BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25763_g3_i13 len=1062 path=[14495:0-154 22476:155-165
14660:166-1061]

Length=1062
                                                                      Score     E

ref|XP_010687125.1|  PREDICTED: uncharacterized protein LOC104901271    180   5e-48   
ref|XP_009591183.1|  PREDICTED: uncharacterized protein LOC104088243    181   2e-47   
gb|AFK13834.1|  putative PIF1 DNA helicase/replication protein A1...    182   1e-46   
ref|XP_010668250.1|  PREDICTED: uncharacterized protein LOC104885245    178   3e-45   
ref|XP_009804789.1|  PREDICTED: uncharacterized protein LOC104249954    169   6e-43   
ref|XP_006432161.1|  hypothetical protein CICLE_v10003309mg             162   1e-40   
ref|XP_010668429.1|  PREDICTED: uncharacterized protein LOC104885435    159   4e-40   
ref|XP_006436413.1|  hypothetical protein CICLE_v10033859mg             160   2e-39   
ref|XP_010692805.1|  PREDICTED: uncharacterized protein LOC104905864    160   2e-39   
ref|XP_004500576.1|  PREDICTED: uncharacterized protein LOC101500546    154   2e-38   
emb|CDY56895.1|  BnaCnng31320D                                          156   2e-38   
ref|XP_010696326.1|  PREDICTED: uncharacterized protein LOC104908859    157   3e-38   
ref|XP_010667882.1|  PREDICTED: uncharacterized protein LOC104884879    154   1e-37   
ref|XP_003637947.1|  hypothetical protein MTR_114s0013                  151   2e-37   
emb|CDY44605.1|  BnaA04g09850D                                          150   2e-37   
gb|ABA94634.1|  AT hook motif-containing protein, putative              154   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003591245.1|  ATP-dependent DNA helicase PIF1                    154   4e-37   
gb|ABA95236.1|  AT hook motif-containing protein, putative, expre...    154   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003599923.1|  Helicase-like protein                              153   5e-37   
gb|EEC82986.1|  hypothetical protein OsI_28021                          152   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_007220327.1|  hypothetical protein PRUPE_ppa018009m2g            149   1e-36   
gb|ABA94947.1|  AT hook motif-containing protein, putative              152   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|AAV44035.1|  putative helicase                                       152   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008245897.1|  PREDICTED: uncharacterized protein LOC103344046    145   2e-36   
ref|XP_008245910.1|  PREDICTED: uncharacterized protein LOC103344060    145   3e-36   
emb|CDY00974.1|  BnaC05g42260D                                          150   4e-36   
ref|XP_007043201.1|  Uncharacterized protein TCM_007660                 147   5e-36   
ref|XP_010671914.1|  PREDICTED: uncharacterized protein LOC104888589    150   6e-36   
emb|CDY68951.1|  BnaAnng28900D                                          149   1e-35   
emb|CDY26953.1|  BnaC09g36300D                                          147   1e-35   
ref|XP_009344860.1|  PREDICTED: uncharacterized protein LOC103936...    145   2e-35   
ref|XP_009344859.1|  PREDICTED: uncharacterized protein LOC103936...    145   3e-35   
emb|CDY22508.1|  BnaC03g23180D                                          146   3e-35   
ref|XP_007031497.1|  PIF1 helicase, putative                            148   4e-35   
ref|XP_007033578.1|  Uncharacterized protein TCM_019749                 146   6e-35   
ref|XP_003626025.1|  ATP-dependent DNA helicase PIF1                    147   8e-35   
emb|CDY67437.1|  BnaCnng54980D                                          145   1e-34   
emb|CDY70555.1|  BnaCnng68840D                                          142   2e-34   
ref|XP_008358546.1|  PREDICTED: uncharacterized protein LOC103422...    142   2e-34   
gb|ABD65117.1|  hypothetical protein 31.t00030                          145   2e-34   Brassica oleracea
ref|XP_003636005.1|  Helicase-like protein                              145   2e-34   
ref|XP_008358542.1|  PREDICTED: uncharacterized protein LOC103422...    142   2e-34   
ref|XP_008229188.1|  PREDICTED: uncharacterized protein LOC103328570    141   3e-34   
ref|XP_003598094.1|  Helicase-like protein                              145   3e-34   
ref|XP_009767708.1|  PREDICTED: uncharacterized protein LOC104218829    143   4e-34   
emb|CDY26545.1|  BnaA09g47320D                                          143   4e-34   
emb|CDY67163.1|  BnaUnng01960D                                          142   5e-34   
emb|CDX95312.1|  BnaC04g28460D                                          141   7e-34   
emb|CDX71251.1|  BnaC07g05300D                                          143   9e-34   
ref|XP_003590244.1|  hypothetical protein MTR_1g050500                  142   2e-33   
ref|XP_003590268.1|  ATP-dependent helicase, putative                   142   4e-33   
ref|XP_010474066.1|  PREDICTED: uncharacterized protein LOC104753520    140   5e-33   
ref|XP_008357575.1|  PREDICTED: uncharacterized protein LOC103421325    138   6e-33   
ref|XP_009138614.1|  PREDICTED: uncharacterized protein LOC103862690    141   7e-33   
gb|ABA96519.2|  hypothetical protein LOC_Os12g06230                     141   1e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDY13952.1|  BnaC09g38740D                                          134   1e-32   
emb|CAD40309.2|  OSJNBb0013O03.4                                        140   1e-32   Oryza sativa [red rice]
ref|XP_009145287.1|  PREDICTED: uncharacterized protein LOC103868995    140   1e-32   
emb|CDY65832.1|  BnaC02g48150D                                          137   1e-32   
ref|XP_008342274.1|  PREDICTED: uncharacterized protein LOC103405083    139   2e-32   
ref|NP_001173850.1|  Os04g0300175                                       140   2e-32   
dbj|BAC84865.1|  helicase-like protein                                  139   2e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAB91581.1|  putative protein                                       139   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001060485.2|  Os07g0651500                                       139   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003604594.1|  Helicase-like protein                              139   3e-32   
emb|CAH66128.1|  OSIGBa0135L04.2                                        139   4e-32   Oryza sativa [red rice]
ref|XP_003603826.1|  Helicase-like protein                              139   4e-32   
emb|CDY33869.1|  BnaC06g04840D                                          137   6e-32   
emb|CDY47242.1|  BnaA02g29280D                                          137   8e-32   
ref|XP_009119774.1|  PREDICTED: uncharacterized protein LOC103844714    138   9e-32   
emb|CDX75122.1|  BnaC09g25600D                                          136   1e-31   
dbj|BAB11364.1|  helicase                                               137   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445013.1|  PREDICTED: uncharacterized protein LOC104727621    134   1e-31   
gb|ABA98394.1|  AT hook motif-containing protein, putative              136   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010468463.1|  PREDICTED: uncharacterized protein LOC104748536    137   2e-31   
gb|KHN42445.1|  hypothetical protein glysoja_033913                     133   2e-31   
ref|XP_008345150.1|  PREDICTED: uncharacterized protein LOC103408064    136   2e-31   
emb|CDY72294.1|  BnaCnng76970D                                          132   2e-31   
gb|AAK54292.1|AC034258_10  putative helicase                            136   3e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47755.2|  expressed protein                                       136   3e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDY51166.1|  BnaCnng20320D                                          133   3e-31   
gb|AAX95983.1|  hypothetical protein LOC_Os11g13920                     136   4e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175163.1|  Os07g0418100                                       136   4e-31   
ref|XP_003614435.1|  Helicase-like protein                              135   4e-31   
ref|XP_008356277.1|  PREDICTED: uncharacterized protein LOC103419978    135   5e-31   
ref|XP_010496603.1|  PREDICTED: uncharacterized protein LOC104773656    135   5e-31   
ref|XP_010490304.1|  PREDICTED: uncharacterized protein LOC104768062    135   5e-31   
ref|XP_009350533.1|  PREDICTED: uncharacterized protein LOC103942063    132   6e-31   
dbj|BAD01692.1|  helicase-like protein                                  135   6e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAL75754.1|AC037197_13  Putative helicase                            128   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004510124.1|  PREDICTED: uncharacterized protein LOC101506803    135   7e-31   
gb|AAP54490.2|  hypothetical protein LOC_Os10g35890                     134   8e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDY68360.1|  BnaUnng02830D                                          130   1e-30   
gb|ABA94881.2|  AT hook motif-containing protein, putative              135   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003628572.1|  ATP-dependent DNA helicase PIF1                    134   1e-30   
ref|XP_008656185.1|  PREDICTED: uncharacterized protein LOC103635531    130   1e-30   
ref|XP_010480905.1|  PREDICTED: uncharacterized protein LOC104759705    134   2e-30   
ref|XP_003595507.1|  ATP-dependent DNA helicase PIF1                    134   2e-30   
ref|NP_001042570.1|  Os01g0244200                                       134   2e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD81603.1|  helicase-like protein                                  134   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513445.1|  PREDICTED: uncharacterized protein LOC104789447    130   2e-30   
ref|XP_009374014.1|  PREDICTED: uncharacterized protein LOC103962959    133   3e-30   
ref|XP_003609124.1|  ATP-dependent DNA helicase PIF1                    133   5e-30   
ref|XP_003606913.1|  ATP-dependent DNA helicase PIF1                    133   5e-30   
ref|XP_009127428.1|  PREDICTED: uncharacterized protein LOC103852269    132   8e-30   
ref|XP_003612653.1|  ATP-dependent DNA helicase PIF1                    132   8e-30   
ref|NP_001172474.1|  Os01g0630700                                       130   3e-29   
ref|XP_004295241.1|  PREDICTED: uncharacterized protein LOC101312236    130   3e-29   
gb|ABA99344.1|  AT hook motif-containing protein, putative              130   3e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAK54302.1|AC034258_20  putative helicase                            130   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003605521.1|  Helicase-like protein                              129   5e-29   
ref|XP_003605542.1|  Helicase-like protein                              130   5e-29   
ref|XP_003605523.1|  Helicase-like protein                              129   5e-29   
ref|XP_009148379.1|  PREDICTED: uncharacterized protein LOC103871829    129   6e-29   
ref|XP_004309332.1|  PREDICTED: uncharacterized protein LOC101313170    129   7e-29   
emb|CDY44529.1|  BnaCnng11400D                                          126   9e-29   
emb|CDX89707.1|  BnaC03g46210D                                          128   1e-28   
emb|CDX85665.1|  BnaA02g01480D                                          127   1e-28   
ref|XP_008660624.1|  PREDICTED: uncharacterized protein LOC103639661    123   1e-28   
emb|CDY06491.1|  BnaC06g11530D                                          124   2e-28   
ref|XP_009108853.1|  PREDICTED: uncharacterized protein LOC103834536    123   2e-28   
ref|XP_006388350.1|  hypothetical protein POPTR_0214s00230g             127   2e-28   
ref|XP_010469634.1|  PREDICTED: uncharacterized protein LOC104749655    127   2e-28   
emb|CDY13504.1|  BnaA03g52220D                                          125   4e-28   
ref|XP_003616288.1|  ATP-dependent DNA helicase PIF1                    127   4e-28   
ref|XP_004301602.1|  PREDICTED: uncharacterized protein LOC101297157    125   4e-28   
emb|CDY32193.1|  BnaA03g54740D                                          123   4e-28   
emb|CDY09407.1|  BnaA02g26030D                                          125   5e-28   
gb|EEC77078.1|  hypothetical protein OsI_15477                          123   5e-28   Oryza sativa Indica Group [Indian rice]
emb|CAE02213.2|  OSJNBb0002N06.2                                        122   6e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008358607.1|  PREDICTED: uncharacterized protein LOC103422335    124   7e-28   
ref|XP_006465121.1|  PREDICTED: uncharacterized protein LOC102624919    124   1e-27   
ref|XP_008656968.1|  PREDICTED: uncharacterized protein LOC103636387    122   1e-27   
ref|XP_010507052.1|  PREDICTED: uncharacterized protein LOC104783614    125   1e-27   
ref|XP_003605676.1|  ATP-dependent DNA helicase PIF1                    125   1e-27   
ref|XP_010451755.1|  PREDICTED: uncharacterized protein LOC104733928    123   2e-27   
gb|AAG51081.1|AC027032_1  hypothetical protein                          125   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89838.1|  BnaA10g02440D                                          122   2e-27   
gb|AAX95750.1|  Eukaryotic protein of unknown function (DUF889), ...    125   2e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CDY67960.1|  BnaAnng25720D                                          121   2e-27   
ref|XP_009789935.1|  PREDICTED: uncharacterized protein LOC104237479    124   3e-27   
ref|XP_010456611.1|  PREDICTED: uncharacterized protein LOC104738072    124   3e-27   
gb|ABD65060.1|  hypothetical protein 27.t00039                          124   4e-27   Brassica oleracea
ref|XP_010689165.1|  PREDICTED: uncharacterized protein LOC104902921    124   4e-27   
emb|CDY47315.1|  BnaAnng08890D                                          121   6e-27   
emb|CDX71614.1|  BnaC09g26550D                                          122   6e-27   
ref|XP_007221236.1|  hypothetical protein PRUPE_ppb022397m2g            118   1e-26   
emb|CAE02205.2|  OSJNBa0095H06.12                                       122   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760977.1|  PREDICTED: uncharacterized protein LOC104213222    118   1e-26   
ref|XP_009120083.1|  PREDICTED: uncharacterized protein LOC103845004    120   1e-26   
emb|CDY04215.1|  BnaC06g26000D                                          121   2e-26   
emb|CDX82848.1|  BnaC01g12980D                                          120   2e-26   
ref|XP_002453868.1|  hypothetical protein SORBIDRAFT_04g020125          121   2e-26   Sorghum bicolor [broomcorn]
gb|EMS67201.1|  hypothetical protein TRIUR3_23959                       121   3e-26   
ref|XP_002449633.1|  hypothetical protein SORBIDRAFT_05g020450          118   3e-26   Sorghum bicolor [broomcorn]
dbj|BAD68127.1|  helicase-like protein                                  121   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003593180.1|  ATP-dependent DNA helicase PIF1                    121   4e-26   
gb|KEH17059.1|  hypothetical protein MTR_0048s0090                      118   5e-26   
gb|AAU44208.1|  unknown protein                                         120   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452166.1|  hypothetical protein SORBIDRAFT_04g021060          117   8e-26   Sorghum bicolor [broomcorn]
ref|XP_009781233.1|  PREDICTED: uncharacterized protein LOC104230189    119   8e-26   
ref|XP_002878906.1|  predicted protein                                  115   9e-26   
ref|XP_006383763.1|  hypothetical protein POPTR_0005s27010g             119   1e-25   
ref|XP_010419309.1|  PREDICTED: uncharacterized protein LOC104705014    117   1e-25   
ref|XP_003622843.1|  Helicase-like protein                              118   3e-25   
emb|CDX75766.1|  BnaC03g38490D                                          115   4e-25   
ref|XP_010497042.1|  PREDICTED: uncharacterized protein LOC104774077    116   6e-25   
emb|CDX84973.1|  BnaC05g20820D                                          115   6e-25   
ref|XP_008650020.1|  PREDICTED: uncharacterized protein LOC103630...    114   7e-25   
ref|XP_004301743.1|  PREDICTED: uncharacterized protein LOC101302173    116   7e-25   
ref|XP_010320516.1|  PREDICTED: uncharacterized protein LOC101245841    116   1e-24   
gb|AAD32757.1|  putative helicase                                       116   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45352.1|  BnaA09g12370D                                          113   2e-24   
gb|AFW61004.1|  hypothetical protein ZEAMMB73_411669                    115   2e-24   
emb|CDX74430.1|  BnaA04g09590D                                          112   2e-24   
ref|XP_003619589.1|  Defensin-like protein                              115   2e-24   
ref|XP_006459769.1|  hypothetical protein AGABI2DRAFT_116714            111   3e-24   
ref|XP_003622731.1|  hypothetical protein MTR_7g051410                  110   3e-24   
ref|XP_002464527.1|  hypothetical protein SORBIDRAFT_01g020130          115   3e-24   Sorghum bicolor [broomcorn]
ref|XP_009129377.1|  PREDICTED: uncharacterized protein LOC103854199    115   3e-24   
ref|XP_008650018.1|  PREDICTED: uncharacterized protein LOC103630...    114   3e-24   
emb|CDY44893.1|  BnaA02g13890D                                          112   3e-24   
ref|XP_010474186.1|  PREDICTED: uncharacterized protein LOC104753664    114   4e-24   
ref|XP_008378701.1|  PREDICTED: uncharacterized protein LOC103441779    115   4e-24   
gb|ABA99349.2|  AT hook motif-containing protein, putative, expre...    114   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145084.1|  PREDICTED: uncharacterized protein LOC103868766    114   5e-24   
gb|KHN29779.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 6         111   5e-24   
ref|XP_004301603.1|  PREDICTED: uncharacterized protein LOC101297450    110   6e-24   
ref|XP_009119505.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    113   1e-23   
ref|XP_003607945.1|  Helicase-like protein                              113   1e-23   
ref|XP_004308435.1|  PREDICTED: uncharacterized protein LOC101290818    112   2e-23   
ref|XP_003600273.1|  ATP-dependent DNA helicase PIF1                    112   2e-23   
ref|XP_003606875.1|  Helicase-like protein                              112   2e-23   
ref|XP_004306651.1|  PREDICTED: uncharacterized protein LOC101307332    108   3e-23   
gb|KDQ27730.1|  hypothetical protein PLEOSDRAFT_1042559                 106   4e-23   
dbj|BAD87158.1|  DNA binding protein-like                               111   5e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CDY20262.1|  BnaC04g36940D                                          106   6e-23   
ref|XP_007334868.1|  hypothetical protein AGABI1DRAFT_47875             103   7e-23   
ref|XP_004296079.1|  PREDICTED: uncharacterized protein LOC101300808    110   8e-23   
ref|XP_008359618.1|  PREDICTED: uncharacterized protein LOC103423324    110   2e-22   
ref|XP_009117965.1|  PREDICTED: uncharacterized protein LOC103843024    109   2e-22   
ref|XP_007860217.1|  hypothetical protein GLOTRDRAFT_30816              106   2e-22   
emb|CDY67942.1|  BnaCnng57090D                                          105   3e-22   
gb|KEH19332.1|  AT hook motif protein, putative                         103   4e-22   
gb|ABA97027.1|  hypothetical protein LOC_Os12g16620                     104   7e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19188.1|  BnaC05g13890D                                          103   8e-22   
ref|XP_002446060.1|  hypothetical protein SORBIDRAFT_06g001180          107   1e-21   Sorghum bicolor [broomcorn]
ref|XP_009107547.1|  PREDICTED: uncharacterized protein LOC103833199    106   1e-21   
gb|AAD15468.1|  putative helicase                                       106   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003936.1|  PREDICTED: uncharacterized protein LOC105110557    102   2e-21   
emb|CDY00429.1|  BnaC07g13970D                                          104   2e-21   
emb|CDY24448.1|  BnaC05g35060D                                          101   2e-21   
ref|XP_009150787.1|  PREDICTED: uncharacterized protein LOC103874120    101   3e-21   
ref|XP_009107548.1|  PREDICTED: uncharacterized protein LOC103833200    105   3e-21   
ref|XP_006461161.1|  hypothetical protein AGABI2DRAFT_54678             100   4e-21   
emb|CDX93905.1|  BnaC04g20640D                                          101   6e-21   
ref|XP_006389497.1|  hypothetical protein POPTR_0022s00390g             103   2e-20   
gb|EXX56857.1|  Pif1p                                                   103   2e-20   
emb|CDY55230.1|  BnaCnng28530D                                          102   2e-20   
ref|XP_009137136.1|  PREDICTED: uncharacterized protein LOC103861187    102   3e-20   
gb|ESA22057.1|  hypothetical protein GLOINDRAFT_45157                 99.8    3e-20   
ref|XP_009138227.1|  PREDICTED: uncharacterized protein LOC103862283    102   3e-20   
emb|CDY70093.1|  BnaCnng66670D                                          101   3e-20   
gb|KDQ08676.1|  hypothetical protein BOTBODRAFT_75354                 98.2    3e-20   
ref|XP_009135954.1|  PREDICTED: uncharacterized protein LOC103860104    102   4e-20   
gb|AAT85232.1|  hypothetical protein                                    102   5e-20   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB02793.1|  helicase-like protein                                  101   7e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67005.1|  BnaAnng23430D                                          101   8e-20   
gb|AET02330.2|  replication factor-A carboxy-terminal domain protein    100   1e-19   
gb|KDQ32681.1|  hypothetical protein PLEOSDRAFT_153646                99.0    2e-19   
emb|CAZ96142.1|  conserved hypothetical protein                       99.0    2e-19   
gb|KDR65039.1|  hypothetical protein GALMADRAFT_82350                 96.3    2e-19   
emb|CDY25439.1|  BnaC09g39540D                                        99.4    2e-19   
emb|CDX96947.1|  BnaC02g30850D                                          100   2e-19   
ref|XP_001830517.2|  hypothetical protein CC1G_13042                  99.4    2e-19   Coprinopsis cinerea okayama7#130
ref|XP_009135997.1|  PREDICTED: uncharacterized protein LOC103860150  99.8    3e-19   
gb|ABA95256.2|  helicase, putative                                    99.8    3e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CDX81603.1|  BnaC02g19070D                                        97.4    5e-19   
emb|CDY60422.1|  BnaCnng36250D                                        98.2    7e-19   
ref|XP_003609074.1|  ATP-dependent DNA helicase PIF1                  97.8    1e-18   
ref|XP_003600221.1|  Helicase-like protein                            97.8    1e-18   
gb|ERZ98206.1|  hypothetical protein GLOINDRAFT_51202                 93.2    1e-18   
ref|XP_009130289.1|  PREDICTED: uncharacterized protein LOC103855081  97.4    1e-18   
emb|CDY46030.1|  BnaA02g16960D                                        97.4    1e-18   
gb|EPT05482.1|  hypothetical protein FOMPIDRAFT_1091844               92.8    2e-18   
ref|XP_007219813.1|  hypothetical protein PRUPE_ppa026702mg           97.1    2e-18   
ref|XP_007407747.1|  hypothetical protein MELLADRAFT_104602           93.6    2e-18   
ref|XP_008037664.1|  hypothetical protein TRAVEDRAFT_147095           94.4    2e-18   
gb|ABD65047.1|  hypothetical protein 26.t00109                        92.4    3e-18   Brassica oleracea
ref|XP_007416731.1|  hypothetical protein MELLADRAFT_39963            93.2    3e-18   
dbj|BAB01023.1|  helicase-like protein                                96.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627854.1|  Helicase-like protein                            95.1    5e-18   
ref|XP_007408644.1|  hypothetical protein MELLADRAFT_62152            91.7    5e-18   
emb|CDY56415.1|  BnaC04g54850D                                        94.0    6e-18   
emb|CDY18760.1|  BnaC08g08560D                                        90.5    7e-18   
gb|EXX55742.1|  hypothetical protein RirG_222610                      94.7    1e-17   
gb|ESA17311.1|  hypothetical protein GLOINDRAFT_46848                 92.8    1e-17   
ref|XP_007405291.1|  hypothetical protein MELLADRAFT_59634            91.3    2e-17   
ref|XP_009768124.1|  PREDICTED: uncharacterized protein LOC104219...  92.0    2e-17   
ref|XP_009768123.1|  PREDICTED: uncharacterized protein LOC104219...  92.0    3e-17   
gb|KDQ22276.1|  hypothetical protein PLEOSDRAFT_1051142               89.4    3e-17   
gb|ESA10808.1|  hypothetical protein GLOINDRAFT_65572                 89.4    3e-17   
ref|XP_010478901.1|  PREDICTED: uncharacterized protein LOC104757808  89.0    3e-17   
gb|KDR70860.1|  hypothetical protein GALMADRAFT_75581                 88.6    5e-17   
ref|XP_007210988.1|  hypothetical protein PRUPE_ppa021189mg           92.0    7e-17   
gb|KDQ32939.1|  hypothetical protein PLEOSDRAFT_1060636               88.6    7e-17   
ref|XP_003026819.1|  hypothetical protein SCHCODRAFT_258815           91.3    8e-17   
ref|XP_003033008.1|  hypothetical protein SCHCODRAFT_257016           91.3    9e-17   
ref|XP_009343173.1|  PREDICTED: uncharacterized protein LOC103935142  89.7    1e-16   
ref|XP_009334952.1|  PREDICTED: uncharacterized protein LOC103927733  89.7    1e-16   
gb|KDR69847.1|  hypothetical protein GALMADRAFT_214918                90.9    1e-16   
gb|EPT05485.1|  hypothetical protein FOMPIDRAFT_1090843               87.4    1e-16   
ref|XP_009546882.1|  hypothetical protein HETIRDRAFT_22960            90.1    1e-16   
ref|XP_009541807.1|  hypothetical protein HETIRDRAFT_44213            89.0    2e-16   
ref|XP_008553649.1|  PREDICTED: uncharacterized protein LOC103575583  90.5    2e-16   
emb|CDY29934.1|  BnaC05g29020D                                        90.1    2e-16   
ref|XP_009353547.1|  PREDICTED: uncharacterized protein LOC103944810  89.4    3e-16   
ref|XP_007225067.1|  hypothetical protein PRUPE_ppa018448mg           90.1    3e-16   
emb|CDY59191.1|  BnaAnng15890D                                        90.1    3e-16   
gb|KDQ22292.1|  hypothetical protein PLEOSDRAFT_171712                89.7    3e-16   
ref|XP_009552423.1|  hypothetical protein HETIRDRAFT_430558           89.4    5e-16   
ref|XP_007407917.1|  hypothetical protein MELLADRAFT_77257            86.3    5e-16   
emb|CDY35665.1|  BnaC09g29870D                                        88.6    5e-16   
ref|XP_007418274.1|  hypothetical protein MELLADRAFT_69302            87.0    5e-16   
ref|XP_006258109.1|  PREDICTED: glycogenin-1                          88.6    6e-16   
ref|XP_009543069.1|  hypothetical protein HETIRDRAFT_425208           89.0    6e-16   
gb|EIE87496.1|  hypothetical protein RO3G_12207                       89.0    7e-16   
ref|XP_008190173.1|  PREDICTED: uncharacterized protein LOC103311997  88.6    9e-16   
ref|XP_010534679.1|  PREDICTED: uncharacterized protein LOC104810180  88.2    9e-16   
ref|XP_005716007.1|  ATP dependant DNA helicase PIF1                  88.6    1e-15   
gb|ERZ98222.1|  hypothetical protein GLOINDRAFT_49592                 84.3    1e-15   
gb|EIE75949.1|  hypothetical protein RO3G_00653                       88.2    1e-15   
ref|XP_007387352.1|  hypothetical protein PUNSTDRAFT_17327            84.0    2e-15   
ref|XP_007333664.1|  hypothetical protein AGABI1DRAFT_131993          86.3    2e-15   
gb|EIE91608.1|  hypothetical protein RO3G_16319                       87.8    2e-15   
ref|XP_010668260.1|  PREDICTED: uncharacterized protein LOC104885260  87.4    2e-15   
gb|KDR83323.1|  hypothetical protein GALMADRAFT_55132                 84.0    2e-15   
ref|XP_006573976.1|  PREDICTED: uncharacterized protein LOC100801254  84.0    3e-15   
emb|CDY61233.1|  BnaC07g47960D                                        85.9    3e-15   
ref|XP_009540537.1|  hypothetical protein HETIRDRAFT_166040           86.3    4e-15   
ref|XP_004295808.1|  PREDICTED: uncharacterized protein LOC101294546  86.7    4e-15   
ref|XP_004295965.1|  PREDICTED: uncharacterized protein LOC101307681  86.3    4e-15   
ref|XP_010480868.1|  PREDICTED: uncharacterized protein LOC104759661  86.3    5e-15   
ref|XP_007409619.1|  hypothetical protein MELLADRAFT_62854            85.9    6e-15   
ref|XP_002450018.1|  hypothetical protein SORBIDRAFT_05g027120        84.3    8e-15   
ref|XP_002472347.1|  predicted protein                                82.0    9e-15   
ref|XP_009544324.1|  hypothetical protein HETIRDRAFT_314300           85.1    1e-14   
ref|XP_008653992.1|  PREDICTED: uncharacterized protein LOC103634183  85.1    1e-14   
emb|CDY71584.1|  BnaCnng73540D                                        84.7    1e-14   
ref|XP_009540539.1|  hypothetical protein HETIRDRAFT_307199           84.3    1e-14   
emb|CDY63542.1|  BnaAnng19010D                                        84.7    1e-14   
emb|CDY67783.1|  BnaCnng56380D                                        80.9    1e-14   
ref|XP_005712995.1|  ATP dependant DNA helicase                       84.7    2e-14   
gb|AAD25621.1|AC005287_23  Hypothetical protein                       84.7    2e-14   
ref|XP_009546299.1|  hypothetical protein HETIRDRAFT_427006           84.7    2e-14   
ref|XP_005709947.1|  ATP dependant DNA helicase                       84.7    2e-14   
ref|XP_009550171.1|  hypothetical protein HETIRDRAFT_429250           84.0    2e-14   
gb|AAT73668.1|  hypothetical protein                                  84.0    2e-14   
gb|KEP45871.1|  putative ATP-dependent DNA helicase PIF1              84.3    2e-14   
gb|EUC59156.1|  helitron helicase-like amino-terminal domain protein  84.3    2e-14   
ref|XP_001835316.2|  transcriptional factor B3                        84.3    2e-14   
ref|XP_007404147.1|  hypothetical protein MELLADRAFT_58373            82.0    2e-14   
ref|XP_008660767.1|  PREDICTED: uncharacterized protein LOC103639853  84.0    3e-14   
gb|EIE88045.1|  hypothetical protein RO3G_12756                       82.0    3e-14   
ref|XP_008549021.1|  PREDICTED: uncharacterized protein LOC103572275  83.6    4e-14   
ref|XP_007408561.1|  hypothetical protein MELLADRAFT_61965            81.6    4e-14   
gb|EGN94905.1|  hypothetical protein SERLA73DRAFT_155591              82.0    4e-14   
ref|XP_008339195.1|  PREDICTED: uncharacterized protein LOC103402228  83.2    6e-14   
ref|XP_006434523.1|  hypothetical protein CICLE_v10004019mg           82.8    6e-14   
gb|KDR70861.1|  hypothetical protein GALMADRAFT_144338                82.0    6e-14   
gb|KDR74073.1|  hypothetical protein GALMADRAFT_71234                 80.1    6e-14   
ref|XP_008482471.1|  PREDICTED: uncharacterized protein LOC103519163  82.8    6e-14   
ref|XP_007005427.1|  hypothetical protein TREMEDRAFT_63051            82.4    7e-14   
emb|CAB87724.1|  putative protein                                     82.0    9e-14   
gb|ERZ98224.1|  hypothetical protein GLOINDRAFT_70684                 79.3    9e-14   
ref|XP_009803962.1|  PREDICTED: uncharacterized protein LOC104249270  82.0    1e-13   
ref|XP_005711525.1|  partial DNA Helicase                             82.0    1e-13   
ref|XP_009544739.1|  hypothetical protein HETIRDRAFT_416578           81.6    1e-13   
ref|XP_005716008.1|  ATP dependant DNA Helicase PIF1                  82.0    1e-13   
ref|XP_007413990.1|  hypothetical protein MELLADRAFT_66017            79.7    1e-13   
ref|XP_009548101.1|  hypothetical protein HETIRDRAFT_428038           81.6    1e-13   
ref|XP_005711602.1|  ATP dependant DNA helicase                       81.6    2e-13   
ref|XP_008557273.1|  PREDICTED: uncharacterized protein LOC103578099  76.6    2e-13   
ref|XP_006372150.1|  hypothetical protein POPTR_0018s12540g           80.9    2e-13   
gb|EEQ86974.1|  PIF1                                                  81.3    3e-13   
ref|XP_010683816.1|  PREDICTED: uncharacterized protein LOC104898428  81.3    3e-13   
ref|XP_005717254.1|  ATP dependant DNA helicase                       80.9    3e-13   
ref|XP_009543068.1|  hypothetical protein HETIRDRAFT_311325           80.5    3e-13   
ref|NP_001172292.1|  Os01g0300400                                     80.5    4e-13   
gb|EUC57660.1|  helitron helicase-like amino-terminal domain protein  80.5    5e-13   
ref|XP_008040407.1|  hypothetical protein TRAVEDRAFT_150795           79.7    5e-13   
gb|EIE76536.1|  hypothetical protein RO3G_01240                       77.0    5e-13   
ref|XP_005718490.1|  ATP dependant DNA helicase                       80.1    6e-13   
ref|XP_008185956.1|  PREDICTED: uncharacterized protein LOC103310215  79.3    8e-13   
gb|EEE54237.1|  hypothetical protein OsJ_01110                        79.3    8e-13   
gb|EGT30965.1|  hypothetical protein CAEBREN_12265                    79.3    1e-12   
ref|XP_008551871.1|  PREDICTED: uncharacterized protein LOC103574241  79.3    1e-12   
ref|XP_009350308.1|  PREDICTED: uncharacterized protein LOC103941836  79.0    1e-12   
ref|XP_008660031.1|  PREDICTED: uncharacterized protein LOC103639028  78.6    1e-12   
ref|XP_003889855.1|  hypothetical protein PGTG_21498                  79.0    1e-12   
ref|XP_007409109.1|  hypothetical protein MELLADRAFT_62392            77.0    1e-12   
emb|CDY12571.1|  BnaC06g00970D                                        74.7    2e-12   
gb|EGN92289.1|  hypothetical protein SERLA73DRAFT_79706               77.8    2e-12   
ref|XP_005713392.1|  Putativ ATP dependant DNA helicase               78.6    2e-12   
ref|XP_007411782.1|  hypothetical protein MELLADRAFT_37130            76.6    2e-12   
ref|XP_007417862.1|  hypothetical protein MELLADRAFT_40611            75.9    2e-12   
ref|XP_007323015.1|  hypothetical protein SERLADRAFT_442403           77.8    2e-12   
ref|XP_007408202.1|  hypothetical protein MELLADRAFT_28670            75.1    2e-12   
ref|XP_005710919.1|  ATP dependant DNA helicase                       78.2    2e-12   
ref|XP_003740984.1|  PREDICTED: uncharacterized protein LOC100902978  78.2    2e-12   
ref|XP_010513195.1|  PREDICTED: uncharacterized protein LOC104789155  77.8    3e-12   
ref|XP_007858724.1|  transcriptional factor b3                        73.6    3e-12   
ref|XP_003336540.1|  hypothetical protein PGTG_17426                  78.2    3e-12   
ref|XP_007414623.1|  hypothetical protein MELLADRAFT_66624            76.6    3e-12   
ref|XP_008556509.1|  PREDICTED: uncharacterized protein LOC103577587  77.4    4e-12   
ref|XP_003338085.2|  hypothetical protein PGTG_19561                  77.4    4e-12   
ref|XP_009631527.1|  PREDICTED: uncharacterized protein LOC104121279  76.3    5e-12   
ref|XP_003890478.1|  hypothetical protein PGTG_20933                  77.0    5e-12   
ref|XP_002439986.1|  hypothetical protein SORBIDRAFT_09g023890        76.3    6e-12   
ref|XP_003739875.1|  PREDICTED: uncharacterized protein LOC100902110  77.0    6e-12   
ref|XP_007419359.1|  hypothetical protein MELLADRAFT_70042            74.3    6e-12   
emb|CEI87177.1|  hypothetical protein RMCBS344292_01597               76.3    6e-12   
emb|CEI92612.1|  hypothetical protein RMCBS344292_06866               75.5    6e-12   
gb|KIH52626.1|  hypothetical protein ANCDUO_17270                     77.0    7e-12   
ref|XP_007002844.1|  hypothetical protein TREMEDRAFT_60521            75.1    7e-12   
ref|XP_001781122.1|  predicted protein                                73.9    8e-12   
ref|XP_008180566.1|  PREDICTED: uncharacterized protein LOC103308633  76.6    8e-12   
ref|XP_005710680.1|  ATP dependant DNA helicase                       76.6    9e-12   
ref|XP_009351049.1|  PREDICTED: uncharacterized protein LOC103942593  76.6    9e-12   
ref|XP_007419499.1|  hypothetical protein MELLADRAFT_70124            73.9    9e-12   
gb|EYB87952.1|  hypothetical protein Y032_0254g286                    76.3    1e-11   
ref|XP_001185162.2|  PREDICTED: uncharacterized protein LOC754317     76.3    1e-11   
ref|XP_009342799.1|  PREDICTED: uncharacterized protein LOC103934779  76.3    1e-11   
emb|CDX89675.1|  BnaC03g45890D                                        71.6    1e-11   
gb|EGO01507.1|  hypothetical protein SERLA73DRAFT_70687               75.9    1e-11   
ref|XP_007320672.1|  hypothetical protein SERLADRAFT_440153           73.2    1e-11   
ref|XP_010694685.1|  PREDICTED: uncharacterized protein LOC104907451  76.3    1e-11   
ref|XP_003097452.1|  hypothetical protein CRE_16968                   76.3    1e-11   
ref|XP_008555447.1|  PREDICTED: uncharacterized protein LOC103576831  75.9    1e-11   
ref|XP_004240810.1|  PREDICTED: uncharacterized protein LOC101249828  75.9    1e-11   
ref|XP_007415118.1|  hypothetical protein MELLADRAFT_28749            72.8    1e-11   
ref|XP_008549898.1|  PREDICTED: uncharacterized protein LOC103572878  75.9    1e-11   
ref|XP_007201631.1|  hypothetical protein PRUPE_ppa020071mg           75.5    2e-11   
ref|XP_009592589.1|  PREDICTED: uncharacterized protein LOC104089...  73.2    2e-11   
gb|ELT90405.1|  hypothetical protein CAPTEDRAFT_202282                73.2    2e-11   
ref|XP_001779987.1|  predicted protein                                74.7    2e-11   
ref|XP_007406091.1|  hypothetical protein MELLADRAFT_33675            73.2    2e-11   
ref|XP_005710814.1|  ATP dependant DNA helicase                       75.5    2e-11   
emb|CEG67848.1|  hypothetical protein RMATCC62417_04210               73.6    2e-11   
ref|XP_009592588.1|  PREDICTED: uncharacterized protein LOC104089...  73.2    2e-11   
ref|XP_005709918.1|  Helicase-like protein                            75.1    3e-11   
ref|XP_002463339.1|  hypothetical protein SORBIDRAFT_02g042016        74.7    3e-11   
ref|XP_007416963.1|  hypothetical protein MELLADRAFT_28736            72.0    3e-11   
emb|CAS00932.1|  Protein CBG26851                                     74.7    3e-11   
gb|AES65222.2|  hypothetical protein MTR_2g036820                     72.0    4e-11   
ref|XP_009757892.1|  PREDICTED: uncharacterized protein LOC104210641  74.7    4e-11   
ref|XP_003740018.1|  PREDICTED: uncharacterized protein LOC100900389  74.3    4e-11   
emb|CDY67433.1|  BnaCnng54940D                                        73.6    4e-11   
ref|XP_005716836.1|  ATP dependant DNA helicase                       74.3    5e-11   
ref|XP_003746054.1|  PREDICTED: uncharacterized protein LOC100903664  74.3    5e-11   
ref|XP_004527327.1|  PREDICTED: uncharacterized protein LOC101459168  74.3    5e-11   
ref|XP_001783466.1|  predicted protein                                70.9    6e-11   
ref|XP_009766150.1|  PREDICTED: uncharacterized protein LOC104217564  72.8    6e-11   
gb|EXX77378.1|  hypothetical protein RirG_024370                      71.2    7e-11   
ref|XP_010692770.1|  PREDICTED: uncharacterized protein LOC104905831  73.2    7e-11   
emb|CEI91913.1|  hypothetical protein RMCBS344292_06190               71.2    7e-11   
emb|CEJ02498.1|  hypothetical protein RMCBS344292_16500               73.2    8e-11   
ref|XP_002440833.1|  hypothetical protein SORBIDRAFT_09g007990        72.4    9e-11   
ref|XP_009796236.1|  PREDICTED: uncharacterized protein LOC104242831  72.4    9e-11   
emb|CEI91150.1|  hypothetical protein RMCBS344292_05450               72.0    9e-11   
emb|CEG70106.1|  hypothetical protein RMATCC62417_06056               68.9    1e-10   
ref|XP_007407960.1|  hypothetical protein MELLADRAFT_34736            71.6    1e-10   
gb|KIH64084.1|  hypothetical protein ANCDUO_05607                     72.8    1e-10   
ref|XP_004308422.1|  PREDICTED: uncharacterized protein LOC101310942  72.8    1e-10   
gb|EFX76669.1|  hypothetical protein DAPPUDRAFT_248756                72.4    1e-10   
emb|CDY67091.1|  BnaAnng23600D                                        72.0    1e-10   
emb|CEG72551.1|  hypothetical protein RMATCC62417_08094               72.4    1e-10   
gb|EYB99390.1|  hypothetical protein Y032_0123g1179                   72.4    2e-10   
gb|EFX81540.1|  hypothetical protein DAPPUDRAFT_242259                72.0    2e-10   
gb|EYB99391.1|  hypothetical protein Y032_0123g1179                   72.8    2e-10   
gb|EYB99392.1|  hypothetical protein Y032_0123g1179                   72.4    2e-10   
ref|XP_009350137.1|  PREDICTED: uncharacterized protein LOC103941658  72.4    2e-10   
ref|XP_007312684.1|  hypothetical protein SERLADRAFT_432435           72.0    2e-10   
ref|XP_010540172.1|  PREDICTED: uncharacterized protein LOC104814022  72.4    2e-10   
emb|CDY68889.1|  BnaCnng60940D                                        72.0    2e-10   
emb|CEI94958.1|  hypothetical protein RMCBS344292_09159               70.1    2e-10   
emb|CEI89911.1|  hypothetical protein RMCBS344292_04248               69.7    2e-10   
ref|XP_009785272.1|  PREDICTED: uncharacterized protein LOC104233559  71.2    2e-10   
ref|XP_001760466.1|  predicted protein                                69.7    2e-10   
ref|XP_002443338.1|  hypothetical protein SORBIDRAFT_08g017746        71.6    3e-10   
gb|EFX69607.1|  hypothetical protein DAPPUDRAFT_258329                71.2    3e-10   
gb|EFX69181.1|  hypothetical protein DAPPUDRAFT_113831                70.9    3e-10   
emb|CEJ03281.1|  hypothetical protein RMCBS344292_17268               70.9    3e-10   
ref|XP_010668309.1|  PREDICTED: uncharacterized protein LOC104885313  71.6    3e-10   
emb|CEJ05039.1|  hypothetical protein RMCBS344292_18987               70.5    3e-10   
ref|XP_009117691.1|  PREDICTED: uncharacterized protein LOC103842780  70.9    4e-10   
ref|XP_003594971.1|  hypothetical protein MTR_2g036820                70.5    4e-10   
emb|CEI86290.1|  hypothetical protein RMCBS344292_00733               67.8    4e-10   
ref|XP_003099547.1|  hypothetical protein CRE_29062                   71.6    4e-10   
ref|XP_003738408.1|  PREDICTED: uncharacterized protein LOC100905460  71.2    4e-10   
ref|XP_003737967.1|  PREDICTED: uncharacterized protein LOC100904111  71.2    4e-10   
emb|CEI97881.1|  hypothetical protein RMCBS344292_12005               67.0    4e-10   
ref|XP_009370621.1|  PREDICTED: uncharacterized protein LOC103959960  71.2    4e-10   
ref|XP_001764729.1|  predicted protein                                68.2    5e-10   
gb|EGT37482.1|  hypothetical protein CAEBREN_25238                    71.2    5e-10   
ref|XP_007403698.1|  hypothetical protein MELLADRAFT_32306            68.6    5e-10   
ref|XP_009375501.1|  PREDICTED: uncharacterized protein LOC103964305  70.5    7e-10   
ref|XP_010468439.1|  PREDICTED: uncharacterized protein LOC104748509  70.5    7e-10   
emb|CEG73987.1|  hypothetical protein RMATCC62417_09265               68.2    7e-10   
gb|KDQ25618.1|  hypothetical protein PLEOSDRAFT_1023971               67.8    8e-10   
ref|XP_009792625.1|  PREDICTED: uncharacterized protein LOC104239643  70.1    8e-10   
tpg|DAA56789.1|  TPA: hypothetical protein ZEAMMB73_813358            67.8    1e-09   
emb|CEG68231.1|  hypothetical protein RMATCC62417_04532               69.7    1e-09   
gb|EFX65310.1|  hypothetical protein DAPPUDRAFT_117368                69.7    1e-09   
emb|CDP05287.1|  unnamed protein product                              69.7    1e-09   
ref|XP_007139973.1|  hypothetical protein PHAVU_008G0744001g          67.0    1e-09   
gb|KHJ98354.1|  hypothetical protein OESDEN_01671                     69.3    1e-09   
ref|NP_001043325.1|  Os01g0556600                                     69.7    1e-09   
emb|CEG67144.1|  hypothetical protein RMATCC62417_03612               68.9    2e-09   
ref|XP_006354286.1|  PREDICTED: uncharacterized protein LOC102596...  68.6    2e-09   
emb|CDJ90379.1|  uncharacterized protein LOC100903664                 69.3    2e-09   
ref|XP_006354285.1|  PREDICTED: uncharacterized protein LOC102596...  68.6    2e-09   
ref|XP_008106815.1|  PREDICTED: uncharacterized protein LOC103278523  69.3    2e-09   
gb|EGT54381.1|  hypothetical protein CAEBREN_32751                    69.3    2e-09   
gb|KDQ53684.1|  hypothetical protein JAAARDRAFT_61092                 66.6    2e-09   
emb|CEI91599.1|  hypothetical protein RMCBS344292_05883               66.6    2e-09   
gb|KFM71124.1|  hypothetical protein X975_02399                       68.9    3e-09   
gb|ESA06597.1|  hypothetical protein GLOINDRAFT_3894                  64.7    3e-09   
emb|CEG83054.1|  hypothetical protein RMATCC62417_17030               67.8    3e-09   
emb|CDJ85606.1|  uncharacterized protein LOC100902978                 68.6    3e-09   
emb|CEI96354.1|  hypothetical protein RMCBS344292_10520               67.8    3e-09   
gb|EEC77881.1|  hypothetical protein OsI_17170                        68.6    3e-09   
emb|CEJ01972.1|  hypothetical protein RMCBS344292_15991               66.6    4e-09   
ref|XP_010446026.1|  PREDICTED: uncharacterized protein LOC104728792  67.8    4e-09   
ref|XP_009591879.1|  PREDICTED: uncharacterized protein LOC104088...  66.6    4e-09   
emb|CEI93360.1|  hypothetical protein RMCBS344292_07595               65.9    4e-09   
emb|CEG70247.1|  hypothetical protein RMATCC62417_06179               65.5    4e-09   
emb|CDJ83292.1|  uncharacterized protein LOC100903664                 67.8    4e-09   
gb|EGT32295.1|  hypothetical protein CAEBREN_24730                    67.4    4e-09   
emb|CEI90238.1|  hypothetical protein RMCBS344292_04566               67.4    4e-09   



