BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25763_g3_i8 len=849 path=[4729:0-256 4986:257-259 22571:260-280
10713:281-290 5020:291-320 10752:321-325 10757:326-370 10802:371-427
10859:428-517 10947:518-524 10954:525-580 22711:581-588 5635:589-622
5669:623-848]

Length=849
                                                                      Score     E

gb|EYU27455.1|  hypothetical protein MIMGU_mgv1a020792mg              54.7    2e-14   
gb|EPS71928.1|  hypothetical protein M569_02828                       51.2    5e-13   
ref|XP_011095576.1|  PREDICTED: serine/threonine-protein phosphat...  51.6    6e-13   
ref|XP_008459571.1|  PREDICTED: serine/threonine-protein phosphat...  53.1    2e-10   
ref|XP_004141632.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    2e-10   
ref|XP_008465654.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  52.0    4e-10   
ref|XP_008451650.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    7e-10   
ref|XP_008465830.1|  PREDICTED: serine/threonine-protein phosphat...  48.1    3e-09   
emb|CDP15114.1|  unnamed protein product                              39.7    3e-09   
ref|XP_004173586.1|  PREDICTED: serine/threonine-protein phosphat...  48.9    3e-09   
ref|XP_009770143.1|  PREDICTED: serine/threonine-protein phosphat...  43.9    4e-09   
ref|XP_010524593.1|  PREDICTED: serine/threonine-protein phosphat...  46.2    4e-09   
ref|XP_010313680.1|  PREDICTED: serine/threonine-protein phosphat...  46.6    4e-09   
ref|XP_006306591.1|  hypothetical protein CARUB_v10008092mg           46.2    4e-09   
ref|XP_008806348.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    6e-09   
ref|XP_010649373.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    7e-09   
emb|CAN60689.1|  hypothetical protein VITISV_044150                   55.1    7e-09   Vitis vinifera
ref|XP_010317405.1|  PREDICTED: serine/threonine-protein phosphat...  43.5    8e-09   
ref|XP_010500321.1|  PREDICTED: serine/threonine-protein phosphat...  44.7    1e-08   
ref|XP_010463270.1|  PREDICTED: serine/threonine-protein phosphat...  45.4    1e-08   
ref|XP_010479222.1|  PREDICTED: serine/threonine-protein phosphat...  45.1    1e-08   
ref|NP_175246.2|  serine/threonine-protein phosphatase 7 long for...  44.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913200.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-08   
emb|CAN67486.1|  hypothetical protein VITISV_005993                   47.0    3e-08   Vitis vinifera
ref|XP_008467081.1|  PREDICTED: serine/threonine-protein phosphat...  48.1    3e-08   
ref|XP_010652564.1|  PREDICTED: serine/threonine-protein phosphat...  49.3    3e-08   
ref|XP_009614431.1|  PREDICTED: serine/threonine-protein phosphat...  40.4    3e-08   
emb|CAN63024.1|  hypothetical protein VITISV_030782                   46.6    3e-08   Vitis vinifera
ref|XP_010942698.1|  PREDICTED: serine/threonine-protein phosphat...  48.5    4e-08   
ref|XP_009147994.1|  PREDICTED: serine/threonine-protein phosphat...  43.1    4e-08   
ref|XP_006393476.1|  hypothetical protein EUTSA_v10011184mg           43.1    4e-08   
ref|XP_006345340.1|  PREDICTED: serine/threonine-protein phosphat...  40.0    6e-08   
ref|XP_010913201.1|  PREDICTED: mediator of DNA damage checkpoint...  53.5    8e-08   
ref|XP_010646219.1|  PREDICTED: uncharacterized protein LOC104878132  43.1    1e-07   
ref|XP_010647645.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    2e-07   
emb|CDP20708.1|  unnamed protein product                              39.3    2e-07   
emb|CAN80287.1|  hypothetical protein VITISV_031384                   42.0    2e-07   Vitis vinifera
ref|XP_010648236.1|  PREDICTED: serine/threonine-protein phosphat...  49.3    2e-07   
ref|XP_010664952.1|  PREDICTED: uncharacterized protein LOC104882614  42.0    2e-07   
ref|XP_008452146.1|  PREDICTED: serine/threonine-protein phosphat...  43.9    3e-07   
emb|CDP22050.1|  unnamed protein product                              49.7    8e-07   
ref|XP_011072162.1|  PREDICTED: serine/threonine-protein phosphat...  40.4    8e-07   
ref|XP_009798030.1|  PREDICTED: serine/threonine-protein phosphat...  44.3    9e-07   
emb|CDP15529.1|  unnamed protein product                              38.9    1e-06   
ref|XP_010660156.1|  PREDICTED: serine/threonine-protein phosphat...  40.8    1e-06   
emb|CAN72880.1|  hypothetical protein VITISV_009742                   42.0    2e-06   Vitis vinifera
ref|XP_011101224.1|  PREDICTED: serine/threonine-protein phosphat...  39.7    2e-06   
emb|CDP03974.1|  unnamed protein product                              41.2    2e-06   
ref|XP_009774892.1|  PREDICTED: serine/threonine-protein phosphat...  40.8    3e-06   
ref|XP_009617744.1|  PREDICTED: serine/threonine-protein phosphat...  39.7    4e-06   
emb|CDP19152.1|  unnamed protein product                              38.1    4e-06   
ref|XP_009763423.1|  PREDICTED: serine/threonine-protein phosphat...  40.8    5e-06   
ref|XP_011093250.1|  PREDICTED: serine/threonine-protein phosphat...  39.3    6e-06   
ref|XP_008460604.1|  PREDICTED: serine/threonine-protein phosphat...  47.0    6e-06   
ref|XP_006361537.1|  PREDICTED: serine/threonine-protein phosphat...  42.7    8e-06   
ref|XP_009767271.1|  PREDICTED: serine/threonine-protein phosphat...  39.7    1e-05   
emb|CAN64400.1|  hypothetical protein VITISV_033061                   39.7    2e-05   Vitis vinifera
ref|XP_010661218.1|  PREDICTED: serine/threonine-protein phosphat...  38.9    2e-05   
ref|XP_004981664.1|  PREDICTED: serine/threonine-protein phosphat...  47.0    3e-05   
ref|XP_004250585.2|  PREDICTED: serine/threonine-protein phosphat...  33.9    4e-05   
ref|XP_009629375.1|  PREDICTED: serine/threonine-protein phosphat...  38.9    4e-05   
dbj|BAD99222.1|  mutator transposase-like polypeptide                 39.7    6e-05   Petunia x hybrida [garden petunia]
emb|CAN81676.1|  hypothetical protein VITISV_040772                   41.2    7e-05   Vitis vinifera
emb|CAN76929.1|  hypothetical protein VITISV_024833                   38.9    7e-05   Vitis vinifera
ref|XP_007146142.1|  hypothetical protein PHAVU_006G0158000g          36.2    8e-05   
ref|XP_009601564.1|  PREDICTED: serine/threonine-protein phosphat...  37.7    9e-05   
ref|XP_009791249.1|  PREDICTED: serine/threonine-protein phosphat...  37.4    1e-04   
emb|CAN78664.1|  hypothetical protein VITISV_019818                   37.0    1e-04   Vitis vinifera
emb|CAN72427.1|  hypothetical protein VITISV_008825                   37.0    1e-04   Vitis vinifera
gb|EAY75755.1|  hypothetical protein OsI_03667                        38.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006644339.1|  PREDICTED: serine/threonine-protein phosphat...  37.7    1e-04   
ref|XP_003568248.1|  PREDICTED: serine/threonine-protein phosphat...  37.7    2e-04   
ref|NP_001172392.1|  Os01g0531200                                     37.7    2e-04   
gb|EEC70809.1|  hypothetical protein OsI_02270                        37.7    2e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001047295.1|  Os02g0592600                                     37.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54729.1|  hypothetical protein OsJ_02076                        37.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13472.1|  hypothetical protein OsJ_03388                        37.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CBI37541.3|  unnamed protein product                              39.3    2e-04   
ref|XP_002463838.1|  hypothetical protein SORBIDRAFT_01g007195        44.3    2e-04   Sorghum bicolor [broomcorn]
gb|EAY86498.1|  hypothetical protein OsI_07878                        37.4    2e-04   Oryza sativa Indica Group [Indian rice]
emb|CDP04906.1|  unnamed protein product                              41.2    3e-04   
ref|XP_009619369.1|  PREDICTED: serine/threonine-protein phosphat...  40.4    3e-04   
ref|XP_009596943.1|  PREDICTED: serine/threonine-protein phosphat...  37.0    5e-04   
ref|XP_010314992.1|  PREDICTED: serine/threonine-protein phosphat...  35.8    5e-04   
ref|XP_008657989.1|  PREDICTED: uncharacterized protein LOC100191...  36.2    5e-04   
emb|CDP12451.1|  unnamed protein product                              38.9    6e-04   
ref|XP_008461739.1|  PREDICTED: serine/threonine-protein phosphat...  36.2    6e-04   
emb|CDP17527.1|  unnamed protein product                              39.7    6e-04   
ref|XP_009758343.1|  PREDICTED: serine/threonine-protein phosphat...  36.6    6e-04   
ref|XP_006356572.1|  PREDICTED: NAC transcription factor 25-like      36.2    7e-04   
ref|XP_010314469.1|  PREDICTED: serine/threonine-protein phosphat...  36.6    8e-04   
gb|EMS47434.1|  hypothetical protein TRIUR3_14673                     42.0    0.001   
ref|XP_006354318.1|  PREDICTED: serine/threonine-protein phosphat...  36.6    0.001   



