576.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Solanum lycopersicum]
 dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum]
Length=958

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VLY G   EGVNSTLSARP V+NIGC+++  + VGK+TK+  E AV+DINSNP VLGGTK
Sbjct  32   VLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEAAVEDINSNPDVLGGTK  91

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++  +D + SG LGIVEAIR+METDT+AI+GPQSS
Sbjct  92   LNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSS  127



>ref|XP_010316485.1| PREDICTED: glutamate receptor 3.6 isoform X3 [Solanum lycopersicum]
Length=937

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VLY G   EGVNSTLSARP V+NIGC+++  + VGK+TK+  E AV+DINSNP VLGGTK
Sbjct  11   VLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEAAVEDINSNPDVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++  +D + SG LGIVEAIR+METDT+AI+GPQSS
Sbjct  71   LNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSS  106



>emb|CDP01776.1| unnamed protein product [Coffea canephora]
Length=940

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G   +G N+ +S RP VLNIG ILTL S +GK+ K+ I+ AV+D+NS+PAVL GTKL+IT
Sbjct  15   GQFSKGFNTNVSGRPDVLNIGSILTLNSVIGKVAKVAIDAAVEDVNSSPAVLRGTKLNIT  74

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +D + SG LGIVEAIR+MET T+AIIGPQSS
Sbjct  75   TLDSNYSGFLGIVEAIRFMETQTMAIIGPQSS  106



>ref|XP_011100274.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100281.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100289.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100297.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
Length=935

 Score =   114 bits (286),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L  G L  G+++  S+RP+V+NIG I TL S +GK+ K+ IE AVKD+NSN +VL GTK
Sbjct  11   LLSFGVLSNGLSANASSRPAVVNIGAIFTLDSTIGKVAKIAIEEAVKDVNSNSSVLQGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++ I + + SG LG+VEA+RYMETD VA+IGPQSS
Sbjct  71   LNVDIRNSNCSGFLGLVEALRYMETDVVAVIGPQSS  106



>ref|XP_010266353.1| PREDICTED: glutamate receptor 3.6-like [Nelumbo nucifera]
Length=881

 Score =   112 bits (279),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y   L  GV +  S+RP+ +NIG IL+  S +GK+ K+ IE AV+D+NSN AVLGGTK
Sbjct  11   VCYFVALSYGVYTNASSRPAYVNIGAILSFNSTIGKVAKIAIEAAVEDVNSNSAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +T+ D   SG LGI+EA+++METDTVAI+GPQSS
Sbjct  71   LVLTMQDTRYSGFLGILEALKFMETDTVAIVGPQSS  106



>ref|XP_007203997.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
 gb|EMJ05196.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
Length=922

 Score =   111 bits (278),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    GV++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  11   VFYNGVASNGVSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LGIVEA+R+ME DTVAIIGPQ++
Sbjct  71   MIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNA  106



>ref|XP_002306436.1| glutamate receptor family protein [Populus trichocarpa]
 gb|EEE93432.1| glutamate receptor family protein [Populus trichocarpa]
Length=937

 Score =   111 bits (277),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    GV + ++ RP  +NIG +L+  S +GK+ K+ I+ AV D+NS+P+VLGGTK
Sbjct  11   VCYNGVCLNGVTTNVTTRPPFVNIGALLSYNSTIGKVAKVAIQAAVDDVNSDPSVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + +NSG LGIVE++++METDTVAIIGPQSS
Sbjct  71   LRLQMQNTNNSGFLGIVESLKFMETDTVAIIGPQSS  106



>ref|XP_010110512.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXC26730.1| Glutamate receptor 3.6 [Morus notabilis]
Length=961

 Score =   110 bits (275),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G N + S RPS++NIG I +L S +G++ K+ IE A++D+NS+P+VL GTKL IT+ D +
Sbjct  61   GTNVSSSVRPSIVNIGAIFSLNSLIGRVAKVAIEAAIEDVNSDPSVLRGTKLKITMQDSN  120

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LGI+EA+R+ME DTVAIIGPQ++
Sbjct  121  YSGFLGIIEALRFMEKDTVAIIGPQNA  147



>gb|KDO85164.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=640

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G   ++SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>gb|KDO85161.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
 gb|KDO85162.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=930

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G   ++SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>ref|XP_006435401.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
 gb|ESR48641.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
Length=930

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G   ++SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>gb|KDO85163.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=777

 Score =   108 bits (270),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G   ++SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>gb|KDO85160.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=938

 Score =   108 bits (271),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G   ++SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>ref|XP_006473826.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Citrus sinensis]
 ref|XP_006473827.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Citrus sinensis]
Length=930

 Score =   108 bits (271),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY G    G    +SARP+V+N+G + TL S +G++ K+ IE AVKD+NSN ++L GTKL
Sbjct  12   LYFGLFSFGYCKNVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVNSNSSILHGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +IT+   + SG +G+VEA+R+METD VAIIGPQ S
Sbjct  72   NITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCS  106



>ref|XP_007203996.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
 gb|EMJ05195.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
Length=937

 Score =   108 bits (270),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    G ++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  11   VFYNGVASNGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LGIVEA+R+ME DTVAIIGPQ++
Sbjct  71   MIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNA  106



>ref|XP_008337897.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
 ref|XP_008337898.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=946

 Score =   108 bits (270),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G    G ++T +S RP V+N+G I +  + +GK+ K+ IE AVKD+NS+P+VLGG
Sbjct  16   MIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVKDVNSDPSVLGG  75

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T+ D + SGLLGI+EA+R+ME DT+AIIGPQ++
Sbjct  76   TKMIVTMQDSNYSGLLGIIEALRFMEKDTIAIIGPQNA  113



>gb|ABO28526.1| glutamate receptor [Malus hupehensis]
Length=946

 Score =   108 bits (270),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G    G ++T +S RP V+N+G I +  + +GK+ K+ IE AVKD+NS+P+VLGG
Sbjct  16   MIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVKDVNSDPSVLGG  75

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T+ D + SGLLGI+EA+R+ME DT+AIIGPQ++
Sbjct  76   TKMIVTMQDSNYSGLLGIIEALRFMEKDTIAIIGPQNA  113



>ref|XP_011022199.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Populus euphratica]
Length=967

 Score =   108 bits (269),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G   +GV + ++ RP  +NIG +L+  + +GK+ K+ I+ AV D+NS+P+VLGGTK
Sbjct  41   VCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVDDVNSDPSVLGGTK  100

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG LGIVE++++METDTVAIIGPQSS
Sbjct  101  LRLQMQNANQSGFLGIVESLKFMETDTVAIIGPQSS  136



>ref|XP_011022202.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022203.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022204.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
Length=937

 Score =   107 bits (268),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G   +GV + ++ RP  +NIG +L+  + +GK+ K+ I+ AV D+NS+P+VLGGTK
Sbjct  11   VCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVDDVNSDPSVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG LGIVE++++METDTVAIIGPQSS
Sbjct  71   LRLQMQNANQSGFLGIVESLKFMETDTVAIIGPQSS  106



>ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=944

 Score =   107 bits (268),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -2

Query  291  PVLY-CGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            P L+ C   C G     S+RPS +NIG I T  S +G++ K+ +E AV+D+NSN ++LGG
Sbjct  29   PFLFGCKTHCYGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGG  88

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TKL I + + + SG +GIVEA+++METDTVA++GPQSS
Sbjct  89   TKLAIKMQNSNCSGFVGIVEALQFMETDTVAVVGPQSS  126



>ref|XP_008241916.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241917.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241918.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
Length=937

 Score =   107 bits (266),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    G ++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  11   VFYNGVASNGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LGIVE +R+ME DTVAIIGPQ++
Sbjct  71   MIVQMQDSNYSGFLGIVEVLRFMEKDTVAIIGPQNA  106



>ref|XP_008241921.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Prunus mume]
Length=937

 Score =   107 bits (266),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    G ++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  11   VFYNGVASNGGSTNVSTRPKFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LGIVE +R+ME DTVAIIGPQ++
Sbjct  71   MIVQMQDSNYSGFLGIVEVLRFMEKDTVAIIGPQNA  106



>ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=932

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L+ G    G  + +S RP V+NIG + + RS +GK+ K+ +E A++D+NSNP+++GGTK
Sbjct  11   LLFSGSYSFGDGANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSNPSIMGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ D + SG LGI+E++R+MET T+AIIGPQ+S
Sbjct  71   LKLSLHDTNYSGFLGIIESLRFMETKTMAIIGPQNS  106



>ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=943

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L+ G    G  + +S RP V+NIG + + RS +GK+ K+ +E A++D+NSNP+++GGTK
Sbjct  11   LLFSGSYSFGDGANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSNPSIMGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ D + SG LGI+E++R+MET T+AIIGPQ+S
Sbjct  71   LKLSLHDTNYSGFLGIIESLRFMETKTMAIIGPQNS  106



>ref|XP_007203235.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
 gb|EMJ04434.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
Length=927

 Score =   106 bits (265),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            V Y G    G  ST +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGT
Sbjct  11   VFYKGVASNGGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGT  70

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            K+ + + D + SG LGIVEA+R+ME DTVAIIGPQ++
Sbjct  71   KMIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNA  107



>ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=928

 Score =   105 bits (263),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYC-GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            +++C G   +G     S+RPS +NIG I T  S +G++ K+ +E AV+D+NSN ++LGGT
Sbjct  14   MVFCSGVFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGT  73

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL I + + + SG +GIVEA+++METDTVA++GPQSS
Sbjct  74   KLAIKMQNSNCSGFVGIVEALQFMETDTVAVVGPQSS  110



>ref|XP_008245275.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=761

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y      G ++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  44   VFYNVVASNGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  103

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LGIVEA+R+ME DTVAIIGPQ++
Sbjct  104  MIVKMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNA  139



>ref|XP_009359613.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Pyrus x bretschneideri]
Length=942

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G    G ++T +S RP V+N+G I +  + +GK+ K+ IE AV+D+NS+P+VLGG
Sbjct  21   MIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVEDVNSDPSVLGG  80

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T  D + SGLLGI+EA+R+ME DT+AIIGPQ++
Sbjct  81   TKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNA  118



>ref|XP_009359612.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Pyrus x bretschneideri]
Length=946

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G    G ++T +S RP V+N+G I +  + +GK+ K+ IE AV+D+NS+P+VLGG
Sbjct  25   MIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVEDVNSDPSVLGG  84

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T  D + SGLLGI+EA+R+ME DT+AIIGPQ++
Sbjct  85   TKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNA  122



>ref|XP_009359614.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359616.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359617.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359618.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
Length=937

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G    G ++T +S RP V+N+G I +  + +GK+ K+ IE AV+D+NS+P+VLGG
Sbjct  16   MIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVEDVNSDPSVLGG  75

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T  D + SGLLGI+EA+R+ME DT+AIIGPQ++
Sbjct  76   TKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNA  113



>ref|XP_002276999.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
 ref|XP_010652906.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
Length=938

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V   G +  GV + +S+RPSV+NIG I +  S +GK+ K  +E AV+D+NS+P VLGGTK
Sbjct  11   VFLNGIISNGVGTNVSSRPSVVNIGAIFSFNSTIGKVAKFALEAAVQDVNSDPTVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +   D + SG   I+EA+++ME DTVAIIGPQSS
Sbjct  71   LKLRTQDTNFSGFGAIMEALQFMEGDTVAIIGPQSS  106



>emb|CBI21566.3| unnamed protein product [Vitis vinifera]
Length=936

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V   G +  GV + +S+RPSV+NIG I +  S +GK+ K  +E AV+D+NS+P VLGGTK
Sbjct  9    VFLNGIISNGVGTNVSSRPSVVNIGAIFSFNSTIGKVAKFALEAAVQDVNSDPTVLGGTK  68

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +   D + SG   I+EA+++ME DTVAIIGPQSS
Sbjct  69   LKLRTQDTNFSGFGAIMEALQFMEGDTVAIIGPQSS  104



>ref|XP_010266235.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=916

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -2

Query  273  YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITI  94
            +  +G     S+RPS +NIG I T  S +G++ K+ +E AV+D+NSN ++LGGTKL I +
Sbjct  39   FFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGTKLAIKM  98

Query  93   VDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + SG +GIVEA+++METDTVA++GPQSS
Sbjct  99   QNSNCSGFVGIVEALQFMETDTVAVVGPQSS  129



>ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010266231.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=947

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -2

Query  273  YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITI  94
            +  +G     S+RPS +NIG I T  S +G++ K+ +E AV+D+NSN ++LGGTKL I +
Sbjct  39   FFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGTKLAIKM  98

Query  93   VDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + SG +GIVEA+++METDTVA++GPQSS
Sbjct  99   QNSNCSGFVGIVEALQFMETDTVAVVGPQSS  129



>ref|XP_008337900.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=929

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/98 (49%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G+   G ++T +S RP V+ +G I +    +GK+ K+ IE AV+D+NS+P+VLGG
Sbjct  16   MIFCSGFASNGASTTNVSTRPDVVKLGAIFSFDXLIGKVAKVAIEAAVEDVNSDPSVLGG  75

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            TK+ +T+ D + SGLLG++EA+++ME DTVAIIGPQ S
Sbjct  76   TKMKVTMQDSNYSGLLGLIEALQFMENDTVAIIGPQFS  113



>ref|XP_011034846.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Populus euphratica]
Length=764

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  L++RP+V+NIG + T  S +G++ K+ I+ AVKD+N+N ++L GTKL++ + + +
Sbjct  59   GYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNVDVRNSN  118

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LG+VEA+R+METD VAIIGPQSS
Sbjct  119  CSGFLGMVEALRFMETDIVAIIGPQSS  145



>ref|XP_009369789.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369790.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369791.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369792.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=943

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = -2

Query  288  VLYC-GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            +++C G+   G ++T +S RP V+N+G I +  + +GK+ K+ IE AV+D+NS+P+VLGG
Sbjct  16   MIFCSGFASNGASTTNVSTRPDVVNLGAIFSFDTFIGKVAKVAIEAAVEDVNSDPSVLGG  75

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGP  10
            TK+ +T+ D + SGLLG++EA+R+ME DT+AIIGP
Sbjct  76   TKMRVTMKDSNYSGLLGLIEALRFMEEDTMAIIGP  110



>ref|XP_011034842.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Populus euphratica]
Length=969

 Score =   103 bits (258),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  L++RP+V+NIG + T  S +G++ K+ I+ AVKD+N+N ++L GTKL++ + + +
Sbjct  59   GYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNVDVRNSN  118

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LG+VEA+R+METD VAIIGPQSS
Sbjct  119  CSGFLGMVEALRFMETDIVAIIGPQSS  145



>ref|XP_002521736.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF40723.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=769