>ref|XP_010687125.1| PREDICTED: uncharacterized protein LOC104901271 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 116/205 (57%), Gaps = 18/205 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD   +CN CGAL W  ER  +      PK++ CC  GK++LP +K+PPP L  
Sbjct  33    EEYWDIGDPTSTCNTCGALMWYEERVGKKRRPSQPKFSLCCMHGKVELPLLKDPPPTLSK  92

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L    + +SRHFI NIR +N MF FTS+GG+V+ SIN G  P +FR+ GQNYH IGSL+P
Sbjct  93    LLDNTDAKSRHFIENIRAFNMMFSFTSMGGKVDSSINQGRGPYVFRLHGQNYHRIGSLLP  152

Query  860   GGGSMTKLAQ----RDVN--------------SRDIHENIVEELKNMLDGNNVLVKCFRM  985
               GS  K  Q     D++              S  +  ++VE +K MLD  N L K FRM
Sbjct  153   QPGSSPKFLQLYYIHDIDNEVSNRISALGSRSSDSLDADVVEAIKEMLDEYNPLTKAFRM  212

Query  986   ARTEIQSNPVVAVKMNLIGRRNKDG  1060
             AR    SN    VK+ LI RR KDG
Sbjct  213   ARDRFDSNEYKDVKLKLIDRRGKDG  237



>ref|XP_009591183.1| PREDICTED: uncharacterized protein LOC104088243, partial [Nicotiana 
tomentosiformis]
Length=830

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 120/207 (58%), Gaps = 18/207 (9%)
 Frame = +2

Query  494   TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
             T   Y D GDA + C YCGA FW  ER ++      P +T CC  GKI+LP  K PP +L
Sbjct  258   TNEEYWDIGDANYECEYCGAYFWFEERVDKKYKNKKPVFTLCCGRGKIKLPNPKEPPSIL  317

Query  674   QSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
             + L F    +++HF  NIR YN++F FTS+GG+V+ S+N    P  FR+SGQNYH IGSL
Sbjct  318   KDLLFGSGAKNKHFRENIRTYNSIFAFTSMGGKVDFSVNKTKGPRTFRLSGQNYHQIGSL  377

Query  854   VPGGGSMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCF  979
             +P  GS  K AQ        +V +R            +H  IV ELK MLD NN+L K F
Sbjct  378   LPPEGSSPKFAQLYIYDTENEVENRIHAISRGEMNNQLHAEIVNELKQMLDDNNILAKSF  437

Query  980   RMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             RM R + Q++    V++ LIG+R  DG
Sbjct  438   RMVRDQFQTDRTSNVRLRLIGKRGSDG  464



>gb|AFK13834.1| putative PIF1 DNA helicase/replication protein A1-like protein 
[Beta vulgaris subsp. vulgaris]
Length=2037

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 118/187 (63%), Gaps = 2/187 (1%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  ++C +CGALFW  ER  ++     P ++ CC  GK+QLP  K+PP +LQ L 
Sbjct  747   YWDIGDPTYTCEHCGALFWYEERIGKHRKSPKPTFSNCCMNGKVQLPHFKDPPALLQRLL  806

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                + +SRHF+ NIR +N+MF FTS+GG+V+ SIN    P +FR+ GQNYH IGSL+P  
Sbjct  807   SNGDSKSRHFLENIRAFNSMFAFTSMGGKVDSSINECRGPYVFRLHGQNYHRIGSLLPNS  866

Query  866   GSMTKLAQRD--VNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
             GS  K    D  +N+      +VEELK MLD  N L K FR+AR  + S+    +++ LI
Sbjct  867   GSTPKSRGSDANINASPFDTGVVEELKKMLDEYNPLAKAFRIARDRLCSDDCSNIRLKLI  926

Query  1040  GRRNKDG  1060
             G R+KDG
Sbjct  927   GSRDKDG  933



>ref|XP_010668250.1| PREDICTED: uncharacterized protein LOC104885245, partial [Beta 
vulgaris subsp. vulgaris]
Length=1507

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 120/208 (58%), Gaps = 23/208 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  ++C +CGALFW  ER  ++     P ++ CC  GK+QLP  K+PP +LQ L 
Sbjct  109   YWDIGDPTYTCEHCGALFWYEERIGKHRKSPKPTFSNCCMNGKVQLPHFKDPPALLQRLL  168

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                + +SRHF+ NIR +N+MF FTS+GG+V+ SIN    P +FR+ GQNYH IGSL+P  
Sbjct  169   SNGDSKSRHFLENIRAFNSMFAFTSMGGKVDSSINECRGPYVFRLHGQNYHRIGSLLPNS  228

Query  866   GSMTKLAQ-----------------------RDVNSRDIHENIVEELKNMLDGNNVLVKC  976
             GS  K +Q                        ++N+      +VEELKNMLD  N L K 
Sbjct  229   GSTPKFSQLYIYDTDNEIANRVQSFRSRGSDANINASPFDTGVVEELKNMLDEYNPLAKA  288

Query  977   FRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             FR+AR    S+    +++ LIG R+KDG
Sbjct  289   FRIARDRFCSDDCSNIRLKLIGSRDKDG  316



>ref|XP_009804789.1| PREDICTED: uncharacterized protein LOC104249954 [Nicotiana sylvestris]
Length=898

 Score =   169 bits (429),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 116/203 (57%), Gaps = 18/203 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             + D GD    C +CGA FW  ER N+N     P+++ CC  GKI LP+ K PP +L+ L 
Sbjct  3     FWDIGDPTCECEHCGAYFWYEERINKNHKAKKPEFSLCCNHGKILLPKPKEPPTILKQLL  62

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F    +S HF +NIR YN+MF FTS+GG+V+  +N    P IF++SGQNYH IGSL+P  
Sbjct  63    FGSGPKSNHFRDNIRSYNSMFSFTSMGGKVDAFVNQTKGPRIFKLSGQNYHQIGSLLPPE  122