>gb|EYU27455.1| hypothetical protein MIMGU_mgv1a020792mg, partial [Erythranthe 
guttata]
Length=616

 Score = 54.7 bits (130),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP+D S L  Q   R+  IW   N++  L   + D         D RV++ +  +GF
Sbjct  9    LHPGPIDDSILTLQDHHRSTDIWNGQNFE-PLTCRRCDGHFWRLGTLDPRVQQMMLKAGF  67

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV +  +++LDH LITAL+ER
Sbjct  68   YGVYKAGRMRLDHALITALVER  89


 Score = 37.4 bits (85),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQD+ V
Sbjct  91   RPETHTFHLPVGETTVTLQDISV  113


 Score = 34.7 bits (78),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL VDG  +TG DT  +  + + +C ELLGF+
Sbjct  114  LWGLPVDGDPITGVDTNRSMDEWQDICNELLGFR  147



>gb|EPS71928.1| hypothetical protein M569_02828, partial [Genlisea aurea]
Length=550

 Score = 51.2 bits (121),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP+D+S L  Q   R+  IW   +++  L   + D         D RV++ +  +GF
Sbjct  9    LHPGPIDNSVLNLQDHHRSTDIWNGQSFE-PLTCRRCDGQFWRLGTLDPRVQKTMLRAGF  67

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV +  +++LDH L+TAL+ER
Sbjct  68   YGVYKAGRMRLDHALVTALVER  89


 Score = 37.4 bits (85),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQD+ V
Sbjct  91   RPETHTFHLPVGEATVTLQDISV  113


 Score = 33.1 bits (74),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL VDG  +TG D   +  + + +C ELLGF+
Sbjct  114  LWGLPVDGDPITGVDANRSMDEWQEICQELLGFR  147



>ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
 ref|XP_011095577.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
Length=1042

 Score = 51.6 bits (122),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP+D S L  Q   R+  IW   +++  L   + D         D RV++ +  +GF
Sbjct  9    LHPGPIDDSVLTLQDHHRSTDIWDGKDFE-PLTCRRCDGHFWRLGTLDPRVQQMMLKAGF  67

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV +  +++LDH LITAL+ER
Sbjct  68   YGVYKAGRMRLDHALITALVER  89


 Score = 37.7 bits (86),  Expect(3) = 6e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQD+ V
Sbjct  91   RPETHTFHLPVGEATVTLQDISV  113


 Score = 32.0 bits (71),  Expect(3) = 6e-13, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL VDG  +TG DT  +  + + +C ELLGF+
Sbjct  114  LWGLPVDGDPITGVDTNRSMDEWQDICNELLGFR  147



>ref|XP_008459571.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=502

 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP+D + L  QS  R+  IW D++  V L   + +   +     D+R++ +L  +GF
Sbjct  1    MEPGPVDPTQLYQQSSHRSQSIW-DTSSTVVLSCRRREAASQRTIPFDQRIEPYLEAAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
             GVSQ+  +QLD  LITAL+ER
Sbjct  60   LGVSQIGFMQLDWHLITALVER  81


 Score = 40.0 bits (92),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FHMP GE  ITLQDV + L 
Sbjct  83   RPETHTFHMPCGECTITLQDVAIQLG  108



>ref|XP_004141632.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis sativus]
 ref|XP_004164541.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis sativus]
Length=354

 Score = 53.5 bits (127),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP+D + L  Q   R+  IW D++  V L   + +   +     DER++ +L  +GF
Sbjct  1    MEPGPIDPTQLYQQPSHRSQFIW-DTSSTVVLSCRRREAASQRTIPFDERIEPYLEAAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
             GVSQ+  +QLD  LITAL+ER
Sbjct  60   LGVSQIGFMQLDWHLITALVER  81


 Score = 39.7 bits (91),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FHMP GE  ITLQDV + L 
Sbjct  83   RPETHTFHMPCGECTITLQDVAIQLG  108



>ref|XP_008465654.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
7 long form homolog [Cucumis melo]
Length=299

 Score = 52.0 bits (123),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP+D S L  Q+  R+  IW D++  V L   + +   +     D+R+  +L   GF G
Sbjct  3    PGPVDDSHLYLQATHRSQSIW-DTSSTVVLSCRRREAASQRTIPFDQRIAPYLEAVGFLG  61

Query  458  VSQLTKIQLDHGLITALLER  517
            VSQ+  +QLD  LITAL+ER
Sbjct  62   VSQVGFMQLDWHLITALVER  81


 Score = 40.0 bits (92),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FHMP GE  ITLQDV V L 
Sbjct  83   RPETHTFHMPCGECTITLQDVAVQLG  108



>ref|XP_008451650.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=163

 Score = 53.5 bits (127),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP+D S L  Q+  R+  IW D++  V L   + +   +     D+R+  +L  +GF G
Sbjct  44   PGPVDDSHLYLQATHRSQSIW-DTSSTVVLSCRRREAASQRTIPFDQRIAPYLEAAGFLG  102

Query  458  VSQLTKIQLDHGLITALLER  517
            VSQ+  +QLD  LITAL+ER
Sbjct  103  VSQVGFMQLDWHLITALVER  122


 Score = 37.7 bits (86),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RP  H FHMP GE  ITLQDV V L 
Sbjct  124  RPVTHTFHMPCGECTITLQDVAVQLG  149



>ref|XP_008465830.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=125

 Score = 48.1 bits (113),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +2

Query  287  GPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYGV  460
            GP+D   L  Q+  R+  +W D N   ++   + + V++        +   LR SGFYG+
Sbjct  6    GPIDPDVLYDQNIHRSETVWDDRNTP-EINCRRREAVVQRTIPLHRNILPLLRASGFYGL  64

Query  461  SQLTKIQLDHGLITALLER  517
            ++L  IQLD  LITALLER
Sbjct  65   ARLGFIQLDWHLITALLER  83


 Score = 41.6 bits (96),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FHMP GE  ITLQDVEV++ 
Sbjct  85   RPETHTFHMPVGESIITLQDVEVFVG  110



>emb|CDP15114.1| unnamed protein product [Coffea canephora]
Length=481

 Score = 39.7 bits (91),  Expect(3) = 3e-09, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQDVEV
Sbjct  93   RPETHTFHLPVGETTVTLQDVEV  115


 Score = 38.1 bits (87),  Expect(3) = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (48%), Gaps = 2/88 (2%)
 Frame = +2

Query  260  VMANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEW  433
            +  +  + PGP     ++  +  RA  I+       QL   + D          E V+++
Sbjct  4    IPTHAALHPGPFVYDIISAGTAHRAHSIFHGHIVGEQLDVRRCDRHFWEHTPIPETVRQY  63

Query  434  LRISGFYGVSQLTKIQLDHGLITALLER  517
            +R++GF GV     + LDH LIT+L+ER
Sbjct  64   IRLAGFEGVLDCGYMMLDHALITSLVER  91


 Score = 31.2 bits (69),  Expect(3) = 3e-09, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL +DG  V G DT  +  + + +C EL+GF
Sbjct  116  LWGLPIDGPPVIGIDTSHSVEEWRNLCGELIGF  148



>ref|XP_004173586.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Cucumis sativus]
Length=195

 Score = 48.9 bits (115),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGP D + L  Q   R+  IW  S+  V L   + +   +     D+R+  +L+ +GF
Sbjct  1    MEPGPSDPTQLYLQPSHRSQSIWEASS-TVVLSCRRREAASQRTIPFDQRIVPYLKAAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
             G SQ+  +QLD  LITAL+ER
Sbjct  60   LGASQIGFMQLDWHLITALVER  81


 Score = 40.0 bits (92),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYL  594
            RPE H FHMP GE  ITLQDV V L
Sbjct  83   RPETHTFHMPCGECTITLQDVAVQL  107



>ref|XP_009770143.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
 ref|XP_009770144.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
 ref|XP_009770145.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=729

 Score = 43.9 bits (102),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 6/86 (7%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAID---DERVKEWLR  439
            ++ PGPLD S L  Q+  R+  +W +   +  +   + D        D     RV + L 
Sbjct  8    QLHPGPLDHSVLTRQNHHRSKDVW-NGEVEKPILCRRSDGNFWNLVHDRPIHRRVLQILI  66

Query  440  ISGFYGVSQLTKIQLDHGLITALLER  517
             +GFYGV ++ +IQLDH  IT+L+ER
Sbjct  67   DAGFYGVYRVGRIQLDHAFITSLVER  92


 Score = 34.7 bits (78),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+  GE  ITLQDV +
Sbjct  94   RPETHTFHLRVGEATITLQDVAI  116


 Score = 29.6 bits (65),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL V+G  V G D+     + + MC  LLGF+
Sbjct  117  LYGLPVEGRPVLGIDSTRKTEEWQDMCDALLGFR  150



>ref|XP_010524593.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Tarenaya hassleriana]
 ref|XP_010524594.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Tarenaya hassleriana]
Length=1154

 Score = 46.2 bits (108),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    ++ +
Sbjct  8    LLNLDLDPGPVDQSVLVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCRQLI  67

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  68   EF-GLYGVYKVAFIQLDYALITALVER  93


 Score = 42.7 bits (99),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ ITLQDV + L  R
Sbjct  95   RPETHTFHLPVGEITITLQDVNILLGLR  122



>ref|XP_010313680.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum lycopersicum]
Length=861

 Score = 46.6 bits (109),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 22/97 (23%)
 Frame = +2