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            ++ RP  LN+G I++  + VGK+ ++ I+ AV D+NSNP++LGGT+L+I I D + SG L
Sbjct  12   VTTRPRRLNVGAIMSFNTTVGKVARIAIKAAVNDVNSNPSILGGTELNIKIQDTNYSGFL  71

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            GI+EA+R+ME DTVAIIGPQSS
Sbjct  72   GIIEALRFMEGDTVAIIGPQSS  93



>ref|XP_011034844.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
 ref|XP_011034845.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
Length=931

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  L++RP+V+NIG + T  S +G++ K+ I+ AVKD+N+N ++L GTKL++ + + +
Sbjct  21   GYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNVDVRNSN  80

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LG+VEA+R+METD VAIIGPQSS
Sbjct  81   CSGFLGMVEALRFMETDIVAIIGPQSS  107



>ref|XP_002301908.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE81181.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=931

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  L++RP+V+NIG + T  S +G++ K+ I+ AVKD+N+N ++L GTKL++ + + +
Sbjct  21   GYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNVDMRNSN  80

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LG+VEA+R+METD VAIIGPQSS
Sbjct  81   CSGFLGMVEALRFMETDIVAIIGPQSS  107



>gb|KHG10460.1| Glutamate receptor 3.6 -like protein [Gossypium arboreum]
Length=947

 Score =   103 bits (257),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = -2

Query  270  LCEGV--NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            +C G+  N+ +S RP+V+NIG I + ++ +GK  K+ IETA++D+NSNP +L GTKL + 
Sbjct  21   VCNGLPLNANVSGRPAVVNIGAIFSFKTVIGKAAKIAIETAIEDVNSNPDILPGTKLILQ  80

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + D + SG + +VEA+ +ME DTVAIIGPQSS
Sbjct  81   MKDSNYSGFMAVVEALLFMERDTVAIIGPQSS  112



>ref|XP_007203104.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
 gb|EMJ04303.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
Length=937

 Score =   103 bits (256),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G      ++ +S RP  +N+G + +  S VGK+ K+ IE A++D+NS+PAVLGGTK
Sbjct  11   VFYNGVASNRGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPAVLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + D + SG LG+VEA+R+ME DTVAIIGP+++
Sbjct  71   MIVQMQDSNYSGFLGVVEALRFMEKDTVAIIGPENA  106



>ref|XP_009392853.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=915

 Score =   102 bits (255),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  291  PVLYCGY-LCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            P+ +C + +  G   ++S+RP+V+++G I T  S +G++ K+ I+ A +D+NS+P VL G
Sbjct  7    PLFFCLFSITSGATRSVSSRPAVVHVGAIFTFNSTIGRVAKVAIDAAKQDVNSDPTVLRG  66

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            T+LDIT+ + + SG  G++EA+++METDTVAI+GPQ S
Sbjct  67   TRLDITMRNTNCSGFFGMMEALQFMETDTVAIVGPQCS  104



>ref|XP_009359611.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=923

 Score =   102 bits (255),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            V Y G    G+N T ++ARP V+N+G I T  S +GKI KL I  AV+D+NSNP +L GT
Sbjct  11   VFYKGSSTSGLNPTNVTARPDVVNVGAIFTFDSVIGKIAKLAITLAVEDVNSNPEILNGT  70

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL + + +  +S  LGI+EA+++ME DTVAIIGPQ S
Sbjct  71   KLALKMQNTKSSDFLGIIEALQFMENDTVAIIGPQFS  107



>ref|XP_009392852.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392854.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=941

 Score =   102 bits (254),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  291  PVLYCGY-LCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGG  115
            P+ +C + +  G   ++S+RP+V+++G I T  S +G++ K+ I+ A +D+NS+P VL G
Sbjct  33   PLFFCLFSITSGATRSVSSRPAVVHVGAIFTFNSTIGRVAKVAIDAAKQDVNSDPTVLRG  92

Query  114  TKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            T+LDIT+ + + SG  G++EA+++METDTVAI+GPQ S
Sbjct  93   TRLDITMRNTNCSGFFGMMEALQFMETDTVAIVGPQCS  130



>ref|XP_011034843.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Populus euphratica]
Length=951

 Score =   102 bits (254),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -2

Query  273  YLCEGVNS--TLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDI  100
            +L  GV S   L++RP+V+NIG + T  S +G++ K+ I+ AVKD+N+N ++L GTKL++
Sbjct  35   WLRHGVLSCRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNV  94

Query  99   TIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + + SG LG+VEA+R+METD VAIIGPQSS
Sbjct  95   DVRNSNCSGFLGMVEALRFMETDIVAIIGPQSS  127



>gb|KDP36767.1| hypothetical protein JCGZ_08058 [Jatropha curcas]
Length=926

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +   ++RP+V+NIG I TL S +GK+ K+ +E AVKD+N+N ++L GTKL IT+ D +
Sbjct  20   GHSRNATSRPAVVNIGAIFTLDSTIGKVAKIAMEEAVKDVNANSSILHGTKLVITMHDSN  79

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG  G+VEA+++METD VAIIGPQSS
Sbjct  80   CSGFTGMVEALKFMETDVVAIIGPQSS  106



>ref|XP_011022201.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Populus euphratica]
Length=965

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G   +GV + ++ RP  +NIG +L+  + +GK+ K+ I+ AV D+NS+P+VLGGTK
Sbjct  41   VCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVDDVNSDPSVLGGTK  100

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG LGI  A+++METDTVAIIGPQSS
Sbjct  101  LRLQMQNANQSGFLGI--ALKFMETDTVAIIGPQSS  134



>gb|AET03597.2| glutamate receptor 3.2 [Medicago truncatula]
Length=936

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNS-  76
            S +SARPS +NIG IL+  S +G++ K+ IE AV DINSNP VL GTKL+I+++D  +S 
Sbjct  22   SNVSARPSTINIGAILSFNSTIGRVAKVAIEAAVDDINSNPKVLSGTKLNISMLDTKSSP  81

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G LGIV+++  ME +TVAIIGPQ S
Sbjct  82   GFLGIVDSLLLMEKETVAIIGPQFS  106



>ref|XP_004289031.1| PREDICTED: glutamate receptor 3.3-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G+ + ++ RP VLNIG I T  S +GKI KL I T V+D+NSNP +L GTKL + + +  
Sbjct  20   GLITNVTTRPEVLNIGSIFTFDSVIGKIAKLAISTTVEDVNSNPNILNGTKLSLKLHNTK  79

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +S  LGIVE +++ME DTVAIIGPQ S
Sbjct  80   SSDFLGIVETLQFMENDTVAIIGPQFS  106



>ref|XP_008786666.1| PREDICTED: glutamate receptor 3.1 [Phoenix dactylifera]
Length=921

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            GV   +S+RP+V+NIG + T  S +G++ K+ I++AV D+NS+P VL GTKL I + D S
Sbjct  19   GVGRNISSRPAVVNIGALFTFNSTIGRVAKVAIDSAVDDVNSDPGVLQGTKLVIDMEDSS  78

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +G LG+VEA+++ME + VA++GPQSS
Sbjct  79   CNGFLGMVEALQFMEKEIVAVVGPQSS  105



>ref|XP_008440927.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Cucumis melo]
Length=900

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            + +S RP V+NIG + + RS +GK+ K+ +E A++D+NS+P++LG TKL++++ D + SG
Sbjct  27   ANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSDPSILGVTKLNLSLHDTNYSG  86

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LGI+E++R+MET T+AIIGPQ+S
Sbjct  87   FLGIIESLRFMETKTMAIIGPQNS  110



>ref|XP_008440920.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440921.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440922.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440924.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440925.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440926.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
Length=938

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            + +S RP V+NIG + + RS +GK+ K+ +E A++D+NS+P++LG TKL++++ D + SG
Sbjct  27   ANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSDPSILGVTKLNLSLHDTNYSG  86

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LGI+E++R+MET T+AIIGPQ+S
Sbjct  87   FLGIIESLRFMETKTMAIIGPQNS  110



>ref|XP_002272859.2| PREDICTED: glutamate receptor 3.3 [Vitis vinifera]
Length=964

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G L  G    LS+RP+V+N+G + T  S +G++ K+ IE AVKD+NS+  VL GTK  +T
Sbjct  45   GVLSNGSQKNLSSRPAVVNVGAVFTFESTIGRVAKIAIEEAVKDVNSDAGVLTGTKFVLT  104

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + SG +G++ A+++MET+T+AIIGPQSS
Sbjct  105  MRNSNCSGFIGMIGALQFMETETIAIIGPQSS  136



>emb|CBI40741.3| unnamed protein product [Vitis vinifera]
Length=934

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G L  G    LS+RP+V+N+G + T  S +G++ K+ IE AVKD+NS+  VL GTK  +T
Sbjct  15   GVLSNGSQKNLSSRPAVVNVGAVFTFESTIGRVAKIAIEEAVKDVNSDAGVLTGTKFVLT  74

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + SG +G++ A+++MET+T+AIIGPQSS
Sbjct  75   MRNSNCSGFIGMIGALQFMETETIAIIGPQSS  106



>gb|KDP43782.1| hypothetical protein JCGZ_22409 [Jatropha curcas]
Length=941

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G    G       RP  +NIG  L+  S +GK+ ++ I+ AV D+NS+P++LGGTKL I 
Sbjct  15   GVCLNGFTRATKRRPEFVNIGATLSFNSTIGKVARIAIQAAVDDVNSDPSILGGTKLRIK  74

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + D + SG LGI+EA+++ME DT+AI+GPQ+S
Sbjct  75   MQDTNYSGFLGIIEALKFMEDDTIAIVGPQAS  106



>ref|XP_009359749.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=933

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            ++ARP V+NIG I+T  S +GKI KL I  AV+D+NSNP +L GTKL + + +  +S  L
Sbjct  35   VTARPDVVNIGAIITFDSVIGKIAKLAITLAVEDVNSNPEILNGTKLTLKMQNTKSSDFL  94

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            GI+EA+++ME DTVAIIGPQ S
Sbjct  95   GIIEALQFMENDTVAIIGPQYS  116



>ref|XP_010923968.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
 ref|XP_010923969.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=930

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            VL  G    G N+T + ++PSV+NIG + T  S +G++ KL I+ AV+D+N+NP +L GT
Sbjct  13   VLLIGAAAAGRNATGVPSKPSVVNIGALFTFNSTIGRVAKLAIQLAVQDVNNNPNLLAGT  72

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            +L++   D + SG LGI+EA++ ME D VAIIGPQSS
Sbjct  73   RLNVIAQDTNCSGFLGIIEALQLMENDVVAIIGPQSS  109



>gb|EYU41186.1| hypothetical protein MIMGU_mgv1a000937mg [Erythranthe guttata]
Length=938

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  RPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIV  58
            RP V+N+G I TL S +G++ K+ IE AV D+NSN +VL GTKL + I + + SG LG+V
Sbjct  32   RPKVVNVGAIFTLDSTIGRVAKIAIEEAVNDVNSNSSVLNGTKLVVDIRNSNCSGFLGLV  91

Query  57   EAIRYMETDTVAIIGPQSS  1
            EA+R+METD +A+IGPQSS
Sbjct  92   EALRFMETDVMAVIGPQSS  110



>ref|XP_006425257.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
 gb|ESR38497.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
Length=940

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + YC      + +  S RPSV+NIG +L+  ++VGK+ KL I+ AV D+NS+P  LGGTK
Sbjct  11   IFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDDVNSDPTTLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + D ++SG L + EA+  ME  TVAIIGPQ +
Sbjct  71   LKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDA  106



>ref|XP_006467103.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
 ref|XP_006467104.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Citrus sinensis]
Length=940

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + YC      + +  S RPSV+NIG +L+  ++VGK+ KL I+ AV D+NS+P  LGGTK
Sbjct  11   IFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDDVNSDPTTLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + D ++SG L + EA+  ME  TVAIIGPQ +
Sbjct  71   LKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDA  106



>gb|KDO71521.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=940

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + YC      + +  S RPSV+NIG +L+  ++VGK+ KL I+ AV D+NS+P  LGGTK
Sbjct  11   IFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDDVNSDPTTLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + D ++SG L + EA+  ME  TVAIIGPQ +
Sbjct  71   LKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDA  106



>gb|KDO71522.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=939

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + YC      + +  S RPSV+NIG +L+  ++VGK+ KL I+ AV D+NS+P  LGGTK
Sbjct  11   IFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDDVNSDPTTLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + D ++SG L + EA+  ME  TVAIIGPQ +
Sbjct  71   LKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDA  106



>gb|KHG26328.1| Glutamate receptor 3.3 -like protein [Gossypium arboreum]
Length=909

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L+ G    G     S RP+V+NIG +    S +G++ K+ I+ A+KD+NSN ++L GTKL
Sbjct  12   LHLGVFQIGYGRNASTRPAVVNIGAMFNFDSIIGRVAKIAIDEALKDVNSNSSILKGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +T+ D + +G LG+VEA+RYM TD VAIIGPQ S
Sbjct  72   SVTLQDTNCNGFLGMVEALRYMATDVVAIIGPQCS  106



>ref|XP_006425260.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425266.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38500.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38506.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=623

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  64   GMVEALTLLENETVAIIGPQFS  85



>gb|KDO71523.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=784

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + YC      + +  S RPSV+NIG +L+  ++VGK+ KL I+ AV D+NS+P  LGGTK
Sbjct  11   IFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDDVNSDPTTLGGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + D ++SG L + EA+  ME  TVAIIGPQ +
Sbjct  71   LKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDA  106



>ref|NP_174978.1| glutamate receptor 3.3 [Arabidopsis thaliana]
 sp|Q9C8E7.1|GLR33_ARATH RecName: Full=Glutamate receptor 3.3; AltName: Full=Ligand-gated 
ion channel 3.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51316.1|AC025815_3 ligand-gated ion channel, putative [Arabidopsis thaliana]
 gb|AEE31925.1| glutamate receptor 3.3 [Arabidopsis thaliana]
Length=933

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEGV-NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
             +  +LC G+   T S +P V+ IG I +  S +GK+ K+ I+ AVKD+NSNP +L GTK
Sbjct  8    FFLSFLCSGLFRRTHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDVNSNPDILSGTK  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   FSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana]
Length=933

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEGV-NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
             +  +LC G+   T S +P V+ IG I +  S +GK+ K+ I+ AVKD+NSNP +L GTK
Sbjct  8    FFLSFLCSGLFRRTHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDVNSNPDILSGTK  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   FSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>ref|XP_008452999.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Cucumis melo]
Length=918

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L CG    G    +S+RPSV+NIG IL+  S +GK+  + I+ AVKD+N++P++L GT L
Sbjct  12   LVCGTFPLGFGKNISSRPSVVNIGAILSYNSTIGKVATIAIKEAVKDVNADPSILPGTNL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +   + + SG LG+VE ++ ME +TVAIIGPQSS
Sbjct  72   WLQTQNSNCSGFLGMVEVLQLMENETVAIIGPQSS  106