Query  866   GSMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMAR  991
             GS  K AQ        +V +R             H  IV++LK MLD +NVL K FRM R
Sbjct  123   GSNPKFAQLYIYDTENEVQNRMHALGRGDRINQFHAEIVQDLKQMLDEHNVLTKSFRMVR  182

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
              +         ++ LIG+RN DG
Sbjct  183   GKFHEETHSNFRLRLIGKRNYDG  205



>ref|XP_006432161.1| hypothetical protein CICLE_v10003309mg, partial [Citrus clementina]
 gb|ESR45401.1| hypothetical protein CICLE_v10003309mg, partial [Citrus clementina]
Length=783

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 117/202 (58%), Gaps = 19/202 (9%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG   ++C YCGA+ W  ER+ +      PK+T CC EG++Q+P MK  PP+L+ L   
Sbjct  7     NFGPPTYTCQYCGAILWYEERNKKTKKVSHPKFTFCCMEGRVQIPLMKETPPLLKYLLGA  66

Query  692   DNEQS-RHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             D+ Q    F  NIR YN+MF FTS+GGRV+ SIN    P +FR+SGQNYH IGSL+P  G
Sbjct  67    DSGQKGSKFRKNIRAYNSMFAFTSMGGRVDASINRSKGPYVFRMSGQNYHHIGSLLPEVG  126

Query  869   SMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ        ++++R           +I   I+ EL  MLD +N LVK FRMAR 
Sbjct  127   KKPQFAQLYIYDTENEIDNRINTLLKHGMKTEIDHEILHELSKMLDQHNNLVKSFRMARD  186

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               ++ P    ++ L+  R +DG
Sbjct  187   RYKTQPESTFRLRLLSSRTRDG  208



>ref|XP_010668429.1| PREDICTED: uncharacterized protein LOC104885435, partial [Beta 
vulgaris subsp. vulgaris]
Length=557

 Score =   159 bits (401),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 116/202 (57%), Gaps = 17/202 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C +CGA  W  ER N+    G PK+  CC +GK+QLP +K PP +L+ L 
Sbjct  70    YSDLGDPTCVCEFCGAQMWFCERVNKRNKNGRPKFGMCCMQGKVQLPLLKRPPQLLEDLL  129

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                + +S HF++NIR YN M+ FTS+GGR+      G  P  ++I GQN+H IGSL+P  
Sbjct  130   QKRHSRSAHFLDNIRGYNIMYSFTSMGGRIITPTTHGRGPYTYKIGGQNHHLIGSLLPND  189

Query  866   GSMTKLAQ-------RDVNSR----------DIHENIVEELKNMLDGNNVLVKCFRMART  994
             G+  K +Q        +V++R             + +V +LK+M+D +N L K FRMAR 
Sbjct  190   GARPKFSQLYIYDTEEEVHNRMNAASSKDPNKFEDRVVAQLKDMIDQHNPLAKSFRMARD  249

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               +SN    +K+ LIGRR+ DG
Sbjct  250   RFESNNGEDLKLRLIGRRDSDG  271



>ref|XP_006436413.1| hypothetical protein CICLE_v10033859mg, partial [Citrus clementina]
 gb|ESR49653.1| hypothetical protein CICLE_v10033859mg, partial [Citrus clementina]
Length=1100

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 112/202 (55%), Gaps = 19/202 (9%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG   ++C YCGA+ W  ER+ +      PK+T CC EG++Q+P MK  PP+L+ L   
Sbjct  39    NFGPPTYTCQYCGAILWYEERNKKTKKVSYPKFTFCCMEGRVQIPFMKETPPLLKYLLGA  98

Query  692   DNEQS-RHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             D+ Q    F  NIR YN+MF FTS+GGRV+ SIN    P +FR+SGQNYH IGSL+P  G
Sbjct  99    DSGQKGSKFRKNIRAYNSMFAFTSMGGRVDASINQSKGPFVFRMSGQNYHHIGSLLPEVG  158

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ  +                     +I   I+ EL  MLD +N LVK FRMAR 
Sbjct  159   KKPQFAQLYIYDTENETDNRINTLLKHGTKTEIDHEILHELSKMLDQHNNLVKSFRMARD  218

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               ++ P     + L+  R +DG
Sbjct  219   RYKTQPESTFCLRLLNSRTRDG  240



>ref|XP_010692805.1| PREDICTED: uncharacterized protein LOC104905864 [Beta vulgaris 
subsp. vulgaris]
Length=1685

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 114/211 (54%), Gaps = 17/211 (8%)
 Frame = +2

Query  479   KYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKN  658
             +Y   T   Y D GD    C +CGA  W  ERSN+      PK++ CC +GK+QLP ++ 
Sbjct  135   EYDVNTLTGYWDIGDPTSECEFCGAQMWFDERSNKQNKTSNPKFSLCCMQGKVQLPLLQR  194

Query  659   PPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYH  838
             PP  L +L    +++S HF  NIR YN MF FTS+GG++  SIN G  P  ++I GQN+H
Sbjct  195   PPSFLANLLEKKHKRSNHFFENIRAYNMMFSFTSMGGKLQTSINQGRGPYNYKIGGQNHH  254

Query  839   WIGSLVPGGGSMTKLAQRDV-----------------NSRDIHENIVEELKNMLDGNNVL  967
              IGSL+P  G   K +Q  +                 N     + ++ E++ M+D  N L
Sbjct  255   LIGSLLPNEGQCPKFSQLYIYDTQDEIVNRKKAACATNPNKFEDQVISEIQTMVDEYNAL  314

Query  968   VKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              K FRMAR    S+    V++ LIGRR+ DG
Sbjct  315   AKNFRMARDRFCSSTCRNVRLKLIGRRDSDG  345



>ref|XP_004500576.1| PREDICTED: uncharacterized protein LOC101500546 [Cicer arietinum]
Length=493

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 114/201 (57%), Gaps = 18/201 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +DFGD +++C+ CGA  W  ER+ ++V   LPK++ CC +G +Q+P +K PP +L SL  
Sbjct  74    VDFGDPSYTCSECGAQMWYEERAEKSVNSNLPKFSLCCMKGLVQIPYLKRPPELLMSLIH  133

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
               + +S+HF  NIR YN+MFCFTS+GG++  + + G  P    +SGQN+H IGSL+P   
Sbjct  134   GQDPRSKHFNENIRAYNSMFCFTSIGGKIQSNSSRGGRPPQCILSGQNFHRIGSLIPEEE  193

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
             +  K AQ  +                    +D+ + +VE+   M+D +NVL K FR  R 
Sbjct  194   ATPKFAQLYIYDTVNEISNRFNHFRSNEQHKDLDKTLVEDFTRMVDEHNVLAKSFRKVRD  253

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +Q N    V + L   R KD
Sbjct  254   HLQHNSTSNVCLRLFRNRTKD  274



>emb|CDY56895.1| BnaCnng31320D [Brassica napus]
Length=868

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 111/187 (59%), Gaps = 2/187 (1%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GDA + C++CGA+ W  ER N+      PK++ CC  G++QLP +K  P +L+ L 
Sbjct  251   YIDEGDATYKCDHCGAIMWYGERINRKRYARKPKFSMCCGHGQVQLPLLKQSPDILKILL  310

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+E SR+F  NIR  N +F FTSLGG+V+RS+  G  P +F++ G+NYH +GSL P  
Sbjct  311   TEDDEMSRYFRENIRVINIVFSFTSLGGKVDRSVQKGIGPQMFQLQGENYHLMGSLKPPE  370

Query  866   GSMTKLAQRDVNSR--DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
             G   K  +    +R  ++ + ++E L  MLD  N  V  FR AR    +NP     M++I
Sbjct  371   GEPKKYKKSAEKTRKEELMKKVIETLMAMLDECNPYVHQFRSARDRFDTNPDETFHMHII  430

Query  1040  GRRNKDG  1060
               R KDG
Sbjct  431   SSREKDG  437



>ref|XP_010696326.1| PREDICTED: uncharacterized protein LOC104908859 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 114/204 (56%), Gaps = 17/204 (8%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             + Y D GD    C +CGA  W  ER N+    G P +  CC +GK+QLP +K PP +L+ 
Sbjct  57    YGYSDLGDPTCVCEFCGAQMWFGERVNKRNKSGRPTFGMCCMQGKVQLPLLKRPPQLLED  116

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L    + +S HF++NIR YN M+ FTS+GGR+      G  P  + I GQN+H IGSL+P
Sbjct  117   LLKKRHSRSTHFLDNIRGYNMMYSFTSMGGRIIAPTTHGRGPYTYNIGGQNHHLIGSLLP  176

Query  860   GGGSMTKLAQ--------------RDVNSRD---IHENIVEELKNMLDGNNVLVKCFRMA  988
               G+  K +Q                 +S+D     + +V +LK+M+D +N L K FRMA
Sbjct  177   NDGARPKFSQLYIYDTEEKVQNRMSAASSKDPNKFEDRVVAQLKDMIDKHNPLAKSFRMA  236

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R   +SN    +K+ LIGRR+ DG
Sbjct  237   RDRFESNNGEDLKLRLIGRRDSDG  260



>ref|XP_010667882.1| PREDICTED: uncharacterized protein LOC104884879 [Beta vulgaris 
subsp. vulgaris]
Length=984

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 116/208 (56%), Gaps = 17/208 (8%)
 Frame = +2

Query  488   F*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPP  667
             F     Y D GD    C +CGA  W  ER N+    G PK+  CC +GK++LP +K PP 
Sbjct  4     FFIVEGYSDLGDPTCVCEFCGAQMWFGERVNKRNKNGRPKFGMCCMQGKVKLPLLKRPPQ  63

Query  668   VLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIG  847
             +L+ L    + +S HF++NIR YN M+ FTS+GGRV      G  P  ++I GQN+H IG
Sbjct  64    LLEDLLKKRHSRSTHFLDNIRGYNMMYSFTSMGGRVIAPTTHGRGPYTYKIGGQNHHLIG  123

Query  848   SLVPGGGSMTKLAQ--------------RDVNSRD---IHENIVEELKNMLDGNNVLVKC  976
             SL+P  G+  K +Q                V+S+D     + +V +LK+M+D +N L K 
Sbjct  124   SLLPNDGARPKFSQLYIYDTEDKVHNRKNAVSSKDPNKFEDRVVAQLKDMVDQHNPLAKS  183

Query  977   FRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              RMAR   +S+    +++ LIGRR+ DG
Sbjct  184   SRMARDRFESDNCEDLRLRLIGRRDSDG  211



>ref|XP_003637947.1| hypothetical protein MTR_114s0013 [Medicago truncatula]
 ref|XP_003638004.1| hypothetical protein MTR_116s0024 [Medicago truncatula]
Length=582

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 115/203 (57%), Gaps = 18/203 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             YLD G  +  C  C AL W  ER  ++     P+++ CC +G+I++   K PP  L  LY
Sbjct  150   YLDIGQPSIKCPNCKALMWYDERVCKSRHTSNPEFSMCCMQGRIEIAPFKRPPKALYDLY  209

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                + +S+ F+ NIR +N+MF FTS+GG ++++ N GN+P I+ ++G+NYH IGSL+P  
Sbjct  210   HKKDRKSKFFLENIRSFNSMFSFTSMGGNIDKTNNNGNAPPIYVLNGENYHRIGSLLPTP  269

Query  866   GSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ  +   D                  +   IVEELKNMLD +N   K +R+AR
Sbjct  270   GNSPKFAQLYIYDTDNELKNRMAAVGMEDDRDSLKSAIVEELKNMLDSSNSFAKSYRLAR  329

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
              ++  N    +K+ ++G+R  DG
Sbjct  330   DKLLQNNAPEIKLRILGKRGYDG  352



>emb|CDY44605.1| BnaA04g09850D [Brassica napus]
Length=512

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 112/209 (54%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  ++C +CGA+ W  ER N+     +P ++ CC +G++QLP +K PP VL+ L 
Sbjct  173   YTDEGDPKYTCTHCGAMMWYGERLNKRRNAKIPTFSLCCMQGQVQLPLLKEPPSVLKKLM  232

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+ +S+HF  N+R YN +F FTSLGG+V RS+  G  P +  + G+NYH +G L P  
Sbjct  233   EGDDSESKHFQKNMRPYNMIFSFTSLGGKVERSVQKGKGPPMLVLQGENYHLMGILTPNN  292

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
              S  K  Q        +V +R                 ++ ++I+E+L  MLD  N  VK
Sbjct  293   DSQAKFGQLYIADTENEVENRANCLSSGKSGFNSKKKDNLRKDIIEKLMKMLDEVNPYVK  352

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR AR      P  +  M ++  R+KDG
Sbjct  353   KFRTARDRFHIAPEDSFHMRIVSDRSKDG  381



>gb|ABA94634.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=1618

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 118/202 (58%), Gaps = 20/202 (10%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG    +C +CGALFW  ER+ +   +G P ++ CC +GK+ LP +K PP  L +L   
Sbjct  284   NFGKPTCTCQHCGALFWYEERT-RGKGKGPPSFSLCCKQGKVDLPTLKKPPTYLSNLMCK  342

Query  692   DN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             +  ++SR++++NIR YN+MF FTS+GG+V+R IN G+ P +FR++GQNYH IG+L+P  G
Sbjct  343   EKGKRSRNYMDNIRVYNSMFAFTSMGGKVDREINNGSGPYVFRMNGQNYHRIGTLLPEEG  402

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ  +                  N   I  +IV  LKNMLD  NVL + FRMAR 
Sbjct  403   DKPRWAQLYIYDTENEVKNRIDASTSSHNRESIDSHIVLGLKNMLDRENVLAQTFRMARD  462

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               +      V + LI +R  DG
Sbjct  463   RFKEGDYHNVSLRLIRKRGGDG  484



>ref|XP_003591245.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1517

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 123/204 (60%), Gaps = 19/204 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             SY DFG     C YCG+  W  ER+ ++    +P+++ CC EG I++     P P L  L
Sbjct  109   SYEDFGQPDCICKYCGSHMWYGERNQKHYKPFVPEFSMCCKEGSIKIAYPPLPEP-LADL  167

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y+ DN++S++F+ NIR +N+MF FTS+GG+++ S+N+GN+P  F ++G+NYH IGSL+P 
Sbjct  168   YYSDNKRSKYFMENIRSFNSMFAFTSMGGKIDSSMNSGNAPPTFVLNGENYHRIGSLLPM  227

Query  863   GGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
              G+  K AQ  V   D                  I  +IV +L+++LD  N  VK +R A
Sbjct  228   EGNGPKFAQLYVYDTDNEIKNRMAAVRMDDDNDTIKSSIVADLRDILDDVNSYVKQYRTA  287

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R  ++++    VK+ ++G+RN+DG
Sbjct  288   RDTLKASNAPTVKLRILGKRNRDG  311



>gb|ABA95236.1| AT hook motif-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=1682

 Score =   154 bits (388),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 118/202 (58%), Gaps = 20/202 (10%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG    +C +CGALFW  ER+ +   +G P ++ CC +GK+ LP +K PP  L +L   
Sbjct  284   NFGKPTCTCQHCGALFWYEERT-RGKGKGPPSFSLCCKQGKVDLPTLKKPPTYLSNLMCK  342

Query  692   DN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             +  ++SR++++NIR YN+MF FTS+GG+V+R IN G+ P +FR++GQNYH IG+L+P  G
Sbjct  343   EKGKRSRNYMDNIRVYNSMFAFTSMGGKVDREINNGSGPYVFRMNGQNYHRIGTLLPEEG  402

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ  +                  N   I  +IV  LKNMLD  NVL + FRMAR 
Sbjct  403   DKPRWAQLYIYDTENEVKNRIDASTSSHNRESIDSHIVLGLKNMLDRENVLAQTFRMARD  462

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               +      V + LI +R  DG
Sbjct  463   RFKEGDYHNVSLRLIRKRGGDG  484



>ref|XP_003599923.1| Helicase-like protein [Medicago truncatula]
Length=1026

 Score =   153 bits (386),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 123/204 (60%), Gaps = 19/204 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             SY DFG     C YCG+  W  ER+++     +P+++ CC EG I++     P P L  L
Sbjct  179   SYEDFGQPYCICKYCGSHMWYGERNHKQYKPIVPEFSMCCKEGSIKIAYPPLPEP-LADL  237

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y+ DN++S++F+ NIR +N+MF FTS+GG+++ S+N+GN+P  F ++G+NYH IGSL+P 
Sbjct  238   YYSDNKRSKYFMENIRSFNSMFAFTSMGGKIDSSMNSGNAPPTFVLNGENYHRIGSLLPM  297

Query  863   GGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
              G+  K AQ  V   D                  I  +IV +L+++LD  N  VK +R A
Sbjct  298   EGNGPKFAQLYVYDTDNEIKNRMAAVRMDDDNDTIKSSIVADLRDILDDVNSYVKQYRTA  357

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R  ++++    VK+ ++G+RN+DG
Sbjct  358   RDTLKASNAPTVKLRILGKRNRDG  381



>gb|EEC82986.1| hypothetical protein OsI_28021 [Oryza sativa Indica Group]
Length=937

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 113/203 (56%), Gaps = 18/203 (9%)
 Frame = +2

Query  500   HSYL-DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQ  676
             HS + +FG   + C +C AL W  ER N N +   P +  CC +GKI+LP +K PP  L+
Sbjct  87    HSQIWNFGKPTYICQHCNALLWYEERLNSNKSTTNPSFGMCCKQGKIKLPPLKEPPQYLK  146

Query  677   SLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
              L   + + S +F  NIR YN+MF FTS+GG V++ IN G  P +FR+ GQNYH IG+L+
Sbjct  147   RLLTGEGKDSTNFRENIRSYNSMFAFTSMGGIVDKEINMGKGPYVFRLHGQNYHHIGTLL  206

Query  857   PGGGSMTKLAQRDV-----------------NSRDIHENIVEELKNMLDGNNVLVKCFRM  985
             P  G+  + AQ  +                 +   +  +IV +L+NM+D NN+L K FRM
Sbjct  207   PEEGNKPRFAQLYIYDTENEVANRISVSGCSDKTPVDPSIVTDLQNMIDENNILAKSFRM  266

Query  986   ARTEIQSNPVVAVKMNLIGRRNK  1054
             AR   +      V + LI  R+K
Sbjct  267   ARDRFKEEDYHDVTLRLISDRDK  289



>ref|XP_007220327.1| hypothetical protein PRUPE_ppa018009m2g, partial [Prunus persica]
 gb|EMJ21526.1| hypothetical protein PRUPE_ppa018009m2g, partial [Prunus persica]
Length=567

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 112/190 (59%), Gaps = 3/190 (2%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y DFG+  H C YCGALFW  E   Q      P +T CC +GKI+L   K  P  L++
Sbjct  98    QEYADFGEKNHKCIYCGALFWLQESIKQRSKNNEPLFTLCCQQGKIKLQSPKPTPCFLEN  157

Query  680   LYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L   +  ++S  F  NIR YN+MF FTS+G ++++SIN G+SP +F+ISGQ +H +GSL+
Sbjct  158   LLDPNKGKKSVLFRENIRVYNSMFAFTSMGAKIDKSINNGSSPYVFKISGQVHHLMGSLL  217

Query  857   PGGGSMTKLAQRDV--NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKM  1030
             P  G   K +Q  +     ++ +NIV+ L  M D  N LVK FR  R + +   +  +K+
Sbjct  218   PPEGQCPKFSQLYIYDTHNELDQNIVDSLIQMFDQTNELVKLFRTIRDKFEKGSLPPLKI  277

Query  1031  NLIGRRNKDG  1060
              L+GR++ D 
Sbjct  278   TLLGRQSNDS  287



>gb|ABA94947.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=1682

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 118/202 (58%), Gaps = 20/202 (10%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG    +C +CGALFW  ER+ +   +G P ++ CC +GK+ LP +K PP  L +L   
Sbjct  284   NFGKPTCTCQHCGALFWYEERT-RGKGKGPPSFSLCCKQGKVDLPTLKKPPTYLSNLMCK  342

Query  692   DN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             +  ++SR++++NIR YN+MF FTS+GG+V+R IN G+ P +FR++GQNYH IG+L+P  G
Sbjct  343   EKGKRSRNYMDNIRVYNSMFAFTSMGGKVDREINNGSGPYVFRMNGQNYHRIGTLLPEEG  402

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ  +                  N   I  +IV  LKNMLD  NVL + FR+AR 
Sbjct  403   DKPRWAQLYIYDTENEVKNRIDASTSSHNRESIDSHIVLGLKNMLDRENVLAQTFRIARD  462

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               +      V + LI +R  DG
Sbjct  463   RFKEGDYHNVSLRLIRKRGGDG  484



>gb|AAV44035.1| putative helicase [Oryza sativa Japonica Group]
Length=1634

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 117/202 (58%), Gaps = 20/202 (10%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG    +C +CGALFW  ER+ +   +G P ++ CC +GK+ LP +K PP  L +L   
Sbjct  236   NFGKPTCTCQHCGALFWYEERT-RGKGKGPPSFSLCCKQGKVDLPTLKKPPTYLSNLMCK  294

Query  692   DN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             +  ++SR++++NIR YN+MF FTS+GG+V+R IN G+ P +FR++GQNYH I +L+P  G
Sbjct  295   EKGKRSRNYMDNIRVYNSMFAFTSMGGKVDREINNGSGPYVFRMNGQNYHRISTLLPEEG  354

Query  869   SMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                + AQ  +                  N   I  +IV  LKNMLD  NVL + FRMAR 
Sbjct  355   DKPRWAQLYIYDTENEVKNRIDASTSSHNRESIDSHIVLGLKNMLDRENVLAQTFRMARD  414

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
               +      V + LI +R  DG
Sbjct  415   RFKEGDYHNVSLRLIRKRGGDG  436



>ref|XP_008245897.1| PREDICTED: uncharacterized protein LOC103344046, partial [Prunus 
mume]
Length=336

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 113/206 (55%), Gaps = 19/206 (9%)
 Frame = +2

Query  497   FHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQ  676
                Y+D GD  + C YCGALFW  E   +      P +T CC +GKI+LP  K  PP L+
Sbjct  95    MEQYVDLGDKNYKCIYCGALFWFKESVKKANAANEPLFTLCCQQGKIKLPISKPTPPFLE  154

Query  677   SLYF-YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
             +L       +S  F  NIR YN+MF FTS+G +V+ SIN+G  P IF+ISGQ +H +GSL
Sbjct  155   NLLDPSKGPKSLLFRENIRAYNSMFAFTSMGAKVDHSINSGPGPYIFKISGQVHHLMGSL  214

Query  854   VPGGGSMTKLAQ--------------RDVNSRD----IHENIVEELKNMLDGNNVLVKCF  979
             +P  G   K AQ                VN ++    + E+IV+ L  M D +N LVK F
Sbjct  215   LPLEGECPKFAQLYIYDTHNETMNRLNAVNCKERNEKLDEDIVQGLIKMFDESNELVKLF  274

Query  980   RMARTEIQSNPVVAVKMNLIGRRNKD  1057
             R  R + +   + ++K+ L+GR+  D
Sbjct  275   RTVRDKFERGCLTSLKLRLLGRQADD  300



>ref|XP_008245910.1| PREDICTED: uncharacterized protein LOC103344060, partial [Prunus 
mume]
Length=336

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 113/206 (55%), Gaps = 19/206 (9%)
 Frame = +2

Query  497   FHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQ  676
                Y+D GD  + C YCGALFW  E   +      P +T CC +GKI+LP  K  PP L+
Sbjct  95    MEQYVDLGDKNYKCIYCGALFWFKESVKKANAANEPLFTLCCQQGKIKLPISKPTPPFLE  154

Query  677   SLYF-YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
             +L       +S  F  NIR YN+MF FTS+G +V+ SIN+G  P IF+ISGQ +H +GSL
Sbjct  155   NLLDPSKGPKSLLFRENIRAYNSMFAFTSMGAKVDHSINSGPGPYIFKISGQVHHLMGSL  214

Query  854   VPGGGSMTKLAQ--------------RDVNSRD----IHENIVEELKNMLDGNNVLVKCF  979
             +P  G   K AQ                VN ++    + E+IV+ L  M D +N LVK F
Sbjct  215   LPLEGECPKFAQLYIYDTHNETMNRLNAVNCKERNEKLDEDIVQGLIKMFDESNELVKLF  274

Query  980   RMARTEIQSNPVVAVKMNLIGRRNKD  1057
             R  R + +   + ++K+ L+GR+  D
Sbjct  275   RTVRDKFERGCLTSLKLRLLGRQADD  300



>emb|CDY00974.1| BnaC05g42260D [Brassica napus]
Length=940

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 113/210 (54%), Gaps = 24/210 (11%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             +Y+D GDA  +C YCGA+ W  ER N+ +    PK+  CC +G++QLP +K PP VLQ L
Sbjct  642   AYIDEGDATFTCTYCGAIMWFGERLNRRLKTRNPKFALCCMQGQVQLPLLKQPPEVLQIL  701

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                D++ S+HF  N R YN +F FTSLGG+V+R++  G  P++  + G+NYH IGSL P 
Sbjct  702   LNGDDKLSKHFQRNTRAYNMVFSFTSLGGKVDRAVRKGKGPNMLVLQGENYHLIGSLQPP  761

Query  863   GGSMTKLAQ-----------------------RDVNSRD-IHENIVEELKNMLDGNNVLV  970
              G+  K  Q                       +    RD + + I++ L  ML+  N  V
Sbjct  762   TGNDAKFGQLYIVDTENETENRTNALSKWGQTKAYKKRDRLKKEIIDLLIKMLNETNPYV  821

Query  971   KCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             K FR A+     NP  +  M ++  R KDG
Sbjct  822   KQFRSAKDRFNINPKDSFHMRIVSDRAKDG  851



>ref|XP_007043201.1| Uncharacterized protein TCM_007660 [Theobroma cacao]
 gb|EOX99032.1| Uncharacterized protein TCM_007660 [Theobroma cacao]
Length=596

 Score =   147 bits (371),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             L+ G   + C +CGA  W  ER N++     P++T CC EGK+ LP  K  P +L +L  
Sbjct  96    LNLGGPRYVCCFCGAQMWYEERKNKSRNERNPRFTMCCMEGKVSLPPFKQTPSLLATLLN  155

Query  689   YDNEQSRH-FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y   ++ + F +N R YN+MF FTS+GG+++  IN    P +F+I+GQN+H IGSL+P  
Sbjct  156   YKGGRTAYKFRHNKRVYNSMFQFTSIGGKIDSEINRRPGPYVFKINGQNHHKIGSLLPVD  215

Query  866   GSMTKLAQR------------------DVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K AQ                   DV    + ENIV+EL  MLD  N +VK FRMA+
Sbjct  216   GERPKFAQLYIYDTENEVSNRINALGYDVQQSGVEENIVKELMEMLDQTNQIVKAFRMAK  275