Query  263  MANERV---RPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAID-----  412
            M NER+    PGPLD S L  Q   R+  +W            + + V+ C   D     
Sbjct  1    MENERLTQLHPGPLDRSVLTRQENHRSEDVW----------GGEVEAVLFCRRCDGGFWS  50

Query  413  --DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
                RV   L  +GFYGV ++  I+LDH  ITAL+ER
Sbjct  51   QVQRRVLHILISAGFYGVYRVGLIKLDHAFITALVER  87


 Score = 32.7 bits (73),  Expect(3) = 4e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  +TLQDV +
Sbjct  89   RPETHTFHFKVGEATVTLQDVAL  111


 Score = 28.9 bits (63),  Expect(3) = 4e-09, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFKI*HDES*N  713
            ++GL ++G  V G D+  T  + + +C + LGF+  HD+  N
Sbjct  112  LYGLPIEGEPVVGIDSSKTPQEWQDLCEQFLGFRP-HDDKLN  152



>ref|XP_006306591.1| hypothetical protein CARUB_v10008092mg [Capsella rubella]
 gb|EOA39489.1| hypothetical protein CARUB_v10008092mg [Capsella rubella]
Length=1401

 Score = 46.2 bits (108),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    K+ +
Sbjct  6    LLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCKKLI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  66   EF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.4 bits (98),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|XP_008806348.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Phoenix dactylifera]
Length=941

 Score = 56.6 bits (135),  Expect(3) = 6e-09, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRAIWTDSNYDVQ-LKAVKYDTVMRCAAIDDERVKEWLR  439
            MAN R++PGP+D S L  Q+  R+   +S   ++ ++ V++   +    ++ E V E L+
Sbjct  1    MAN-RLQPGPVDKSVLTDQARHRSTIIESGQALKPIRFVEHGRKLNMWNVEHEGVLELLK  59

Query  440  ISGFYGVSQLTKIQLDHGLITALLER*GRRST  535
             +GFY +S+L +I LDH L+ AL+ER  RR T
Sbjct  60   RAGFYYLSRLKRIHLDHALLNALIER-WRRET  90


 Score = 25.8 bits (55),  Expect(3) = 6e-09, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%)
 Frame = +3

Query  594  GLKVDGLLVTGQDTIGTKAQVKLMCTELLG  683
            GL VDGL VTG+    T    + +C ELLG
Sbjct  112  GLLVDGLPVTGK----TSYDWEQLCMELLG  137


 Score = 25.0 bits (53),  Expect(3) = 6e-09, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E   FH+  GE+ I L+DV +
Sbjct  87   RRETQTFHLRHGEMTILLKDVAI  109



>ref|XP_010649373.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
 ref|XP_010649374.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
 ref|XP_010649375.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=1005

 Score = 55.1 bits (131),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP+D S L  Q   R  AIWT  N ++     +    MR   +D  RV+ ++  +GFYG
Sbjct  125  PGPIDGSVLVLQHEHRSGAIWTGQNRNILTCRQRLARFMREWPLD-HRVRPYIIQAGFYG  183

Query  458  VSQLTKIQLDHGLITALLER  517
            V ++  IQLD  LITAL+ER
Sbjct  184  VYRVGFIQLDWTLITALVER  203


 Score = 32.7 bits (73),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E H FH+  GE  ITLQD  V L  R
Sbjct  205  RQETHTFHLAVGESTITLQDTAVLLGLR  232



>emb|CAN60689.1| hypothetical protein VITISV_044150 [Vitis vinifera]
Length=1001

 Score = 55.1 bits (131),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP+D S L  Q   R  AIWT  N ++     +    MR   +D  RV+ ++  +GFYG
Sbjct  125  PGPIDGSVLVLQHEHRSGAIWTGQNRNILTCRQRLARFMREWPLD-HRVRPYIIQAGFYG  183

Query  458  VSQLTKIQLDHGLITALLER  517
            V ++  IQLD  LITAL+ER
Sbjct  184  VYRVGFIQLDWTLITALVER  203


 Score = 32.7 bits (73),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E H FH+  GE  ITLQD  V L  R
Sbjct  205  RQETHTFHLAVGESTITLQDTAVLLGLR  232



>ref|XP_010317405.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum lycopersicum]
Length=481

 Score = 43.5 bits (101),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 11/94 (12%)
 Frame = +2

Query  263  MANE---RVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYD----TVMRCAAIDD  415
            MAN+   ++ PGPL+S+ L  Q   R+  IW + N ++ L   + D     ++    I  
Sbjct  1    MANDSEYKLDPGPLESNVLTGQLTHRSQDIW-EGNVNMILNTRREDGNFWKLIEKYPIH-  58

Query  416  ERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
             RV E +R+SG YGV +  +  +D  LITAL+ER
Sbjct  59   PRVLEVIRLSGLYGVYKSNRPAIDRSLITALVER  92


 Score = 35.8 bits (81),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  ITLQDVEV
Sbjct  94   RPETHTFHFRTGEATITLQDVEV  116


 Score = 27.7 bits (60),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL V+G  V G + I T    + +C  LLGF
Sbjct  117  LYGLPVNGDPVLGNEMIRTIEDWQNICQRLLGF  149



>ref|XP_010500321.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Camelina sativa]
Length=1324

 Score = 44.7 bits (104),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    ++ +
Sbjct  6    LLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCQKLI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  66   EF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.4 bits (98),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|XP_010463270.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Camelina sativa]
Length=1146

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +2

Query  260  VMANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEW  433
            V  N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    ++ 
Sbjct  27   VSLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCQKL  86

Query  434  LRISGFYGVSQLTKIQLDHGLITALLER  517
            +   G YGV ++  IQLD+ LITAL+ER
Sbjct  87   IEF-GLYGVYKVAFIQLDYALITALVER  113


 Score = 41.6 bits (96),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  115  RPETHTFHLPAGEITVTLQDVNILLGLR  142



>ref|XP_010479222.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X1 [Camelina sativa]
 ref|XP_010479223.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X1 [Camelina sativa]
Length=1314

 Score = 45.1 bits (105),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    ++ +
Sbjct  6    LLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCQKLI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  66   EF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.0 bits (97),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|NP_175246.2| serine/threonine-protein phosphatase 7 long form homolog [Arabidopsis 
thaliana]
 sp|Q9LNG5.1|PPP7L_ARATH RecName: Full=Serine/threonine-protein phosphatase 7 long form 
homolog [Arabidopsis thaliana]
 gb|AAF79521.1|AC023673_9 F21D18.16 [Arabidopsis thaliana]
 gb|AEE32251.1| serine/threonine-protein phosphatase 7 long form homolog [Arabidopsis 
thaliana]
Length=1340

 Score = 44.7 bits (104),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   +D    ++ +
Sbjct  6    LLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLDPLVCQKLI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  66   EF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.0 bits (97),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|XP_010913200.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X1 [Elaeis guineensis]
Length=941

 Score = 54.7 bits (130),  Expect(3) = 2e-08, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRAIWTDSNYDVQ-LKAVKYDTVMRCAAIDDERVKEWLR  439
            MAN R++PGP+D S L  Q+  R+   +S   ++ ++ V++   +    ++ E V + L+
Sbjct  1    MAN-RLQPGPVDKSVLTDQARHRSAIIESGQALKPIRFVEHGRKLNMWNVEHEGVLDLLK  59

Query  440  ISGFYGVSQLTKIQLDHGLITALLER*GRRST  535
             +GFY +S+L +I LDH L+ AL+ER  RR T
Sbjct  60   RAGFYYLSRLKRIHLDHALLNALIER-WRRET  90


 Score = 25.8 bits (55),  Expect(3) = 2e-08, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%)
 Frame = +3

Query  594  GLKVDGLLVTGQDTIGTKAQVKLMCTELLG  683
            GL VDGL VTG+    T    + +C ELLG
Sbjct  112  GLLVDGLPVTGK----TNYDWEQLCMELLG  137


 Score = 25.0 bits (53),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E   FH+  GE+ I L+DV +
Sbjct  87   RRETQTFHLRHGEMTILLKDVAI  109



>emb|CAN67486.1| hypothetical protein VITISV_005993 [Vitis vinifera]
Length=1448

 Score = 47.0 bits (110),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 3/83 (4%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRRAIWTDSNYDVQLKAVKYD--TVMRCAAIDDERVKEWLRISG  448
            R  P PLD S LA Q   R+   DS    Q+   +    T MR   +D  R++ ++  SG
Sbjct  787  RFDPDPLDRSILALQDRHRSQLVDSGQLNQVLTCRQRLWTFMREWEMD-PRIRRYVMQSG  845

Query  449  FYGVSQLTKIQLDHGLITALLER  517
            FYGV ++  I LD  LIT+L+ER
Sbjct  846  FYGVYRVGHISLDWPLITSLVER  868


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  870  RPETHTFHLPIGEMTVTLQDVAMILGLR  897



>ref|XP_008467081.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Cucumis melo]
Length=296

 Score = 48.1 bits (113),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 3/79 (4%)
 Frame = +2

Query  287  GPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYGV  460
            GP+D S L  Q+  R+  IW D++  V L   + +   +C    D+R+  +L  + F  V
Sbjct  4    GPVDDSHLYLQATHRSQSIW-DTSSTVVLSCRRREAASQCTIPFDQRIAPYLEAARFLRV  62