>ref|XP_006425259.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425262.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425264.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425265.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38499.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38502.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38504.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38505.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=611

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  64   GMVEALTLLENETVAIIGPQFS  85



>gb|KDO71515.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
 gb|KDO71516.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
 gb|KDO71517.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=633

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  26   VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  85

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  86   GMVEALTLLENETVAIIGPQFS  107



>ref|XP_007135963.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 ref|XP_007135964.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07957.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07958.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
Length=918

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = -2

Query  288  VLYC-GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            V++C G++  G  +  S RPSV+NIG I  + S +GK+ KL +E AVKD+N++  +L GT
Sbjct  10   VVWCLGFV--GAANVSSLRPSVVNIGAIFNIDSVLGKVAKLTLEEAVKDVNADTNILHGT  67

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            K+ +T+ + + SG LG+V+A+R+METD VAIIGPQSS
Sbjct  68   KIVLTMQNSNYSGFLGMVQALRFMETDVVAIIGPQSS  104



>gb|KDO71514.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=914

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  26   VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  85

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  86   GMVEALTLLENETVAIIGPQFS  107



>gb|KDO71518.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=574

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  26   VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  85

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  86   GMVEALTLLENETVAIIGPQFS  107



>ref|XP_004145549.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 ref|XP_004157067.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 gb|KGN55521.1| hypothetical protein Csa_4G664290 [Cucumis sativus]
Length=918

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L CG    G    +S+RPSV+NIG IL+  S +G++  + IE AVKD+N++P++L GT L
Sbjct  12   LVCGTFPLGFGKNVSSRPSVVNIGAILSHNSTIGRVATIAIEEAVKDVNADPSILPGTNL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + + + SG LG+VE ++ ME  TVAIIGPQSS
Sbjct  72   WLQMQNSNCSGFLGMVEVLQLMENKTVAIIGPQSS  106



>ref|XP_006425261.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38501.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=926

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  64   GMVEALTLLENETVAIIGPQFS  85



>ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
 gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
Length=870

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L+ G    G     S RP V+NIG I +  + VG++ K+ I  AVKD+NSN ++L GTKL
Sbjct  12   LHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVNSNLSILQGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +T+ D + SG +G+VEA++YMETD VAIIGPQ +
Sbjct  72   AVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCA  106



>ref|XP_006467097.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
Length=948

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  26   VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  85

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  86   GMVEALTLLENETVAIIGPQFS  107



>ref|XP_006467099.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Citrus sinensis]
Length=632

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  26   VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  85

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  86   GMVEALTLLENETVAIIGPQFS  107



>ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
 gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
Length=941

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L+ G    G     S RP V+NIG I +  + VG++ K+ I  AVKD+NSN ++L GTKL
Sbjct  12   LHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVNSNLSILQGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +T+ D + SG +G+VEA++YMETD VAIIGPQ +
Sbjct  72   AVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCA  106



>ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
Length=933

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L+ G    G     S RP V+NIG I +  + VG++ K+ I  AVKD+NSN ++L GTKL
Sbjct  12   LHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVNSNLSILQGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +T+ D + SG +G+VEA++YMETD VAIIGPQ +
Sbjct  72   AVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCA  106



>ref|XP_010266236.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266237.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266238.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
Length=928

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 5/96 (5%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G L  G       RPSVLNIG I T  +  G++ K+ ++ AV D+NS+P+VLGG+K
Sbjct  11   ILYFGVLSNG-----GPRPSVLNIGAIFTFNTINGRVAKIAMKAAVDDVNSDPSVLGGSK  65

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +T+ D + SG  GI+ A++YME DTVAIIGPQ+S
Sbjct  66   LVLTLHDSNYSGFSGIIGALQYMEMDTVAIIGPQNS  101



>ref|XP_010530328.1| PREDICTED: glutamate receptor 3.3 [Tarenaya hassleriana]
Length=962

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = -2

Query  288  VLYCGYLC-----EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAV  124
            +L+  +LC     +G +  +S RP+ + IG I +  S +GK+ K+ I+ AVKD+NSNP +
Sbjct  7    LLFLSWLCFAVLGKGYSRNVSVRPAAVKIGSIFSFDSVIGKVAKIAIDEAVKDVNSNPDI  66

Query  123  LGGTKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L GT+ D+++ + + SG LG+VEA+R ME D VAI+GPQ S
Sbjct  67   LDGTQFDVSMHNSNCSGFLGMVEALRLMEKDIVAIVGPQCS  107



>ref|XP_004287716.1| PREDICTED: glutamate receptor 3.3-like [Fragaria vesca subsp. 
vesca]
Length=940

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+ G    G  +T S RP ++N+G +L   S VGK+ KL +E AV D+NS+P++L GTK
Sbjct  17   VLFNGCASHGATNT-SRRPEIVNVGAMLAYNSIVGKVAKLALEAAVADVNSDPSILNGTK  75

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + + + SG LGI+EA+R+ME DTVAIIGP ++
Sbjct  76   MVVGMQNSNFSGFLGIIEALRFMEKDTVAIIGPHNA  111



>ref|XP_006425263.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38503.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=765

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            +S  P VLNIG +  L S +GK+ K+ IE AV+D+NSNPA+LGGTKL +T+ D + S  L
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G+VEA+  +E +TVAIIGPQ S
Sbjct  64   GMVEALTLLENETVAIIGPQFS  85



>ref|XP_008804475.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Phoenix dactylifera]
Length=932

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G++  G +  +S+RP+V+NIG + T  S +G+  K+ I  A+ D+N++ +VL GTKL IT
Sbjct  30   GFISGGASRNVSSRPAVVNIGAVFTFNSTIGRAAKVAINAAMDDVNADSSVLQGTKLAIT  89

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + D + +G LGIVEA+++ME D +AI+GPQ S
Sbjct  90   MQDSNCNGFLGIVEALQFMEVDIIAIVGPQCS  121



>ref|XP_007046473.1| Glutamate receptor 3.6 [Theobroma cacao]
 gb|EOX90630.1| Glutamate receptor 3.6 [Theobroma cacao]
Length=939

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G+   GV++ +S RP V+NIG I + +S +GK  K+ +E A++DINSNP +L GTK
Sbjct  17   ILYNGFPIIGVSTNVSTRPEVVNIGAIFSFQSVIGKAAKVAVEAAIEDINSNPDILRGTK  76

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L++ + D + SG L +VEA+ +ME DTVAIIGPQSS
Sbjct  77   LNLQLKDSNYSGFLAMVEALLFMERDTVAIIGPQSS  112



>ref|XP_007018097.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 ref|XP_007018098.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15322.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15323.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
Length=843

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            L+ G    G     S RP V+NIG I +  + VG++ K+ I  AVKD+NSN ++L GTKL
Sbjct  12   LHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVNSNLSILQGTKL  71

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +T+ D + SG +G+VEA++YMETD VAIIGPQ +
Sbjct  72   AVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCA  106



>ref|XP_008804484.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Phoenix dactylifera]
Length=916

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G++  G +  +S+RP+V+NIG + T  S +G+  K+ I  A+ D+N++ +VL GTKL IT
Sbjct  14   GFISGGASRNVSSRPAVVNIGAVFTFNSTIGRAAKVAINAAMDDVNADSSVLQGTKLAIT  73

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + D + +G LGIVEA+++ME D +AI+GPQ S
Sbjct  74   MQDSNCNGFLGIVEALQFMEVDIIAIVGPQCS  105



>ref|XP_003533409.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006587553.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006587554.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
 ref|XP_006587555.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Glycine max]
 gb|KHN38862.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS-NS  76
            S +S RPS +NIG +++  S VG++ K+ IE AV DINSN  +L GTKL+I+++D   ++
Sbjct  22   SNVSTRPSTVNIGALMSFNSTVGRVAKVAIEAAVDDINSNATILNGTKLNISMLDTKLST  81

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G LGI++++R ME DTVAIIGPQ S
Sbjct  82   GFLGIIDSLRLMEKDTVAIIGPQFS  106



>ref|XP_007203444.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
 gb|EMJ04643.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
Length=895

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLS-ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            V Y G    G+ + ++ ARP V+NIG I T  S +GKI KL I  AV+D+NS+P +L GT
Sbjct  2    VFYNGASSNGLGANVTTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPEILNGT  61

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL + + +  +S  LGI+EA++++E DTVAIIGPQ S
Sbjct  62   KLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFS  98



>ref|XP_010918356.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010918357.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=922

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            GV   +S+RP+V+NIG +    S +G++ K+ I+ AV D+NS+P VL GTKL I + D S
Sbjct  19   GVGRNISSRPAVVNIGGLFAFNSTIGRVAKVAIDAAVDDVNSDPGVLQGTKLVIDMKDSS  78

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +G LG VEA+++ME + VA++GPQSS
Sbjct  79   CNGFLGTVEALQFMEKEIVAVVGPQSS  105



>ref|XP_006383781.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61578.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=684

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCG-YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+C  +   G +  +S+RP+V+NIG I T  S +G++ K+ I+ AVKD+N+N ++L GT+
Sbjct  12   LFCVLFSTSGYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTE  71

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I + + + SG LG+ EA+++ E D +AIIGPQSS
Sbjct  72   LKIHMKNSNCSGFLGLAEALKFTENDVIAIIGPQSS  107



>ref|XP_008235912.1| PREDICTED: glutamate receptor 3.2-like [Prunus mume]
Length=932

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RP+ +N+G + TL +  G+++K+ IE AV D+NS+P +LGGTKL IT  D + SG LG
Sbjct  21   ASRPAAVNVGAMCTLGTINGRVSKIAIEAAVNDVNSDPTILGGTKLSITFHDSNFSGFLG  80

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            I+ A+++ME+DTVAIIGPQ++
Sbjct  81   IIGALKFMESDTVAIIGPQTA  101



>ref|XP_010103244.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXB95115.1| Glutamate receptor 3.6 [Morus notabilis]
Length=1034

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYC-GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            +++C G L + ++  +S RP V+ +G ++   S +GKI KL I  AV+D+NSN  +L GT
Sbjct  109  IVFCNGILSDAISHNVSTRPEVVRVGALICFDSMIGKIAKLAITAAVEDVNSNSTILKGT  168

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             L + + D   S  LGIVEA+R+ME DTVAIIGPQ S
Sbjct  169  VLKVAMQDTKTSDFLGIVEALRFMENDTVAIIGPQFS  205



>ref|XP_008337899.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=925

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            ++ARP V+NIG I T  S +GKI KL I  AV+D+NSNP +L GTKL + + +  +S  L
Sbjct  27   VTARPDVVNIGAIFTFDSVIGKIAKLAITLAVEDVNSNPEILNGTKLTLKMQNTKSSDFL  86

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            GI+EA+++ E DTVAIIGPQ S
Sbjct  87   GIIEALQFTENDTVAIIGPQYS  108



>ref|XP_007046475.1| Glutamate receptor isoform 2 [Theobroma cacao]
 gb|EOX90632.1| Glutamate receptor isoform 2 [Theobroma cacao]
Length=662

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  ++ RP V+NIG + +  S VGK+ ++ IE A++D+NS P VL GTKL +T+ D +
Sbjct  20   GNSVNVTTRPDVVNIGALFSFNSTVGKVARVAIEAALEDVNSEPGVLNGTKLKLTMQDTN  79

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LGIVEA++ M+ +TVAIIGPQ S
Sbjct  80   YSGFLGIVEALKLMQNETVAIIGPQLS  106



>ref|XP_008237957.1| PREDICTED: glutamate receptor 3.3 [Prunus mume]
Length=945

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  RPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIV  58
            RP+V+NIG I T  S +GK+ KL IE AVKD+NSN +VL GTKL + + + + SG  G+V
Sbjct  36   RPAVVNIGAIFTFDSTIGKVAKLAIEEAVKDVNSNFSVLHGTKLAVKMRNSNCSGFGGMV  95

Query  57   EAIRYMETDTVAIIGPQSS  1
            +A+++METD VAIIGPQSS
Sbjct  96   QALQFMETDIVAIIGPQSS  114



>ref|XP_010680624.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=907

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            GV    S RP+ +N+G I +  S +GK+ K+ IE A+ D+NS+  VL GTKL+IT+ DD 
Sbjct  26   GVGRNHSTRPTTINVGAIFSFNSTIGKVAKVAIEAAMDDVNSSSEVLNGTKLNITMQDDH  85

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            N+G LG V+ + +ME+  VAIIGP+SS
Sbjct  86   NNGFLGFVQTMTFMESGVVAIIGPESS  112



>emb|CDY70557.1| BnaC08g46160D, partial [Brassica napus]
Length=533

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEG-VNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+   LC G +    S +P V+ IG I +  S +GK+ K+ IE AVKD+NSNP +L GT+
Sbjct  8    LFLSCLCLGFLGHGYSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDVNSNPDILVGTR  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   LQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006342153.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Solanum tuberosum]
Length=946

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G   +G++   ++RP+V+N+G I T  S +G+  K+ I+ AVKD+NSN +VL GTKL + 
Sbjct  30   GVCSDGLSGNGTSRPAVVNVGAIFTFDSTIGRAAKIAIQEAVKDVNSNSSVLQGTKLVVQ  89

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + SG LG+V A+++METD VA+IGPQSS
Sbjct  90   LQNSNCSGFLGMVGALKFMETDVVAVIGPQSS  121



>ref|XP_007046474.1| Glutamate receptor isoform 1 [Theobroma cacao]
 gb|EOX90631.1| Glutamate receptor isoform 1 [Theobroma cacao]
Length=932

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G +  ++ RP V+NIG + +  S VGK+ ++ IE A++D+NS P VL GTKL +T+ D +
Sbjct  20   GNSVNVTTRPDVVNIGALFSFNSTVGKVARVAIEAALEDVNSEPGVLNGTKLKLTMQDTN  79

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LGIVEA++ M+ +TVAIIGPQ S
Sbjct  80   YSGFLGIVEALKLMQNETVAIIGPQLS  106



>ref|XP_010094542.1| Glutamate receptor 3.3 [Morus notabilis]
 gb|EXB56296.1| Glutamate receptor 3.3 [Morus notabilis]
Length=932

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G    G    +S+RP+V+N+G I +  S +G++  L IE AVKD+NSN ++L GTK
Sbjct  12   LLYLGGFPFGHGKNVSSRPAVVNVGAIFSFDSTIGRVATLAIEEAVKDVNSNSSILRGTK  71

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG +G+VEA++ +E D +AIIGPQSS
Sbjct  72   LSVQMQNSNCSGFVGMVEALQLLEKDVIAIIGPQSS  107



>ref|XP_006383780.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61577.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=661