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
                +    + VK+ LIG R  DG
Sbjct  276   ERFKEPDYIPVKLRLIGARMNDG  298



>ref|XP_010671914.1| PREDICTED: uncharacterized protein LOC104888589 [Beta vulgaris 
subsp. vulgaris]
Length=1538

 Score =   150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 108/199 (54%), Gaps = 17/199 (9%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYD  694
             FG   H C  CGA  W  ER  +   +  PKY  CC +GK++LP +K PP  L+SL   +
Sbjct  116   FGGPKHFCLDCGARVWIEERVKRERAKDHPKYNICCQKGKVKLPLLKEPPEYLKSLLDPN  175

Query  695   NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSM  874
             +  S  F + IR YN++F FTS+GG V+R IN G  P IFRI GQNYH IGSL+P  G  
Sbjct  176   SGTSTKFKDCIRAYNSIFAFTSMGGEVDRKINRGRGPYIFRILGQNYHKIGSLLPPDGEQ  235

Query  875   TKLAQ-------RDVNSR----------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQ  1003
              +  Q        +V +R          D+   IVE L  MLD +N L K FRMA+    
Sbjct  236   PRFTQLYVHDPSNEVRNRISSLTNNAPGDLDPQIVEGLSRMLDEHNELAKVFRMAKERFS  295

Query  1004  SNPVVAVKMNLIGRRNKDG  1060
                +  V++ LI  R+KDG
Sbjct  296   GTDMQPVQVRLIATRSKDG  314



>emb|CDY68951.1| BnaAnng28900D, partial [Brassica napus]
Length=977

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 107/208 (51%), Gaps = 23/208 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GDA H C +CGA+ W  ER N+  +   PK++ CC  G++QLP +K  P +L+   
Sbjct  311   YIDEGDATHKCEHCGAIMWYGERINRKRSTRKPKFSLCCGHGQVQLPLLKESPAILKKFL  370

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+E SR+F  NIR  N +F FTSLGG+V+RS+  G  P +F++ G+NYH +GSL P  
Sbjct  371   TEDDEMSRYFRENIRVINMVFSFTSLGGKVDRSVKKGIGPQMFQLQGENYHLMGSLKPPN  430

Query  866   GSMT-----------------------KLAQRDVNSRDIHENIVEELKNMLDGNNVLVKC  976
             G                          K +       ++ + +++ L  MLD  N  V  
Sbjct  431   GEPKFGQLYIVDTENEIGNRSGIIGKYKKSTEKARKEELRKKVIQALTAMLDECNPYVHQ  490

Query  977   FRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             FR AR    +NP     M +I  R KDG
Sbjct  491   FRSARDRFDTNPDQTFHMRIISSREKDG  518



>emb|CDY26953.1| BnaC09g36300D [Brassica napus]
Length=726

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 112/209 (54%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  ++C+YCGA+ W +ER N+      P +  CC +G++QLP +K PP VL++L 
Sbjct  263   YKDEGDPTYTCSYCGAIMWYNERVNKRKNTRTPSFALCCLQGQVQLPLLKEPPEVLKNLL  322

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++  S+HF  N R YN +F FTSLGG+  RS+  G  P+ F++ G+NYH +GSL PG 
Sbjct  323   EGNDPLSKHFQRNCRPYNMVFSFTSLGGKCERSVQKGIGPNTFQLQGENYHLMGSLTPGD  382

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G   K  Q        ++ +R                 ++ + I+E L  MLD  N  VK
Sbjct  383   GKKAKFGQMYIVDTENEIENRANALSKPDQNFQPKKKDNLKKEIIELLMKMLDEVNPYVK  442

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR A+   +  P  A  M ++  R +DG
Sbjct  443   QFRSAKDRFKMQPENAYHMRIVSDRVRDG  471



>ref|XP_009344860.1| PREDICTED: uncharacterized protein LOC103936728 isoform X2 [Pyrus 
x bretschneideri]
Length=536

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 111/207 (54%), Gaps = 23/207 (11%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              Y D GD  + C +CGA FW  E         LP +T CC +GKI+ P  K  PP L   
Sbjct  58    EYADLGDKNYKCVHCGAYFWLKESLKPKCKNDLPVFTLCCQQGKIKFPNPKPAPPFLD--  115

Query  683   YFYD---NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
             Y  D    +++  F  NIR YN+MF FTS+G +V+ SIN G+SP IF+ISGQ  H +GSL
Sbjct  116   YLLDPTKGQKNLSFRENIRTYNSMFAFTSMGAKVDNSINNGSSPYIFKISGQVCHLMGSL  175

Query  854   VPGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCF  979
             +P      K AQ  V                  N++ +   IVE L  M D +N LVK F
Sbjct  176   LPVDNESPKFAQLYVYDTYNEVENRLKVFNSNGNNQRLDPTIVEGLIKMFDASNELVKLF  235

Query  980   RMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             RMAR + +++ + ++KM L+GR+  D 
Sbjct  236   RMARDKFENDGLSSLKMTLLGRQLNDS  262



>ref|XP_009344859.1| PREDICTED: uncharacterized protein LOC103936728 isoform X1 [Pyrus 
x bretschneideri]
Length=569

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 111/207 (54%), Gaps = 23/207 (11%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              Y D GD  + C +CGA FW  E         LP +T CC +GKI+ P  K  PP L   
Sbjct  58    EYADLGDKNYKCVHCGAYFWLKESLKPKCKNDLPVFTLCCQQGKIKFPNPKPAPPFLD--  115

Query  683   YFYD---NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
             Y  D    +++  F  NIR YN+MF FTS+G +V+ SIN G+SP IF+ISGQ  H +GSL
Sbjct  116   YLLDPTKGQKNLSFRENIRTYNSMFAFTSMGAKVDNSINNGSSPYIFKISGQVCHLMGSL  175

Query  854   VPGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCF  979
             +P      K AQ  V                  N++ +   IVE L  M D +N LVK F
Sbjct  176   LPVDNESPKFAQLYVYDTYNEVENRLKVFNSNGNNQRLDPTIVEGLIKMFDASNELVKLF  235

Query  980   RMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             RMAR + +++ + ++KM L+GR+  D 
Sbjct  236   RMARDKFENDGLSSLKMTLLGRQLNDS  262



>emb|CDY22508.1| BnaC03g23180D [Brassica napus]
Length=706

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 116/210 (55%), Gaps = 24/210 (11%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              YLD GD  + C++CGA+ W  ER N++     P ++ CC +G++QLP +K PP +L+ L
Sbjct  165   EYLDDGDPDYKCSHCGAIMWYGERLNKHRNAKNPTFSLCCIQGQVQLPLLKEPPTILKKL  224

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                D+ +SRHF  +IR YN +F FTSLGG+V R++  G  P +F++ G+NYH I +L P 
Sbjct  225   LEGDDPRSRHFQKHIRPYNMVFSFTSLGGKVQRTLKKGKGPDMFQLQGENYHLIRNLTPP  284

Query  863   GGSMTKL-------AQRDVNSR-----------------DIHENIVEELKNMLDGNNVLV  970
              GS  K         + +V +R                 ++ ++I++ L  ML+  N  V
Sbjct  285   EGSEAKFGHLYIVDTENEVENRAKCLSSGKQKIQVKKKDNLRKDIIDALMRMLNEVNPYV  344

Query  971   KCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             K FR AR    ++P  +  M ++  R KDG
Sbjct  345   KKFRSARDRFNTDPEDSFHMRIVSERLKDG  374



>ref|XP_007031497.1| PIF1 helicase, putative [Theobroma cacao]
 gb|EOY02423.1| PIF1 helicase, putative [Theobroma cacao]
Length=1873

 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             L+ G   + C +C A  W  ER N++     P++T CC EGK+ LP  K  P +L +L  
Sbjct  179   LNLGGPRYVCCFCSAQMWYEERKNKSRNERNPRFTMCCMEGKVSLPPFKQTPSLLATLLN  238

Query  689   YDNEQSRH-FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y   ++ + F +NIR YN+MF FTS+GG+++  IN    P +F+I+GQN+H IGSL+P  
Sbjct  239   YKGGRTAYKFRHNIRVYNSMFQFTSIGGKIDSEINRRPGPYVFKINGQNHHKIGSLLPVD  298

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K AQ                   DV    + ENIV+EL  MLD  N +VK FRMA+
Sbjct  299   GERPKFAQLYIYDTENEVSNRINALGYDVQQSGVEENIVKELMEMLDQTNQIVKAFRMAK  358

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
                +    + VK+ LIG R  DG
Sbjct  359   ERFKEPDYIPVKLRLIGARMNDG  381



>ref|XP_007033578.1| Uncharacterized protein TCM_019749 [Theobroma cacao]
 gb|EOY04504.1| Uncharacterized protein TCM_019749 [Theobroma cacao]
Length=870

 Score =   146 bits (369),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             L+ G   + C + GA  W  ER N++     P++T CC EGK+ LP  K  P +L +L  
Sbjct  179   LNLGGPRYVCCFYGAQMWYEERKNKSRNERNPRFTMCCMEGKVSLPPFKQTPSLLATLLN  238

Query  689   YDNEQSRH-FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y   ++ + F +NIR YN+MF FTS+GG+++  IN    P +F+I+GQN+H IGSL+P  
Sbjct  239   YKGGRTAYKFRHNIRVYNSMFQFTSIGGKIDSEINRRPGPYVFKINGQNHHKIGSLLPVD  298

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K AQ                   DV    + ENIV+EL  MLD  N +VK FRMA+
Sbjct  299   GERPKFAQLYIYDTENEVSNRINALGYDVQQSGVEENIVKELMEMLDQTNQIVKAFRMAK  358

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
                +    + VK+ LIG R  DG
Sbjct  359   ERFKEPDYIPVKLRLIGARMNDG  381



>ref|XP_003626025.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1589

 Score =   147 bits (371),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             SY   G+   +C +CGAL W  ER N+      P+++ CC +G+I++   K  P  L  L
Sbjct  180   SYFQIGEPRFTCEWCGALMWYEERVNKQRDTSNPEFSMCCMQGRIEIAPFKRLPQPLYDL  239

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y  ++ +S+ F+ NIR +N+MF FTS+GG ++ + N G +P +F ++G+NYH IGSL+P 
Sbjct  240   YHNNDRKSKFFLENIRSFNSMFAFTSMGGTIDTTRNNGKAPPVFVLNGENYHRIGSLLPK  299

Query  863   GGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
              G   K AQ  +   D                  + +++VEE++++LD +N  V+ +RM 
Sbjct  300   DGDQPKFAQLYIYDTDNELRNRMSCVSMEDDKNSLKKDLVEEIRHILDRSNSYVQSYRMV  359

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R ++  N    +K+ ++G+R  DG
Sbjct  360   RDKLLENNAPTIKLRILGKRGYDG  383



>emb|CDY67437.1| BnaCnng54980D [Brassica napus]
Length=961

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 112/204 (55%), Gaps = 19/204 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C  CGALFW +ER +++     P +T CC  GK+QLP++K PP +L+ L 
Sbjct  379   YKDDGDLTRQCLKCGALFWYNERVSKSRNARTPVFTMCCMRGKVQLPQLKEPPELLRRLL  438

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+  S+HF +NIR  N MF FTSLGG+++ SIN G  P +F++ G+NYH IGSL P  
Sbjct  439   TNDDSMSKHFRDNIRPINMMFSFTSLGGKIDNSINKGQGPKVFKLHGENYHLIGSLKPPP  498

Query  866   GSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMAR  991
                 K +Q  ++  +                  I E++VE + NML  +NV VK FR A 
Sbjct  499   DHPAKFSQLYIHDTENEVQNRIAALSGNSEKSKIREDLVEAIMNMLRISNVHVKTFRNAM  558

Query  992   TEIQS-NPVVAVKMNLIGRRNKDG  1060
                 + +    + + LI  R KDG
Sbjct  559   DRFNAEDECQELSLVLIHNRLKDG  582



>emb|CDY70555.1| BnaCnng68840D, partial [Brassica napus]
Length=564

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 107/206 (52%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD  + C  CGALFW +ER  +      P +T CC  GKI+LP +K PP  L  
Sbjct  250   EEYKDDGDLENECPKCGALFWFNERIGKTRKTRKPTFTMCCLNGKIKLPLLKEPPEYLMG  309

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  S+HF +NIR  N MF FTSLGG+++ S N G  P IF++ G+NYH IGS+ P
Sbjct  310   LLTKDDVISKHFRDNIRPLNMMFSFTSLGGKIDNSTNRGRGPKIFKLHGENYHLIGSVKP  369

Query  860   GGGSMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRM  985
               G   K +Q        +V +R            I  ++VE + NML G NV VK FR 
Sbjct  370   KPGETAKFSQLYIHDTENEVQNRLSALSGNSERSKIRPDLVESIMNMLRGCNVHVKTFRN  429

Query  986   ARTEI-QSNPVVAVKMNLIGRRNKDG  1060
             A       +    V + LI  R KDG
Sbjct  430   AMDRFNNESECQDVSLVLINDRQKDG  455



>ref|XP_008358546.1| PREDICTED: uncharacterized protein LOC103422277 isoform X2 [Malus 
domestica]
Length=528

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 112/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD ++ C +CGA FW  E   Q+  +  P +T CC +GKI  P  K  P  L  
Sbjct  60    KDYADLGDKSYKCVFCGAYFWLKESLKQSRKKNQPIFTVCCQQGKIIFPAPKPTPTFLNC  119

Query  680   LYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L   +  Q S  F  NIR YN+MF FTS+G +++ SIN G+SP IF+ISGQ  H +GSL+
Sbjct  120   LLDPNGRQKSLSFRKNIRAYNSMFSFTSMGAKIDHSINDGSSPYIFKISGQVCHLMGSLL  179

Query  857   PGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFR  982
             P      K AQ  V                  N+R++  +IV+EL  + D  N LVK FR
Sbjct  180   PTDNEPPKFAQLYVYDTYNEVQNRLRAFNSQGNNRNLDSSIVQELIKIFDECNQLVKFFR  239

Query  983   MARTEIQSNPVVAVKMNLIGRRNKDG  1060
              AR + +++ ++ + M L+GR+ +D 
Sbjct  240   TARDKFETDGLINLTMTLLGRQPRDS  265



>gb|ABD65117.1| hypothetical protein 31.t00030 [Brassica oleracea]
Length=1471

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 112/206 (54%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD    C  CGALFW +ER +++     P +T CC  GK+QLP++K PP +L+ 
Sbjct  87    EDYKDDGDLTRQCLKCGALFWYNERVSKSRNARTPVFTMCCMRGKVQLPQLKEPPELLRR  146

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  S+HF +NIR  N MF FTSLGG+++ SIN G  P +F++ G+NYH IGSL P
Sbjct  147   LLTNDDSMSKHFRDNIRPINMMFSFTSLGGKIDNSINKGQGPKVFKLHGENYHLIGSLKP  206

Query  860   GGGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRM  985
                   K +Q  ++  +                  I E++VE + NML  +NV VK FR 
Sbjct  207   PPDHPAKFSQLYIHDTENEVQNRIAALSGNSEKSKIREDLVEAIMNMLRISNVHVKTFRN  266

Query  986   ARTEIQS-NPVVAVKMNLIGRRNKDG  1060
             A     + +    + + LI  R KDG
Sbjct  267   AMDRFNAEDECQELSLVLIHNRLKDG  292



>ref|XP_003636005.1| Helicase-like protein [Medicago truncatula]
Length=1844

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 107/201 (53%), Gaps = 16/201 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C  CGAL W  ER +++    +PK+  CC  GK++LP ++ PP +LQ L 
Sbjct  438   YSDIGDPIWECQMCGALMWYQERKDKSRHSTVPKFQLCCGGGKVKLPLLEQPPQLLQDLL  497

Query  686   FYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             F +    +++F  NIR YN MF FTS G +++  IN G  P   R+ GQ  H +GSL+P 
Sbjct  498   FGNQSPATKNFQTNIRTYNAMFSFTSPGMKMDTKINNGKGPPTLRMQGQTCHRVGSLLPL  557

Query  863   GGSMTKLAQRDV---------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTE  997
              G   K AQ  +                ++DI E IV++LK MLD NNV  K FRMAR  
Sbjct  558   PGDSPKYAQLYIFDTDNEISNRMNSFRTNKDIDEEIVKKLKLMLDQNNVHAKVFRMARDM  617

Query  998   IQSNPVVAVKMNLIGRRNKDG  1060
             +       VK+ LI  R  DG
Sbjct  618   LNDVNFQDVKLKLIADRKTDG  638



>ref|XP_008358542.1| PREDICTED: uncharacterized protein LOC103422277 isoform X1 [Malus 
domestica]
 ref|XP_008358543.1| PREDICTED: uncharacterized protein LOC103422277 isoform X1 [Malus 
domestica]
 ref|XP_008358544.1| PREDICTED: uncharacterized protein LOC103422277 isoform X1 [Malus 
domestica]
 ref|XP_008358545.1| PREDICTED: uncharacterized protein LOC103422277 isoform X1 [Malus 
domestica]
Length=572

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 112/204 (55%), Gaps = 19/204 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD ++ C +CGA FW  E   Q+  +  P +T CC +GKI  P  K  P  L  L 
Sbjct  106   YADLGDKSYKCVFCGAYFWLKESLKQSRKKNQPIFTVCCQQGKIIFPAPKPTPTFLNCLL  165

Query  686   FYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               +  Q S  F  NIR YN+MF FTS+G +++ SIN G+SP IF+ISGQ  H +GSL+P 
Sbjct  166   DPNGRQKSLSFRKNIRAYNSMFSFTSMGAKIDHSINDGSSPYIFKISGQVCHLMGSLLPT  225

Query  863   GGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
                  K AQ  V                  N+R++  +IV+EL  + D  N LVK FR A
Sbjct  226   DNEPPKFAQLYVYDTYNEVQNRLRAFNSQGNNRNLDSSIVQELIKIFDECNQLVKFFRTA  285

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R + +++ ++ + M L+GR+ +D 
Sbjct  286   RDKFETDGLINLTMTLLGRQPRDS  309



>ref|XP_008229188.1| PREDICTED: uncharacterized protein LOC103328570 [Prunus mume]
Length=458

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 112/205 (55%), Gaps = 19/205 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y DFGD  + C YCGALFW  E   Q +    P +T CC +GKI+L   K  P  L++
Sbjct  109   QGYADFGDKNYKCIYCGALFWLKESIKQKLKNNKPLFTLCCQQGKIKLQMPKPTPFFLEN  168

Query  680   LYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L   +   +S  F  NIR YN+MF FTS+G +V++SIN G+SP IF+ISGQ +H +GSL+
Sbjct  169   LLDPNKGHKSVLFRENIRVYNSMFAFTSMGAKVDQSINNGSSPYIFKISGQVHHLMGSLL  228

Query  857   PGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K AQ  +                   +  + ++IV+ L  M D +N LVK FR
Sbjct  229   PPEGQSPKFAQLYIYDTHNEVMNRLDAVNCNQKNEKLDQSIVQGLIQMFDESNELVKNFR  288

Query  983   MARTEIQSNPVVAVKMNLIGRRNKD  1057
               R + +   +  +K+ L+GR+  D
Sbjct  289   TVRDKFEEGSLAPLKITLLGRQPND  313



>ref|XP_003598094.1| Helicase-like protein [Medicago truncatula]
Length=1672

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              YL+ G     C +C AL W  ER  ++     P++T CC +G+I++  +K  P  L  L
Sbjct  290   EYLECGQLLFKCPFCKALMWYDERVRKSRNTTKPEFTMCCMQGRIEIAPLKKLPKPLYDL  349

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y  ++ +S++F+ NIR +N+MF FTS+GG ++++ N G +P +F ++G+NYH IGSL+P 
Sbjct  350   YHKNDRKSKYFMENIRSFNSMFAFTSMGGNIDKTKNDGKAPPVFVLNGENYHQIGSLLPK  409

Query  863   GGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
              G   K AQ  +   D                  + + IVEE++++LD +N  VK +R+ 
Sbjct  410   PGHQPKFAQLYIYDTDNELKNRMDVVRMEDDKNSMKQKIVEEIRDVLDSSNSYVKSYRLV  469

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R  +  N   ++++ ++G+R  DG
Sbjct  470   RETLLKNQAPSIQLRILGKRGYDG  493



>ref|XP_009767708.1| PREDICTED: uncharacterized protein LOC104218829, partial [Nicotiana 
sylvestris]
Length=687

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 101/181 (56%), Gaps = 13/181 (7%)
 Frame = +2

Query  518   GDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDN  697
             GDA + C YCGA FW  ER ++      P +T CC  GKI+LP  K PP +L+ L F   
Sbjct  154   GDANYECEYCGAYFWFEERVDKKYKNKKPVFTLCCGRGKIKLPNPKEPPSILKDLLFGSG  213

Query  698   EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMT  877
              +S+HF  NIR YN++F FTS+GG+V+ S+N    P  FR+SGQNY+ IGSL+P  GS  
Sbjct  214   AKSKHFRENIRTYNSIFSFTSMGGKVDVSVNKTKGPRTFRLSGQNYYQIGSLLPPEGSSP  273

Query  878   KLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
             K  Q  +      EN V          N  +   R+ R + Q +    V++ LIG+R  D
Sbjct  274   KFTQLYIYDT---ENEV----------NNRINAIRIIRDQFQEDRTSNVRLRLIGKRCSD  320

Query  1058  G  1060
             G
Sbjct  321   G  321



>emb|CDY26545.1| BnaA09g47320D [Brassica napus]
Length=781

 Score =   143 bits (361),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (55%), Gaps = 24/207 (12%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             + YLD GD  + C++CGA+ W  ER N+      P ++ CC +G++QLP +K PP VL+ 
Sbjct  407   NEYLDEGDPDYKCSHCGAIMWYGERLNKRRNAKNPVFSLCCMQGQVQLPLLKEPPTVLKK  466

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+ +SRHF  +IR YN +F FTSLGG+V R++  G  P +F++ G+NYH +G+L P
Sbjct  467   LLEGDDPRSRHFQKHIRPYNMVFSFTSLGGKVVRALKKGIGPDMFQLQGENYHLLGNLTP  526

Query  860   GGGSMTKLAQR-----------------------DVNSRD-IHENIVEELKNMLDGNNVL  967
               GS  K  Q                         VN +D + ++I+E L  ML+  N  
Sbjct  527   PDGSEAKFGQLYIVDTENEVENRAKSISSGKQKFQVNKKDNLRKDIIEVLMKMLNEVNPY  586

Query  968   VKCFRMARTEIQSNPVVAVKMNLIGRR  1048
             V+ FR AR    ++P  +  M ++  R
Sbjct  587   VQKFRSARDRFDTDPDDSFHMRIVSER  613



>emb|CDY67163.1| BnaUnng01960D [Brassica napus]
Length=706

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 106/206 (51%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD  + C  CGALFW +ER  +      P +T CC  GKI+LP +K PP  L  
Sbjct  250   EEYKDDGDLENECPKCGALFWFNERIGKTRKTRKPTFTMCCLNGKIKLPLLKEPPEYLMG  309

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  S+HF +NIR  N MF FTSLGG+++ S N G  P IF++ G+NYH IGS+ P
Sbjct  310   LLTKDDVISKHFRDNIRPLNMMFSFTSLGGKIDNSTNRGRGPKIFKLHGENYHLIGSVKP  369

Query  860   GGGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRM  985
               G   K +Q  ++  +                  I  ++VE + NML G NV VK FR 
Sbjct  370   KPGETAKFSQLYIHDTENKVQNRLSALSGNSERSKIRPDLVESIMNMLRGCNVHVKTFRN  429

Query  986   ARTEI-QSNPVVAVKMNLIGRRNKDG  1060
             A       +    V + LI  R KDG
Sbjct  430   AMDRFNNESECQDVSLVLINDRQKDG  455



>emb|CDX95312.1| BnaC04g28460D [Brassica napus]
Length=581

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (52%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  ++C+YCG + W +ER N+      P +  CC +G++QLP +K PP VL+ L 
Sbjct  232   YNDEGDPTYTCSYCGTIMWYNERVNKRKNTRTPSFALCCLQGQVQLPLLKEPPEVLKKLL  291

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++  SRHF  N R YN +F FTSLGG+  RS+  G  P+ F++ G+NYH +GSL PG 
Sbjct  292   EGNDHLSRHFQRNSRPYNMVFSFTSLGGKCERSVQKGIGPNTFQLQGENYHLMGSLTPGN  351

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G      Q        ++ +R                 ++ + I+E L  MLD  N  VK
Sbjct  352   GKKANFGQMYIVDTENEIENRANVLSKPGQTFQPKKKDNLKKEIIELLMKMLDEVNPYVK  411

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR A+   +  P  A  M ++  +  DG
Sbjct  412   QFRSAKDRFKMQPENAYHMRIVSDQVTDG  440



>emb|CDX71251.1| BnaC07g05300D [Brassica napus]
Length=1060

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 107/208 (51%), Gaps = 19/208 (9%)
 Frame = +2

Query  494   TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
             T   Y D GD  + C  CGALFW +ER  +      P +T CC  GKI+LP +K PPP L
Sbjct  294   TEAEYKDDGDLTNECPICGALFWYNERIGKKRKTKNPIFTMCCMRGKIKLPLLKEPPPFL  353

Query  674   QSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
               L   D+  S+HF +NIR  N MF FTSLGG+++ SIN GN P IFR+ G+NYH IGS+
Sbjct  354   IDLLTKDDAISKHFRDNIRPLNMMFSFTSLGGKIDNSINRGNGPKIFRLHGENYHLIGSM  413

Query  854   VPGGGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCF  979
              P      K +Q  ++  +                  I  ++ + +  ML   NV VK F
Sbjct  414   KPDANETAKFSQLYIHDTENEVENRLCALSGNGERTKIRADLEQSIMEMLRECNVHVKTF  473

Query  980   RMARTEIQS-NPVVAVKMNLIGRRNKDG  1060
             R A     S +    + + LI  R KDG
Sbjct  474   RNAMDRFNSEDECEDLSLVLINSREKDG  501



>ref|XP_003590244.1| hypothetical protein MTR_1g050500 [Medicago truncatula]
Length=1015

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 107/170 (63%), Gaps = 1/170 (1%)
 Frame = +2

Query  551   ALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIR  730
              LF   ER+ ++V    PK +  C +G I LP M  PPP++++L+   + +SRHF++NIR
Sbjct  663   GLFRDGERARKDVVTTTPKTSLGCMQGNITLPFMTEPPPLMRNLFSGTDAKSRHFLSNIR  722