Query  461  SQLTKIQLDHGLITALLER  517
            SQ+  +QLD  LITAL+ER
Sbjct  63   SQVRFMQLDWHLITALVER  81


 Score = 37.4 bits (85),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYL  594
            RP+ H FHMP G+  ITLQDV V L
Sbjct  83   RPKTHTFHMPCGKCTITLQDVAVQL  107



>ref|XP_010652564.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=754

 Score = 49.3 bits (116),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGPLD + L  Q+  R  A WT  +   +L   + + +    ++ D R+   L+ +GF
Sbjct  1    MEPGPLDPTVLHGQATHRSSAAWTGVDSK-ELHCRRREAIFHRTSVLDGRIIPLLQQAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV++L  I LD  LITA +ER
Sbjct  60   YGVARLGFISLDWHLITAFVER  81


 Score = 36.2 bits (82),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P GE  ITLQD+ + + 
Sbjct  83   RPETHTFHLPQGECTITLQDIAMLIG  108



>ref|XP_009614431.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
 ref|XP_009614432.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=733

 Score = 40.4 bits (93),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAID---DERVKEWLR  439
            ++ PG LD S L  Q+  R+  +W +   +  +   + D        D     RV + L 
Sbjct  8    QLHPGSLDHSVLTRQNHHRSKDVW-NGEVEKPILCRRSDGNFWNLVHDRPIHRRVLQILI  66

Query  440  ISGFYGVSQLTKIQLDHGLITALLER  517
             +GFYGV ++ +IQLDH  IT+L+ER
Sbjct  67   DAGFYGVYRVGRIQLDHAFITSLVER  92


 Score = 34.7 bits (78),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+  GE  ITLQDV +
Sbjct  94   RPETHTFHLRVGEATITLQDVAI  116


 Score = 30.0 bits (66),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL V+G  V G D+     + + MC  LLGF+
Sbjct  117  LYGLPVEGRPVLGIDSTRKTEEWQNMCDALLGFR  150



>emb|CAN63024.1| hypothetical protein VITISV_030782 [Vitis vinifera]
Length=1433

 Score = 46.6 bits (109),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRRAIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFY  454
            R  P PLD S LA Q   R+   DS   +  +   + T MR   +D  R++ ++  SGFY
Sbjct  735  RFDPDPLDRSILALQDRHRSQLVDSGQVLTCRQRLW-TFMREWEMD-PRIRRYVMQSGFY  792

Query  455  GVSQLTKIQLDHGLITALLER  517
            GV ++  I LD  LIT+L+ER
Sbjct  793  GVYRVEHISLDWPLITSLVER  813


 Score = 38.9 bits (89),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  815  RPETHTFHLPIGEMTVTLQDVAMILGLR  842



>ref|XP_010942698.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Elaeis guineensis]
Length=524

 Score = 48.5 bits (114),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP+D S L  Q+  R  AIW            +   + R  ++D  R+  +LR +GFYG
Sbjct  3    PGPIDDSILYGQATHRSSAIWDGQESGFLTCRRRLRALHRSTSLD-IRIVPYLRQAGFYG  61

Query  458  VSQLTKIQLDHGLITALLER  517
            +S++  IQLD  LITA +ER
Sbjct  62   LSRVGFIQLDWHLITAFVER  81


 Score = 37.0 bits (84),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P+GE  ITL+D+ + L 
Sbjct  83   RPETHTFHLPYGECTITLEDICIQLG  108



>ref|XP_009147994.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Brassica rapa]
Length=1334

 Score = 43.1 bits (100),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 10/94 (11%)
 Frame = +2

Query  242  MICFDTVMANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDD  415
            +I FD       + PGP+D S L +Q   R  AIW D     +L        MR   ++ 
Sbjct  6    LISFD-------LDPGPVDQSVLVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLEP  58

Query  416  ERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
               ++ +   G YGV ++  IQLD+ LITAL+ER
Sbjct  59   LVCRKLIEF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.0 bits (97),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|XP_006393476.1| hypothetical protein EUTSA_v10011184mg [Eutrema salsugineum]
 gb|ESQ30762.1| hypothetical protein EUTSA_v10011184mg [Eutrema salsugineum]
Length=1398

 Score = 43.1 bits (100),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWL  436
            + N  + PGP+D S L +Q   R  AIW D     +L        MR   ++    ++ +
Sbjct  6    LLNFDLDPGPVDQSILVWQHEHRSAAIWEDEVPPRELTCRHKLLGMRDWPLEPLVCQKLI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
               G YGV ++  IQLD+ LITAL+ER
Sbjct  66   EF-GLYGVYKVAFIQLDYALITALVER  91


 Score = 42.4 bits (98),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  93   RPETHTFHLPAGEITVTLQDVNILLGLR  120



>ref|XP_006345340.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum tuberosum]
Length=541

 Score = 40.0 bits (92),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 10/85 (12%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVK-----YDTVMRCAAIDDERVKEWLRI  442
            PGPL+ S L  Q   R+  IW D N ++ L   +     +D V +       RV E + +
Sbjct  11   PGPLEPSVLTQQLTHRSRDIW-DGNVNMILNTRRCDGKFWDLVKKYPI--HPRVLEVIEL  67

Query  443  SGFYGVSQLTKIQLDHGLITALLER  517
            SG YG+ +  +  +D  LIT+L+ER
Sbjct  68   SGLYGIYRSNRPSIDRSLITSLVER  92


 Score = 35.8 bits (81),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  ITLQDVEV
Sbjct  94   RPETHTFHFRTGEATITLQDVEV  116


 Score = 28.1 bits (61),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL V+G  V G ++I T    + +C  LLGF
Sbjct  117  LYGLPVNGDPVLGDESIRTIGDWQNICQRLLGF  149



>ref|XP_010913201.1| PREDICTED: mediator of DNA damage checkpoint protein 1-like isoform 
X2 [Elaeis guineensis]
Length=839

 Score = 53.5 bits (127),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRAIWTDSNYDVQ-LKAVKYDTVMRCAAIDDERVKEWLR  439
            MAN R++PGP+D S L  Q+  R+   +S   ++ ++ V++   +    ++ E V + L+
Sbjct  1    MAN-RLQPGPVDKSVLTDQARHRSAIIESGQALKPIRFVEHGRKLNMWNVEHEGVLDLLK  59

Query  440  ISGFYGVSQLTKIQLDHGLITALLER  517
             +GFY +S+L +I LDH L+ AL+ER
Sbjct  60   RAGFYYLSRLKRIHLDHALLNALIER  85


 Score = 25.0 bits (53),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E   FH+  GE+ I L+DV +
Sbjct  87   RRETQTFHLRHGEMTILLKDVAI  109


 Score = 25.0 bits (53),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%)
 Frame = +3

Query  594  GLKVDGLLVTGQDTIGTKAQVKLMCTELLG  683
            GL VDGL VTG+    T    + +C ELLG
Sbjct  112  GLLVDGLPVTGK----TNYDWEQLCMELLG  137



>ref|XP_010646219.1| PREDICTED: uncharacterized protein LOC104878132 [Vitis vinifera]
Length=1625

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRAIWTDSNYDVQLKAV-----KYDTVMRCAAIDDERVKEWLRISG  448
            P PLD+S L  Q   R+   DS    QL +V          MR   +D  R++ ++  SG
Sbjct  850  PDPLDTSVLVLQDRHRSHLVDSG---QLASVLTCRQHVSRFMREWEMDS-RLRPYIIRSG  905

Query  449  FYGVSQLTKIQLDHGLITALLER  517
            FY V ++  I LD GLIT+L+ER
Sbjct  906  FYDVYRIGHITLDWGLITSLVER  928


 Score = 40.8 bits (94),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ ITLQDV V L  R
Sbjct  930  RPETHTFHLPVGEMTITLQDVAVILGLR  957



>ref|XP_010647645.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Vitis vinifera]
Length=263

 Score = 50.1 bits (118),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGPLD + L  Q+  R  A WT  +   +L   + + +    ++ D R+   L+ +GF
Sbjct  1    MEPGPLDPTVLHGQATHRSSAAWTGVD-SKELHCRRREAIFHRTSVLDGRITPLLQQAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV++L  I LD  LITA +ER
Sbjct  60   YGVARLGFISLDWHLITAFVER  81


 Score = 33.1 bits (74),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P  E  ITLQD+ + + 
Sbjct  83   RPETHTFHLPQEECTITLQDIAMLIG  108



>emb|CDP20708.1| unnamed protein product, partial [Coffea canephora]
Length=565

 Score = 39.3 bits (90),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQD+EV
Sbjct  273  RPETHTFHLPVGETTVTLQDIEV  295


 Score = 31.6 bits (70),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLG  683
            ++GL +DG  VTG DT  T  + + +C ELL 
Sbjct  296  LWGLPIDGPPVTGIDTSHTIEEWRNLCEELLA  327


 Score = 31.2 bits (69),  Expect(3) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 2/80 (3%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRAIWTDSNYDV--QLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP     +   S  RA      + V  QL   + D          E V  ++R++GF  
Sbjct  192  PGPFVYDVIPPGSVNRAYSIFHGHIVGDQLDVRRCDRGFWEHTPIPETVLHYIRLAGFGV  251

Query  458  VSQLTKIQLDHGLITALLER  517
            V +   + +DH LIT+L+ER
Sbjct  252  VLECGYMMIDHALITSLVER  271



>emb|CAN80287.1| hypothetical protein VITISV_031384 [Vitis vinifera]
Length=1524

 Score = 42.0 bits (97),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 7/82 (9%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRAIWTDSNYDVQLKAV----KYDTVMRCAAIDDERVKEWLRISGF  451
            P PLD+S L      R+   DS    QL +V    ++ +        D R++ ++  SGF
Sbjct  853  PDPLDTSVLVLXDRHRSHLVDSG---QLASVLTCRQHVSRFXREWEMDSRLRPYIIRSGF  909