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCG-YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+C  +   G +  +S+RP+V+NIG I T  S +G++ K+ I+ AVKD+N+N ++L GT+
Sbjct  12   LFCVLFSTSGYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTE  71

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I + + + SG LG+ EA+++ E D +AIIGPQSS
Sbjct  72   LKIHMKNSNCSGFLGLAEALKFTENDVIAIIGPQSS  107



>ref|XP_007202847.1| hypothetical protein PRUPE_ppa014700mg, partial [Prunus persica]
 gb|EMJ04046.1| hypothetical protein PRUPE_ppa014700mg, partial [Prunus persica]
Length=806

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVN---STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLG  118
            VLY G    G+    +  +ARP V+NIG I T  S +GKI KL I  AV+D+NS+P  L 
Sbjct  2    VLYNGASSNGIGVGATATTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPENLN  61

Query  117  GTKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            GTKL + + +  +S  LGI+EA+++ME DTVAIIGPQ S
Sbjct  62   GTKLTLKMQNTKSSDFLGIIEALQFMENDTVAIIGPQFS  100



>ref|XP_002891241.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=937

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGV-NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            +L+   LC G+     S +P V+ IG I +  S +GK+ K+ I+ AVKD+NSNP +L GT
Sbjct  7    LLFLSCLCTGLFTKAHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDVNSNPDILRGT  66

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  67   KLSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>ref|XP_008803655.1| PREDICTED: glutamate receptor 3.5-like [Phoenix dactylifera]
Length=957

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -2

Query  276  GYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDI  100
            G    G N T + ++PSV+NIG +LT  S +G+  KL I+ AV+D+NSNP +L GT+L++
Sbjct  43   GAAAAGRNGTGVPSKPSVVNIGALLTFNSIIGRAAKLAIQLAVQDVNSNPNLLAGTRLNV  102

Query  99   TIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
               D + SG LGI+EA++ ME D VAIIGPQSS
Sbjct  103  IAQDTNCSGFLGIMEALQLMENDVVAIIGPQSS  135



>ref|XP_002306988.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE93984.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=932

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCG-YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+C  +   G +  +S+RP+V+NIG I T  S +G++ K+ I+ AVKD+N+N ++L GT+
Sbjct  12   LFCVLFSTSGYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTE  71

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I + + + SG LG+ EA+++ E D +AIIGPQSS
Sbjct  72   LKIHMKNSNCSGFLGLAEALKFTENDVIAIIGPQSS  107



>ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris]
Length=930

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYC-GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L C G   +G++   ++RP+V+N+G I T  S +G++ K+ I+ AVKD+NSN ++L GTK
Sbjct  11   LLCFGVGSDGLSGNGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVNSNSSLLRGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG LG+V A+++METD VA+IGPQSS
Sbjct  71   LVVKLQNSNCSGFLGMVGALKFMETDVVAVIGPQSS  106



>ref|XP_006403911.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
 gb|ESQ45364.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
Length=896

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ + +SARP V+NIG + T  S +G++ K+ +E AV+D+N+NP+VL  T+L I + D 
Sbjct  17   QGLTTNVSARPQVVNIGSVFTFTSLIGRVIKVAMEAAVEDVNANPSVLNNTQLRIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G + I+E +R+ME++TVAIIGPQ S
Sbjct  77   KFNGFMSIMEPLRFMESETVAIIGPQRS  104



>ref|XP_009786332.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Nicotiana sylvestris]
Length=641

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYC-GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L C G   +G++   ++RP+V+N+G I T  S +G++ K+ I+ AVKD+NSN ++L GTK
Sbjct  11   LLCFGVGSDGLSGNGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVNSNSSLLRGTK  70

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + + + + SG LG+V A+++METD VA+IGPQSS
Sbjct  71   LVVKLQNSNCSGFLGMVGALKFMETDVVAVIGPQSS  106



>ref|XP_007200076.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
 gb|EMJ01275.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
Length=897

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RP+ +N+G + T+ +  G+++K+ IE AV D+NS+P +LGGTKL IT  D + SG LG
Sbjct  21   ASRPAAVNVGAMCTVGTINGRVSKIAIEAAVNDVNSDPTILGGTKLSITFHDSNFSGFLG  80

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            I+ A+++ME+DTVAIIGPQ++
Sbjct  81   IIGALKFMESDTVAIIGPQTA  101



>gb|AFW69814.1| hypothetical protein ZEAMMB73_405216 [Zea mays]
Length=901

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL    L  G+  +L ARPSV+NIG IL L S +G ++ + I  AV+DINS+P VL GT 
Sbjct  10   VLSLFLLPNGICKSLVARPSVVNIGSILRLNSTIGGVSDVAIRAAVEDINSDPTVLNGTT  69

Query  108  LDITIVD-DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +   D + N G LG+V+A+++METD +AIIGPQ S
Sbjct  70   LHVETRDTNCNDGFLGMVQALQFMETDVIAIIGPQCS  106



>ref|XP_006855692.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
 gb|ERN17159.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
Length=936

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G+N  +S RPSV+N+G I + +S +G + K+ I+ A KD+N++ +VL GTKL IT+ D +
Sbjct  22   GLN--ISPRPSVVNVGAIFSFKSPIGSVEKIAIKAAEKDVNADSSVLNGTKLVITMQDAA  79

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             S  + IVEA+++METDTVAIIGPQ+S
Sbjct  80   GSYFVAIVEALQFMETDTVAIIGPQTS  106



>ref|XP_010680623.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=960

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -2

Query  276  GYLC-EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDI  100
            G LC  GV++  S RP V+NIG I++  S  GK+ KL IE A+ D+NS+  VL GTKL+I
Sbjct  20   GILCANGVDTISSTRPKVVNIGAIMSFNSITGKVAKLAIEAAMDDVNSSSQVLKGTKLNI  79

Query  99   TIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            ++ D + SG LG +EA+  +E+  VAIIGPQSS
Sbjct  80   SMSDSNYSGFLGAIEAMTIIESGVVAIIGPQSS  112



>ref|XP_010240316.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240317.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240318.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240319.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240320.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
Length=941

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            ++C      ++  +SARP  ++IG + T  S +G++ K+ I  AV DIN +P++L GTKL
Sbjct  10   IFCCLCSYALSKNVSARPDEVSIGALFTFNSTIGRVAKVAISAAVNDINDDPSILPGTKL  69

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + D + SG +GIV+A+++ME DTVAI+GPQSS
Sbjct  70   VVQMQDSNCSGFVGIVQALQFMEKDTVAIVGPQSS  104



>ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=927

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGI  61
            +RP+V++IG I TL S +G++ K+ IE AVKD+N+N ++L GT+L + I + + SG  G+
Sbjct  27   SRPAVVSIGAIFTLDSTIGRVAKVAIEEAVKDVNANSSILHGTRLALHIQNSNCSGFSGM  86

Query  60   VEAIRYMETDTVAIIGPQSS  1
            VEA+R+METD VAI+GPQSS
Sbjct  87   VEALRFMETDVVAILGPQSS  106



>dbj|BAJ34460.1| unnamed protein product [Thellungiella halophila]
Length=500

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ + +SARP V+NIG + T  S +G++ K+ +E AV+D+N+NP+VL  T+L I + D 
Sbjct  17   QGLTTNVSARPQVVNIGSVFTFTSLIGRVIKVAMEAAVEDVNANPSVLNNTQLRIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G + I+E +R+ME++TVAIIGPQ S
Sbjct  77   KFNGFMSIMEPLRFMESETVAIIGPQRS  104



>ref|XP_008645171.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.1-like [Zea 
mays]
Length=926

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL    L  G+  +L ARPSV+NIG IL L S +G ++ + I  AV+DINS+P VL GT 
Sbjct  10   VLSLFLLPNGICKSLVARPSVVNIGSILRLNSTIGGVSDVAIRAAVEDINSDPTVLNGTT  69

Query  108  LDITIVD-DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +   D + N G LG+V+A+++METD +AIIGPQ S
Sbjct  70   LHVETRDTNCNDGFLGMVQALQFMETDVIAIIGPQCS  106



>ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
 ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
Length=930

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+    ++RP+V+N+G I T  S +G++ K+ I+ AVKD+NSN ++L GTKL + + + 
Sbjct  19   DGLTGKGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVNSNSSLLRGTKLIVKLQNS  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + SG LG+V A+++METD VA+IGPQSS
Sbjct  79   NCSGFLGMVGALKFMETDVVAVIGPQSS  106



>ref|XP_007156250.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
 gb|ESW28244.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
Length=819

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            + Y G+   G+ S++  RP ++N+G +L+  S VG++ K+ IE AV D+NS+P +L GTK
Sbjct  11   MFYHGFPSMGI-SSVYGRPRIVNVGALLSFNSTVGRVAKVAIEAAVDDVNSDPTILNGTK  69

Query  108  LDITIVDDS-NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I  +D   ++G LGIV+++R ME DTVAIIGPQ S
Sbjct  70   LKILTLDTKLSAGFLGIVDSLRLMENDTVAIIGPQFS  106



>ref|XP_011041194.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041195.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041196.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041197.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041198.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041199.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041200.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
Length=933

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCG-YLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+C  +   G +  +S+RP+V+NIG + T  S +G++ K+ IE AVKD+N+N ++L GT+
Sbjct  12   LFCVLFSTSGYSRNVSSRPAVVNIGAMFTFESTIGRVAKIAIEEAVKDVNANSSILHGTE  71

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I +   + SG LG+ EA+++ E D +AIIGPQSS
Sbjct  72   LKIHMRKSNCSGFLGLAEALKFTENDVIAIIGPQSS  107



>ref|XP_009107640.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Brassica rapa]
Length=929

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEG-VNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+   LC G +    S +P V+ IG I +  S +GK+ K+ IE AVKD+NSNP +L GT+
Sbjct  8    LFLSCLCLGFLGHGHSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDVNSNPDILVGTR  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   LQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>ref|XP_008241924.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=922

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLS-ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            V Y G    G+ + ++ ARP V+NIG I T  S +GKI K+ I  A++D+NS+P +L GT
Sbjct  12   VFYNGASSNGLGANVTTARPDVVNIGAIFTFDSVIGKIAKVAIALAIEDVNSDPEILNGT  71

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL + + +  +S  LGI+EA++++E DTVAIIGPQ S
Sbjct  72   KLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFS  108



>ref|XP_006306244.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
 gb|EOA39142.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
Length=941

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S +P V+ IG I +  S +GK+ K+ IE AVKD+NSNP +L GTK  +++ + + SG +G
Sbjct  26   SGKPEVVKIGSIFSFNSAIGKVAKIAIEEAVKDVNSNPNILTGTKFSVSMQNSNCSGFMG  85

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +VEA+R+ME D V IIGPQ S
Sbjct  86   MVEALRFMEKDIVGIIGPQCS  106



>ref|XP_007043076.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
 gb|EOX98907.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
Length=940

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L    LC GV S  +++P V+N+G I T  +  GK+ K+ ++ A  DINS+P+VLGG K
Sbjct  22   LLSTSILCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLGGRK  81

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I++ D + S  LGI+ A+++ME+D VAIIGPQSS
Sbjct  82   LTISLHDSNYSSFLGIIGALQFMESDKVAIIGPQSS  117



>ref|XP_007043075.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
 gb|EOX98906.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
Length=944

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L    LC GV S  +++P V+N+G I T  +  GK+ K+ ++ A  DINS+P+VLGG K
Sbjct  22   LLSTSILCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLGGRK  81

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I++ D + S  LGI+ A+++ME+D VAIIGPQSS
Sbjct  82   LTISLHDSNYSSFLGIIGALQFMESDKVAIIGPQSS  117



>ref|XP_009107641.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Brassica rapa]
Length=775

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEG-VNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+   LC G +    S +P V+ IG I +  S +GK+ K+ IE AVKD+NSNP +L GT+
Sbjct  8    LFLSCLCLGFLGHGHSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDVNSNPDILVGTR  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   LQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>emb|CDY68928.1| BnaA08g29720D, partial [Brassica napus]
Length=533

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -2

Query  285  LYCGYLCEG-VNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            L+   LC G +    S +P V+ IG I +  S +G++ K+ IE AVKD+NSNP +L GT+
Sbjct  8    LFLSCLCLGFLGHGHSEKPEVVKIGSIFSFNSVIGRVAKIAIEEAVKDVNSNPDILVGTR  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ + + SG +G+VEA+R+ME D V IIGPQ S
Sbjct  68   LQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCS  103



>ref|XP_007203978.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
 gb|EMJ05177.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
Length=813

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 48/99 (48%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVN---STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLG  118
            V Y G    G+    +  +ARP V+NIG I T  S +GKI KL I  AV+D+NS+P  L 
Sbjct  2    VFYNGASSNGIGVGATATTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPENLN  61

Query  117  GTKLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            GTKL + + +  +S  LGI+EA++++E DTVAIIGPQ S
Sbjct  62   GTKLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFS  100



>ref|XP_004161019.1| PREDICTED: glutamate receptor 3.2-like [Cucumis sativus]
Length=644

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+C    +G+ S  S+R  V+ +G I +L S  GK++K+ IE A KD+NS+P+VLGG K
Sbjct  28   VLFC---VQGIISEGSSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVNSDPSVLGGRK  84

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I+I D + SG LGI  A++YM +DTVAI+GP+ S
Sbjct  85   LSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDS  120



>ref|XP_008373417.1| PREDICTED: glutamate receptor 3.3 [Malus domestica]
Length=959

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  RPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIV  58
            RP+V+ IG I T  S +G++ KL I  AVKD+NSN ++L GTKL + +   + SG LG+V
Sbjct  55   RPAVVKIGAIFTFESTIGRVAKLAIXEAVKDVNSNSSILHGTKLAVNMQSSNCSGFLGMV  114

Query  57   EAIRYMETDTVAIIGPQSS  1
            +A+++METD VAIIGPQSS
Sbjct  115  QALQFMETDIVAIIGPQSS  133



>ref|XP_004144891.1| PREDICTED: glutamate receptor 3.2-like [Cucumis sativus]
Length=922

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+C    +G+ S  S+R  V+ +G I +L S  GK++K+ IE A KD+NS+P+VLGG K
Sbjct  28   VLFC---VQGIISEGSSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVNSDPSVLGGRK  84

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I+I D + SG LGI  A++YM +DTVAI+GP+ S
Sbjct  85   LSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDS  120



>gb|KGN43348.1| hypothetical protein Csa_7G025200 [Cucumis sativus]
Length=921

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+C    +G+ S  S+R  V+ +G I +L S  GK++K+ IE A KD+NS+P+VLGG K
Sbjct  28   VLFC---VQGIISEGSSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVNSDPSVLGGRK  84

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I+I D + SG LGI  A++YM +DTVAI+GP+ S
Sbjct  85   LSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDS  120