Query  731   RYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRD  910
              YNNMF FTSLGGRV+   N G+ P  F ISGQ YH IGSLVP  G   K AQ +++  +
Sbjct  723   SYNNMFAFTSLGGRVDTGRNDGHGPPQFIISGQKYHRIGSLVPEEGQTPKFAQFELSDGN  782

Query  911   -IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
              +  ++V++L  ++D  N+LVK FRM R   ++N  V VK+ L   RN D
Sbjct  783   GLDRSLVQDLMKLMDECNLLVKKFRMVRDFREANVDVPVKLRLFRNRNFD  832



>ref|XP_003590268.1| ATP-dependent helicase, putative [Medicago truncatula]
Length=1790

 Score =   142 bits (358),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (63%), Gaps = 1/171 (1%)
 Frame = +2

Query  551   ALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIR  730
              LF   ER+ ++V    PK +  C +G I LP M  PPP++++L+   + +SRHF++NIR
Sbjct  663   GLFRDGERARKDVVTTTPKTSLGCMQGNITLPFMTEPPPLMRNLFSGTDAKSRHFLSNIR  722

Query  731   RYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRD  910
              YNNMF FTSLGGRV+   N G+ P  F ISGQ YH IGSLVP  G   K AQ +++  +
Sbjct  723   SYNNMFAFTSLGGRVDTGRNDGHGPPQFIISGQKYHRIGSLVPEEGQTPKFAQFELSDGN  782

Query  911   -IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              +  ++V++L  ++D  N+LVK FRM R   ++N  V VK+ L   RN D 
Sbjct  783   GLDRSLVQDLMKLMDECNLLVKKFRMVRDFREANVDVPVKLRLFRNRNFDS  833



>ref|XP_010474066.1| PREDICTED: uncharacterized protein LOC104753520 [Camelina sativa]
Length=743

 Score =   140 bits (353),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 110/204 (54%), Gaps = 19/204 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y + GD ++ C  CGA  W  ER N+   +  P Y  CC +GK++LP++K PP  L +L 
Sbjct  361   YYEDGDPSYICEDCGAYMWYGERLNKRRKKAKPIYLMCCGKGKVKLPKLKTPPNTLSALL  420

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             + D+++S++F +NIR YN MF FTSL G++N SIN G  P +F++ G+NYH IG ++P  
Sbjct  421   YNDDDRSKNFRDNIRAYNMMFSFTSLDGKINHSINNGRGPYVFQMCGENYHRIGDILPEP  480

Query  866   GSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMAR  991
             G      Q  ++  D                  I + IV  LK MLD +N  V+ FR AR
Sbjct  481   GEKPTFLQLYIHDVDNEVPNRIAAFGPSGATEKIMQTIVVLLKRMLDNHNPHVQAFRSAR  540

Query  992   TEIQ-SNPVVAVKMNLIGRRNKDG  1060
                  +N    +++ +   RN D 
Sbjct  541   ERFDLTNNAANLRLRIPAERNADA  564



>ref|XP_008357575.1| PREDICTED: uncharacterized protein LOC103421325 [Malus domestica]
Length=535

 Score =   138 bits (347),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 112/205 (55%), Gaps = 19/205 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y+D GD  + C YCGA FW  E   Q      P Y+ CC +GK++LPR    P  L++
Sbjct  77    QKYVDLGDKNYKCIYCGAFFWIKESLKQKSKNNEPLYSLCCQQGKVKLPRPLPTPHFLEN  136

Query  680   LYFYDNEQSRH-FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L      Q    F  NIR YN+MF FTSLG +V+ ++N  + P IF+ISGQ +H +GSL+
Sbjct  137   LLDPTKGQKXLLFRENIRAYNSMFAFTSLGAKVDHTVNNQSGPYIFKISGQVHHLMGSLL  196

Query  857   PGGGSMTKLAQ--------------RDVNSRD----IHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K AQ                VN ++    + ENIVE L NM +  N LV+ FR
Sbjct  197   PPDGECPKFAQLYVYDTANEIGNRLNAVNCKERNMKLDENIVEGLINMFNEXNELVQMFR  256

Query  983   MARTEIQSNPVVAVKMNLIGRRNKD  1057
               R + ++N + ++K++++GR+  D
Sbjct  257   TIRDKFENNSLPSLKISILGRQLND  281



>ref|XP_009138614.1| PREDICTED: uncharacterized protein LOC103862690 [Brassica rapa]
Length=1781

 Score =   141 bits (356),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 112/207 (54%), Gaps = 25/207 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  + C  CGALFW +ER ++N     P +T CC  GK++LP +K PP  LQ+L 
Sbjct  346   YKDDGDIENECPVCGALFWLNERISRNRKTKTPVFTMCCMRGKVKLPLLKEPPEFLQALL  405

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++  S+HF +NIR  N MF FTSLGG+++ S+N G  P +F++ G+NYH IG++ P  
Sbjct  406   TNEDVISKHFRDNIRPLNMMFSFTSLGGKIDNSVNRGKGPKVFKLHGENYHLIGNMKPKA  465

Query  866   GSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMAR  991
                 K +Q  ++  +                  I E+++E +  ML   NV VK FR A 
Sbjct  466   NEKAKFSQLYIHDTENEVQNRISALSGNSERSKIREDLLESIMKMLRECNVHVKTFRNAM  525

Query  992   T----EIQSNPVVAVKMNLIGRRNKDG  1060
                  E++S  +  V   LI  R KDG
Sbjct  526   ERFNDEVESQDLSLV---LIHNRQKDG  549



>gb|ABA96519.2| hypothetical protein LOC_Os12g06230 [Oryza sativa Japonica Group]
Length=2279

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 111/202 (55%), Gaps = 21/202 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G  +H C YCGA+FW  ER  +       K  Y  CC  GKI LP +K+PP  L  L  
Sbjct  284   YGGPSHECPYCGAIFWYQERVKKGSVLSQRKIIYNLCCRSGKINLPELKDPPTYLAKLLK  343

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             YD + +S+ F+  IR YN++F FTSLG  V++SIN G++P +F+I+G  +H IG L+P  
Sbjct  344   YDGDARSKRFLRQIRSYNSLFAFTSLGASVDKSINNGSAPCVFKINGVVHHRIGGLLPQR  403

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ                  +D  S +    IV  L +MLD +N LVK FR AR
Sbjct  404   GAPPKFAQLYIYDTENEIKNRMDIFEKDKPSDEPDPKIVAGLTSMLDEHNELVKAFRFAR  463

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               +Q++    V + L+G  ++D
Sbjct  464   DRLQAHGDHKVALRLLGCDSRD  485



>emb|CDY13952.1| BnaC09g38740D [Brassica napus]
Length=322

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            YLD GD  + C +CGA+ W  ER N+      P ++ CC +G++QLP +K PP VL+ L 
Sbjct  162  YLDEGDPDYKCGHCGAIMWYGERLNKRRNAKKPTFSLCCMQGQVQLPLLKEPPSVLKKLL  221

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D  +SRHF  +IR YN +F FTSLGGRV RS+  G  P +F++ G+NYH +G+L P  
Sbjct  222  EGDEPRSRHFQKHIRPYNMVFSFTSLGGRVERSLKKGRGPDMFQLQGENYHLLGNLTPPD  281

Query  866  GSMTKLAQ  889
            GS  K  Q
Sbjct  282  GSDPKFGQ  289



>emb|CAD40309.2| OSJNBb0013O03.4 [Oryza sativa Japonica Group]
Length=2052

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   H C YCGA+FW  ER  ++  V++    Y  CC  G+I LP +K+PP  L  L  
Sbjct  221   YGGPTHECPYCGAVFWYQERVKKSSLVSKRKVVYNLCCKGGRIDLPELKHPPSFLAKLLK  280

Query  689   YD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + +S+ F+  IR YN++F FTSLG  ++RSINTG+SP +F+I+G  +H IGSL+P  
Sbjct  281   FDGDARSKRFLRQIRSYNSLFAFTSLGADIDRSINTGSSPCVFKINGVVHHRIGSLLPKH  340

Query  866   GSMTKLAQRDVNSRD-------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
             G+  K AQ  +   D                     + IVE+L +MLD +N LVK FR A
Sbjct  341   GAPPKFAQLYIYDTDNETTNRMNIFDKESSSDGPPDKQIVEKLGSMLDEHNELVKSFRYA  400

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             +  ++ +      + L+G   KD
Sbjct  401   KERLEEHGYQDTALRLMGCNAKD  423



>ref|XP_009145287.1| PREDICTED: uncharacterized protein LOC103868995 [Brassica rapa]
Length=1598

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 109/206 (53%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D G+  + C  CGALFW +ER  ++     P +T CC  GKI+LP +K PP  L  
Sbjct  143   EEYNDDGELENECPRCGALFWYNERIGRSRKTKTPIFTMCCLRGKIKLPVLKEPPAYLHG  202

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  SRHF +NIR  N MF FTSLGG+++ SINTG  P IF++ G+NYH IGS+ P
Sbjct  203   LLTNDDGLSRHFRDNIRAINMMFSFTSLGGKIDNSINTGQGPKIFKLHGENYHLIGSVKP  262

Query  860   GGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRM  985
                   K +       Q +V +R            +  ++VE +  ML  +NV V+ FR 
Sbjct  263   NPNEAAKFSQLYIHDTQNEVQNRISALSGSADKSKLRADLVESIMQMLRDSNVHVQTFRN  322

Query  986   ARTEI-QSNPVVAVKMNLIGRRNKDG  1060
             A       +    VK+ LI  R KDG
Sbjct  323   AMDRFNDESECEDVKLVLIHNRQKDG  348



>emb|CDY65832.1| BnaC02g48150D [Brassica napus]
Length=498

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 101/205 (49%), Gaps = 23/205 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GDA H C +CGA+ W  ER N+      PK++ CC  G++QLP +K  P +L+   
Sbjct  294   YIDEGDATHKCEHCGAIMWYGERINRKRYARKPKFSMCCGHGQVQLPLLKESPAILKRFL  353

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+E SR+F  NIR  N +F FTSLGG+V+RS+     P +F++ G+NYH +GSL P  
Sbjct  354   TEDDEMSRYFRENIRVINMVFSFTSLGGKVDRSVKKRIGPQMFQLQGENYHLMGSLKPPN  413

Query  866   GSMT-----------------------KLAQRDVNSRDIHENIVEELKNMLDGNNVLVKC  976
             G                          K +       ++ + ++  L  MLD  N  V  
Sbjct  414   GEPKFGQLYIVDTENEIVNRSGILGKYKKSTEKARKEELRKKVIHALMAMLDECNPYVHQ  473

Query  977   FRMARTEIQSNPVVAVKMNLIGRRN  1051
             FR AR    +NP     M +I  R 
Sbjct  474   FRSARDRFDTNPDQTFHMRIISSRE  498



>ref|XP_008342274.1| PREDICTED: uncharacterized protein LOC103405083 [Malus domestica]
 ref|XP_008342275.1| PREDICTED: uncharacterized protein LOC103405083 [Malus domestica]
Length=792

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 110/205 (54%), Gaps = 19/205 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y+D GD  + C YCGALFW  E   Q      P Y+ CC +GK++LPR    P  L++
Sbjct  113   QKYVDLGDKKYKCIYCGALFWXKESLKQKSKNNEPLYSLCCQQGKVKLPRPMLTPHFLEN  172

Query  680   LYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L      Q S  F  NIR YN+MF FTS+G +V+ ++N    P IF+ISGQ +H +GSL+
Sbjct  173   LLDPTKGQTSLLFRENIRAYNSMFAFTSMGAKVDHTVNNQLGPYIFKISGQVHHLMGSLL  232

Query  857   PGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K AQ  V                   +  + ENIV+ L NM + +N LV+ FR
Sbjct  233   PPDGECPKFAQLXVYDTANEIGNRFNAINCKETNMKLDENIVKGLXNMFNESNELVQVFR  292

Query  983   MARTEIQSNPVVAVKMNLIGRRNKD  1057
               R + ++N + ++K+ ++GR   D
Sbjct  293   TIRDKFENNSLPSLKITILGRXLND  317



>ref|NP_001173850.1| Os04g0300175 [Oryza sativa Japonica Group]
 dbj|BAH92578.1| Os04g0300175 [Oryza sativa Japonica Group]
Length=1718

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   H C YCGA+FW  ER  ++  V++    Y  CC  G+I LP +K+PP  L  L  
Sbjct  231   YGGPTHECPYCGAVFWYQERVKKSSLVSKRKVVYNLCCKGGRIDLPELKHPPSFLAKLLK  290

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + +S+ F+  IR YN++F FTSLG  ++RSINTG+SP +F+I+G  +H IGSL+P  
Sbjct  291   FDGDARSKRFLRQIRSYNSLFAFTSLGADIDRSINTGSSPCVFKINGVVHHRIGSLLPKH  350

Query  866   GSMTKLAQRDVNSRD-------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
             G+  K AQ  +   D                     + IVE+L +MLD +N LVK FR A
Sbjct  351   GAPPKFAQLYIYDTDNETTNRMNIFDKESSSDGPPDKQIVEKLGSMLDEHNELVKSFRYA  410

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             +  ++ +      + L+G   KD
Sbjct  411   KERLEEHGYQDTALRLMGCNAKD  433



>dbj|BAC84865.1| helicase-like protein [Oryza sativa Japonica Group]
 dbj|BAD32013.1| helicase-like protein [Oryza sativa Japonica Group]
Length=1516

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 115/203 (57%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YCGA+FW  ER  S   +++    Y  CC  G+IQLP+++ PP  L SL  
Sbjct  57    YGPPTYECPYCGAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLRAPPEPLASLLN  116

Query  689   YD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S++F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  117   YNGDARSKNFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  176

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  177   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  236

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  237   RERVIQHGNQQVTLRLLGCNAKD  259



>emb|CAB91581.1| putative protein [Arabidopsis thaliana]
Length=1752

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 110/209 (53%), Gaps = 24/209 (11%)
 Frame = +2

Query  494   TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
             T  +YLD GDA + CNYCGAL W  ER N+      P +T CC +G ++LP +K+ P ++
Sbjct  311   TKSAYLDHGDATYKCNYCGALMWFAERINKKQQNKSPTFTLCCGKGNVKLPLLKDSPALI  370

Query  674   QSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
              +L   D+  SR+F  NIR YN +F  TSLGGRV+ S+  G  P++FR+ G NYH IGSL
Sbjct  371   NNLLTGDDALSRNFRENIRIYNMIFAMTSLGGRVDNSMPKGKGPNMFRLQGGNYHLIGSL  430

Query  854   VPGGGSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNN  961
              P  G   K +Q        +V++R                  + + ++E L  ML+  N
Sbjct  431   KPNPGDYAKYSQLYIVDTENEVDNRATVINKGKGRRNTPAKQKLKKEVIEALIEMLNKVN  490

Query  962   VLVKCFRMARTEIQSNPVVAVKMNLIGRR  1048
               V  FR AR  IQ +      M ++  R
Sbjct  491   PYVDKFRQARERIQDDNDEPFHMRIVADR  519



>ref|NP_001060485.2| Os07g0651500 [Oryza sativa Japonica Group]
 dbj|BAF22399.2| Os07g0651500 [Oryza sativa Japonica Group]
Length=2021

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 115/203 (57%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YCGA+FW  ER  S   +++    Y  CC  G+IQLP+++ PP  L SL  
Sbjct  192   YGPPTYECPYCGAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLRAPPEPLASLLN  251

Query  689   YD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S++F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  252   YNGDARSKNFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  311

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  312   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  371

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  372   RERVIQHGNQQVTLRLLGCNAKD  394



>ref|XP_003604594.1| Helicase-like protein [Medicago truncatula]
Length=1689

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 103/201 (51%), Gaps = 16/201 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C  CGA  W  ER N++     PK+  CC +G IQLP ++ PP +L  L 
Sbjct  283   YYDIGDPVIECQRCGACMWYQERKNKSRESANPKFGLCCGDGTIQLPYLRKPPALLSHLM  342

Query  686   FYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             +  N  + +HF  NIR YN+MF F+S G +V+++I  G  P   RI GQ  H IGS++P 
Sbjct  343   YDQNSSECKHFQQNIRLYNSMFAFSSPGFKVDKNIRRGRGPPTIRIQGQACHRIGSMIPM  402

Query  863   GGSMTKLAQRDV---------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTE  997
              G   K AQ  +               N+  +   ++  L+ MLD NNV  K FRMAR  
Sbjct  403   PGRPPKFAQLYIYDTENELQHRLQGLSNANQLDIQMIAALQKMLDENNVHAKSFRMARDR  462

Query  998   IQSNPVVAVKMNLIGRRNKDG  1060
             +    V  +K+ LI  R  DG
Sbjct  463   LCEGDVQNLKLKLISERTTDG  483



>emb|CAH66128.1| OSIGBa0135L04.2 [Oryza sativa Indica Group]
Length=1517

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 114/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YCGA+FW  ER  S   +++    Y  CC  G+IQLP+++ PP  L SL  
Sbjct  57    YGPPTYECPYCGAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLRAPPEPLASLLN  116

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S+ F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  117   YNGDARSKIFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  176

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  177   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  236

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  237   RERVIQHGNQQVTLRLLGCNTKD  259



>ref|XP_003603826.1| Helicase-like protein [Medicago truncatula]
Length=1679

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 111/204 (54%), Gaps = 19/204 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y   G+    C  CGAL W  ER  ++     P+++ CC +G+I++   K  P  L  LY
Sbjct  314   YFQVGEPRFVCESCGALMWYEERVGKHRDTSNPEFSLCCMQGRIEIAPFKRLPRQLYDLY  373

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++++S+ F+ NIR +N+MF FTS+G  ++++ N GN+P +F ++G+NYH IGSL+P  
Sbjct  374   HENDKKSKFFMENIRSFNSMFAFTSMGATIDKTKNDGNAPPVFVLNGENYHQIGSLLPKE  433

Query  866   GSMTKLAQRDVNSRD-------------------IHENIVEELKNMLDGNNVLVKCFRMA  988
             G   K AQ  +   D                   +  +IV+EL+++LD +N  VK +R  
Sbjct  434   GDQPKFAQLYIYDTDNELSNRMAAVGYMKDDKNSMKRDIVKELRHILDHSNSFVKSYRQV  493

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R  +       +K+ ++G+R  DG
Sbjct  494   RDTLTQEDAPHIKLRILGKRGYDG  517



>emb|CDY33869.1| BnaC06g04840D [Brassica napus]
Length=717

 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 102/194 (53%), Gaps = 22/194 (11%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C YC AL W  E S  +V  G P YT CC +G+++LP +K+PP  LQSL       S  
Sbjct  9     ECTYCKALVWYSESSGTDVRTGEPTYTVCCQQGRVKLPPLKDPPDYLQSL----PANSTP  64

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F NNIR YN+M  FTS+G  ++ SI + N P  +RI GQ +H IGSL+P  G   +  Q 
Sbjct  65    FRNNIRVYNSMLAFTSVGASIDHSITSENGPPAYRIHGQLFHRIGSLIPMPGKPPQFLQM  124

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              R   S  + E+I+  L NMLD NN L K FR AR   +SN   
Sbjct  125   WIVDTDNEVTNRMKTMTRRKPSEALEEDIITGLTNMLDENNYLSKFFRKARDLYKSNECQ  184

Query  1019  AVKMNLIGRRNKDG  1060
              + + L+G++ K G
Sbjct  185   YLTIRLVGQKGKVG  198



>emb|CDY47242.1| BnaA02g29280D [Brassica napus]
Length=912

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 107/209 (51%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD  + C +CGA+ W  ER N       PK+  CC +G++QLP +K+ P +L+ L 
Sbjct  322   YIDDGDPTYKCEHCGAIMWYGERINNKKHTRKPKFALCCGQGQVQLPLLKDSPAILKQLL  381

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                +EQSR+F +NIR  N +F FTSLGG+ + S   G+ P +  + G+NYH +GSL P  
Sbjct  382   HGSDEQSRYFRDNIRAINMVFSFTSLGGKFDHSAPKGSGPKMIVLQGENYHLMGSLKPPA  441

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G   K  Q        +V +R                  I   +++ L  ML+  N  V 
Sbjct  442   GDPAKFGQLYIVDTENEVANRASIIGRYKKSAEKAKKESIRNQVIQSLMTMLNEVNPYVH  501

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR A+   ++NP+    M +I  R KDG
Sbjct  502   QFRSAKDRFETNPLETFHMRIISSRAKDG  530



>ref|XP_009119774.1| PREDICTED: uncharacterized protein LOC103844714 [Brassica rapa]
Length=1655

 Score =   138 bits (347),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 107/194 (55%), Gaps = 19/194 (10%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  CGALFW +ER +++    +P YT CC  GKIQLP ++ PP  LQ L   D+  S+H+
Sbjct  223   CPKCGALFWYNERVSKSRNARIPVYTMCCMRGKIQLPVLQPPPEFLQGLLTNDDPISKHY  282

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRD  895
              +NIR  N MF FTSLGG+++ S+N G  P +F++ G+N+H IGS+ P      K +Q  
Sbjct  283   QDNIRALNMMFSFTSLGGKIDNSVNMGKGPKVFKLHGENFHLIGSVKPKPTEPAKFSQLY  342

Query  896   VNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTEI-QSNPVV  1018
             ++  +                  I E++VE + NML  +NV VK FR A+      +   
Sbjct  343   IHDTENEVRNRISALSGNSERSKIREDLVEAIMNMLRASNVHVKTFRNAKDRFNNEDERE  402

Query  1019  AVKMNLIGRRNKDG  1060
              + + LI  R KDG
Sbjct  403   ELSLVLIHSRLKDG  416



>emb|CDX75122.1| BnaC09g25600D [Brassica napus]
Length=789

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 106/209 (51%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD  + C +CGA+ W  ER N       PK+  CC +G++QLP +K+ P +L+ L 
Sbjct  323   YIDDGDPTYKCEHCGAIMWYGERINNKKHTRKPKFALCCGQGQVQLPLLKDSPAILKQLL  382

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                +EQSR+F +NIR  N +F FTSLGG+ + S   G+ P +  + G+NYH +GSL P  
Sbjct  383   HGSDEQSRYFRDNIRAINMVFSFTSLGGKFDHSAPKGSGPKMIVLQGENYHLMGSLKPPA  442

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G   K  Q        +V +R                  I   +++ L  ML+  N  V 
Sbjct  443   GDPAKFGQLYIVDTENEVTNRASIIGKYKKSAEKAKKESIRNQVIQSLMTMLNEVNPYVH  502

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR A+   ++NP     M +I  R KDG
Sbjct  503   QFRSAKDRFETNPQETFHMRIISSRAKDG  531



>dbj|BAB11364.1| helicase [Arabidopsis thaliana]
Length=1523

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 108/208 (52%), Gaps = 23/208 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD  ++C YCGA+ W  ER  + V     K+T CC +G+++LP +KN P +L +L 
Sbjct  235   YIDHGDPIYACEYCGAIMWHGERIEKTVKNKKSKFTSCCLQGQVKLPFLKNSPELLYALP  294

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+E SRHF  NIR YN +F FTSLGG    S+     P +F+I  +NYH IGSL P  
Sbjct  295   TNDDEISRHFRENIRAYNMIFYFTSLGGDTENSVRASGGPQMFQIHRENYHRIGSLKPDN  354

Query  866   GSMTKLAQ-------RDVNSR----------------DIHENIVEELKNMLDGNNVLVKC  976
                 K  Q        +V++R                ++ + I++ +  +L+  N  V  
Sbjct  355   DIPPKFMQLYIVDTENEVDNRSEALSNGVNADKYKKKELRKEIIDAVIKLLNSINPYVSH  414

Query  977   FRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              R AR    +NP   + M ++ +R KDG
Sbjct  415   LRTARDRFNANPEETLHMRIVSKREKDG  442



>ref|XP_010445013.1| PREDICTED: uncharacterized protein LOC104727621 [Camelina sativa]
Length=577

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 106/212 (50%), Gaps = 25/212 (12%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y+D GD    C+YCGA+ W  ER N+      PK++ CC +G ++LP +K    +++ 
Sbjct  12    EKYVDHGDPTFKCSYCGAMMWYDERINKRRRSKKPKFSLCCLQGTVKLPLLKEALELIRE  71

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  SRHF  NIR YN +F FTSLGG+V+RS+  G  P  F++ GQN+H IGSL P
Sbjct  72    LLSKDDALSRHFRENIRAYNMLFAFTSLGGQVDRSVEKGKGPKKFQLHGQNFHKIGSLKP  131

Query  860   GGGSMTKLAQRDVNSRD------------------------IHENIVEELKNMLDGNNVL  967
               G   K +Q  +   D                        I + ++ +L  +LD  N  
Sbjct  132   EDGDYAKFSQLYIVVTDNEIENRSSVMSKGKQSGSLKGRQSIRKELIAKLIRLLDKVNPY  191

Query  968   VKCFRMARTEIQSNPVVAVKMNLIGRR-NKDG  1060
             V+ FR  + +  ++      M ++  R  KDG
Sbjct  192   VESFRQPKDKFAADENAKFHMRIVSDRVGKDG  223



>gb|ABA98394.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=881

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLY  685
             +G   + C YCGA+FW  ER  S   V++    Y  CC  GKIQLP++++PP P+   L 
Sbjct  42    YGPPTYECPYCGAVFWYQERVKSTSAVSQRRIVYNLCCKGGKIQLPKLRSPPEPLATLLN  101

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + +S+ F+  I+ YN+MF FTSLG  ++R INTGN+P +F+I+G  +H IGSL+P  
Sbjct  102   FNGDARSKRFLRQIQSYNSMFAFTSLGATIDRLINTGNAPYVFKINGVVHHRIGSLLPSS  161

Query  866   GSMTKLAQRDV----------------NSRDIHE---NIVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  +                +S D  +    IV  L +MLD +N LV+ FR A
Sbjct  162   GSPPKFAQLYIYDPQNETQNRLNIFGNDSDDADKPDPEIVSALSSMLDRHNSLVQTFRYA  221

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    + + L+G   KD
Sbjct  222   RERLSQHGDQKITLRLLGCNAKD  244



>ref|XP_010468463.1| PREDICTED: uncharacterized protein LOC104748536 [Camelina sativa]
Length=1461

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 106/210 (50%), Gaps = 25/210 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  +SC +CGA+FW  ER  + V    P YT CC +G+I LP +K  P +L +L 
Sbjct  72    YADDGDPEYSCPHCGAIFWYGERLRRRVRTNNPVYTGCCMQGQIVLPMLKESPEMLWNLL  131