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV ++  I LD GLIT+L+ER
Sbjct  910  YGVYRIGHITLDWGLITSLVER  931


 Score = 40.8 bits (94),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ ITLQDV V L  R
Sbjct  933  RPETHTFHLPVGEMTITLQDVAVILGLR  960



>ref|XP_010648236.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=277

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRAI--WTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGF  451
            + PGPLD++ L  Q+  R+   WT  +   +L   + + +    ++ D R+   L+ +GF
Sbjct  1    MEPGPLDATVLHGQATHRSFVAWTGVD-SKELHCRRREAIFHRTSVLDGRIIPLLQQAGF  59

Query  452  YGVSQLTKIQLDHGLITALLER  517
            YGV++L  I LD  LITA +ER
Sbjct  60   YGVARLGFISLDWHLITAFVER  81


 Score = 33.5 bits (75),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH+P GE  ITLQD+ + + 
Sbjct  83   RSETHTFHLPQGECTITLQDIAMLIG  108



>ref|XP_010664952.1| PREDICTED: uncharacterized protein LOC104882614 [Vitis vinifera]
Length=1314

 Score = 42.0 bits (97),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRAIWTDSNYDVQLKAV-----KYDTVMRCAAIDDERVKEWLRISG  448
            P  LD+S L  Q   R+   DS    QL +V          MR   +D  R++ ++  SG
Sbjct  528  PDTLDTSILVLQDRHRSHLVDSG---QLASVLTCRQHISRFMREWEMD-PRLRPYIIRSG  583

Query  449  FYGVSQLTKIQLDHGLITALLER  517
            FYGV ++  I LD GLIT+L+ER
Sbjct  584  FYGVYRIGHITLDWGLITSLVER  606


 Score = 40.4 bits (93),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ ITLQDV V L  R
Sbjct  608  RPETHTFHLPVGEMTITLQDVAVILGLR  635



>ref|XP_008452146.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=211

 Score = 43.9 bits (102),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 10/85 (12%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCR--RAIWTDSN---YDVQLKAVKYDTVMRCAAIDDERVKEWLRI  442
            + P P+D + L  Q+    + IW D N    + + +AV Y T+          +   LR 
Sbjct  3    LNPRPIDPNVLYDQNIHQSKTIWGDHNTPEINCRREAVVYRTISL-----HRNILPLLRA  57

Query  443  SGFYGVSQLTKIQLDHGLITALLER  517
            SGFY +S+L  IQLD  LI AL+ER
Sbjct  58   SGFYEISRLGFIQLDRHLIIALIER  82


 Score = 38.5 bits (88),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FHM  GE  ITLQDVEV + 
Sbjct  84   RPETHTFHMSVGECTITLQDVEVLVG  109



>emb|CDP22050.1| unnamed protein product, partial [Coffea canephora]
Length=598

 Score = 49.7 bits (117),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +2

Query  281  RPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFY  454
             PGPLD S L  QS  R  AI+  +  D+ ++            +DD R+ +++  +GFY
Sbjct  9    HPGPLDGSVLYLQSKHRSAAIFQGTGVDLDVRRCDMRFFQPLIHLDD-RIAQYIDAAGFY  67

Query  455  GVSQLTKIQLDHGLITALLER  517
            G+ +   + +DH LI AL+ER
Sbjct  68   GIRRAGYLTVDHDLINALVER  88


 Score = 31.2 bits (69),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 1/24 (4%)
 Frame = +1

Query  520  RPEVHAFHMP-FGEVGITLQDVEV  588
            + E H FH+P  GE  +TLQDVEV
Sbjct  90   KQETHTFHLPVMGEATVTLQDVEV  113



>ref|XP_011072162.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
Length=481

 Score = 40.4 bits (93),  Expect(3) = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (5%)
 Frame = +2

Query  287  GPLDSSSLAFQSCRRAI-WTDSNYDVQLKAVKYDTVMRCAAIDD---ERVKEWLRISGFY  454
            GP DS+ L+ Q+  R+    D + D  L + + D         +   ERV+E L   GFY
Sbjct  8    GPRDSTVLSQQAQHRSDDIPDGDLDAVLISRRADGTFWSYFNQNNMSERVQEILHQIGFY  67

Query  455  GVSQLTKIQLDHGLITALLER  517
            GV +  ++QL+  LITAL+ER
Sbjct  68   GVYRCGRLQLNQHLITALVER  88


 Score = 33.5 bits (75),  Expect(3) = 8e-07, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH   GE  ITLQDV++  A
Sbjct  90   RSETHTFHFRVGEATITLQDVQIIWA  115


 Score = 25.8 bits (55),  Expect(3) = 8e-07, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++ L +DG  VTG D   T  Q +  C   +GF 
Sbjct  113  IWALPIDGEPVTGIDFDRTTQQWQEYCLTYIGFS  146



>ref|XP_009798030.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=589

 Score = 44.3 bits (103),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 43/89 (48%), Gaps = 4/89 (4%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTV--MRCAAIDDERVKE  430
            M    V PGP     L  Q   R+  +W     +  L+A + D V       +   RV +
Sbjct  1    MDVPHVHPGPFSDKILVLQGDHRSAYVWEGELVEQTLRARRVDDVWDFMGERVFHPRVVQ  60

Query  431  WLRISGFYGVSQLTKIQLDHGLITALLER  517
             LR +GFY + ++  +QLD  LITAL+ER
Sbjct  61   RLRDTGFYRIFEIGLLQLDWSLITALIER  89


 Score = 36.6 bits (83),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVE  585
            RPE H FH+P GE  ITL+DV+
Sbjct  91   RPETHTFHLPIGEATITLRDVQ  112



>emb|CDP15529.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 38.9 bits (89),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  +TLQDVE+
Sbjct  102  RPETHTFHLPVGEATVTLQDVEM  124


 Score = 32.7 bits (73),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query  374  VKYDTVMRCAAIDDERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            +   T  R  +I D RV  ++ ++GF GV +     +DH LIT+L+ER
Sbjct  54   ISAGTAHRHTSIPD-RVCRYIALTGFEGVLESGYQMVDHSLITSLVER  100


 Score = 28.1 bits (61),  Expect(3) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL +DG  V G DT  +  +   +C E +GF 
Sbjct  125  LWGLHIDGPPVIGIDTYRSIQEWGAICEEFIGFS  158



>ref|XP_010660156.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=171

 Score = 40.8 bits (94),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ ITLQDV V L  R
Sbjct  38   RPETHTFHLPVGEMTITLQDVAVILGLR  65


 Score = 39.7 bits (91),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D R++ ++  SGFYGV ++  I LD GLIT+L+ER
Sbjct  2    DPRLRPYIIQSGFYGVYRIGHITLDWGLITSLVER  36



>emb|CAN72880.1| hypothetical protein VITISV_009742 [Vitis vinifera]
Length=1422

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 38/78 (49%), Gaps = 20/78 (26%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRAIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYGVS  463
            P PLD+S L  Q   R                    MR   +D  R++ ++  SGFYGV 
Sbjct  717  PDPLDTSVLVLQDRHR-------------------FMREWEMD-SRLRPYIIRSGFYGVY  756

Query  464  QLTKIQLDHGLITALLER  517
            ++  I LD GLIT+L+ER
Sbjct  757  RIGHITLDWGLITSLVER  774


 Score = 37.7 bits (86),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P  E+ ITLQDV V L  R
Sbjct  776  RPETHTFHLPVXEMTITLQDVAVILGLR  803



>ref|XP_011101224.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
Length=259

 Score = 39.7 bits (91),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (5%)
 Frame = +2

Query  287  GPLDSSSLAFQSCRRAI-WTDSNYDVQLKAVKYDTVMRCAAIDD---ERVKEWLRISGFY  454
            GP DS+ L+ Q+  R+    D + D  L + + D         +   ERV+E L   GFY
Sbjct  8    GPRDSTVLSQQAQHRSDDIPDGDLDAVLISRRADGNFWSYFNQNNMFERVQEILHQIGFY  67

Query  455  GVSQLTKIQLDHGLITALLER  517
            GV +  ++QL+  LITAL+ER
Sbjct  68   GVYRCGRLQLNQHLITALVER  88


 Score = 33.1 bits (74),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH   GE  ITLQDV++  A
Sbjct  90   RSETHTFHFRVGEATITLQDVQIIWA  115


 Score = 25.4 bits (54),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++ L +DG  VTG D   T  Q +  C   +GF 
Sbjct  113  IWALPIDGEPVTGIDFDRTTQQWQEYCLTYIGFS  146



>emb|CDP03974.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 41.2 bits (95),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D RV  ++ I+GF GV +   +Q++HGLITAL+ER
Sbjct  371  DPRVSHYIDIAGFGGVRRAGYLQVNHGLITALVER  405


 Score = 32.3 bits (72),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 1/24 (4%)
 Frame = +1

Query  520  RPEVHAFHMP-FGEVGITLQDVEV  588
            R E H FH+P  GE  +TLQDVEV
Sbjct  407  RQETHTFHLPVMGEATVTLQDVEV  430


 Score = 24.3 bits (51),  Expect(3) = 2e-06, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 19/33 (58%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL VDGL VT      +  Q K +  E+LGF
Sbjct  431  LWGLPVDGLPVTLIHVKRSPLQRKHLVQEVLGF  463