>ref|XP_010550509.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Tarenaya hassleriana]
Length=889

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -2

Query  270  LCEGVN-STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITI  94
            LC+ V     S RP V+N+G + T  S +G++ K+ +E AV+D+NS+P++L GT L I +
Sbjct  10   LCDAVAVQGASTRPDVVNVGAVFTFGSVIGRVIKVAMEAAVEDVNSSPSILNGTHLKIIM  69

Query  93   VDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             D    G + IVE +R+METDTVAIIGPQ S
Sbjct  70   HDTKFIGFMSIVETLRFMETDTVAIIGPQRS  100



>ref|XP_004154082.1| PREDICTED: glutamate receptor 3.2-like, partial [Cucumis sativus]
Length=817

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+C    +G+ S  S+R  V+ +G I +L S  GK++K+ IE A KD+NS+P+VLGG K
Sbjct  28   VLFC---VQGIISEGSSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVNSDPSVLGGRK  84

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I+I D + SG LGI  A++YM +DTVAI+GP+ S
Sbjct  85   LSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDS  120



>ref|XP_007043077.1| Glutamate receptor 2 isoform 3 [Theobroma cacao]
 gb|EOX98908.1| Glutamate receptor 2 isoform 3 [Theobroma cacao]
Length=639

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +L    LC GV S  +++P V+N+G I T  +  GK+ K+ ++ A  DINS+P+VLGG K
Sbjct  22   LLSTSILCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLGGRK  81

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L I++ D + S  LGI+ A+++ME+D VAIIGPQSS
Sbjct  82   LTISLHDSNYSSFLGIIGALQFMESDKVAIIGPQSS  117



>ref|XP_010550505.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550506.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550507.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550508.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
Length=896

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = -2

Query  270  LCEGVN-STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITI  94
            LC+ V     S RP V+N+G + T  S +G++ K+ +E AV+D+NS+P++L GT L I +
Sbjct  10   LCDAVAVQGASTRPDVVNVGAVFTFGSVIGRVIKVAMEAAVEDVNSSPSILNGTHLKIIM  69

Query  93   VDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             D    G + IVE +R+METDTVAIIGPQ S
Sbjct  70   HDTKFIGFMSIVETLRFMETDTVAIIGPQRS  100



>gb|AFW66756.1| hypothetical protein ZEAMMB73_452909 [Zea mays]
Length=951

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G+  +L+ARPSV+NIG IL L S  G ++ + I  AV+DINS+P VL GT L +   D +
Sbjct  19   GIGKSLAARPSVVNIGSILRLNSTTGGVSDVAIRAAVEDINSDPTVLNGTTLHVQTRDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + G LG+V+A+++METD +AIIGPQ S
Sbjct  79   CDDGFLGMVQALQFMETDVIAIIGPQCS  106



>dbj|BAL15056.1| glutamate receptor 3.3 [Solanum lycopersicum]
Length=808

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G   +G++   ++RP+V+++G I T  S +G+  K+ I+ AVKD+NSN ++L GTKL + 
Sbjct  20   GVCSDGLSRNGTSRPAVVSVGAIFTFDSTIGRAAKIAIQEAVKDVNSNSSILQGTKLVVQ  79

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + SG LG+V A+++METD VA+IGPQSS
Sbjct  80   LQNSNCSGFLGMVGALKFMETDVVAVIGPQSS  111



>ref|XP_003527293.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006581132.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006581133.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
Length=929

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S+RP+V++IG I  + S +GK+ K+ +E AVKD+N++  +L GT+L +T+ + ++SG +G
Sbjct  30   SSRPAVVHIGAIFNIDSVLGKVAKITLEEAVKDVNADKTILHGTQLVLTMQNSNHSGFIG  89

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +V+A+R+METD +AIIGPQSS
Sbjct  90   MVQALRFMETDVIAIIGPQSS  110



>ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
Length=945

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  GYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDIT  97
            G   +G++   ++RP+V+++G I T  S +G+  K+ I+ AVKD+NSN ++L GTKL + 
Sbjct  32   GVCSDGLSRNGTSRPAVVSVGAIFTFDSTIGRAAKIAIQEAVKDVNSNSSILQGTKLVVQ  91

Query  96   IVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + + SG LG+V A+++METD VA+IGPQSS
Sbjct  92   LQNSNCSGFLGMVGALKFMETDVVAVIGPQSS  123



>ref|XP_009372603.1| PREDICTED: glutamate receptor 3.3-like [Pyrus x bretschneideri]
Length=936

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  RPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIV  58
            RP+V+NIG I T  S +G++ KL I+ AVKD+NSN ++L GT+L + +   + SG LG+V
Sbjct  32   RPAVVNIGAIFTFDSTIGRVAKLAIQEAVKDVNSNSSILHGTELVVHMRTSNCSGFLGMV  91

Query  57   EAIRYMETDTVAIIGPQSS  1
            +A+++METD VA+IGPQSS
Sbjct  92   QALQFMETDIVAVIGPQSS  110



>ref|XP_009418664.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418665.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418666.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
Length=918

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G     S+RP+V+++G I T  S +G + K+ I+ A  D+NS+P+VL GT+L I + D +
Sbjct  18   GATRNASSRPTVVHVGAIFTFDSTIGSVAKVAIDAAEDDVNSDPSVLRGTRLQIIMRDTN  77

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG LG++EA+++METDTVAI+GPQ +
Sbjct  78   CSGFLGMMEALQFMETDTVAIVGPQCT  104



>ref|XP_011087613.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Sesamum indicum]
Length=930

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+      G ++   +RP  + IG I +  + +GK+ K+ ++ AV+D+NS+P +LGGTK
Sbjct  8    VLFSCLFVGGFSADKVSRPEFVKIGSIFSFGTIIGKVAKIAMKAAVEDVNSDPTILGGTK  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L  ++ D + SG LGI+  ++YMET+TVAIIGPQ+S
Sbjct  68   LVFSMHDSNYSGFLGIIGGLKYMETNTVAIIGPQAS  103



>ref|XP_010923978.1| PREDICTED: glutamate receptor 3.5-like [Elaeis guineensis]
Length=661

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            VL  G    G N T + ++PSV+NIG + T  S +G++ KL I+ AV+D+NSN  +L GT
Sbjct  13   VLLIGAAAAGQNRTGVPSKPSVVNIGALFTFNSTIGRVAKLAIQLAVQDVNSNRNLLAGT  72

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             L+I   D + SG LGI++A++ ME D VA+IGPQSS
Sbjct  73   MLNIIPRDTNCSGFLGIIQALQLMENDVVAVIGPQSS  109



>ref|XP_010478979.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
 ref|XP_010478980.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=936

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S +P V+ IG I +  S +GK+ K+ I+ AVKD+NSNP +L GTK  +++ + + SG +G
Sbjct  22   SGKPKVVKIGSIFSFNSVIGKVAKIAIDEAVKDVNSNPNILTGTKFSVSMQNSNCSGFMG  81

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +VEA+R+ME D V IIGPQ S
Sbjct  82   MVEALRFMEKDIVGIIGPQCS  102



>ref|XP_010500221.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
 ref|XP_010500222.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
Length=936

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S +P V+ IG I +  S +GK+ K+ I+ AVKD+NSNP +L GTK  +++ + + SG +G
Sbjct  22   SGKPKVVKIGSIFSFNSVIGKVAKIAIDEAVKDVNSNPNILTGTKFSVSMQNSNCSGFMG  81

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +VEA+R+ME D V IIGPQ S
Sbjct  82   MVEALRFMEKDIVGIIGPQCS  102



>gb|KCW56490.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=944

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL  G    G ++  SARP  +N+G + ++ + +G + K+ +  AV+D+NS+P+VLGGTK
Sbjct  15   VLQSGSGLFGASTNASARPEFVNVGGVFSVNTLIGSVAKVAVLAAVEDVNSDPSVLGGTK  74

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + I D + SG LGIVEA+++ME+DTVAIIGPQ+S
Sbjct  75   LKVMIHDTNYSGFLGIVEALQFMESDTVAIIGPQTS  110



>ref|XP_010029575.1| PREDICTED: glutamate receptor 3.6 [Eucalyptus grandis]
 gb|KCW56489.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=942

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL  G    G ++  SARP  +N+G + ++ + +G + K+ +  AV+D+NS+P+VLGGTK
Sbjct  15   VLQSGSGLFGASTNASARPEFVNVGGVFSVNTLIGSVAKVAVLAAVEDVNSDPSVLGGTK  74

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L + I D + SG LGIVEA+++ME+DTVAIIGPQ+S
Sbjct  75   LKVMIHDTNYSGFLGIVEALQFMESDTVAIIGPQTS  110



>ref|XP_008447826.1| PREDICTED: glutamate receptor 3.2 [Cucumis melo]
Length=922

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = -2

Query  288  VLYCGYLCEGVNST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            VL+C    +G+ S  +S+R  V+ +G I +L S  GK++K+ IE A KD+NS+P+VLGG 
Sbjct  30   VLFC---VQGITSEGISSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVNSDPSVLGGR  86

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL I+I D + SG LGI  A++YM +DTVAI+GP+ S
Sbjct  87   KLSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDS  123



>ref|XP_010935350.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010935351.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=916

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            LY  ++  G +  +S+RP+V+ IG +    S +G++ K+ I  A+ D+N++ +VL GTKL
Sbjct  11   LYLAFVSSGASRNVSSRPAVVTIGAVFGFNSTIGRVAKVAINAALDDVNADSSVLQGTKL  70

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             I + D + +G LGIVEA+++ME D +A++GPQ S
Sbjct  71   AIEMQDSNCNGFLGIVEALQFMEADIIAMVGPQCS  105



>ref|XP_011087614.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Sesamum indicum]
Length=791

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL+      G ++   +RP  + IG I +  + +GK+ K+ ++ AV+D+NS+P +LGGTK
Sbjct  8    VLFSCLFVGGFSADKVSRPEFVKIGSIFSFGTIIGKVAKIAMKAAVEDVNSDPTILGGTK  67

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L  ++ D + SG LGI+  ++YMET+TVAIIGPQ+S
Sbjct  68   LVFSMHDSNYSGFLGIIGGLKYMETNTVAIIGPQAS  103



>ref|XP_004952125.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Setaria italica]
 ref|XP_004952126.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Setaria italica]
Length=965

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G++++L+ARPSV++IG IL   S  G ++ + I  A++DINS+P VL GT L + + D +
Sbjct  19   GIHNSLAARPSVVSIGSILRFNSTTGGVSAVAIRAALEDINSDPTVLNGTMLRVDMRDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + G LG+VEA+++METD +AIIGPQ S
Sbjct  79   CDDGFLGMVEALQFMETDVIAIIGPQCS  106



>ref|XP_004500848.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Cicer arietinum]
Length=935

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGI  61
            +RP+ +NIG I T  S +GK+ KL +E AVKDINSN  +L GT+L + +   + SG  G+
Sbjct  40   SRPTFVNIGAIFTFDSSIGKVAKLAMEEAVKDINSNSNILHGTQLRLHMQTSNCSGFDGM  99

Query  60   VEAIRYMETDTVAIIGPQSS  1
            ++A+R+METD +AI+GPQSS
Sbjct  100  IQALRFMETDVIAILGPQSS  119



>gb|EEC72350.1| hypothetical protein OsI_05591 [Oryza sativa Indica Group]
Length=906

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-  88
            +G+  +L+ARPS++NIG IL   S +G ++ + I+ A++DINS+  +L GT L + + D 
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  87   DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + G LG+VEA+++METD +AIIGPQ S
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCS  106



>ref|XP_010267710.1| PREDICTED: glutamate receptor 3.5-like isoform X2 [Nelumbo nucifera]
Length=942

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            ST S  PSV+NIG +LT+ S +GK++   I  AV D+NS+P +LG TKL +++ D + SG
Sbjct  75   STTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCSG  134

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LG +EA++ +E D VAIIGPQSS
Sbjct  135  FLGTIEALQLLEKDMVAIIGPQSS  158



>ref|NP_001045687.1| Os02g0117500 [Oryza sativa Japonica Group]
 dbj|BAD07727.1| putative glutamate receptor [Oryza sativa Japonica Group]
 dbj|BAF07601.1| Os02g0117500 [Oryza sativa Japonica Group]
Length=944

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-  88
            +G+  +L+ARPS++NIG IL   S +G ++ + I+ A++DINS+  +L GT L + + D 
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  87   DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + G LG+VEA+++METD +AIIGPQ S
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCS  106



>ref|XP_009115834.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
 ref|XP_009115835.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
Length=940

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G ++ +S RP V+NIG + T +S +GK+ K+ ++ AV D+N+NP VL  T+L+I + D 
Sbjct  66   QGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDVNANPTVLNNTRLNIIMHDT  125

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQ  7
              +G + I+E +R+ME  TVAIIGPQ
Sbjct  126  KFNGFMSIMEPLRFMENKTVAIIGPQ  151



>ref|XP_004952127.1| PREDICTED: glutamate receptor 3.1-like isoform X3 [Setaria italica]
Length=934

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G++++L+ARPSV++IG IL   S  G ++ + I  A++DINS+P VL GT L + + D +
Sbjct  19   GIHNSLAARPSVVSIGSILRFNSTTGGVSAVAIRAALEDINSDPTVLNGTMLRVDMRDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + G LG+VEA+++METD +AIIGPQ S
Sbjct  79   CDDGFLGMVEALQFMETDVIAIIGPQCS  106



>ref|XP_006396004.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
 gb|ESQ33290.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
Length=937

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S +P+V+ IG I +  S +GK+ K+ I  AVKD+NSNP +L GT L +++ + + SG +G
Sbjct  23   SGKPTVVKIGSIFSFDSVIGKVAKIAINEAVKDVNSNPDILRGTHLQVSMQNSNCSGFMG  82

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +VEA+R+ME D V IIGPQ S
Sbjct  83   MVEALRFMEKDIVGIIGPQCS  103



>gb|KEH36348.1| glutamate receptor 3.2 [Medicago truncatula]
Length=663

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RPS +NIG I T  S +GK+ KL +E AVKD+NSN ++L  T+L + +   + SG  G
Sbjct  25   NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNSSILHSTQLVLHMQTSNCSGFDG  84

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +++A+R+METD +AI+GPQSS
Sbjct  85   MIQALRFMETDVIAILGPQSS  105



>emb|CDX73718.1| BnaC08g22850D [Brassica napus]
Length=891

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G ++ +S RP V+NIG + T +S +GK+ K+ ++ AV D+N+NP VL  T+L+I + D 
Sbjct  17   QGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDVNANPTVLNNTRLNIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQ  7
              +G + I+E +R+ME  TVAIIGPQ
Sbjct  77   KFNGFMSIMEPLRFMENKTVAIIGPQ  102