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               +++ SRHF  N R YN +F FTSLGG+V+RS+  G  PS+F + G+NYH +GSL P  
Sbjct  132   TNEDDLSRHFQENSRPYNMVFSFTSLGGKVDRSVKKGRGPSMFALQGENYHLMGSLKPKA  191

Query  866   GSMTKLAQ---------------------RDVN---SRDIHENIVEELKNMLDGNNVLVK  973
             G   K  Q                     R V     +    ++VE L  +LD  N  V+
Sbjct  192   GDYAKFQQLYIVDTQNEVQNRVNVMSKEGRQVKVDGKKKFRPDLVESLIKLLDEVNPHVR  251

Query  974   CFRMARTEIQSNPVVA-VKMNLIGRRNKDG  1060
              FRMAR         +   M +I  R  DG
Sbjct  252   AFRMARDRFDMEKEESNFHMRIISSRITDG  281



>gb|KHN42445.1| hypothetical protein glysoja_033913, partial [Glycine soja]
Length=531

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 107/202 (53%), Gaps = 17/202 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL-QSL  682
             Y D GD    C++C A  W  ER +++     P+++ CC   K++LP +++PP  L Q L
Sbjct  4     YSDLGDQLMQCSHCNANMWYDERVSKDKRTTNPRFSLCCGNDKVELPLLQSPPKYLYQLL  63

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y +    S+++  NIR YN MF FTS G + ++SIN    P   RI GQ  H IGS++P 
Sbjct  64    YDHGTSDSKNYQQNIRTYNMMFAFTSAGIKFDKSINHSRGPPTIRIQGQPCHRIGSMLPM  123

Query  863   GGSMTKLAQ-------RDVNSR---------DIHENIVEELKNMLDGNNVLVKCFRMART  994
              G   K AQ        +V +R          I E+IV +L  +LD  NV  K FRMAR 
Sbjct  124   PGKEPKFAQLYIFDTENEVQNRINAISSPHNQIQEHIVSQLSEILDEYNVHAKTFRMARD  183

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
              +Q   V  +K+ LI  R KDG
Sbjct  184   RLQDVQVNNIKLKLIANREKDG  205



>ref|XP_008345150.1| PREDICTED: uncharacterized protein LOC103408064 [Malus domestica]
Length=1150

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 108/199 (54%), Gaps = 20/199 (10%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTR-GLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             Y+DFG     C YCGALFW  ER   N++    P++T CC   K++ P +K  P  L+ L
Sbjct  139   YVDFGPRNSQCQYCGALFWSTERLKTNISSVRRPQFTACCMSEKVKFPPVKPTPAYLEHL  198

Query  683   YFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                 N Q S HF  N+R YN+M  FTS+G +V+ SIN G  P +F+I+GQ +H +GSL+P
Sbjct  199   LNSTNSQESSHFKTNVRLYNSMMGFTSMGAKVDASINKGQGPYVFKINGQVHHLMGSLLP  258

Query  860   GGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRM  985
               G   K A       Q ++N+R            + E IV  L  MLD  N LV+ FR+
Sbjct  259   PEGESPKFAQLYIYDTQNEINNRISCFPHSEVSSKVDEQIVSGLIKMLDECNELVQLFRV  318

Query  986   ARTEIQSNPVVAVKMNLIG  1042
             AR +I      ++++ L G
Sbjct  319   ARDKINEQSTSSLRLRLHG  337



>emb|CDY72294.1| BnaCnng76970D, partial [Brassica napus]
Length=380

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 114/213 (54%), Gaps = 13/213 (6%)
 Frame = +2

Query  440   FQYNIVKTKCKEFKYGF*TFH-----------SYLDFGDAAHSCNYCGALFWRHERSNQN  586
              + NIVK+    F+  F               +Y+D GDA ++C YCGA+ W  ER N+ 
Sbjct  51    LKTNIVKSLAALFEEAFCATEKPAKKALPKEDAYIDEGDATYTCTYCGAIMWFGERLNRR  110

Query  587   VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLG  766
             +    PK++ CC +G++QLP +K PP VL++L    ++ S+HF  N R YN +F FTSLG
Sbjct  111   LKTPNPKFSLCCMQGQVQLPLLKQPPEVLKNLLTGGDKLSKHFQRNTRPYNMVFSFTSLG  170

Query  767   GRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQR-DVNSRDIHENIVEEL-K  940
             G+++RS+  G  P++  + G+NY  IGSL P  G+  K  Q   V++ +  EN  + L  
Sbjct  171   GKIDRSVRKGKGPNMLVLQGENYLLIGSLQPPNGNDAKFGQLYIVDTENEAENRTKALSS  230

Query  941   NMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
             ++LD  ++ +   R         P  +    LI
Sbjct  231   DLLDSFHMRIVSDRAKDGRTYDTPTASEVAALI  263



>gb|AAK54292.1|AC034258_10 putative helicase [Oryza sativa Japonica Group]
Length=1501

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 106/201 (53%), Gaps = 19/201 (9%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG     C +C AL W  ERS  +  +  P +  CC +GK+ LP +K  PP L SL   
Sbjct  155   NFGGPTCMCQHCHALMWHAERSLHSTVKQ-PSFGLCCKQGKVALPPLKEQPPYLTSLLTR  213

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
             D  +S ++  NIR YN+MF FTS+GG V+R IN G+ P IFR++GQN+H IG+L+P G +
Sbjct  214   DGGRSTNYQQNIRSYNSMFAFTSMGGTVDRKINNGHGPYIFRLNGQNHHHIGTLLPEGSN  273

Query  872   MTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTE  997
               +  Q  V   +                  + +  +  L  MLD NN L + FRMAR  
Sbjct  274   KPRFQQLYVYDTENEIENRIEASKSGASNAPLDQKTIASLLKMLDENNTLAQTFRMARDR  333

Query  998   IQSNPVVAVKMNLIGRRNKDG  1060
              + +      + L+  R++DG
Sbjct  334   FKEDDYHNYTLRLLDNRDQDG  354



>gb|ABB47755.2| expressed protein [Oryza sativa Japonica Group]
Length=1517

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 106/201 (53%), Gaps = 19/201 (9%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             +FG     C +C AL W  ERS  +  +  P +  CC +GK+ LP +K  PP L SL   
Sbjct  155   NFGGPTCMCQHCHALMWHAERSLHSTVKQ-PSFGLCCKQGKVALPPLKEQPPYLTSLLTR  213

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
             D  +S ++  NIR YN+MF FTS+GG V+R IN G+ P IFR++GQN+H IG+L+P G +
Sbjct  214   DGGRSTNYQQNIRSYNSMFAFTSMGGTVDRKINNGHGPYIFRLNGQNHHHIGTLLPEGSN  273

Query  872   MTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTE  997
               +  Q  V   +                  + +  +  L  MLD NN L + FRMAR  
Sbjct  274   KPRFQQLYVYDTENEIENRIEASKSGASNAPLDQKTIASLLKMLDENNTLAQTFRMARDR  333

Query  998   IQSNPVVAVKMNLIGRRNKDG  1060
              + +      + L+  R++DG
Sbjct  334   FKEDDYHNYTLRLLDNRDQDG  354



>emb|CDY51166.1| BnaCnng20320D [Brassica napus]
Length=556

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 111/211 (53%), Gaps = 25/211 (12%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNV-TRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             +Y+D G+  + C YC A  W  ER ++   T+  P ++ CC +G+++LP ++  P V++ 
Sbjct  168   AYVDEGNPTYKCEYCKAKMWYGERLDRKTRTKKNPIFSLCCGQGQVKLPMLRESPLVIKQ  227

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L +  +E+SR++  N+R  N +F FTSLGG+V+RSI  G  P  F + G+NYH +GS+ P
Sbjct  228   LLYGKDEKSRYYHKNLRALNMLFSFTSLGGKVDRSIPNGVGPKTFTLQGENYHLMGSMKP  287

Query  860   GGGSMTKLAQRDVN-------SRD-----------------IHENIVEELKNMLDGNNVL  967
               G   K  Q D+N        RD                 + + I+E++  +LD  N  
Sbjct  288   DLGDSAKFTQLDINDIESEVDDRDSVMSKYNTEADKVKNQAMRKQIIEDIIKVLDDVNPY  347

Query  968   VKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             VK FR AR  +   P    +M ++  R K G
Sbjct  348   VKQFRQARERLSMEPNEKFRMRIVSNREKHG  378



>gb|AAX95983.1| hypothetical protein LOC_Os11g13920 [Oryza sativa Japonica Group]
 gb|ABA92343.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=2157

 Score =   136 bits (343),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 114/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YC A+FW  ER  S   +++    Y  CC  G+IQLP+++ PP  L SL  
Sbjct  148   YGPPTYECPYCRAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLRAPPEPLASLLN  207

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S++F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  208   YNGDARSKNFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  267

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  268   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  327

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  328   RERVIQHGNQQVTLRLLGCNAKD  350



>ref|NP_001175163.1| Os07g0418100 [Oryza sativa Japonica Group]
 dbj|BAH93891.1| Os07g0418100 [Oryza sativa Japonica Group]
Length=2266

 Score =   136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 110/202 (54%), Gaps = 21/202 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G  +H C YCGA+FW  ER  +       K  Y  CC  GKI LP +K+PP +L  L  
Sbjct  223   YGGPSHECPYCGAVFWYQERVKKGTVLSQRKIVYNLCCRGGKISLPELKHPPSLLAELLK  282

Query  689   YDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D   +S+ F+  IR YN++F FTSLG  ++++IN G +P +F+I+G  +H IG L+P  
Sbjct  283   FDGGVRSKRFLRQIRSYNSLFAFTSLGANIDKTINNGTAPCVFKINGVVHHRIGGLLPQQ  342

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ                  RD  S +    IV +L +MLD +N LVK FR AR
Sbjct  343   GAPPKFAQLYIYDTENETANRMNIFERDNLSDEPDPEIVRDLGSMLDEHNDLVKAFRFAR  402

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               ++ +    V + L+G  ++D
Sbjct  403   DRLKDHGDQKVALRLLGCDSRD  424



>ref|XP_003614435.1| Helicase-like protein [Medicago truncatula]
Length=936

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 107/215 (50%), Gaps = 16/215 (7%)
 Frame = +2

Query  461   TKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQ  640
             T     + G      Y D GD    C  CGA  W  ER +++     P +  CC  GK+Q
Sbjct  268   TNATNIQVGEPALQDYFDIGDPDCICQQCGAEMWYLERKHKSKFTTTPLFQLCCGNGKVQ  327

Query  641   LPRMKNPPPVLQSLYF-YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFR  817
             LP ++ PP VLQ L F + +E S++F  N R YN+MF F+S G + +  +  G  P   R
Sbjct  328   LPLLRQPPSVLQHLLFDHQSEDSKNFQQNTRMYNSMFSFSSPGMKFDDKVTKGRGPPTMR  387

Query  818   ISGQNYHWIGSLVPGGGSMTKLAQRDV---------------NSRDIHENIVEELKNMLD  952
             I GQ  H IGSL+P  G + K AQ  +               N+++I E+IV  L  MLD
Sbjct  388   IQGQTCHRIGSLLPPDGELPKYAQLYIYDTENEIQNKIKGFENTKNISEDIVVRLCKMLD  447

Query  953   GNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
              +NV  K FRMAR  ++   +  +K+ LI     D
Sbjct  448   EHNVHAKSFRMARDILKGGHMNDLKLRLISESKSD  482



>ref|XP_008356277.1| PREDICTED: uncharacterized protein LOC103419978 [Malus domestica]
Length=1096

 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 105/199 (53%), Gaps = 20/199 (10%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTR-GLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             Y+DFG     C YCGALFW  ER   NV+    P +T CC   K++ P +K  P  L+ L
Sbjct  139   YVDFGPRNSQCQYCGALFWSTERLKTNVSSIRRPXFTACCMSQKVKFPPVKPTPAYLEHL  198

Query  683   YFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                 N Q S HF  N+R YN+M  FTS G +V+ SIN G  P +F+I+GQ +H +GSL+P
Sbjct  199   LNSTNSQESSHFKTNVRLYNSMMAFTSXGAKVDXSINKGQGPYVFKINGQVHHLMGSLLP  258

Query  860   GGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRM  985
               G   K A       Q ++N+R            + E IV  L  MLD  N LV+ FR+
Sbjct  259   PEGESPKFAQLYIYDTQNEINNRMSCFPHSEESSKVDEQIVSGLIKMLDECNELVQLFRV  318

Query  986   ARTEIQSNPVVAVKMNLIG  1042
             AR  I      ++++ L G
Sbjct  319   ARDRINEQSTSSLRLRLHG  337



>ref|XP_010496603.1| PREDICTED: uncharacterized protein LOC104773656, partial [Camelina 
sativa]
Length=1271

 Score =   135 bits (341),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 108/209 (52%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD  ++C +CGA+FW  ER N+      PK+  CC +G+I LP +K  P +L+ L 
Sbjct  212   YVDDGDPDYTCEHCGAIFWYGERLNKRRNAKNPKFAACCMQGQITLPSLKESPELLRQLL  271

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               D+E +R+F +NIR +N +F FTS+GGRV+  +  G  P +F + G+NYH +G+L P  
Sbjct  272   TGDDELARNFKDNIRAHNMIFSFTSIGGRVDHCVPKGRGPQMFALQGENYHLMGALKPKP  331

Query  866   GSMTKLAQRDV---------------NSRD---------IHENIVEELKNMLDGNNVLVK  973
             G + K  Q  +               N +D           + I+E +  +L+  N  V 
Sbjct  332   GELAKFLQLYIIDTANEVENRMNIMSNGKDPDNGQGKKKFRKEIIESIIKLLNQINPHVD  391

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR AR    +N      M +I +R  DG
Sbjct  392   AFRSARDRFNTNDEERFHMRIIAKRTTDG  420



>ref|XP_010490304.1| PREDICTED: uncharacterized protein LOC104768062 [Camelina sativa]
Length=1262

 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 105/210 (50%), Gaps = 25/210 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  +SC++CGALFW  ER  +      P Y  CC +G+I LP +K  P +L +L 
Sbjct  10    YEDDGDPDYSCSHCGALFWYGERVRRTRKTNNPVYIGCCMQGQIVLPMLKESPEMLWNLL  69

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               +++ SRHF  N R YN +F FTSLGGRV+RS+  G  PS+F + G+NYH +GSL P  
Sbjct  70    TNEDDLSRHFQENTRPYNMLFSFTSLGGRVDRSVKKGRGPSMFALQGENYHLMGSLKPKP  129

Query  866   GSMTKL-------AQRDVN-----------------SRDIHENIVEELKNMLDGNNVLVK  973
             G   K         Q +VN                  +    ++VE    +LD  N  V+
Sbjct  130   GDYAKFQQLYIVDTQNEVNNSLNVMSKEDRRNNVDGKKKFRPDLVESFIKLLDDVNPHVQ  189

Query  974   CFRMARTEIQSNPVVA-VKMNLIGRRNKDG  1060
              FRMAR         +   M +I  R  DG
Sbjct  190   AFRMARDRFDIEKEESNFHMRIISNRKTDG  219



>ref|XP_009350533.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350534.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350535.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350536.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350537.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350538.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350539.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
 ref|XP_009350540.1| PREDICTED: uncharacterized protein LOC103942063 [Pyrus x bretschneideri]
Length=507

 Score =   132 bits (332),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 110/204 (54%), Gaps = 24/204 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD ++ C  CGA FW  E   Q+  +  P +T CC +GKI+    K  P  L SL 
Sbjct  130   YADLGDKSYKCVDCGAYFWLKESLKQSWKKNQPIFTLCCQQGKIKFSTPKPTPIFLDSLL  189

Query  686   FYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               +  ++S  F  NIR YN+MF FTS+G +V+ SIN G+SP IF+ISGQ YH +GSL+P 
Sbjct  190   DPNGGQKSLSFRENIRAYNSMFSFTSMGAKVDHSINDGSSPYIFKISGQIYHLMGSLLPV  249

Query  863   GGSMTKLAQR----------------DVNSRDIH--ENIVEELKNMLDGNNVLVKCFRMA  988
                  K AQ                 D + +++     IVE L  M + +N LVK FR A
Sbjct  250   NNESPKFAQLYVYDTYNEVQNRLKAVDCDGKNVRLDSKIVENLIKMFNESNELVKLFRTA  309

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R     + ++++KM L GR+  DG
Sbjct  310   R-----DGLISLKMILSGRQPNDG  328



>dbj|BAD01692.1| helicase-like protein [Oryza sativa Japonica Group]
 dbj|BAD03910.1| helicase-like protein [Oryza sativa Japonica Group]
Length=1430

 Score =   135 bits (340),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YC A+FW  ER  S   +++    Y  CC  G+IQLP+++ PP  L SL  
Sbjct  80    YGPPTYECPYCRAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLRAPPEPLASLLN  139

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S+ F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  140   YNGDARSKIFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  199

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  200   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  259

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  260   RERVIQHGNQQVTLRLLGCNAKD  282



>gb|AAL75754.1|AC037197_13 Putative helicase [Oryza sativa Japonica Group]
 gb|ABB46593.2| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=257

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 109/203 (54%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLY  685
             +G   + C YCGA+FW  ER  S   +T+    Y  CC  G+IQLP+++ PP P+   L 
Sbjct  41    YGPPTYECPYCGAMFWYQERVKSTSAITKRKIVYNLCCKGGQIQLPKLRPPPEPLATLLN  100

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + +S+ F+  IR YN+MF FTS+G  V++SINTGN+P +F+I+G  +H IG+LV   
Sbjct  101   FNGDARSKRFLRQIRLYNSMFVFTSMGATVDKSINTGNAPYVFKINGVVHHRIGTLVRSR  160

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  +        N  +I EN           I+  L  M D  N LV+ FR A
Sbjct  161   GSPPKFAQLYIYDSENEIQNRLNIFENDGDNVDKADSEILAALSLMFDAENALVQNFRYA  220

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             +  +  +    + +  +G   KD
Sbjct  221   KERLSEHGDQQITLRRLGCNAKD  243



>ref|XP_004510124.1| PREDICTED: uncharacterized protein LOC101506803 [Cicer arietinum]
Length=1210

 Score =   135 bits (340),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +2

Query  509  LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
            +DFGD +++C+ CGA  W  ER+ ++V   LPK++ CC +G +Q+P +K PP +L SL  
Sbjct  135  VDFGDPSYTCSECGAQMWYEERAEKSVNSNLPKFSLCCMKGLVQIPYLKRPPELLMSLIH  194

Query  689  YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
              + +S+HF  NIR YN+MFCFTS+GG++  + + G  P  F +SGQN+H IGSL+P   
Sbjct  195  GQDPRSKHFKENIRAYNSMFCFTSIGGKIQSNSSRGGGPPQFILSGQNFHRIGSLIPEEE  254

Query  869  SMTKLAQ  889
            +  K AQ
Sbjct  255  ATPKFAQ  261



>gb|AAP54490.2| hypothetical protein LOC_Os10g35890 [Oryza sativa Japonica Group]
Length=1077

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 111/202 (55%), Gaps = 21/202 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G  +H C YCGA+FW  ER  ++  V++    Y  CC  GKI LP +K PP +L  L  
Sbjct  206   YGGPSHECPYCGAVFWYQERVKRDSAVSQRRIVYNLCCRGGKISLPELKYPPDMLAKLLK  265

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + QS+ F+  IR YN++F FTSLG  V +SIN G +P +F+I+G  +H IGSL+P  
Sbjct  266   FDGDAQSKRFLRQIRSYNSLFAFTSLGADVEKSINNGTAPYVFKINGVVHHRIGSLLPQR  325

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ                  R+ ++ +   +IV  L  MLD +N LVK FR AR
Sbjct  326   GAKPKFAQLYIYDTENETANRINIFDRENSNDEPDPSIVTRLGAMLDQHNDLVKSFRYAR  385

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               +  +    + + L+G   KD
Sbjct  386   DRLNEHGNEQIALRLLGCNAKD  407



>emb|CDY68360.1| BnaUnng02830D [Brassica napus]
Length=389

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            YLD GD  + C +CGA  W  ER N+      P ++ CC +G++QLP +K PP VL+ L 
Sbjct  229  YLDEGDPDYKCGHCGATMWYGERLNKRRNAKKPTFSLCCMQGQVQLPLLKEPPSVLKKLL  288

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D  +SRHF  +IR YN +F FTSLGGRV RS+  G  P +F++ G+NYH +G+L    
Sbjct  289  EGDEPRSRHFQKHIRPYNMVFSFTSLGGRVERSLKKGRGPDMFQLQGENYHLLGNLTSPD  348

Query  866  GSMTKLAQ  889
            GS  K  Q
Sbjct  349  GSDPKFGQ  356



>gb|ABA94881.2| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=2157

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 113/203 (56%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YC A+FW  ER  S   +++    Y  CC  G+IQLP++  PP  L SL  
Sbjct  148   YGPPTYECPYCRAMFWYQERVKSASAISKRKIIYNLCCKGGRIQLPKLHAPPEPLASLLN  207

Query  689   YD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y+ + +S++F+  IR YN+MF F+S+G  +++SINTGN+P +F+I+G  +H IG+LVP  
Sbjct  208   YNGDARSKNFLRQIRSYNSMFAFSSMGAAIDKSINTGNAPYVFKINGVVHHRIGTLVPSC  267

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             GS  K AQ  V        N  +I EN           I+  L +MLD  N LV+ FR A
Sbjct  268   GSPPKFAQLYVYDPENELQNRLNIFENDGDNSDKADPEIIRALSSMLDAENTLVQSFRYA  327

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +    V + L+G   KD
Sbjct  328   RERVIRHGNQQVTLRLLGCNAKD  350



>ref|XP_003628572.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1483

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 111/205 (54%), Gaps = 18/205 (9%)
 Frame = +2

Query  497   FHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQ  676
             +  Y D G+    C  CGA+ W  ER+ +++T   P  + CC +G I +P M  PP + +
Sbjct  72    YQEYSDVGNNDTVCQKCGAMVWYGERAEKHLTPVSPNVSMCCMKGNITIPYMLEPPVLTR  131

Query  677   SLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             +L+     +S HF++++R YNNMF FTSLGG++  S N G  P  F ISGQNYH +GSL+
Sbjct  132   NLFMGLEPRSNHFLSHVRSYNNMFAFTSLGGKIEFSGNDGRGPPQFVISGQNYHRMGSLI  191

Query  857   PGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K AQ  +                  N + +  ++++++  +++ +N LVKCFR
Sbjct  192   PDDGIRPKFAQLYIYDTQNEVSNRLSHFSSIPNEQVLDPSLIDDILQVMNRDNTLVKCFR  251

Query  983   MARTEIQSNPVVAVKMNLIGRRNKD  1057
             M R   +    V V++ L   R+ D
Sbjct  252   MVRDFREVYCDVPVQLRLFRNRSYD  276



>ref|XP_008656185.1| PREDICTED: uncharacterized protein LOC103635531 [Zea mays]
Length=379

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 103/201 (51%), Gaps = 20/201 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYD  694
             +G   + C+YC A+FW  ER   N      +Y  CC  GKI +P  K  P  L SL  +D
Sbjct  73    YGTPDYECSYCHAVFWYAERVRSNQQDSSIRYNNCCKGGKISIPPFKPRPEPLASLARFD  132

Query  695   NEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
              +  SR FI NIR+YN +F FTS+G +++ S+N G  P +F+I GQ +H IG+L+P  GS
Sbjct  133   GDATSRKFIRNIRQYNCLFAFTSMGAQIDNSVNDGRGPPLFKICGQVHHRIGTLLPDNGS  192

Query  872   -----------MTKLAQRDVNSRDIHEN--------IVEELKNMLDGNNVLVKCFRMART  994
                         T   Q  +N+ D  +         I+  L  MLD +N  VK FRMAR 
Sbjct  193   PPRFIQLYIYDTTNEVQNRINALDSGDRTQDSFDPVIIRNLIKMLDHHNPFVKKFRMARD  252

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +  NP     + LIG +  D
Sbjct  253   RLADNPNEEFTIRLIGAKEGD  273



>ref|XP_010480905.1| PREDICTED: uncharacterized protein LOC104759705 [Camelina sativa]
Length=1246

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 110/220 (50%), Gaps = 24/220 (11%)
 Frame = +2

Query  473   EFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRM  652
             EF+  +     Y+D GD  ++C +CGA+FW  ER N+      PK+  CC +G+I LP +
Sbjct  144   EFQDYYDQSEDYVDDGDPDYTCEHCGAIFWYGERLNKRRNAKNPKFAACCMQGQITLPSL  203

Query  653   KNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQN  832
             K  P +L  L   D+E +R+F +NIR YN +F FTS+GGRV+  +  G  P +F + G+N
Sbjct  204   KESPELLWQLLTGDDELARNFKDNIRAYNMIFSFTSIGGRVDHCVPKGRGPQMFALQGEN  263

Query  833   YHWIGSLVPGGGSMTKLAQRDV---------------NSRD---------IHENIVEELK  940
             YH +G+L P  G + K  Q  +               N +D           + I+E + 
Sbjct  264   YHLMGALKPKPGELAKFLQLYIIDTANEVENRMNIMSNGKDPDNGQGKKKFRKEIIESII  323

Query  941   NMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              +L+  N  V  FR AR    +N      M +I +R   G
Sbjct  324   KLLNQINPHVDAFRSARDRFNTNDEERFHMRIIAKRTTGG  363



>ref|XP_003595507.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1873

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 107/202 (53%), Gaps = 18/202 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             LD GD    C  C +  W  ER+ Q++T    K++ CC +GK+ LP ++ PP +L +L  
Sbjct  461   LDVGDPVVICRDCKSRVWFEERAEQDMTARNAKFSLCCMKGKVLLPILEKPPELLYNLMN  520

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
              ++ +S +++ NIR YN+MF FTSLGG++ R  N G  P  F + GQNYH +G L+P  G
Sbjct  521   GNHAKSTNYLQNIRSYNSMFSFTSLGGKIQRDRNDGGGPPQFILRGQNYHRMGGLLPDQG  580

Query  869   SMTKLAQ--------------RDVNSRD----IHENIVEELKNMLDGNNVLVKCFRMART  994
             S  K AQ              +  +S D    +   +VEELK M+D  N   K FR  R 
Sbjct  581   STPKFAQLYIYDTSNETANRVKHFSSGDSVNKVDTGLVEELKEMVDAFNKYAKKFRQVRD  640

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
              ++        + L+GRR +D 
Sbjct  641   HVEQGGTPNFSVRLLGRRTRDA  662