>ref|XP_009774892.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=187

 Score = 40.8 bits (94),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  ITLQDVEV
Sbjct  90   RPETHTFHLPIGEATITLQDVEV  112


 Score = 38.1 bits (87),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 6/84 (7%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTV---MRCAAIDDERVKEWLRI  442
            + P P     L  Q   R+  IW        L+A + D +   +R   + D  V   L+ 
Sbjct  5    IHPSPYSRELLVLQGDHRSTHIWEGELLSQTLRARRVDDLWDFLRHRVLHDHVVHR-LQA  63

Query  443  SGFYGVSQLTKIQLDHGLITALLE  514
            +GFY + ++ +IQ+D  LITAL+E
Sbjct  64   TGFYRIIEIGRIQVDWALITALIE  87



>ref|XP_009617744.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
 ref|XP_009617753.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=179

 Score = 39.7 bits (91),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 45/91 (49%), Gaps = 6/91 (7%)
 Frame = +2

Query  260  VMANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTV---MRCAAIDDERV  424
            VM    V PGP     L  Q+  R+  IW         +A + D +   +R   +   R+
Sbjct  17   VMEVPHVDPGPASLELLLLQAEHRSSYIWEGQLLAQTFRARRVDDMWDFLRAHHLQS-RI  75

Query  425  KEWLRISGFYGVSQLTKIQLDHGLITALLER  517
               L+ +GFY + ++ ++QLD  LITAL+ER
Sbjct  76   VRRLQDTGFYRIIEIGRLQLDLSLITALIER  106


 Score = 38.9 bits (89),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  I LQDVEV
Sbjct  108  RPETHTFHLPIGEATIMLQDVEV  130



>emb|CDP19152.1| unnamed protein product [Coffea canephora]
Length=1182

 Score = 38.1 bits (87),  Expect(3) = 4e-06, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D RV   L  +GFYGV  + ++ LDH LITAL+ER
Sbjct  102  DARVLLHLAQAGFYGVYCIGQLPLDHSLITALVER  136


 Score = 35.4 bits (80),  Expect(3) = 4e-06, Method: Composition-based stats.
 Identities = 15/26 (58%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH P GE  ITLQDV + L 
Sbjct  138  REETHTFHFPVGECTITLQDVAILLG  163


 Score = 23.9 bits (50),  Expect(3) = 4e-06, Method: Composition-based stats.
 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLG  683
            + GL +DG  +T  ++     + + +C ELLG
Sbjct  161  LLGLPIDGDPITSPESSKKMQEWQALCQELLG  192



>ref|XP_009763423.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=308

 Score = 40.8 bits (94),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  ITLQDVEV
Sbjct  91   RPETHTFHLPIGEATITLQDVEV  113


 Score = 37.7 bits (86),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 8/91 (9%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTV---MRCAAID-DERV  424
            M    V P PL    L  Q   R+  +W     +  L A + D +   MR   ID   R+
Sbjct  1    MDVPHVHPEPLSDELLVLQGDHRSADVWEGELLEQTLCARRVDDLWDFMR--GIDFHPRI  58

Query  425  KEWLRISGFYGVSQLTKIQLDHGLITALLER  517
             + LR + FY + ++ ++QLD  LITAL+ER
Sbjct  59   VQRLRDTDFYRIFEIGRLQLDWSLITALIER  89



>ref|XP_011093250.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Sesamum indicum]
Length=259

 Score = 39.3 bits (90),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            ERV+E L   GFYGV +  ++QL+  LITAL+ER
Sbjct  55   ERVQEILHQIGFYGVYRCGRLQLNQHLITALVER  88


 Score = 33.5 bits (75),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH+  GE  IT+QDV++  A
Sbjct  90   RSETHTFHLRVGEATITIQDVQINWA  115


 Score = 24.3 bits (51),  Expect(3) = 6e-06, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 0/33 (0%)
 Frame = +3

Query  591  FGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            + L +DG  VTG D   T  Q +  C   +GF 
Sbjct  114  WALPIDGEPVTGIDFDRTTQQWQEYCLTYIGFS  146



>ref|XP_008460604.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460605.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460606.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460607.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
 ref|XP_008460608.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=872

 Score = 47.0 bits (110),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYG  457
            PGP D+S L  Q+  R  AIW   +  V     +   +M+   +D  RV++ +  +GFYG
Sbjct  143  PGPADNSILVLQNQHRSEAIWMGEDPSVLTCRQRLAAMMKDWQLD-PRVRQLIIKAGFYG  201

Query  458  VSQLTKIQLDHGLITALLER  517
            V ++  +Q+D  LITAL+ER
Sbjct  202  VYRVGILQIDWPLITALVER  221


 Score = 30.8 bits (68),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH   GE  +TLQDV + L 
Sbjct  223  RQETHTFHFTVGESTVTLQDVALLLG  248



>ref|XP_006361537.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum tuberosum]
Length=144

 Score = 42.7 bits (99),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H+FH+PFGEV ITLQD++V
Sbjct  91   RPETHSFHLPFGEVTITLQDMQV  113


 Score = 34.7 bits (78),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (48%), Gaps = 19/92 (21%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRAIWTDSNYDVQLKA-VKYDTVMRCAAIDDE-----------R  421
            V PGP++ + L  Q   ++       ++  K  + + + M+   ++D            R
Sbjct  5    VNPGPINRTLLLSQHEHKS-------ELSWKGEISFGSFMKTVHMNDTWNLFRLHRPYGR  57

Query  422  VKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            V+E LR SG Y V  + ++Q D  L+T ++ER
Sbjct  58   VEEILRKSGLYDVVCVGRMQYDRALVTTMVER  89



>ref|XP_009767271.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=372

 Score = 39.7 bits (91),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 46/92 (50%), Gaps = 10/92 (11%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAIDDER-----  421
            M    + PGP     L  Q+  R+  IW     D  L++ K D V+       ER     
Sbjct  1    MEVPPLHPGPASLELLQLQAEHRSSYIWEGELLDRTLRSRKIDDVLDFL---KERQLYPC  57

Query  422  VKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            +   L+ +GFY + +++++QLD  L+TAL+ER
Sbjct  58   IVRLLQDTGFYSIIEISRLQLDWSLLTALIER  89


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E+H FH P GE  ITLQDVEV
Sbjct  91   RQEMHTFHFPIGETTITLQDVEV  113



>emb|CAN64400.1| hypothetical protein VITISV_033061 [Vitis vinifera]
Length=835

 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D R++ ++  SGFYGV ++  I LD GLIT+L+E+
Sbjct  409  DPRLRPYIIQSGFYGVYRIXHITLDWGLITSLVEK  443


 Score = 36.6 bits (83),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E H FH+P GE+ ITLQDV V L  R
Sbjct  445  RLETHTFHLPVGEMTITLQDVVVILGLR  472



>ref|XP_010661218.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=234

 Score = 38.9 bits (89),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P GE+ ITLQDV V L 
Sbjct  38   RPETHTFHLPVGEMTITLQDVVVILG  63


 Score = 37.0 bits (84),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D R++ ++   GFYGV ++  I LD GLIT+L+ER
Sbjct  2    DSRLRPYIIRFGFYGVYRIGHITLDWGLITSLVER  36



>ref|XP_004981664.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Setaria italica]
Length=677

 Score = 47.0 bits (110),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = +2

Query  272  ERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRIS  445
            + + PGP+D S L  Q   +  AI+    Y   ++ +++ T +    +  E +   L+ S
Sbjct  19   QNLDPGPVDKSVLVEQEFHKSEAIFVGKIYK-PVRFIEHGTRLNQWEVKHEGMLALLQRS  77

Query  446  GFYGVSQLTKIQLDHGLITALLER  517
            GFY +S L ++QLDH L+ AL+ER
Sbjct  78   GFYHLSLLKRVQLDHALLNALVER  101


 Score = 28.5 bits (62),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E   FH+ FGE+ + L+DV +    R
Sbjct  103  RRETQTFHLRFGEITVLLKDVAILTGLR  130



>ref|XP_004250585.2| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum lycopersicum]
Length=522

 Score = 33.9 bits (76),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +1

Query  523  PEVHAFHMPFGEVGITLQDVEV  588
            PE H FH   GE  ITLQDVEV
Sbjct  59   PETHTFHFRTGEATITLQDVEV  80


 Score = 32.3 bits (72),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +2

Query  419  RVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            R+ E + +SG YGV +  +  +D  LIT+L+ER
Sbjct  24   RILEMIELSGLYGVYRSNRPSIDRSLITSLVER  56


 Score = 28.1 bits (61),  Expect(3) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL V+G  V G ++I T    + +C  LLGF
Sbjct  81   LYGLPVNGDPVLGDESIRTIGDWQNICQRLLGF  113



>ref|XP_009629375.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=191

 Score = 38.9 bits (89),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  ITL+DVEV
Sbjct  91   RPETHTFHLPIGEATITLKDVEV  113


 Score = 36.2 bits (82),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 38/83 (46%), Gaps = 4/83 (5%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRCAAID--DERVKEWLRIS  445
            V PGP     L  Q+  R+  +W    +    +A   D +           R+   L+ +
Sbjct  6    VHPGPASLELLLLQAEHRSSYVWDGQRFSQTFRARHIDDMWEFIGAHPLHPRIVRRLQDT  65