>ref|XP_010267713.1| PREDICTED: glutamate receptor 3.5-like isoform X4 [Nelumbo nucifera]
Length=854

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            ST S  PSV+NIG +LT+ S +GK++   I  AV D+NS+P +LG TKL +++ D + SG
Sbjct  75   STTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCSG  134

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LG +EA++ +E D VAIIGPQSS
Sbjct  135  FLGTIEALQLLEKDMVAIIGPQSS  158



>ref|XP_006577929.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
Length=925

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S+RP+ ++IG I ++ S +GK+ K+ +E AVKD+N++  +L GT+L +++ + ++SG +G
Sbjct  30   SSRPAFVHIGAIFSMDSVLGKVAKITLEEAVKDVNADKTILHGTQLVLSMQNSNHSGFVG  89

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +V+A+R+METD +AIIGPQSS
Sbjct  90   MVQALRFMETDVIAIIGPQSS  110



>gb|KEH36347.1| glutamate receptor 3.2 [Medicago truncatula]
Length=708

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RPS +NIG I T  S +GK+ KL +E AVKD+NSN ++L  T+L + +   + SG  G
Sbjct  70   NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNSSILHSTQLVLHMQTSNCSGFDG  129

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +++A+R+METD +AI+GPQSS
Sbjct  130  MIQALRFMETDVIAILGPQSS  150



>ref|XP_009115836.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Brassica rapa]
 emb|CDX78008.1| BnaA09g32030D [Brassica napus]
Length=891

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G ++ +S RP V+NIG + T +S +GK+ K+ ++ AV D+N+NP VL  T+L+I + D 
Sbjct  17   QGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDVNANPTVLNNTRLNIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQ  7
              +G + I+E +R+ME  TVAIIGPQ
Sbjct  77   KFNGFMSIMEPLRFMENKTVAIIGPQ  102



>ref|XP_010267711.1| PREDICTED: glutamate receptor 3.5-like isoform X3 [Nelumbo nucifera]
 ref|XP_010267712.1| PREDICTED: glutamate receptor 3.5-like isoform X3 [Nelumbo nucifera]
Length=939

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            ST S  PSV+NIG +LT+ S +GK++   I  AV D+NS+P +LG TKL +++ D + SG
Sbjct  37   STTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCSG  96

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LG +EA++ +E D VAIIGPQSS
Sbjct  97   FLGTIEALQLLEKDMVAIIGPQSS  120



>ref|XP_010267709.1| PREDICTED: glutamate receptor 3.5-like isoform X1 [Nelumbo nucifera]
Length=977

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            ST S  PSV+NIG +LT+ S +GK++   I  AV D+NS+P +LG TKL +++ D + SG
Sbjct  75   STTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCSG  134

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LG +EA++ +E D VAIIGPQSS
Sbjct  135  FLGTIEALQLLEKDMVAIIGPQSS  158



>ref|XP_004512282.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=915

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G+         S RP+V+NIG + +  + VG+I K+ IE AVKD+NS+P +LG TK
Sbjct  11   ILYNGFSSTEAGIHNSTRPAVVNIGALFSFNTSVGRIIKIAIEAAVKDVNSDPNILGETK  70

Query  108  LDITIVDDSN-SGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ +DS   G L I E ++ M +DTVAIIGP SS
Sbjct  71   LKLSLQEDSKYRGFLSIAEVLQVMSSDTVAIIGPHSS  107



>ref|XP_004512281.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
Length=943

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G+         S RP+V+NIG + +  + VG+I K+ IE AVKD+NS+P +LG TK
Sbjct  11   ILYNGFSSTEAGIHNSTRPAVVNIGALFSFNTSVGRIIKIAIEAAVKDVNSDPNILGETK  70

Query  108  LDITIVDDSN-SGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +++ +DS   G L I E ++ M +DTVAIIGP SS
Sbjct  71   LKLSLQEDSKYRGFLSIAEVLQVMSSDTVAIIGPHSS  107



>ref|XP_007156252.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
 gb|ESW28246.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
Length=906

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
             Y G+  +G+ S++S RP  +NIG IL+  S +G++ K+ I+ AV D+NS+  +L GTKL
Sbjct  12   FYSGFPSKGI-SSVSTRPRAVNIGAILSFNSRIGRVAKVAIQAAVDDVNSDATILNGTKL  70

Query  105  DITIVDDS-NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             I+++D   ++G LGI+++   ME +TVAIIGPQ S
Sbjct  71   KISMLDTKLSTGFLGIIDSFLLMERETVAIIGPQYS  106



>ref|XP_010507397.1| PREDICTED: glutamate receptor 3.6-like [Camelina sativa]
Length=694

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ +++SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  25   QGLTTSVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  84

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  85   KFNGFMSFLEPLRFMESETVAIIVPQRS  112



>ref|XP_003603849.1| Glutamate-gated kainate-type ion channel receptor subunit GluR5 
[Medicago truncatula]
 gb|AES74100.1| glutamate receptor 3.2 [Medicago truncatula]
Length=914

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RPS +NIG I T  S +GK+ KL +E AVKD+NSN ++L  T+L + +   + SG  G
Sbjct  25   NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNSSILHSTQLVLHMQTSNCSGFDG  84

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +++A+R+METD +AI+GPQSS
Sbjct  85   MIQALRFMETDVIAILGPQSS  105



>gb|KEH36346.1| glutamate receptor 3.2 [Medicago truncatula]
Length=959

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RPS +NIG I T  S +GK+ KL +E AVKD+NSN ++L  T+L + +   + SG  G
Sbjct  70   NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNSSILHSTQLVLHMQTSNCSGFDG  129

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +++A+R+METD +AI+GPQSS
Sbjct  130  MIQALRFMETDVIAILGPQSS  150



>gb|KEH36349.1| glutamate receptor 3.2 [Medicago truncatula]
Length=781

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RPS +NIG I T  S +GK+ KL +E AVKD+NSN ++L  T+L + +   + SG  G
Sbjct  25   NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNSSILHSTQLVLHMQTSNCSGFDG  84

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +++A+R+METD +AI+GPQSS
Sbjct  85   MIQALRFMETDVIAILGPQSS  105



>gb|KHG21169.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=925

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            GV S     P ++N+G I +  +  GK+ K+ ++ A  DINS+P+VLGG KL I + D +
Sbjct  15   GVLSEEGLNPGIMNVGAIFSFNTINGKVAKVAMKAAEDDINSDPSVLGGRKLSIQLHDSN  74

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             S  LGI+ A+++METDTVAIIGPQSS
Sbjct  75   FSSFLGIIGALQFMETDTVAIIGPQSS  101



>emb|CAN64711.1| hypothetical protein VITISV_043726 [Vitis vinifera]
Length=959

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  PSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVE  55
            P V+NIG I T  +  GK+ K+ ++ A +D+NS+P++LGG KL IT+ D + SG L IV 
Sbjct  83   PEVVNIGAIFTFSTINGKVAKIAMKAAEQDVNSDPSILGGRKLAITLHDSNYSGFLSIVG  142

Query  54   AIRYMETDTVAIIGPQSS  1
            A+++ME+DTVAIIGPQS+
Sbjct  143  ALQFMESDTVAIIGPQSA  160



>ref|XP_010686867.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686871.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686877.1| PREDICTED: glutamate receptor 3.3 [Beta vulgaris subsp. vulgaris]
Length=931

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            ++RP+V+NIG +    S +GK+ K+ I+ AV D+NSN ++L G+KL++T+ D   SG LG
Sbjct  25   ASRPAVINIGALFNFNSTIGKVAKIAIQEAVNDVNSNSSILHGSKLNLTMRDSVCSGFLG  84

Query  63   IVEAIRYMETDTVAIIGPQSS  1
             ++A++ MET+ +AIIGPQSS
Sbjct  85   FIQAMQLMETEVMAIIGPQSS  105



>ref|XP_011092253.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092254.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092255.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
Length=931

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  240  ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGI  61
            +RP+V+NIG   T  +  GK+ K+ +  AV+D+NS+P+ LGG+KL ++  D + SG LGI
Sbjct  28   SRPAVVNIGAAFTFGTINGKVAKIAMNAAVEDVNSDPSFLGGSKLVLSTHDSNYSGFLGI  87

Query  60   VEAIRYMETDTVAIIGPQSS  1
            +  ++YMETDTVAIIGPQ S
Sbjct  88   IGGLQYMETDTVAIIGPQVS  107



>ref|XP_004290072.1| PREDICTED: glutamate receptor 3.2-like [Fragaria vesca subsp. 
vesca]
Length=939

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  270  LCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIV  91
            +C G  +  ++RP+V+NIG +  + +  G ++K+ I+ A +D+N++P++L GTK  ++I 
Sbjct  12   ICVGRFTEGASRPAVVNIGAMFAVSTINGGVSKIAIKAAEEDVNADPSILSGTKFSVSIH  71

Query  90   DDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            D + SG L I+ A++YME+DTVAIIGPQ+S
Sbjct  72   DSNYSGFLSIIGALKYMESDTVAIIGPQTS  101



>ref|XP_002279899.1| PREDICTED: glutamate receptor 3.2 [Vitis vinifera]
Length=917

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  PSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVE  55
            P V+NIG I T  +  GK+ K+ ++ A +D+NS+P++LGG KL IT+ D + SG L IV 
Sbjct  24   PEVVNIGAIFTFSTINGKVAKIAMKAAEQDVNSDPSILGGRKLAITLHDSNYSGFLSIVG  83

Query  54   AIRYMETDTVAIIGPQSS  1
            A+++ME+DTVAIIGPQS+
Sbjct  84   ALQFMESDTVAIIGPQSA  101



>emb|CBI37733.3| unnamed protein product [Vitis vinifera]
Length=1147

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  PSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVE  55
            P V+NIG I T  +  GK+ K+ ++ A +D+NS+P++LGG KL IT+ D + SG L IV 
Sbjct  254  PEVVNIGAIFTFSTINGKVAKIAMKAAEQDVNSDPSILGGRKLAITLHDSNYSGFLSIVG  313

Query  54   AIRYMETDTVAIIGPQSS  1
            A+++ME+DTVAIIGPQS+
Sbjct  314  ALQFMESDTVAIIGPQSA  331



>ref|XP_008230073.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
 ref|XP_008230074.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
Length=944

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  NST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSN  79
            N+T LS RPS LNIG + TL S +G+  K  I  A+ D+NS+P +L GTKL++ + D + 
Sbjct  37   NATHLSTRPSSLNIGALFTLNSVIGRAAKPAIYAAIDDVNSDPRILPGTKLNVILHDTNC  96

Query  78   SGLLGIVEAIRYMETDTVAIIGPQSS  1
            SG LG VEA++ +E D VA IGPQSS
Sbjct  97   SGFLGTVEALQLIENDVVAAIGPQSS  122



>gb|EEE56178.1| hypothetical protein OsJ_05129 [Oryza sativa Japonica Group]
Length=870

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-  88
            +G+  +L+ARPS++NIG IL   S +G ++ + I+ A++DINS+  +L GT L + + D 
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  87   DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + G LG+VEA+++METD +AIIGPQ S
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCS  106



>ref|XP_010426707.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426708.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426709.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426710.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426711.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426713.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010426714.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
 ref|XP_010426715.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
 ref|XP_010426716.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=862

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ +++SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  25   QGLTTSVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  84

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  85   KFNGFMSFLEPLRFMESETVAIIVPQRS  112



>ref|XP_010496956.1| PREDICTED: glutamate receptor 3.6-like, partial [Camelina sativa]
Length=561

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ +++SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  25   QGLTTSVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  84

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  85   KFNGFMSFLEPLRFMESETVAIIVPQRS  112



>ref|XP_010090700.1| Glutamate receptor 3.2 [Morus notabilis]
 gb|EXB40419.1| Glutamate receptor 3.2 [Morus notabilis]
Length=927

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  252  STLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSG  73
            S  ++RPSV+ +G I T +S  G+++K+ IE A +D+NS+ +VLGGTKL +T  D + SG
Sbjct  19   SEEASRPSVVKVGAIFTSKSINGRVSKVAIEAAEQDVNSDMSVLGGTKLSVTFHDSNYSG  78

Query  72   LLGIVEAIRYMETDTVAIIGPQSS  1
             LGI+ A+ +M +DTVAIIGPQ++
Sbjct  79   FLGILGALTFMGSDTVAIIGPQNA  102



>ref|XP_010426717.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
 ref|XP_010426719.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
 ref|XP_010426720.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
Length=854

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ +++SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  17   QGLTTSVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  77   KFNGFMSFLEPLRFMESETVAIIVPQRS  104



>ref|XP_008241922.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
 ref|XP_008241923.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=924

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLS-ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            GV +T++ ARP V+NI  I T  S +GKI K+ I  AV+D+NS+P +L G KL + + + 
Sbjct  23   GVGATVTTARPDVVNIAAIFTFDSVIGKIAKVAIALAVEDVNSDPEILNGKKLTLKMQNT  82

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +S  LGI+EA+ ++E DTVAIIGPQ S
Sbjct  83   KSSDFLGIIEALLFLENDTVAIIGPQFS  110



>ref|XP_009340816.1| PREDICTED: glutamate receptor 3.2-like [Pyrus x bretschneideri]
Length=572

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -2

Query  270  LCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIV  91
            +C   ++  ++RP V+N+G +    S  GK+ K+ IE A  D+N++P++LG TKL I+  
Sbjct  12   VCIQGSAEAASRPPVMNVGAMFAAGSINGKVLKIAIEAAGNDVNADPSILGKTKLSISFH  71

Query  90   DDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            D + SG LG++ A+RYME+DT AI+GPQ+S
Sbjct  72   DSNYSGFLGLIGALRYMESDTFAILGPQNS  101



>ref|XP_010530965.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
 ref|XP_010530966.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
 ref|XP_010530967.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
Length=914

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -2

Query  270  LCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIV  91
            L  G+ S  ++RP V+N+G I +L +  G +  + ++ A  D+NS+P   GG+KL IT+ 
Sbjct  20   LSAGLLSEAASRPHVVNVGAICSLSTKDGIVANIAMKAAENDVNSDPTFFGGSKLAITLH  79

Query  90   DDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            D   SG LG++ A+++METDTVAIIGPQ+S
Sbjct  80   DGKTSGFLGLMGALQFMETDTVAIIGPQTS  109



>ref|XP_007156251.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
 gb|ESW28245.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
Length=738

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
             Y G+  +G+ S++S RP  +NIG IL+  S +G++ K+ I+ AV D+NS+  +L GTKL
Sbjct  12   FYSGFPSKGI-SSVSTRPRAVNIGAILSFNSRIGRVAKVAIQAAVDDVNSDATILNGTKL  70