>ref|NP_001042570.1| Os01g0244200 [Oryza sativa Japonica Group]
 dbj|BAF04484.1| Os01g0244200 [Oryza sativa Japonica Group]
Length=2498

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 111/202 (55%), Gaps = 21/202 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G  +H C YCGA+FW  ER  ++  V++    Y  CC  GKI LP +K PP +L  L  
Sbjct  218   YGGPSHECPYCGAVFWYQERVKRDSAVSQRRIVYNLCCRGGKISLPELKYPPDMLAKLLK  277

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + QS+ F+  IR YN++F FTSLG  V +SIN G +P +F+I+G  +H IGSL+P  
Sbjct  278   FDGDAQSKRFLRQIRSYNSLFAFTSLGADVEKSINNGTAPYVFKINGVVHHRIGSLLPQR  337

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ                  R+ ++ +   +IV  L  MLD +N LVK FR AR
Sbjct  338   GAKPKFAQLYIYDTENETANRINIFDRENSNDEPDPSIVTGLGAMLDQHNDLVKSFRYAR  397

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               +  +    + + L+G   KD
Sbjct  398   DRLNEHGNEQIALRLLGCNAKD  419



>dbj|BAD81603.1| helicase-like protein [Oryza sativa Japonica Group]
Length=1652

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 111/202 (55%), Gaps = 21/202 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G  +H C YCGA+FW  ER  ++  V++    Y  CC  GKI LP +K PP +L  L  
Sbjct  218   YGGPSHECPYCGAVFWYQERVKRDSAVSQRRIVYNLCCRGGKISLPELKYPPDMLAKLLK  277

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + QS+ F+  IR YN++F FTSLG  V +SIN G +P +F+I+G  +H IGSL+P  
Sbjct  278   FDGDAQSKRFLRQIRSYNSLFAFTSLGADVEKSINNGTAPYVFKINGVVHHRIGSLLPQR  337

Query  866   GSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ                  R+ ++ +   +IV  L  MLD +N LVK FR AR
Sbjct  338   GAKPKFAQLYIYDTENETANRINIFDRENSNDEPDPSIVTGLGAMLDQHNDLVKSFRYAR  397

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               +  +    + + L+G   KD
Sbjct  398   DRLNEHGNEQIALRLLGCNAKD  419



>ref|XP_010513445.1| PREDICTED: uncharacterized protein LOC104789447 [Camelina sativa]
Length=513

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 110/210 (52%), Gaps = 25/210 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             YLD GDA + C YCGA  W  ER N++  +  P +T CC +G ++LP +K  P +++ L 
Sbjct  118   YLDHGDATYKCKYCGAFMWYDERINKSRNQKYPTFTLCCGQGSVKLPFLKESPDLIKKLL  177

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++  S ++  NIR +N +F  TSLGG+V++S+  G  P++FR+ G NYH IGSL P  
Sbjct  178   KGNDAMSINYRENIRTFNMIFAMTSLGGKVDQSMPKGKGPNMFRLQGGNYHLIGSLKPDE  237

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G   K +Q        +V++R                  +++ ++E L  ML+  N  V 
Sbjct  238   GDYAKYSQLYIVDTENEVDNRATVIKKGKNTKAAAGKQKLNKEVIEALMKMLNDVNPYVN  297

Query  974   CFRMARTEIQSNPVVAVKMNLIG-RRNKDG  1060
              FR AR   QS       M ++  R+  DG
Sbjct  298   IFRCARERFQSATDEPFHMRIVADRKGVDG  327



>ref|XP_009374014.1| PREDICTED: uncharacterized protein LOC103962959 [Pyrus x bretschneideri]
Length=1866

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 107/200 (54%), Gaps = 22/200 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHE--RSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             Y+DFG     C YCGALFW  E  ++N + TR  P++T CC   K++ P +K  P  L  
Sbjct  204   YIDFGPRNFQCQYCGALFWSTEQLKTNASSTRR-PQFTACCMSQKVKFPPVKPAPAYLDH  262

Query  680   LYFYDNEQS-RHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L    N Q   HF  N+R YN+M  FTS+G +V+ SIN G  P +F+I+GQ +H +GSL+
Sbjct  263   LLNPTNSQENSHFKKNVRLYNSMMAFTSMGAKVDASINKGQGPYVFKINGQVHHLMGSLL  322

Query  857   PGGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K A       Q +VN+R            + E IV  L  MLD  N LV+ FR
Sbjct  323   PPEGESPKFAQLYIYDTQNEVNNRMSCFPHSEASSKLDEQIVGGLIKMLDECNELVQLFR  382

Query  983   MARTEIQSNPVVAVKMNLIG  1042
             +AR  I      ++++ L G
Sbjct  383   LARDRINQQSASSLRLRLYG  402



>ref|XP_003609124.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1558

 Score =   133 bits (334),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 107/203 (53%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +D G     C  CG+  W +ER+++      P ++ CC +G + L  ++ PP  L+ L  
Sbjct  1     MDLGHPNFECEKCGSTMWYNERADKPRRPRNPTFSLCCLKGDVSLEFLEQPPDYLKELLA  60

Query  689   YDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y     S  F   IR YN++F FTS+G +++ ++N    P +++ISGQNYH IG L+PG 
Sbjct  61    YKGGRHSVKFREKIRAYNSIFAFTSMGAKIDNTVNLRPGPYVYKISGQNYHRIGGLIPGQ  120

Query  866   GSMTKLAQRDVN------------------SRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K +Q  V+                  +RD+  +IV  LK+MLD NN + K FRMAR
Sbjct  121   GKQPKFSQLYVHDTENEIQNRLSSLNGGKTARDLDADIVRRLKDMLDMNNSVAKLFRMAR  180

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
               + +     V++ LIG R+ D 
Sbjct  181   DRLSAPDNKEVRIRLIGTRSNDS  203



>ref|XP_003606913.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1558

 Score =   133 bits (334),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 107/203 (53%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +D G     C  CG+  W +ER+++      P ++ CC +G + L  ++ PP  L+ L  
Sbjct  1     MDLGHPNFECEKCGSTMWYNERADKPRRPRNPTFSLCCLKGDVSLEFLEQPPDYLKELLA  60

Query  689   YDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y     S  F   IR YN++F FTS+G +++ ++N    P +++ISGQNYH IG L+PG 
Sbjct  61    YKGGRHSVKFREKIRAYNSIFAFTSMGAKIDNTVNLRPGPYVYKISGQNYHRIGGLIPGQ  120

Query  866   GSMTKLAQRDVN------------------SRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K +Q  V+                  +RD+  +IV  LK+MLD NN + K FRMAR
Sbjct  121   GKQPKFSQLYVHDTENEIQNRLSSLNGGKTARDLDADIVRRLKDMLDMNNSVAKLFRMAR  180

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
               + +     V++ LIG R+ D 
Sbjct  181   DRLSAPDNKEVRIRLIGTRSNDS  203



>ref|XP_009127428.1| PREDICTED: uncharacterized protein LOC103852269 [Brassica rapa]
Length=1749

 Score =   132 bits (332),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 108/206 (52%), Gaps = 19/206 (9%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
               Y D GD  + C YCGALFW +ER  +      P +T CC  GKI+LP +K PP +L  
Sbjct  312   EEYKDDGDLTNECAYCGALFWFNERIGKGRKTRNPVFTMCCMRGKIKLPVLKEPPELLLR  371

Query  680   LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
             L   D+  S+H+ +NIR  N MF FTSLGG+++ SINTG  P +F++ G+NYH IGS+ P
Sbjct  372   LLTNDDVISKHYRDNIRPLNMMFSFTSLGGKIDNSINTGKGPKVFKMHGENYHLIGSVKP  431

Query  860   GGGSMTKLAQRDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRM  985
                   K +Q  ++  +                  I  ++V+E+  ML   NV VK FR 
Sbjct  432   KPNETAKFSQLYIHDTENEVQNRLSALSGNKEKSKIRADLVKEIMEMLRACNVHVKSFRN  491

Query  986   ARTEI-QSNPVVAVKMNLIGRRNKDG  1060
                    ++    + + L+  R +DG
Sbjct  492   VMDRFNDADDTETLSLVLLHTRLQDG  517



>ref|XP_003612653.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1427

 Score =   132 bits (331),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 107/203 (53%), Gaps = 19/203 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +D G     C  CG+  W +ER+++      P ++ CC +G + L  ++ PP  L+ L  
Sbjct  1     MDLGHPNFECEKCGSTMWYNERADKPRRPRNPTFSLCCLKGDVSLEFLEQPPDYLKELLA  60

Query  689   YDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             Y     S  F   IR YN++F FTS+G +++ ++N    P +++ISGQNYH IG L+PG 
Sbjct  61    YKGGRHSVKFREKIRAYNSIFAFTSMGDKIDNTVNLRPGPYVYKISGQNYHRIGGLIPGQ  120

Query  866   GSMTKLAQRDVN------------------SRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   K +Q  V+                  +RD+  +IV  LK+MLD NN + K FRMAR
Sbjct  121   GKQPKFSQLYVHDTENEIQNRLSSLNGGKTARDLDADIVRRLKDMLDMNNSVAKLFRMAR  180

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
               + +     V++ LIG R+ D 
Sbjct  181   DRLSAPDNKEVRIRLIGTRSNDS  203



>ref|NP_001172474.1| Os01g0630700 [Oryza sativa Japonica Group]
 dbj|BAH91204.1| Os01g0630700 [Oryza sativa Japonica Group]
Length=1671

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 122/229 (53%), Gaps = 25/229 (11%)
 Frame = +2

Query  440   FQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YT  613
             F Y+I+K   +  K    T+     +G   + CN+CGALFW  ER     +    +  Y 
Sbjct  132   FSYSILKDYMEILKA---TYPERSYYGGPDYQCNHCGALFWYQERVVSQSSHRAKRIAYN  188

Query  614   KCCYEGKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSIN  790
              CC  GKI LP  +  PP+LQSL  +D    S  F+  IR+YN++F FTSLG  ++RSIN
Sbjct  189   LCCRGGKISLPVHRPFPPILQSLIRFDGGACSSSFMRLIRQYNSLFAFTSLGANIDRSIN  248

Query  791   TGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV------------------NSRDIH  916
             TG+ P +FRI+G  +H IGSL+P  G   + AQ  +                  ++ D+ 
Sbjct  249   TGHGPYVFRINGVVHHRIGSLLPSPGRRPEYAQLYIYDTTNKLQNRLNIFDHADSAVDVP  308

Query  917   E-NIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             +  IV+EL +ML+  N LV+ FR+AR ++ S     + + LIG  +  G
Sbjct  309   DPAIVQELISMLNQCNPLVQQFRLARDKLLSPSAPEIAIKLIGSGHSQG  357



>ref|XP_004295241.1| PREDICTED: uncharacterized protein LOC101312236 [Fragaria vesca 
subsp. vesca]
Length=1713

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 113/206 (55%), Gaps = 25/206 (12%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTR-GLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             +Y+DFGD  + C  C ALFW   R ++NV +   P YT CC EG++++PR K  P  L+ 
Sbjct  130   AYVDFGDMTNVCVDCDALFWL--RESKNVPKNSQPIYTGCCQEGRVRVPRAKPTPAFLEH  187

Query  680   LYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L    N  QS  F  NIR YN+ F FTS+G  V+ ++N G+ P +F+ISGQ YH +GSL+
Sbjct  188   LLDAGNGRQSVEFRKNIRAYNSTFAFTSMGANVDTTVNDGHGPYVFKISGQIYHLMGSLI  247

Query  857   PGGGSMTKLA--------------QRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMAR-  991
             P  G + K A              QR ++  D+  ++   L +M D NN LV+ +R  R 
Sbjct  248   PPVGELPKFAQLYIYDTENEVANRQRAIDGLDL--DVFSRLIDMFDENNELVQYYRSLRN  305

Query  992   ----TEIQSNPVVAVKMNLIGRRNKD  1057
                   ++S  +  + +++IG R  D
Sbjct  306   KYNDASLRSMNLTILDIDMIGDRQYD  331



>gb|ABA99344.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=1025

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 104/198 (53%), Gaps = 22/198 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHE--RSNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLY  685
             +G   + C YCGA+FW  E  +S   VT+    Y  CC   KI LPR++NPP P+   L 
Sbjct  171   YGAPNYECPYCGAIFWYQEGVKSASAVTKRKIVYNLCCKGAKIDLPRIRNPPEPLATLLN  230

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + +S+ F+  IR YN+MF F S+G  V+++INTGN+P +F+I+   +H IGSL+P  
Sbjct  231   FNGDARSKRFLRQIRSYNSMFAFASMGATVDKTINTGNAPYVFKINSVVHHKIGSLLPSR  290

Query  866   GSMTKLAQ-------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
             G   K AQ                    D        +IV  L +MLD  N+LV+ FR A
Sbjct  291   GKQPKFAQLYIYDPENETENRMNIFQHDDSTGERADPSIVRALSDMLDSENMLVQTFRYA  350

Query  989   RTEIQSNPVVAVKMNLIG  1042
             R  +  +    + + L+G
Sbjct  351   RERLAEHGNQTLTLRLMG  368



>gb|AAK54302.1|AC034258_20 putative helicase [Oryza sativa Japonica Group]
 gb|AAP54108.1| AT hook motif-containing protein, putative [Oryza sativa Japonica 
Group]
Length=1573

 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 106/210 (50%), Gaps = 27/210 (13%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHE-----RSNQ----NVTRGLPKYTKCCYEGKIQLPRMKNPP  664
             +FG     C +C AL W  E     RS Q       +  P +  CC +GK+ LP +K PP
Sbjct  160   NFGGPTCMCPHCHALMWHGEKIQSTRSKQPSFSRQRKNQPSFGLCCKQGKVALPPLKEPP  219

Query  665   PVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWI  844
               L SL   D   S ++  NIR YN+MF FTS+GG V+R IN G  P +FR++GQNYH I
Sbjct  220   HFLSSLLARDGGTSENYQQNIRSYNSMFAFTSMGGAVDRKINKGRGPYVFRLNGQNYHHI  279

Query  845   GSLVPGGGSMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLV  970
             G+L+P G +  +  Q        ++ +R            + E  +  L  MLD NN L 
Sbjct  280   GTLLPKGSNKPRFQQLYIYDTENEIKNRIEASRSGTRNASLDEKTIAGLLTMLDENNTLA  339

Query  971   KCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             + FRMAR   + +      + L+  R++DG
Sbjct  340   QTFRMARERFKEDDYHNYTLRLLDNRDQDG  369



>ref|XP_003605521.1| Helicase-like protein [Medicago truncatula]
Length=1262

 Score =   129 bits (325),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 114/204 (56%), Gaps = 18/204 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              Y   G+    C +CGA+ W  ER ++      P+++ CC +G+I++   K  P  L  L
Sbjct  175   DYYSVGEPRFICPWCGAIMWYEERVSKRTDTSNPEFSLCCMQGRIEIAPFKRLPRGLYDL  234

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             Y  ++++S+ F+ NIR +N+MF FTS+G  +N + N GN+P +F ++G+NYH IGSL+P 
Sbjct  235   YHNNDKKSKIFLENIRSFNSMFAFTSMGANINSTNNNGNAPPVFVLNGENYHQIGSLLPK  294

Query  863   GGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
              G   + AQ  +                  + + I + IV+EL+++LD +N  VK +RM 
Sbjct  295   HGDQPRFAQLYIYDTDNELSNRMLSVRMEDDKKSIKKTIVKELRHILDNSNSFVKSYRMV  354

Query  989   RTEIQSNPVVAVKMNLIGRRNKDG  1060
             R  +  +    +K+ ++G+R  DG
Sbjct  355   RDTLLEDNAPQIKLRILGKRGYDG  378



>ref|XP_003605542.1| Helicase-like protein [Medicago truncatula]
Length=1641

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 114/203 (56%), Gaps = 18/203 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y   G+    C +CGA+ W  ER ++      P+++ CC +G+I++   K  P  L  LY
Sbjct  176   YYSVGEPRFICPWCGAIMWYEERVSKRTDTSNPEFSLCCMQGRIEIAPFKRLPRGLYDLY  235

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++++S+ F+ NIR +N+MF FTS+G  +N + N GN+P +F ++G+NYH IGSL+P  
Sbjct  236   HNNDKKSKIFLENIRSFNSMFAFTSMGANINSTNNNGNAPPVFVLNGENYHQIGSLLPKH  295

Query  866   GSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   + AQ  +                  + + I + IV+EL+++LD +N  VK +RM R
Sbjct  296   GDQPRFAQLYIYDTDNELSNRMLSVRMEDDKKSIKKTIVKELRHILDNSNSFVKSYRMVR  355

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
               +  +    +K+ ++G+R  DG
Sbjct  356   DTLLEDNAPQIKLRILGKRGYDG  378



>ref|XP_003605523.1| Helicase-like protein [Medicago truncatula]
Length=1585

 Score =   129 bits (325),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 114/203 (56%), Gaps = 18/203 (9%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y   G+    C +CGA+ W  ER ++      P+++ CC +G+I++   K  P  L  LY
Sbjct  176   YYSVGEPRFICPWCGAIMWYEERVSKRTDTSNPEFSLCCMQGRIEIAPFKRLPRGLYDLY  235

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++++S+ F+ NIR +N+MF FTS+G  +N + N GN+P +F ++G+NYH IGSL+P  
Sbjct  236   HNNDKKSKIFLENIRSFNSMFAFTSMGANINSTNNNGNAPPVFVLNGENYHQIGSLLPKH  295

Query  866   GSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMAR  991
             G   + AQ  +                  + + I + IV+EL+++LD +N  VK +RM R
Sbjct  296   GDQPRFAQLYIYDTDNELSNRMLSVRMEDDKKSIKKTIVKELRHILDNSNSFVKSYRMVR  355

Query  992   TEIQSNPVVAVKMNLIGRRNKDG  1060
               +  +    +K+ ++G+R  DG
Sbjct  356   DTLLEDNAPQIKLRILGKRGYDG  378



>ref|XP_009148379.1| PREDICTED: uncharacterized protein LOC103871829 [Brassica rapa]
Length=1435

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 103/191 (54%), Gaps = 24/191 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER N+      P++  CC +G+++LP ++ PP VL+ L   D++ S+HF  N+R YN
Sbjct  2     WYGERLNKRKNTTKPQFALCCLQGQVKLPLLREPPIVLKRLMEGDDKLSKHFQKNMRPYN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDV  898
              +F FTSLGG+V RS+  G  PS+F++ G+NYH +GSL P  G   K  Q        +V
Sbjct  62    MVFSFTSLGGKVERSVQKGVGPSMFQLQGENYHLMGSLQPNEGKDAKFGQLYIVDTENEV  121

Query  899   NSR-----------------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
             N+R                  +   I++ L  MLD  N  VK FR A+   Q++P  A  
Sbjct  122   NNRANCLSSGKGTFKTQKKDKLKPEIIDLLIKMLDEVNPYVKQFRSAKDRFQTDPEEAFH  181

Query  1028  MNLIGRRNKDG  1060
             M ++  R+KDG
Sbjct  182   MRIVSERSKDG  192



>ref|XP_004309332.1| PREDICTED: uncharacterized protein LOC101313170, partial [Fragaria 
vesca subsp. vesca]
Length=1158

 Score =   129 bits (324),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTR-GLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             +Y+DFGD  + C  C ALFW  E  +++V R   P YT CC EG+I+LP +K  P  L+ 
Sbjct  115   TYVDFGDMTNVCVDCDALFWLPE--SKHVPRDARPIYTGCCQEGRIRLPSVKPTPDFLEY  172

Query  680   LYFYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L   +N  +  +F  NIR YN MF FTS+G  V+ ++N G+ P +F+ISGQ YH +GSLV
Sbjct  173   LLDPNNGIECVNFRKNIRGYNTMFAFTSIGANVDTTVNDGHGPYVFKISGQIYHLMGSLV  232

Query  857   PGGGSMTKLAQRDVNSRD------------IHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
             P  G   K AQ  ++  +            +  +++ +L +M DGNN LV+ +R  R + 
Sbjct  233   PPQGECPKFAQLYIHDTENEVVNRQRVIDGLDPDVISKLIDMFDGNNELVQYYRSIRAKY  292

Query  1001  QSNPVVAVKMNLI  1039
               + + +  + +I
Sbjct  293   DDDSLRSFNLTII  305



>emb|CDY44529.1| BnaCnng11400D [Brassica napus]
Length=548

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+D GD +++C++CGA+ W  ER N+      P ++ C  +G++ LP +K PP VL+ L 
Sbjct  161  YIDEGDPSYTCSHCGAIMWYGERINRRRNTRTPSFSLCSGQGQVVLPFLKEPPEVLKGLI  220

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
            + +++QS+HF  N+R YN +F FTSLGG+V RS+  G  P +F++ G+NYH +GSL P  
Sbjct  221  YGEDKQSKHFQKNLRPYNMVFSFTSLGGKVERSVKKGLGPDMFQLHGENYHLLGSLRPPD  280

Query  866  GSMTKLAQ  889
            G+  K  Q
Sbjct  281  GNSAKFGQ  288



>emb|CDX89707.1| BnaC03g46210D [Brassica napus]
Length=943

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 110/210 (52%), Gaps = 25/210 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHER-SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             Y+D G+     +YC A  W  ER   +  T+  P ++ CC +G+++LP +K  P ++Q L
Sbjct  309   YVDEGNPTFKFDYCNAKMWYDERLERKKRTKKKPVFSLCCGQGQVKLPLLKESPLLIQRL  368

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
              F D++ S+++  NIR  N +F FTSLGG+V+RS+  G+ P  F++ G+N H +GS+ P 
Sbjct  369   LFGDDDMSKYYQENIRSINMLFAFTSLGGKVDRSMPKGHGPQPFQLHGENMHLMGSMKPD  428

Query  863   GGSMTKLAQ-------RDVNSRD-----------------IHENIVEELKNMLDGNNVLV  970
              G   K +Q       R+V+ RD                 + + I+E + NMLD  N  V
Sbjct  429   EGDSAKFSQLYIVDNEREVDDRDSVMSKYKKAADNAKKHNLRKKIIELIINMLDDVNPYV  488

Query  971   KCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             K FR AR    S+      M ++  R K G
Sbjct  489   KQFRSARERFGSSGAEKFHMRIVSNREKYG  518



>emb|CDX85665.1| BnaA02g01480D [Brassica napus]
Length=916

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            YLD GD  + CNYCGA  W  ER  +      PK++ CC +G++QLP +K  P +L+ L 
Sbjct  751  YLDEGDPTYICNYCGAKMWYGERIEKRNKTKKPKFSLCCGQGQVQLPLLKESPEILKRLL  810

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D+E S++F  NIR+ N +F FTSLGG+V+R +  G  P +F++ G+NYH +GSL P  
Sbjct  811  HCDDEISKYFRENIRQLNMVFSFTSLGGKVDRCLPQGRGPKMFQLQGENYHLMGSLKPPA  870

Query  866  GSMTKLAQ  889
            G   K +Q
Sbjct  871  GEEAKFSQ  878



>ref|XP_008660624.1| PREDICTED: uncharacterized protein LOC103639661 [Zea mays]
Length=335

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 116/232 (50%), Gaps = 27/232 (12%)
 Frame = +2

Query  422   AVRCENFQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGL  601
              ++C +F  + VKT          T+H    +G  ++ C +C ALFW +ER   +V    
Sbjct  17    TLQCGHFDPDFVKTIKA-------TYHDRSYYGRPSYQCVHCSALFWHNERIRSSVGTRS  69

Query  602   PKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVN  778
               Y  CC  GK+++P  +  P  L SL  +D +  S++F+ NIR+YN +F FTS+G  ++
Sbjct  70    VIYNSCCKGGKVRIPAYRPRPEPLLSLARFDGDVVSKNFMQNIRQYNCLFAFTSMGAHID  129

Query  779   RSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--------------RDVNSRD--  910
             RS+N G  P +F+I GQ +H IGSL+P      K  Q              R ++S D  
Sbjct  130   RSLNDGRGPPVFKICGQIHHRIGSLLPMTDQPPKFLQLYVYDTSHEVNNRIRSLSSDDAP  189

Query  911   ---IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
                I   IV EL  MLD +N   K FR+A+  +  +      + +IG +  D
Sbjct  190   DSPIQPQIVHELLQMLDTHNPFAKKFRIAKERLIEHADEEFIIRIIGAKEGD  241



>emb|CDY06491.1| BnaC06g11530D [Brassica napus]
Length=416

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 96/189 (51%), Gaps = 25/189 (13%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD  H C +CGA+ W                      G++QLP +K  PP LQ L 
Sbjct  150   YIDDGDPTHKCEHCGAIMWY---------------------GQVQLPLLKESPPTLQRLL  188

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSP-SIFRISGQNYHWIGSLVPG  862
             +  + +SR+F  NIR+ N +F FTSLGGR +RS+  G  P  +F + G+NYH +GSL P 
Sbjct  189   YGIDAKSRYFRENIRQLNMVFSFTSLGGRCDRSVQRGCGPLKMFVLQGENYHLMGSLKPP  248

Query  863   GGSMTKLAQRDVNS---RDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMN  1033
              G   K  ++   S     I   +++ L  ML+  N  V  FR A+    +NP  A  M 
Sbjct  249   PGDPAKKYKKSAESSKKETIRNQVIDSLLKMLNEVNPYVHQFRSAKDRFNTNPEEAFHMR  308

Query  1034  LIGRRNKDG  1060
             ++  R KDG
Sbjct  309   IVSSREKDG  317



>ref|XP_009108853.1| PREDICTED: uncharacterized protein LOC103834536 [Brassica rapa]
Length=336

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 0/115 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+D GDA H C +CGA+ W  ER N+      PK++ CC  G++QLP +K  P +L+   
Sbjct  222  YIDEGDATHKCEHCGAIMWYGERINRKRYTRKPKFSMCCGHGQVQLPLLKESPAILKRFL  281

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGS  850
              D+E SR+F  NIR  N +F FTSLGG+V+RS+  G  P +F++ G+NYH +GS
Sbjct  282  TEDDEMSRYFRENIRVINMVFSFTSLGGKVDRSVKKGIGPQMFQLQGENYHLMGS  336



>ref|XP_006388350.1| hypothetical protein POPTR_0214s00230g, partial [Populus trichocarpa]
 gb|ERP47264.1| hypothetical protein POPTR_0214s00230g, partial [Populus trichocarpa]
Length=804

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 113/210 (54%), Gaps = 24/210 (11%)
 Frame = +2