Query  446  GFYGVSQLTKIQLDHGLITALLE  514
            GFY + ++ ++Q D  LITA++E
Sbjct  66   GFYRIIEIGRLQFDWALITAMIE  88



>dbj|BAD99222.1| mutator transposase-like polypeptide [Petunia x hybrida]
Length=155

 Score = 39.7 bits (91),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 45/84 (54%), Gaps = 8/84 (10%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYD----TVMRCAAIDDERVKEWLRIS  445
            PGPLD S L  Q   R+  IW D   D+ L   K D     +++   I  +RV + +  +
Sbjct  16   PGPLDRSVLIAQHTHRSRDIW-DGKPDMILNTRKCDGNFWKLVKEYPIH-QRVLDVIICA  73

Query  446  GFYGVSQLTKIQLDHGLITALLER  517
            GFYGV +  +  +D  LIT+L+ER
Sbjct  74   GFYGVYRSCRPSIDRSLITSLVER  97


 Score = 35.0 bits (79),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  +TLQDVEV
Sbjct  99   RPETHTFHFRSGEATVTLQDVEV  121



>emb|CAN81676.1| hypothetical protein VITISV_040772 [Vitis vinifera]
Length=644

 Score = 41.2 bits (95),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +2

Query  287  GPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISGFYGV  460
            GP+D S L  Q   R  AI +D +  V     ++   +R   + D  V+ ++  +GFYG+
Sbjct  11   GPVDGSVLYLQHEHRSEAIQSDQDRKVLTCRQRWSRFIRDWPLHD-LVRPYVVQAGFYGL  69

Query  461  SQLTKIQLDHGLITALLER  517
             ++  IQLD  LITAL+ER
Sbjct  70   YRVGFIQLDWALITALVER  88


 Score = 33.1 bits (74),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E H FH+  GE  +TLQDV V L  R
Sbjct  90   RQETHTFHLAVGESTVTLQDVAVLLGLR  117



>emb|CAN76929.1| hypothetical protein VITISV_024833 [Vitis vinifera]
Length=952

 Score = 38.9 bits (89),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            RPE H FH+P GE+ +TLQDV + L  R
Sbjct  671  RPETHTFHLPIGEMXVTLQDVAMILGLR  698


 Score = 35.0 bits (79),  Expect(2) = 7e-05, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D  ++ ++  SGFYGV ++  I LD  LIT+L ER
Sbjct  635  DPXIRRYVMQSGFYGVYRVGHISLDXPLITSLXER  669



>ref|XP_007146142.1| hypothetical protein PHAVU_006G0158000g, partial [Phaseolus vulgaris]
 gb|ESW18136.1| hypothetical protein PHAVU_006G0158000g, partial [Phaseolus vulgaris]
Length=139

 Score = 36.2 bits (82),  Expect(3) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FH P GE  ITL+DVE+ L 
Sbjct  76   RTETHTFHFPLGETTITLEDVELILG  101


 Score = 33.5 bits (75),  Expect(3) = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = +2

Query  389  VMRCAAIDDERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            V++   I D+RVK  +  SGF  + +   I  +H LITAL+ER
Sbjct  32   VLKHEDILDQRVKRLIDHSGFGHLLKFKHIDFNHVLITALVER  74


 Score = 23.9 bits (50),  Expect(3) = 8e-05, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 4/33 (12%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            + GL +DG +VTG     T   +  +C +LLGF
Sbjct  99   ILGLPIDGQVVTGI----TSGDLVSLCDQLLGF  127



>ref|XP_009601564.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=179

 Score = 37.7 bits (86),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E H FH+P GE  ITLQDVEV
Sbjct  47   RHETHTFHLPIGEAAITLQDVEV  69


 Score = 35.8 bits (81),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  419  RVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            RV + LR +GFY + ++ ++QLD  LITAL+ER
Sbjct  13   RVVQLLRDTGFYMILEIGQLQLDWSLITALIER  45



>ref|XP_009791249.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana sylvestris]
Length=141

 Score = 37.4 bits (85),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P  E  ITLQDV+V
Sbjct  64   RPETHTFHLPISEATITLQDVQV  86


 Score = 36.6 bits (83),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +2

Query  419  RVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            RV + LR  GFY + Q+ ++QLD  LITAL+ER
Sbjct  30   RVVQLLRDRGFYRIFQIGRLQLDWSLITALIER  62



>emb|CAN78664.1| hypothetical protein VITISV_019818 [Vitis vinifera]
Length=1433

 Score = 37.0 bits (84),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  362  QLKAVKYDTVMRCAAIDDERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            +L   + + +    ++ D R+   L+ +GFYGV++L  I LD  LITA +ER
Sbjct  792  ELHCRRREAIFHRTSVLDGRIIPLLQQAGFYGVARLGFISLDWHLITAFVER  843


 Score = 36.2 bits (82),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P GE  ITLQD+ + + 
Sbjct  845  RPETHTFHLPQGECTITLQDIAMLIG  870



>emb|CAN72427.1| hypothetical protein VITISV_008825 [Vitis vinifera]
Length=1436

 Score = 37.0 bits (84),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  362  QLKAVKYDTVMRCAAIDDERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            +L   + + +    ++ D R+   L+ +GFYGV++L  I LD  LITA +ER
Sbjct  712  ELHCRRREAIFHRTSVLDGRIIPLLQQAGFYGVARLGFISLDWHLITAFVER  763


 Score = 36.2 bits (82),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H FH+P GE  ITLQD+ + + 
Sbjct  765  RPETHTFHLPQGECTITLQDIAMLIG  790



>gb|EAY75755.1| hypothetical protein OsI_03667 [Oryza sativa Indica Group]
Length=801

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  177  RPETHSFHLASGEMAVTLQDVAMLLA  202


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  140  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  175



>ref|XP_006644339.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Oryza brachyantha]
Length=760

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  141  RPETHSFHLASGEMAVTLQDVAMLLA  166


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  104  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  139



>ref|XP_003568248.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Brachypodium distachyon]
 ref|XP_010231266.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Brachypodium distachyon]
 ref|XP_010231267.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Brachypodium distachyon]
Length=754

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +GF G+SQ+ +   QLD  LITAL+ER
Sbjct  104  ERYRPYLRDAGFLGLSQICQKMPQLDKALITALVER  139


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV +  A
Sbjct  141  RPETHSFHLASGEMTVTLQDVAMLFA  166



>ref|NP_001172392.1| Os01g0531200 [Oryza sativa Japonica Group]
 dbj|BAG95763.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91122.1| Os01g0531200 [Oryza sativa Japonica Group]
Length=684

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  139  RPETHSFHLASGEMAVTLQDVAMLLA  164


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  102  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  137



>gb|EEC70809.1| hypothetical protein OsI_02270 [Oryza sativa Indica Group]
Length=733

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  182  RPETHSFHLASGEMAVTLQDVAMLLA  207


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  145  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  180



>ref|NP_001047295.1| Os02g0592600 [Oryza sativa Japonica Group]
 dbj|BAD34087.1| calcineurin-like phosphoesterase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF09209.1| Os02g0592600 [Oryza sativa Japonica Group]
 gb|EAZ23640.1| hypothetical protein OsJ_07341 [Oryza sativa Japonica Group]
Length=766

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  142  RPETHSFHLASGEMTVTLQDVSMLLA  167


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  105  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  140



>gb|EEE54729.1| hypothetical protein OsJ_02076 [Oryza sativa Japonica Group]
Length=696

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  151  RPETHSFHLASGEMAVTLQDVAMLLA  176


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  114  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  149



>gb|EAZ13472.1| hypothetical protein OsJ_03388 [Oryza sativa Japonica Group]
Length=761

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  159  RPETHSFHLASGEMAVTLQDVAMLLA  184


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  122  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  157



>emb|CBI37541.3| unnamed protein product [Vitis vinifera]
Length=773

 Score = 39.3 bits (90),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            D RV+ ++  +GFYGV ++  IQLD  LITAL+ER
Sbjct  82   DHRVRPYIIQAGFYGVYRVGFIQLDWTLITALVER  116


 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 16/28 (57%), Gaps = 0/28 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA*R  603
            R E H FH+  GE  ITLQD  V L  R
Sbjct  118  RQETHTFHLAVGESTITLQDTAVLLGLR  145



>ref|XP_002463838.1| hypothetical protein SORBIDRAFT_01g007195 [Sorghum bicolor]
 gb|EER90836.1| hypothetical protein SORBIDRAFT_01g007195 [Sorghum bicolor]
Length=313

 Score = 44.3 bits (103),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRISG  448
            ++ PGP+D S L  Q   +  AI+    Y   ++ +++ T +       E +   L+ SG
Sbjct  12   KLDPGPVDKSVLVEQEFHKSEAIFVGKIYK-PVRFIEHGTGLNQWEDRHEGMLVLLKRSG  70

Query  449  FYGVSQLTKIQLDHGLITALLER  517
            FY +S L ++QLDH L+ AL+ER
Sbjct  71   FYHLSFLKRVQLDHALLNALVER  93


 Score = 28.1 bits (61),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E   FH+ FGE+ + L+DV +
Sbjct  95   RRETQTFHLRFGEITVLLKDVAI  117



>gb|EAY86498.1| hypothetical protein OsI_07878 [Oryza sativa Indica Group]
Length=652

 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV + LA
Sbjct  142  RPETHSFHLASGEMTVTLQDVSMLLA  167


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  105  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  140



>emb|CDP04906.1| unnamed protein product [Coffea canephora]
Length=341

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  508  FRAMRPEVHAFHMPFGEVGITLQDVEV  588
            F   RPE H FH+P GE  +TLQDVEV
Sbjct  53   FERWRPETHTFHLPVGEATVTLQDVEV  79