Query  105  DITIVDDS-NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             I+++D   ++G LGI+++   ME +TVAIIGPQ S
Sbjct  71   KISMLDTKLSTGFLGIIDSFLLMERETVAIIGPQYS  106



>ref|XP_007204033.1| hypothetical protein PRUPE_ppa020695mg [Prunus persica]
 gb|EMJ05232.1| hypothetical protein PRUPE_ppa020695mg [Prunus persica]
Length=900

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G    G+ + ++ARP  +NIG I    S +G+I KL I  AV+D+NS+P +L GTK
Sbjct  9    VFYNGSSSSGLGTNVTARPDTVNIGAIFPFDSVIGEIAKLAISIAVEDVNSDPKLLNGTK  68

Query  108  LDITIVDDSNSGLLGIVE-AIRYMETDTVAIIGPQSS  1
            L + I +  +S  LGIVE A+++ME D VAI+GPQ S
Sbjct  69   LILKIQNIKSSDFLGIVEQALQFMENDIVAILGPQFS  105



>ref|XP_003533408.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
 gb|KHN38861.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            +LY G+   G  +T S  PS +NIG IL+  S +GK+ K+ I  AV DINSN  +L GTK
Sbjct  11   ILYSGFPSIGTTTTDSTSPSAVNIGAILSFNSTIGKVAKVAIHAAVDDINSNATILNGTK  70

Query  108  LDITIVDDS-NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L+IT++D   ++G LGI+++   ME DTVAIIGPQ S
Sbjct  71   LNITLLDTKLSTGFLGIIDSFLLMEKDTVAIIGPQYS  107



>gb|EMT17124.1| Glutamate receptor 3.1 [Aegilops tauschii]
Length=885

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G++ +L+ARP V+NIG IL L S  G +  + I  A++DINS+P VL GT L +   D +
Sbjct  19   GISKSLAARPPVVNIGSILQLNSTTGGVAAIAINAALEDINSDPTVLNGTTLKVETKDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
               G LG+V+A+++METD +AI+GPQ S
Sbjct  79   CFDGFLGMVQALQFMETDVIAIVGPQCS  106



>emb|CAB63012.1| putative glutamate receptor [Arabidopsis thaliana]
Length=1039

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+   +SARP V+NIG + T  S +GK+ K+ ++ AV+D+N++P++L  T L I + D 
Sbjct  191  QGLTKIVSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASPSILNTTTLRIIMHDT  250

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G + I+E +++ME++TVAIIGPQ S
Sbjct  251  KYNGFMSIMEPLQFMESETVAIIGPQRS  278



>ref|XP_006292183.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
 gb|EOA25081.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
Length=903

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+   +SARP V+NIG + T  S +GK+ K+ ++ AV+D+N++P++L  T L I + D 
Sbjct  17   QGLTKIVSARPQVVNIGAVFTFDSLIGKVIKIAMDAAVEDVNASPSILNTTTLKIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G + I+E +++ME++TVAIIGPQ S
Sbjct  77   KFNGFMSIMEPLQFMESETVAIIGPQRS  104



>ref|XP_010515560.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515563.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515564.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=858

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ + +SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  25   QGLTTNVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  84

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  85   KFNGFMSFLEPLRFMESETVAIIVPQRS  112



>ref|XP_003545055.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Glycine max]
Length=915

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  VLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAI  49
            V+ IG I TL++  G+++K+ I+ A KD+NS+P +LGG KL ITI D + SG LG + A+
Sbjct  30   VVKIGAIFTLKTINGRVSKIAIQAAEKDVNSDPRILGGRKLSITIHDSNFSGFLGFIGAL  89

Query  48   RYMETDTVAIIGPQSS  1
            +++ TDTVAIIGPQSS
Sbjct  90   KFLVTDTVAIIGPQSS  105



>ref|XP_010515561.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=858

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ + +SARP VLNIG + T  S +G++ K+ ++ AV+DIN++P+VL  T L I + D 
Sbjct  25   QGLTTNVSARPQVLNIGSVFTFNSHIGRVVKVAMDAAVEDINASPSVLNNTLLKIIMHDT  84

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G +  +E +R+ME++TVAII PQ S
Sbjct  85   KFNGFMSFLEPLRFMESETVAIIVPQRS  112



>ref|XP_003573352.1| PREDICTED: glutamate receptor 3.1 isoform X1 [Brachypodium distachyon]
Length=925

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G+  +L+ARP V+NIG IL   S +G ++ + I  A++DIN++P VL GT L + + D +
Sbjct  19   GICKSLAARPPVVNIGSILQFNSTIGGVSAVAIHAALEDINADPTVLNGTTLQVMLKDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
               G LG+V+A+++METD +AIIGPQ S
Sbjct  79   CYDGFLGMVQALQFMETDVIAIIGPQCS  106



>gb|KDP47011.1| hypothetical protein JCGZ_10738 [Jatropha curcas]
Length=914

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -2

Query  240  ARPS-VLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            AR S V+N+G I +  +  G+++K+ ++ A  DINS+P++LGG KL IT+ D + SG LG
Sbjct  20   ARNSDVVNVGAIFSFSTINGRVSKIAMKAAEDDINSDPSILGGRKLSITMHDSNYSGFLG  79

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            I+ A+++METDTVAIIGPQSS
Sbjct  80   IIGALQFMETDTVAIIGPQSS  100



>ref|NP_190716.3| glutamate receptor 3.6 [Arabidopsis thaliana]
 sp|Q84W41.1|GLR36_ARATH RecName: Full=Glutamate receptor 3.6; AltName: Full=Ligand-gated 
ion channel 3.6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42266.1| putative glutamate receptor [Arabidopsis thaliana]
 gb|AEE78797.1| glutamate receptor 3.6 [Arabidopsis thaliana]
Length=903

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+   +SARP V+NIG + T  S +GK+ K+ ++ AV+D+N++P++L  T L I + D 
Sbjct  17   QGLTKIVSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASPSILNTTTLRIIMHDT  76

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              +G + I+E +++ME++TVAIIGPQ S
Sbjct  77   KYNGFMSIMEPLQFMESETVAIIGPQRS  104



>ref|XP_006595634.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Glycine max]
Length=909

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  VLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAI  49
            V+ IG I TL++  G+++K+ I+ A KD+NS+P +LGG KL ITI D + SG LG + A+
Sbjct  24   VVKIGAIFTLKTINGRVSKIAIQAAEKDVNSDPRILGGRKLSITIHDSNFSGFLGFIGAL  83

Query  48   RYMETDTVAIIGPQSS  1
            +++ TDTVAIIGPQSS
Sbjct  84   KFLVTDTVAIIGPQSS  99



>ref|XP_006364369.1| PREDICTED: glutamate receptor 3.2-like [Solanum tuberosum]
Length=895

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  225  LNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAIR  46
            + IG I +  +  GK+ K+ +E AV+D+NS+P++LGG KL +T+ D + SG LGI+ A++
Sbjct  24   VKIGAIFSFGTTNGKVAKIAMEAAVQDVNSDPSLLGGRKLALTLHDSNYSGFLGIIGALQ  83

Query  45   YMETDTVAIIGPQSS  1
            +METDTVA+IGPQSS
Sbjct  84   FMETDTVAVIGPQSS  98



>ref|XP_006595635.1| PREDICTED: glutamate receptor 3.2-like isoform X3 [Glycine max]
Length=774

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  VLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAI  49
            V+ IG I TL++  G+++K+ I+ A KD+NS+P +LGG KL ITI D + SG LG + A+
Sbjct  30   VVKIGAIFTLKTINGRVSKIAIQAAEKDVNSDPRILGGRKLSITIHDSNFSGFLGFIGAL  89

Query  48   RYMETDTVAIIGPQSS  1
            +++ TDTVAIIGPQSS
Sbjct  90   KFLVTDTVAIIGPQSS  105



>ref|XP_010270508.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=897

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  222  NIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAIRY  43
            NIG IL+  S +G++ K+ +E A+ D+NSN +VL GTKL I + + + SG +GIVEA+++
Sbjct  40   NIGAILSFDSTIGRVAKIALEAAMDDVNSNSSVLHGTKLVIKMQNSNCSGFVGIVEALQF  99

Query  42   METDTVAIIGPQSS  1
            MET+T+AIIGPQSS
Sbjct  100  METNTIAIIGPQSS  113



>ref|XP_010270507.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=938

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  222  NIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAIRY  43
            NIG IL+  S +G++ K+ +E A+ D+NSN +VL GTKL I + + + SG +GIVEA+++
Sbjct  40   NIGAILSFDSTIGRVAKIALEAAMDDVNSNSSVLHGTKLVIKMQNSNCSGFVGIVEALQF  99

Query  42   METDTVAIIGPQSS  1
            MET+T+AIIGPQSS
Sbjct  100  METNTIAIIGPQSS  113



>ref|XP_007217063.1| hypothetical protein PRUPE_ppa001079mg [Prunus persica]
 gb|EMJ18262.1| hypothetical protein PRUPE_ppa001079mg [Prunus persica]
Length=916

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLL  67
            LS RPS LNIG + TL S +G+  K  I  A+ D+NS+P++L GTKL++ + D + S  L
Sbjct  13   LSTRPSSLNIGALFTLNSVIGRAAKPAIYAAIDDVNSDPSILPGTKLEVILHDTNCSAFL  72

Query  66   GIVEAIRYMETDTVAIIGPQSS  1
            G VEA++ +E D VA IGPQSS
Sbjct  73   GTVEALQLIEDDVVAAIGPQSS  94



>emb|CDP07274.1| unnamed protein product [Coffea canephora]
Length=923

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            S RP+V+N+G I +  S +G++ K+ I+ AVKD+NSN  +L GTKL + +   + SG +G
Sbjct  30   STRPAVVNVGAIFSFDSTIGRVAKIAIQEAVKDVNSNSTLLPGTKLVVKMRTSNCSGFVG  89

Query  63   IVEAIRYMETDTVAIIGPQSS  1
            +V A++ MET+TVA+IGPQSS
Sbjct  90   MVGALQLMETETVAVIGPQSS  110



>ref|XP_008353536.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353537.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353538.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=946

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -2

Query  243  SARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLG  64
            SARPS LNIG + T  S +GK  K  I  A++D+NS+ +VL GTKL++   D + SG LG
Sbjct  43   SARPSTLNIGALFTFNSVIGKAAKPAILAAIEDVNSDQSVLHGTKLNVIFHDTNCSGFLG  102

Query  63   IVEAIRYMETDTVAIIGPQSS  1
             VEA++ +E D VA IGPQSS
Sbjct  103  TVEALQLIENDVVAAIGPQSS  123



>gb|KDP43780.1| hypothetical protein JCGZ_22407 [Jatropha curcas]
Length=919

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            V Y G+    V+S   ARP+V+NIG +L   S +GK+ K+ IETAV+D+N +P+VLGGTK
Sbjct  2    VFYNGF-SSNVSSNFDARPNVVNIGALLNFNSTIGKVAKVAIETAVEDVNRDPSVLGGTK  60

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L +    D  SG L  +EA+  + ++ VAI+GPQ S
Sbjct  61   LQVICRTDY-SGYLDTLEALSLIGSEVVAILGPQFS  95



>ref|XP_006646788.1| PREDICTED: glutamate receptor 3.1-like [Oryza brachyantha]
Length=937

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/89 (45%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-  88
            +G+  +L+ARPS +NIG IL   S +G ++ + I+ A++DINS+  +L GT L + + D 
Sbjct  18   DGICRSLAARPSTVNIGSILRFNSTIGGVSVVAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  87   DSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            + + G LG+V+A+++METD +AIIGPQ S
Sbjct  78   NCDDGFLGMVQALQFMETDVIAIIGPQCS  106



>ref|XP_002451391.1| hypothetical protein SORBIDRAFT_04g001290 [Sorghum bicolor]
 gb|EES04367.1| hypothetical protein SORBIDRAFT_04g001290 [Sorghum bicolor]
Length=768

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G+  +L+ARP V++IG IL L S  G ++ + I  AV DINS+P +L GT L +   D +
Sbjct  18   GIGKSLAARPPVVSIGSILQLSSTTGGVSDVAIHAAVDDINSDPTILNGTTLQVDTRDTN  77

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + G LG+VEA++YM TD + IIGPQ S
Sbjct  78   CDDGFLGMVEALQYMATDVITIIGPQCS  105



>ref|XP_010270512.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010270513.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
Length=924

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  240  ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGI  61
            +RP+ +NIG I T  +  GK+ ++ ++ AV D+NS+ ++LGG+KL +T  D + SGL GI
Sbjct  22   SRPASVNIGAIFTFDTINGKVARIAMKAAVDDVNSDLSILGGSKLALTFHDSNYSGLFGI  81

Query  60   VEAIRYMETDTVAIIGPQ  7
            + A++YME DTVAIIGPQ
Sbjct  82   IGALQYMEADTVAIIGPQ  99



>gb|EMT06987.1| Glutamate receptor 3.3 [Aegilops tauschii]
Length=901

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G+   L+ARP V+NIG IL   S  G +  + I  A++DINS+P VL GT L + I D +
Sbjct  19   GICKGLAARPPVVNIGSILQFNSTTGGVAAVAIHAALEDINSDPTVLNGTTLKVQIKDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
               G LG+V+A+++METD VA+IGPQ S
Sbjct  79   CFDGFLGMVQALQFMETDVVALIGPQCS  106



>ref|XP_010907850.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=932

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNS  76
            N++ S+ P V+N+G + T  S +G+   L IE AV+D+N + +VL GTKL++   D + S
Sbjct  35   NTSNSSVPPVVNVGALFTFNSTIGRAATLAIEFAVEDVNKDASVLSGTKLNVIKQDTNCS  94

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G LG +EA++ ME D VAIIGPQSS
Sbjct  95   GFLGTIEALQLMEKDVVAIIGPQSS  119



>ref|XP_011022198.1| PREDICTED: glutamate receptor 3.6-like [Populus euphratica]
Length=931

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G+N T  ARP V+ IG +L   + VGK+ K+ IE AV+D+N+N  +LG TKL + + D  
Sbjct  29   GLNDT--ARPKVVKIGALLNFNTIVGKVAKVAIEAAVEDVNNNNTILGETKLQVAMHDTK  86

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            NS  LG+++A+  M+ +TVAIIGPQ+S
Sbjct  87   NSSFLGMLDALGLMDGETVAIIGPQTS  113



>ref|XP_010063139.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Eucalyptus 
grandis]
Length=940

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNS  76
            +  +++RP+ +N+G +L   S +G++ K+ IE AVKD+NSN ++L GT+L + + + + S
Sbjct  33   SKNVTSRPAAVNVGGVLVFDSTIGRVAKIAIEEAVKDVNSNSSILPGTELVLKMQNTNCS  92

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G  G+VE +++M+ D VAI+GPQSS
Sbjct  93   GFFGMVEVLQFMKNDVVAILGPQSS  117