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGF  686
            ++GL +DG  V G DT  +  +   +C ELLGF
Sbjct  80   LWGLHIDGPPVIGVDTYRSIQEWGAICEELLGF  112



>ref|XP_009619369.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=180

 Score = 40.4 bits (93),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+P GE  ITLQDVEV
Sbjct  47   RPETHTFHLPIGEATITLQDVEV  69


 Score = 32.0 bits (71),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  419  RVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            RV + LR  GFY + ++ ++QL   LITAL+ER
Sbjct  13   RVVQCLRDMGFYKILEIGRLQLGWSLITALIER  45



>ref|XP_009596943.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Nicotiana tomentosiformis]
Length=297

 Score = 37.0 bits (84),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH+  GE  ITLQDVEV
Sbjct  91   RPEKHTFHLSIGEATITLQDVEV  113


 Score = 34.3 bits (77),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (46%), Gaps = 6/90 (7%)
 Frame = +2

Query  263  MANERVRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTV---MRCAAIDDERVK  427
            M      PGP     L  Q   R+  IW          A + D +   +R   +    V+
Sbjct  1    MEVPPFHPGPTTLELLLLQGEHRSSYIWEGQLLAQMFPARRVDDMWDFLRAHPLHPCIVR  60

Query  428  EWLRISGFYGVSQLTKIQLDHGLITALLER  517
              L+ +GFY + ++ ++QLD  LITAL+ER
Sbjct  61   R-LQDTGFYRIVEIGRLQLDWSLITALIER  89



>ref|XP_010314992.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Solanum lycopersicum]
Length=334

 Score = 35.8 bits (81),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  ITLQDVEV
Sbjct  58   RPETHTFHFRTGEATITLQDVEV  80


 Score = 35.4 bits (80),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  419  RVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            RV E +R+SG YGV +  +  +D  LITAL+ER
Sbjct  24   RVLEVIRLSGLYGVYKSNRPAIDRSLITALVER  56



>ref|XP_008657989.1| PREDICTED: uncharacterized protein LOC100191389 isoform X1 [Zea 
mays]
 ref|XP_008657990.1| PREDICTED: uncharacterized protein LOC100191389 isoform X1 [Zea 
mays]
 ref|XP_008657991.1| PREDICTED: uncharacterized protein LOC100191389 isoform X1 [Zea 
mays]
 gb|AFW85365.1| hypothetical protein ZEAMMB73_781058 [Zea mays]
Length=797

 Score = 36.2 bits (82),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            RPE H+FH+  GE+ +TLQDV +  A
Sbjct  138  RPETHSFHLASGEITVTLQDVAMLFA  163


 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = +2

Query  416  ERVKEWLRISGFYGVSQLTK--IQLDHGLITALLER  517
            ER + +LR +G  G+SQ+ +   QLD  LITAL+ER
Sbjct  101  ERYRPYLRDAGLLGLSQICQKMPQLDKALITALVER  136



>emb|CDP12451.1| unnamed protein product [Coffea canephora]
Length=489

 Score = 38.9 bits (89),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  413  DERVKEWLRISGFYGVSQLTKIQLDHGLITALLER  517
            DERV +++  +GFYG+ +   + +DH LI AL+ER
Sbjct  77   DERVAQYIDAAGFYGIRRAGYLTVDHDLINALVER  111


 Score = 32.3 bits (72),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 1/24 (4%)
 Frame = +1

Query  520  RPEVHAFHMP-FGEVGITLQDVEV  588
            R E H FH+P  GE  +TLQDVEV
Sbjct  113  RQETHNFHLPVMGEATVTLQDVEV  136



>ref|XP_008461739.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Cucumis melo]
Length=277

 Score = 36.2 bits (82),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  434  LRISGFYGVSQLTKIQLDHGLITALLER  517
            LR S FYG+++L  IQLD  LITALLER
Sbjct  27   LRASRFYGLARLGFIQLDWHLITALLER  54


 Score = 35.0 bits (79),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEVYLA  597
            R E H FHM  GE  ITLQDVEV + 
Sbjct  56   RLETHTFHMSVGECTITLQDVEVLVG  81



>emb|CDP17527.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 39.7 bits (91),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  YCPFRAMRPEVHAFHMPFGEVGITLQDVEV  588
            + P    RPE H FH+P GE  +TLQDVEV
Sbjct  53   HTPIPDPRPETHTFHLPVGEATVTLQDVEV  82


 Score = 31.2 bits (69),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFK  689
            ++GL +DG  V G DT  +  +   +C ELLGF 
Sbjct  83   LWGLHIDGPPVIGVDTYRSIQEWGAICEELLGFS  116



>ref|XP_009758343.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog, 
partial [Nicotiana sylvestris]
Length=281

 Score = 36.6 bits (83),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 4/84 (5%)
 Frame = +2

Query  278  VRPGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVKYDTVMRC--AAIDDERVKEWLRIS  445
            V PGP     L  Q   R+  IW     D  L A + D +       +   R+   LR +
Sbjct  6    VHPGPAADQVLVLQGEHRSSYIWEGHLLDRTLHARRSDDLWEFLKGRVFHARIVYRLRAT  65

Query  446  GFYGVSQLTKIQLDHGLITALLER  517
            GF  + ++ ++QL+  LITAL+E+
Sbjct  66   GFLRIFEIGRMQLNWSLITALIEQ  89


 Score = 34.3 bits (77),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDV  582
            RPE H FH+P  E  ITLQDV
Sbjct  91   RPETHTFHLPTREATITLQDV  111



>ref|XP_006356572.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=398

 Score = 36.2 bits (82),  Expect(3) = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            RPE H FH   GE  +TLQDVEV
Sbjct  297  RPETHTFHFKTGEATVTLQDVEV  319


 Score = 30.0 bits (66),  Expect(3) = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +3

Query  588  VFGLKVDGLLVTGQDTIGTKAQVKLMCTELLGFKI*HDE  704
            ++GL V+G  V G +TI T    + +C  LLGF   H++
Sbjct  320  LYGLPVNGDPVLGNETIKTIGDWQNICQRLLGFIPSHED  358


 Score = 23.5 bits (49),  Expect(3) = 7e-04, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +2

Query  482  LDHGLITALLER  517
            +DH LITAL+ER
Sbjct  284  IDHSLITALVER  295



>ref|XP_010314469.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X1 [Solanum lycopersicum]
Length=310

 Score = 36.6 bits (83),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = +2

Query  275  RVRPGPLDSSSLAFQSCRRA--IWTDS-NYDVQLKAVK---YDTVMRCAAIDDERVKEWL  436
            R+ PGPL+   L  Q   R+  IW  S N  +  +      +D V +   +   RV E +
Sbjct  8    RLDPGPLEPLVLTQQLTHRSRDIWNGSVNMILNTRRCDGKFWDLVKK--YLIHPRVLEMI  65

Query  437  RISGFYGVSQLTKIQLDHGLITALLER  517
             +SG YGV +  +  +D  LIT+L+ER
Sbjct  66   ELSGLYGVYRSNRSSIDRSLITSLVER  92


 Score = 33.9 bits (76),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +1

Query  523  PEVHAFHMPFGEVGITLQDVEV  588
            PE H FH   GE  ITLQDVEV
Sbjct  95   PETHTFHFRTGEATITLQDVEV  116



>gb|EMS47434.1| hypothetical protein TRIUR3_14673 [Triticum urartu]
Length=1139

 Score = 42.0 bits (97),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 45/84 (54%), Gaps = 3/84 (4%)
 Frame = +2

Query  272  ERVRPGPLDSSSLAFQSCRR--AIWTDSNYDVQLKAVKYDTVMRCAAIDDERVKEWLRIS  445
            + + PGP+D S L  Q   +  AI     Y   ++ +++ T +    +  E +   L+ +
Sbjct  3    QNLDPGPVDKSVLVEQELHKSEAISVGKVYK-PIRFIEHGTRLNQWEVKHEGMLAILQRA  61

Query  446  GFYGVSQLTKIQLDHGLITALLER  517
            GFY +  L ++QLDH L+ AL+ER
Sbjct  62   GFYHLCFLKRVQLDHALLNALVER  85


 Score = 28.5 bits (62),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  520  RPEVHAFHMPFGEVGITLQDVEV  588
            R E   FH+ FGE+ + L+DV +
Sbjct  87   RRETQTFHLRFGEMAVLLKDVAI  109



>ref|XP_006354318.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Solanum tuberosum]
Length=699

 Score = 36.6 bits (83),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 10/85 (12%)
 Frame = +2

Query  284  PGPLDSSSLAFQSCRRA--IWTDSNYDVQLKAVK-----YDTVMRCAAIDDERVKEWLRI  442
            PGPL+SS L  Q   R+  IW D + ++ L   +     +D V +       RV E +++
Sbjct  11   PGPLESSVLTEQITHRSRDIW-DGSVNMILNTRRCDGKFWDLVKKYPI--PPRVLEVIQL  67

Query  443  SGFYGVSQLTKIQLDHGLITALLER  517
             G YG+ +  +  +D  LIT+L+ER
Sbjct  68   FGLYGIYRSHQPMIDRSLITSLVER  92


 Score = 33.9 bits (76),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +1

Query  523  PEVHAFHMPFGEVGITLQDVEV  588
            PE H FH   GE  ITLQDVEV
Sbjct  95   PETHTFHFRTGEATITLQDVEV  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224