>ref|XP_008666833.1| PREDICTED: glutamate receptor 3.1-like [Zea mays]
Length=635

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVD-D  85
            G+  +L+ARPSV+NI  IL L S  G ++ + I  AV+DIN +P VL GT L +   D +
Sbjct  19   GIGKSLAARPSVVNIRSILQLNSTTGGVSDVAIRAAVEDINLDPTVLNGTTLQVQTRDTN  78

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             N G LG+V+A+++METD +AII PQ S
Sbjct  79   CNDGFLGMVQALQFMETDVIAIIRPQCS  106



>ref|XP_006657772.1| PREDICTED: glutamate receptor 3.4-like [Oryza brachyantha]
Length=928

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLS-ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGT  112
            +L  G + +G N T   +RP+ L IG + T  S +G+  K  IE AV D+N++P VL GT
Sbjct  15   ILASGAMADGQNVTGDGSRPAELRIGALFTFHSVIGRAVKPAIELAVADVNADPGVLPGT  74

Query  111  KLDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            KL IT+ D + SG LG +EA+  +  D VA++GPQSS
Sbjct  75   KLSITMQDTNCSGFLGTIEALELLAKDVVAVLGPQSS  111



>ref|XP_009121143.1| PREDICTED: glutamate receptor 3.1 isoform X2 [Brassica rapa]
Length=876

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -2

Query  282  YCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLD  103
            + G L EG +++   RP V+ +G I  L +  G    L  + A +D+NS+P+ LGG+KL 
Sbjct  14   FLGLLSEGASTS---RPRVIKVGAIFGLNTMYGHTASLAFKAAEEDVNSDPSFLGGSKLR  70

Query  102  ITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            I I D   SG L I+ A+++METD VAIIGPQ+S
Sbjct  71   IMITDAQRSGFLSIMGALQFMETDVVAIIGPQTS  104



>ref|XP_009353274.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009353275.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
Length=959

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  NST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSN  79
            N+T LSARPS LNIG + T  S +G+  K  I  A+ D+NS+ ++L GTKL+I + D + 
Sbjct  38   NATHLSARPSSLNIGALFTFNSVIGRAAKPAILAAIDDVNSDQSILRGTKLNIILHDTNC  97

Query  78   SGLLGIVEAIRYMETDTVAIIGPQSS  1
            SG LG VEA+  +E D VA +GPQSS
Sbjct  98   SGFLGTVEAMELIENDVVAAVGPQSS  123



>ref|XP_009108612.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Brassica rapa]
 ref|XP_009108613.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Brassica rapa]
 ref|XP_009108615.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Brassica rapa]
Length=925

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ S  ++RP V+N+G I  L +  GK+  + ++ A  D+NS+P+ LGG+KL I + D 
Sbjct  16   DGIISEGASRPHVVNVGAIFGLNTLHGKVANIAMKAAEDDVNSDPSFLGGSKLRILMNDA  75

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              SG L I+ A+++METD VAIIGPQ+S
Sbjct  76   KRSGFLSIIGALKFMETDAVAIIGPQTS  103



>ref|XP_010270514.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Nelumbo nucifera]
Length=765

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -2

Query  240  ARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGI  61
            +RP+ +NIG I T  +  GK+ ++ ++ AV D+NS+ ++LGG+KL +T  D + SGL GI
Sbjct  22   SRPASVNIGAIFTFDTINGKVARIAMKAAVDDVNSDLSILGGSKLALTFHDSNYSGLFGI  81

Query  60   VEAIRYMETDTVAIIGPQ  7
            + A++YME DTVAIIGPQ
Sbjct  82   IGALQYMEADTVAIIGPQ  99



>ref|XP_009353273.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Pyrus x bretschneideri]
Length=1009

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  NST-LSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSN  79
            N+T LSARPS LNIG + T  S +G+  K  I  A+ D+NS+ ++L GTKL+I + D + 
Sbjct  88   NATHLSARPSSLNIGALFTFNSVIGRAAKPAILAAIDDVNSDQSILRGTKLNIILHDTNC  147

Query  78   SGLLGIVEAIRYMETDTVAIIGPQSS  1
            SG LG VEA+  +E D VA +GPQSS
Sbjct  148  SGFLGTVEAMELIENDVVAAVGPQSS  173



>ref|XP_002306435.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
 gb|EEE93431.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
Length=913

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G+N T  ARP V+ IG +L   + VGK+ K+ IE AV+D+N N  +LG TKL +T+ D  
Sbjct  13   GLNDT--ARPKVVKIGALLNFNTTVGKVAKVAIEAAVEDVN-NSTILGETKLQVTMQDTE  69

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
            NS  LG+++A+  M+ +TVAIIGPQ+S
Sbjct  70   NSSFLGMLDALSLMDGETVAIIGPQTS  96



>emb|CDX76331.1| BnaA08g10690D [Brassica napus]
Length=910

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ S  ++RP V+N+G I  L +  GK+  + ++ A  D+NS+P+ LGG+KL I + D 
Sbjct  16   DGIISEGASRPHVVNVGAIFGLNTLHGKVANIAMKAAEDDVNSDPSFLGGSKLRILMNDA  75

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              SG L I+ A+++METD VAIIGPQ+S
Sbjct  76   KRSGFLSIIGALKFMETDAVAIIGPQTS  103



>ref|XP_009108616.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Brassica rapa]
Length=910

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ S  ++RP V+N+G I  L +  GK+  + ++ A  D+NS+P+ LGG+KL I + D 
Sbjct  16   DGIISEGASRPHVVNVGAIFGLNTLHGKVANIAMKAAEDDVNSDPSFLGGSKLRILMNDA  75

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              SG L I+ A+++METD VAIIGPQ+S
Sbjct  76   KRSGFLSIIGALKFMETDAVAIIGPQTS  103



>ref|XP_008667839.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=914

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            ++C      +    SARPSV+N+G + T  S +G+  K+ I  AV DIN +P+VL GTKL
Sbjct  10   IFCCVCSCALGQNTSARPSVVNVGALFTFHSTIGRAAKVAIAAAVNDINRDPSVLQGTKL  69

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + D + SG + IV+A+++ME DT+AIIGPQSS
Sbjct  70   VVQMQDTNYSGFISIVQALQFMEKDTIAIIGPQSS  104



>ref|XP_009121142.1| PREDICTED: glutamate receptor 3.1 isoform X1 [Brassica rapa]
Length=912

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -2

Query  282  YCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLD  103
            + G L EG +++   RP V+ +G I  L +  G    L  + A +D+NS+P+ LGG+KL 
Sbjct  14   FLGLLSEGASTS---RPRVIKVGAIFGLNTMYGHTASLAFKAAEEDVNSDPSFLGGSKLR  70

Query  102  ITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            I I D   SG L I+ A+++METD VAIIGPQ+S
Sbjct  71   IMITDAQRSGFLSIMGALQFMETDVVAIIGPQTS  104



>ref|XP_009108617.1| PREDICTED: glutamate receptor 3.2-like isoform X3 [Brassica rapa]
Length=904

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ S  ++RP V+N+G I  L +  GK+  + ++ A  D+NS+P+ LGG+KL I + D 
Sbjct  16   DGIISEGASRPHVVNVGAIFGLNTLHGKVANIAMKAAEDDVNSDPSFLGGSKLRILMNDA  75

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              SG L I+ A+++METD VAIIGPQ+S
Sbjct  76   KRSGFLSIIGALKFMETDAVAIIGPQTS  103



>ref|XP_008667836.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008667837.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008667838.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA36289.1| TPA: hypothetical protein ZEAMMB73_842396 [Zea mays]
Length=931

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  LYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKL  106
            ++C      +    SARPSV+N+G + T  S +G+  K+ I  AV DIN +P+VL GTKL
Sbjct  10   IFCCVCSCALGQNTSARPSVVNVGALFTFHSTIGRAAKVAIAAAVNDINRDPSVLQGTKL  69

Query  105  DITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
             + + D + SG + IV+A+++ME DT+AIIGPQSS
Sbjct  70   VVQMQDTNYSGFISIVQALQFMEKDTIAIIGPQSS  104



>ref|XP_002520606.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF41779.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=924

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  PSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVE  55
            P V+N+G I T  +  GK+ ++ ++ A  DINS+P++LGG K   T+ D + SG LGI+ 
Sbjct  23   PGVINVGAIFTFNTINGKVARIAMKAAEDDINSDPSILGGWKFSTTMHDSNFSGFLGIIG  82

Query  54   AIRYMETDTVAIIGPQSS  1
            A+++METDTVAI+GPQ++
Sbjct  83   ALQFMETDTVAILGPQNA  100



>ref|XP_010548165.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548166.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548167.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548168.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548169.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548170.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
Length=922

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = -2

Query  288  VLYCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTK  109
            VL  G + EG +S    R  V+N+G I +L +  G+I    ++ A  D+NS+P+ LGG+K
Sbjct  12   VLGTGLVSEGASSR---RHDVVNVGAICSLSTTDGRIANFAMKAAENDVNSDPSFLGGSK  68

Query  108  LDITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            L+IT+ +   SG L ++ A+++METDTVAIIGPQ+S
Sbjct  69   LNITLHNGKTSGFLSLMGALQFMETDTVAIIGPQTS  104



>ref|XP_010426704.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
 ref|XP_010426705.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
Length=903

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
            G+   +SARP  +NIG + T  S +GK+ K+ ++ AV+D+N++P++L  T L I + D  
Sbjct  18   GLTKIVSARPKAVNIGAVFTFNSLIGKVIKVAMDAAVEDVNASPSILNTTTLKIIMHDTK  77

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             +G + I+E + +ME++TVAIIGPQ S
Sbjct  78   FNGFMSIMEPLHFMESETVAIIGPQRS  104



>emb|CAN72607.1| hypothetical protein VITISV_021339 [Vitis vinifera]
Length=916

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  VLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEAI  49
            ++N+G + T  S +G++ K+ IE AVKD+NS+  VL GTK  +T+ + + SG +G++ A+
Sbjct  13   IVNVGAVFTFESTIGRVAKIAIEEAVKDVNSDAGVLTGTKFVLTMRNSNCSGFIGMIGAL  72

Query  48   RYMETDTVAIIGPQSS  1
            ++MET+T+AIIGPQSS
Sbjct  73   QFMETETIAIIGPQSS  88



>ref|XP_004509455.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
 ref|XP_004509456.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=940

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = -2

Query  255  NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSN-  79
            NST+   P+ +NIG + +  + VG+I K+ +E AVKDINS+P++LG TKL +++ +DS  
Sbjct  26   NSTVP--PAFVNIGVLYSFNTSVGRIVKIAVEAAVKDINSDPSILGKTKLKLSLQEDSKY  83

Query  78   SGLLGIVEAIRYMETDTVAIIGPQSS  1
             G L I EA++ M T TVAIIGPQ+S
Sbjct  84   RGFLSIAEALQLMATRTVAIIGPQTS  109



>ref|XP_007142574.1| hypothetical protein PHAVU_008G292200g [Phaseolus vulgaris]
 gb|ESW14568.1| hypothetical protein PHAVU_008G292200g [Phaseolus vulgaris]
Length=791

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -2

Query  231  SVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNSGLLGIVEA  52
            SV+ IG I TL++  G+++K+ I+ A KD+NS+P +LGG KL I   D + SG LG + A
Sbjct  29   SVVKIGAIFTLKTTNGQVSKIAIQAAEKDVNSDPRILGGRKLSINFHDSNFSGFLGFIGA  88

Query  51   IRYMETDTVAIIGPQSS  1
            ++++ TDTVAIIGPQ+S
Sbjct  89   LKFLMTDTVAIIGPQTS  105



>emb|CDY65624.1| BnaCnng48020D [Brassica napus]
Length=870

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  264  EGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDD  85
            +G+ S  ++RP V+N+G I  L +  GK+  + ++ A  D+NS+P+ LGG+KL I + D 
Sbjct  16   DGIISEGASRPHVVNVGAIFGLNTLHGKVAYIAMKAAEDDVNSDPSFLGGSKLRILMNDA  75

Query  84   SNSGLLGIVEAIRYMETDTVAIIGPQSS  1
              SG L I+ A+++METD VAIIGPQ+S
Sbjct  76   KRSGFLSIIGALKFMETDVVAIIGPQTS  103



>dbj|BAK04480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  GVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDS  82
             ++  + ARP  +++G + T  S +G+  K+ I  AV DIN + ++L GT L + + D +
Sbjct  16   ALSKNIYARPDTVSVGALFTFNSTIGRAAKIAISAAVNDINKDSSILPGTNLVVEMQDSN  75

Query  81   NSGLLGIVEAIRYMETDTVAIIGPQSS  1
             SG +GIV+A+++ME DTVAIIGPQSS
Sbjct  76   CSGFVGIVQALQFMEKDTVAIIGPQSS  102



>ref|XP_009403107.1| PREDICTED: glutamate receptor 3.5-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNS  76
            +  +++ PS +N+G + T  S +G+  KL IE AV+D+NS+P+VL GT+L++   D   S
Sbjct  22   SGNIASWPSAVNVGALFTFDSTIGRAAKLAIELAVEDVNSSPSVLAGTRLNLYAQDTYCS  81

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G  GI+E+++ +E + VAIIGPQSS
Sbjct  82   GFFGIIESLQLIEKNVVAIIGPQSS  106



>emb|CDY24327.1| BnaA07g02520D [Brassica napus]
Length=912

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -2

Query  282  YCGYLCEGVNSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLD  103
            + G L EG +++   RP V+ +G I  L +  G    L  + A +D+NS+P+ LGG+KL 
Sbjct  14   FLGLLSEGASTS---RPRVIKVGAIFGLNTMYGHTASLAFKAAEEDVNSDPSFLGGSKLR  70

Query  102  ITIVDDSNSGLLGIVEAIRYMETDTVAIIGPQSS  1
            I I D   SG L I+ A+++METD VAIIGPQ+S
Sbjct  71   IMISDAQRSGFLSIMGALQFMETDVVAIIGPQTS  104



>gb|KEH39012.1| glutamate receptor 3.2 [Medicago truncatula]
Length=662

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  NSTLSARPSVLNIGCILTLRSDVGKITKLVIETAVKDINSNPAVLGGTKLDITIVDDSNS  76
            NST+S+RP+V+ IG + T+ S +G+  +  I+TA+ D+N+N  +L G K+D+   D + S
Sbjct  28   NSTVSSRPTVVKIGALFTVDSVIGRSAQQGIKTAIDDVNANKTILPGIKMDVIFHDTNCS  87

Query  75   GLLGIVEAIRYMETDTVAIIGPQSS  1
            G +G VEA++ ME + +A IGPQSS
Sbjct  88   GFIGTVEALQLMENEVIATIGPQSS  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 505919614020