Query  494   TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
             + + Y+DFGD    C++C A FW  E+  ++ T+  P+++ CC  GKI+LPR  + P VL
Sbjct  139   SINEYIDFGDKTFKCSHCKAFFWLDEKLARS-TKTNPQFSLCCLGGKIRLPRPLSTPHVL  197

Query  674   QSLYFYD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGS  850
               L      E S+ F  NIR YN+MF FTS+G  ++ S+N    P +F+I+G  +H +GS
Sbjct  198   DKLLDPAFGEASKKFRTNIRAYNSMFAFTSMGANIDHSVNCRPGPYVFKINGHCHHLMGS  257

Query  851   LVPGGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKC  976
             L+P  G   K AQ  +                  ++  + E++V++L +ML+  N LV  
Sbjct  258   LLPSDGETPKFAQLYIYDTTNEVANRLAPFPHGSSASTLDESVVKDLIDMLNSTNCLVGL  317

Query  977   FRMA--RTEIQSNPVVAVKMNLIGRRNKDG  1060
             FR A  R  +  NP    K+ L+G+R  D 
Sbjct  318   FRHASQRLSMSDNP--GYKLRLLGQRTHDS  345



>ref|XP_010469634.1| PREDICTED: uncharacterized protein LOC104749655 [Camelina sativa]
Length=1270

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +2

Query  503  SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             YLD GD  + C YCGA+ W  ER N+      PK++ CC +G ++LP ++  P +++ L
Sbjct  257  EYLDHGDPTYKCCYCGAMMWYDERVNKRRRSRKPKFSLCCLQGTVKLPFLREAPELIREL  316

Query  683  YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               D+  SRHF  NIR YN +F FTSLGG+VNR+   G  P  F++ GQN H IGS+ P 
Sbjct  317  LSKDDALSRHFRENIRAYNMLFAFTSLGGQVNRTAEKGQGPKQFQLHGQNLHKIGSMKPE  376

Query  863  GGSMTKLAQ  889
             G   K +Q
Sbjct  377  DGDYAKFSQ  385



>emb|CDY13504.1| BnaA03g52220D [Brassica napus]
Length=683

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 100/188 (53%), Gaps = 13/188 (7%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD   SC YCGA+ W  ER  ++  R  P +T CC +G++QLP +K PP VL +L 
Sbjct  234   YVDEGDPTESCGYCGAIMWYGERIRKSEYRRKPIFTLCCMQGQVQLPLLKKPPDVLMNLL  293

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP--  859
                ++ S+HF  N R YN +F FTSL          G  P +  + G+NYH +GSL P  
Sbjct  294   TGTDKLSKHFQKNTRPYNMIFSFTSL----------GRGPQMLVLHGENYHLMGSLTPPE  343

Query  860   GGGSMTKLAQRDVNSRD-IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNL  1036
             GG +  +   R   + D + ++I+  +  ML+  N  V  FR A    + +P     M +
Sbjct  344   GGNAKGRKNARSERTEDGLKKDIILPIMKMLNDVNPYVAQFRSASERFRMDPEKTFHMRI  403

Query  1037  IGRRNKDG  1060
             + R +KDG
Sbjct  404   VSRSDKDG  411



>ref|XP_003616288.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1567

 Score =   127 bits (319),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 101/193 (52%), Gaps = 18/193 (9%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  C  +    ERS ++ +      + CC +GKI LP M  PPP+L+ L+   + +S HF
Sbjct  169   CVDCNVMMELRERSRRDSSTLSHDVSMCCMKGKITLPYMIEPPPLLRQLFNGLHPRSGHF  228

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRD  895
             + NIR YNN+F FTS+GG++   IN G  P  F ISGQNYH IG L+P  G   K  Q  
Sbjct  229   LANIRSYNNLFSFTSMGGKIETEINRGQGPPHFVISGQNYHRIGCLLPADGERPKFCQLY  288

Query  896   V------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
             +                  +  ++  +++EEL +++D +N LVK FRM R     N  V 
Sbjct  289   IYDTENELANRMAHFSGRSDESNLDSSLIEELLSLMDEHNKLVKSFRMVRDFCVQNDNVP  348

Query  1022  VKMNLIGRRNKDG  1060
             V++ L   RN D 
Sbjct  349   VRLRLFRNRNFDA  361



>ref|XP_004301602.1| PREDICTED: uncharacterized protein LOC101297157 [Fragaria vesca 
subsp. vesca]
Length=729

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 102/177 (58%), Gaps = 16/177 (9%)
 Frame = +2

Query  503  SYLDFGDAAHSCNYCGALFWRHERSNQNVTR-GLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
            +Y+D GD  + C  C ALFW  E  ++ + R G P YT CC EG+I+LP ++  P  L+ 
Sbjct  61   AYVDVGDMTNVCIDCHALFWLQE--SKFIRRNGSPVYTGCCQEGRIRLPPVRPAPVFLEY  118

Query  680  LYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
            L    N ++S  F NNIR YN MF FTS+G  V++++  G+ P +F+ISGQ YH +GSL+
Sbjct  119  LLDSTNGQKSVEFRNNIRSYNTMFAFTSMGANVDKTVTDGHGPYVFKISGQVYHLMGSLI  178

Query  857  PGGGSMTKLAQ-------RDVNSRD-----IHENIVEELKNMLDGNNVLVKCFRMAR  991
            P  G   K AQ        +V +R      +   IV  L +MLD +N LV+ FR  R
Sbjct  179  PPEGECPKFAQLYIYDTENEVANRQKAVDGLDSEIVTRLIDMLDESNELVQYFRSVR  235



>emb|CDY32193.1| BnaA03g54740D [Brassica napus]
Length=425

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (64%), Gaps = 0/121 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+D GDA H C +CGA+ W  ER N+      PK++ C   G++QLP +K  P +L+   
Sbjct  281  YIDEGDATHKCEHCGAIMWYGERINRKRYARKPKFSMCWGHGQVQLPLLKESPAILKRFL  340

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D+E SR+F  NIR  N +F FTSLGG+V+RS+  G  P +F++ G+NYH +GSL P  
Sbjct  341  TEDDEMSRYFRENIRVINMVFSFTSLGGKVDRSVKKGIGPQMFQLQGENYHLMGSLKPPN  400

Query  866  G  868
            G
Sbjct  401  G  401



>emb|CDY09407.1| BnaA02g26030D [Brassica napus]
Length=732

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 103/209 (49%), Gaps = 24/209 (11%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+D GD    C +CG + W  ER  +      PK+  CC +G++QLP +K  P +L+ L 
Sbjct  259   YVDEGDPTFKCEHCGTIMWYGERIEKKKQNKKPKFALCCGQGQVQLPLLKQSPEILKKLL  318

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++E S+++  NIR+ N +F FTSLGG+++RS   G+ P +  + G+NYH +GSL P  
Sbjct  319   TDNDEISKYYRENIRQINMVFSFTSLGGKIDRSAPQGSGPKMVVLQGENYHLMGSLKPPP  378

Query  866   GSMTKLAQRDVNSRD------------------------IHENIVEELKNMLDGNNVLVK  973
             G   K  Q  +   D                        + + ++E L  MLD  N  V 
Sbjct  379   GEDPKFGQLYIVDTDNEIQNRSSIIGKYKTKQEKAKKERLRKQVIERLVKMLDEVNPYVH  438

Query  974   CFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              FR AR    + P   + M ++  R KDG
Sbjct  439   QFRTARERFNTFPEETLHMRIVSSREKDG  467



>gb|EEC77078.1| hypothetical protein OsI_15477 [Oryza sativa Indica Group]
 gb|EEE60800.1| hypothetical protein OsJ_14396 [Oryza sativa Japonica Group]
Length=465

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 100/207 (48%), Gaps = 21/207 (10%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             S L+ G  +H+C YCGALFW  ER ++      P Y KCC  G + LP  K PP  L SL
Sbjct  54    SPLNLGPPSHTCCYCGALFWYEERIDRRRHTTRPLYNKCCKGGSVILPSYKPPPEPLHSL  113

Query  683   Y-FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                 D  +S HF  NIR YN+MF FTS+G  V  SIN G  P  F+ SGQ  H IGSL+P
Sbjct  114   LTAVDRAKSAHFCENIRYYNSMFAFTSMGVNVIDSINDGRGPYTFKRSGQLCHRIGSLLP  173

Query  860   GGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRM  985
                   + AQ  +                   +   +E IV  L  M D +N +VK FR+
Sbjct  174   KRDKRPEYAQLYIFDTQNELMNRLRVGTYKNRAFQPNEEIVAALMQMFDAHNPIVKLFRV  233

Query  986   ARTEIQ--SNPVVAVKMNLIGRRNKDG  1060
             AR  +     P     + L G  +K G
Sbjct  234   ARDRLSRAGAPDDHYFIRLFGSPDKHG  260



>emb|CAE02213.2| OSJNBb0002N06.2 [Oryza sativa Japonica Group]
 emb|CAE05848.2| OSJNBa0091C07.10 [Oryza sativa Japonica Group]
Length=443

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 100/207 (48%), Gaps = 21/207 (10%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             S L+ G  +H+C YCGALFW  ER ++      P Y KCC  G + LP  K PP  L SL
Sbjct  32    SPLNLGPPSHTCCYCGALFWYEERIDRRRHTTRPLYNKCCKGGSVILPSYKPPPEPLHSL  91

Query  683   Y-FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                 D  +S HF  NIR YN+MF FTS+G  V  SIN G  P  F+ SGQ  H IGSL+P
Sbjct  92    LTAVDRAKSAHFCENIRYYNSMFAFTSMGVNVIDSINDGRGPYTFKRSGQLCHRIGSLLP  151

Query  860   GGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRM  985
                   + AQ  +                   +   +E IV  L  M D +N +VK FR+
Sbjct  152   KRDKRPEYAQLYIFDTQNELMNRLRVGTYKNRAFQPNEEIVAALMQMFDAHNPIVKLFRV  211

Query  986   ARTEIQ--SNPVVAVKMNLIGRRNKDG  1060
             AR  +     P     + L G  +K G
Sbjct  212   ARDRLSRAGAPDDHYFIRLFGSPDKHG  238



>ref|XP_008358607.1| PREDICTED: uncharacterized protein LOC103422335 [Malus domestica]
Length=566

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 102/197 (52%), Gaps = 19/197 (10%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              Y+DFG     C YCGALFW  E+S +N +    ++T CC   K++ PR+K   P L  L
Sbjct  106   EYVDFGLRNCQCQYCGALFWSXEQSAKNASSSTLQFTTCCMSQKVKFPRVKPTXPYLDDL  165

Query  683   YFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                 N + S  F  NIR YN+M   TS+G +V+ SIN G  P +F+I+GQ +H +GSL+P
Sbjct  166   LNPKNSRNSLQFKTNIRSYNSMMXLTSMGAKVDASINKGRGPYVFKINGQVHHLMGSLLP  225

Query  860   GGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRM  985
               G   K A       Q +V++R            +  ++V+ L  MLD  N + K FR+
Sbjct  226   LEGEXPKFAQLYIHDTQNEVSNRIGCFSGSETVEKLDHHVVDGLIKMLDECNEVXKLFRL  285

Query  986   ARTEIQSNPVVAVKMNL  1036
             AR  I       + + L
Sbjct  286   ARDMIDEGSTSHLXLRL  302



>ref|XP_006465121.1| PREDICTED: uncharacterized protein LOC102624919 [Citrus sinensis]
Length=698

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 95/164 (58%), Gaps = 19/164 (12%)
 Frame = +2

Query  626   EGKIQLPRMKNPPPVLQSLYFYDNEQS-RHFINNIRRYNNMFCFTSLGGRVNRSINTGNS  802
             EG++Q+P MK  PP+L+ L   D+ Q    F  NIR YN+MF FTS+GGRV+ SIN    
Sbjct  2     EGRVQIPFMKETPPLLKYLLGADSGQKGSKFRKNIRAYNSMFAFTSMGGRVDASINRSKG  61

Query  803   PSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDVNSR-----------DIHENIV  928
             P +FR+SGQNYH IGSL+P  G   + AQ        ++++R           +I   I+
Sbjct  62    PYVFRMSGQNYHHIGSLLPEVGKKPQFAQLYIYDTENEIDNRINTLLKHGMKTEIDHEIL  121

Query  929   EELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              EL  MLD +N LVK FRMAR   ++ P    ++ L+  R +DG
Sbjct  122   HELSKMLDQHNNLVKSFRMARDRYKTQPESTFRLRLLNSRTRDG  165



>ref|XP_008656968.1| PREDICTED: uncharacterized protein LOC103636387 [Zea mays]
Length=410

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 114/232 (49%), Gaps = 27/232 (12%)
 Frame = +2

Query  422   AVRCENFQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGL  601
              ++C +F  N VKT          ++H    +G  ++ C +C ALFW  ER   +V    
Sbjct  56    TLQCGHFDPNFVKTIKA-------SYHDRSYYGRPSYQCIHCSALFWHGERIRSSVGTRS  108

Query  602   PKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVN  778
               Y  CC  GK+++P  +  P  L SL  +D +  S+ F+ NIR+YN +F FTS+G  ++
Sbjct  109   VIYNSCCKGGKVRIPAYRPRPEPLLSLARFDGDVVSKTFMQNIRQYNCLFAFTSMGAHID  168

Query  779   RSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--------------RDVNSRD--  910
             RS+N G  P +F++ GQ +H IGSL+P      K  Q              R ++S D  
Sbjct  169   RSLNDGRGPPVFKVCGQIHHRIGSLLPMTDQPPKFLQLYVYDTSHEVNNRIRSLSSDDAP  228

Query  911   ---IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
                I   IV EL  MLD +N   K FR+A+  +  +      + +IG +  D
Sbjct  229   DSPIQPQIVNELLQMLDTHNPFAKKFRIAKERLTEHADEEFIIRIIGAKEGD  280



>ref|XP_010507052.1| PREDICTED: uncharacterized protein LOC104783614 [Camelina sativa]
Length=964

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+D GD    C+YCGA+ W  E+ N+       K++ CC +G ++LP +K  P +++ L 
Sbjct  285  YVDHGDPTFKCSYCGAMMWYDEQINKRRRSRKLKFSLCCLQGTVKLPLLKEAPELIRKLL  344

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D+  SRHF  NIR YN +F FTS+GG+V+RS+  G  P  F++ GQN+H IGSL P  
Sbjct  345  SKDDALSRHFRENIRAYNMLFAFTSVGGQVDRSVEKGKGPKQFQLHGQNFHKIGSLKPED  404

Query  866  GSMTKLAQ  889
            G   K +Q
Sbjct  405  GDYAKFSQ  412



>ref|XP_003605676.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1561

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 105/201 (52%), Gaps = 18/201 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             + FG    +C  C A  W  ERS ++       ++ CC +GK++LP +  PP +L SL  
Sbjct  195   IHFGQPEFTCKRCFAELWYEERSEKSRRGSDIDFSICCQKGKVELPLITRPPRLLLSLIN  254

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
               + +S+HF +N R YN+MF FTS+GG +  +IN G  P  F + GQNYH IGSL+P  G
Sbjct  255   GYDRRSKHFKDNYRAYNSMFAFTSMGGNIQTTINNGGGPPQFILGGQNYHRIGSLLPEPG  314

Query  869   SMTKLAQ-----------------RDVNSRD-IHENIVEELKNMLDGNNVLVKCFRMART  994
             +  K AQ                 R  NS D I  ++V++L  M+D  N L K FR  R 
Sbjct  315   TTPKFAQLYIYDTQNEVENRAGHFRSGNSSDKIDISLVKDLTKMIDEYNPLSKSFRKVRD  374

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +++    ++ + L  +R  D
Sbjct  375   MVEAGNAPSLALRLFRKRAND  395



>ref|XP_010451755.1| PREDICTED: uncharacterized protein LOC104733928 [Camelina sativa]
Length=649

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            YLD GDA + C YCGAL W  ER NQ   +  P +T CC +G ++LP +K  P +++ L 
Sbjct  79   YLDHGDATYKCKYCGALMWFKERINQRRNQKDPIFTLCCGQGSVKLPFLKESPELIKKLL  138

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              ++  SR++  NIR +N +F  TSLGG+V++S+  G  P++FR+ G NYH IGSL P  
Sbjct  139  KGNDAMSRNYRENIRIFNMIFAMTSLGGKVDQSMPKGKGPNMFRLQGGNYHLIGSLKPND  198

Query  866  GSMTKLAQ  889
            G   K +Q
Sbjct  199  GDYAKYSQ  206



>gb|AAG51081.1|AC027032_1 hypothetical protein [Arabidopsis thaliana]
Length=1678

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 107/205 (52%), Gaps = 24/205 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             YLD GD  + C YCGA+ W  ER  +  T     +T CC EG ++LP +K  P +L++L 
Sbjct  325   YLDHGDPTYKCKYCGAMMWYDERIRKKETNKESVFTLCCGEGSVKLPFLKESPHLLKNLL  384

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++  S+H+ +N R +N +F  TS GG+V++S+  G  P++FR+ G NYH IGSL    
Sbjct  385   SGNHPLSKHYRDNARIFNMVFAMTSFGGKVDKSMPKGRGPAMFRLQGGNYHLIGSLKLTP  444

Query  866   GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
             G   K +Q        +V +R                 ++ +N++E +  ML+  N  V+
Sbjct  445   GDYAKYSQLYIIDTENEVENRATVINKGKNAKPASGKPNLDKNLIEAIIKMLNRCNPYVR  504

Query  974   CFRMARTEIQSNPVVAVKMNLIGRR  1048
              FR AR  IQ+N      M +I  R
Sbjct  505   RFRTARERIQTNDEEPFHMRIIADR  529



>emb|CDX89838.1| BnaA10g02440D [Brassica napus]
Length=526

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 102/182 (56%), Gaps = 7/182 (4%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             +Y+D GDA ++C YCGA+ W  ER  + +    P+++ CC +G++QLP +K PP VL++L
Sbjct  122   AYIDEGDATYTCTYCGAIMWFGERLKRRLKTKNPQFSLCCMKGQVQLPLLKQPPEVLKNL  181

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                D++ S+HF  N R YN +  FTSLGG+++RS+  G  P++  +  +N     S    
Sbjct  182   LNGDDKLSKHFQRNTRAYNMVLSFTSLGGKIDRSVRKGKGPNMLVLQAENRTKALS----  237

Query  863   GGSMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIG  1042
              G  +K  ++   S  + + I+  L  ML+  N  VK FR A+     NP  +  M + G
Sbjct  238   KGRQSKAYKK---SDGLKKEIIGLLIKMLNETNPYVKQFRSAKDRFTINPKDSFHMRIDG  294

Query  1043  RR  1048
              R
Sbjct  295   FR  296



>gb|AAX95750.1| Eukaryotic protein of unknown function (DUF889), putative [Oryza 
sativa Japonica Group]
 gb|ABG65978.1| hypothetical protein LOC_Os10g12174 [Oryza sativa Japonica Group]
Length=1806

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 110/198 (56%), Gaps = 22/198 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY-  685
             +G   + C YC A+FW  ER  S   +++    Y  CC  GKIQLP+++ PP  L++L  
Sbjct  234   YGAPTYECLYCVAVFWFQERVKSLSAISKRKIVYNLCCKSGKIQLPKLREPPEPLKTLLK  293

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + +S+ F+  +R YN+MF FTS+G  ++R+IN G++P +F+I+G  +H IGSL+P  
Sbjct  294   FNGDARSKRFLRQVRSYNSMFAFTSMGATIDRTINNGSAPYVFKINGVVHHKIGSLLPAQ  353

Query  866   GSMTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMA  988
             G   + AQ  +        N  +I EN           IV+ L  MLD +N LV+ F  A
Sbjct  354   GRRPQFAQLYIYDPENEIQNRINIFENDGSNSDKADPAIVDALCTMLDSHNTLVQKFHYA  413

Query  989   RTEIQSNPVVAVKMNLIG  1042
             R  +  +   ++ + L+G
Sbjct  414   RERLNEHGNQSLTLRLMG  431



>emb|CDY67960.1| BnaAnng25720D [Brassica napus]
Length=485

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y D GD ++ C YC A  W  ER ++ +    P +T CC++GK+ LP +K PP  L SL 
Sbjct  36   YYDDGDPSYVCGYCQAYMWFGERISKRLVGVNPIFTMCCHKGKVNLPILKAPPKTLLSLL  95

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
            +  NE   HF   IR YN MF FTSLGG+VN +IN G+ P +F++ G+NYH IG ++P 
Sbjct  96   YNKNETRSHFRELIRAYNMMFSFTSLGGQVNHAINNGSGPYVFQLCGENYHLIGGILPA  154



>ref|XP_009789935.1| PREDICTED: uncharacterized protein LOC104237479 [Nicotiana sylvestris]
Length=913

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 92/160 (58%), Gaps = 15/160 (9%)
 Frame = +2

Query  626   EGKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNS  802
             EG+++LP M  PPP L+ L   D+ Q    F  NI  YN+MF FTS+GGRV+RSIN    
Sbjct  2     EGRVRLPLMSQPPPYLKYLLSTDSGQLGISFRKNIIVYNSMFAFTSMGGRVDRSINRSKG  61

Query  803   PSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRD----------IHEN----IVEELK  940
             P +FR+SGQNYH IGSL+P  G   + AQ  +   +          +HE     IV+ L 
Sbjct  62    PYVFRMSGQNYHHIGSLLPKTGKKPQFAQHYIYDTENEIHNRMNSLLHEEVDPKIVQGLS  121

Query  941   NMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              MLD +N+L K FRMAR   + +P    ++ L+  R +DG
Sbjct  122   EMLDEHNILAKIFRMARDRYKQHPESVFRLRLLSDRTRDG  161



>ref|XP_010456611.1| PREDICTED: uncharacterized protein LOC104738072 [Camelina sativa]
Length=1340

 Score =   124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 102/205 (50%), Gaps = 24/205 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             YLD GD  + C +CGA  W  ER N+      P ++ C  +G +QLP  K  P  ++ + 
Sbjct  23    YLDHGDPEYKCQFCGAFMWYDERLNKRRNANNPSFSLCFLQGTVQLPLFKESPEFIKKML  82

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                +  S+HF NN+R Y+ +F  TSLGG+V+++++ G  P++F++ G NYH IGS+ P  
Sbjct  83    TGTDRLSKHFQNNLRGYDMVFAITSLGGKVDKTVHQGKGPNMFQLQGSNYHLIGSMKPKE  142

Query  866   GSMTKLAQ-------------RDVNS-----------RDIHENIVEELKNMLDGNNVLVK  973
                 K +Q             + V S           +++ + I+E L  MLD  N+ VK
Sbjct  143   KDYAKFSQLYNVDTENEVPNRQTVMSKSKTSTTGGGKKNLKKEIIEPLIKMLDEVNLYVK  202

Query  974   CFRMARTEIQSNPVVAVKMNLIGRR  1048
              FR A     SN      M +I  R
Sbjct  203   HFRAASYRFASNADETFHMRIISDR  227



>gb|ABD65060.1| hypothetical protein 27.t00039 [Brassica oleracea]
Length=1367

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 93/187 (50%), Gaps = 20/187 (11%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER  +      P +T CC  GK+ LPR+ NPP  L +L    +E S+H+   IR YN
Sbjct  2     WYGERIGKRRRSANPVFTMCCKHGKVVLPRLANPPMELMTLLCKGDELSKHYREFIRAYN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV-------  898
              MF FTSLGG+++ SIN G  P +FR+SG+NYH IG +VP      K +Q  +       
Sbjct  62    MMFSFTSLGGKIDHSINNGRGPFVFRMSGENYHRIGDIVPEPRQAPKFSQLYIIDTLNEI  121

Query  899   -------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
                           ++ + E +V  LKNMLD  N  VK FR AR           +M LI
Sbjct  122   KNRLDAYAGSDRAAAKKLREPLVLLLKNMLDQCNPHVKAFRSARERFDVEGSTGYRMRLI  181

Query  1040  GRRNKDG  1060
               R  DG
Sbjct  182   ESRQSDG  188



>ref|XP_010689165.1| PREDICTED: uncharacterized protein LOC104902921 [Beta vulgaris 
subsp. vulgaris]
Length=1422

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 105/215 (49%), Gaps = 18/215 (8%)
 Frame = +2

Query  416   CFAVRCENFQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTR  595
             C  +  ++ Q++  +   +E  Y   T   Y D GD    C +CGA  W  ERSN+  T 
Sbjct  14    CNGMNAQDLQHDHDEESVEE--YDVNTLTGYWDIGDPTSECEFCGAQMWFDERSNKQNTT  71

Query  596   GLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRV  775
               PK++ CC +GK+QLP ++ PP  L +L    +++S HF  NIR YN MF FTS+GG+ 
Sbjct  72    SKPKFSLCCMQGKVQLPLLQRPPSFLANLLEKKHKRSNHFFENIRAYNMMFSFTSMGGQ-  130

Query  776   NRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRDIHENIVEELKNMLDG  955
                   G   S   I       +           K A    N     + ++ E++ M+D 
Sbjct  131   ------GPKFSQLYIYDTQDEIVNR---------KKAACATNPNKFEDQVISEIQTMVDE  175

Query  956   NNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              N L K FRMAR    S+    V++ LIGRR+ DG
Sbjct  176   YNALAKNFRMARDRFCSSTCRNVRLKLIGRRDSDG  210



>emb|CDY47315.1| BnaAnng08890D [Brassica napus]
Length=606

 Score =   121 bits (304),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 102/186 (55%), Gaps = 23/186 (12%)
 Frame = +2

Query  503  SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
            SY D+GDA   C +C AL W +ER N+      PK++ CC  GKI+LP     P VL  L
Sbjct  133  SYEDYGDATWLCEHCNALMWYNERINKRRNCIPPKFSMCCMHGKIELPPPPVLPQVLLDL  192

Query  683  YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             F  + +S +FI NIR YN+MF FTS+GG ++ S+N G  P +FR+ GQN+H IGSL+P 
Sbjct  193  LFRGDSESINFIENIRAYNSMFAFTSMGGEIDASVNNGRGPFVFRLHGQNFHQIGSLLPE  252

Query  863  GG---SMTKL------------------AQRDVNS--RDIHENIVEELKNMLDGNNVLVK  973
             G   + T+L                   +R  NS  R + ++ VE +K+MLD      K
Sbjct  253  EGLPPAFTQLYIFDTENEVRNRISAFSSKRRAPNSQPRTLRDDTVEAIKSMLDECKPYAK  312

Query  974  CFRMAR  991
              R AR
Sbjct  313  ILRTAR  318



>emb|CDX71614.1| BnaC09g26550D [Brassica napus]
Length=884

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            YLD GD  + C+YCGA  W  ER  +      PK++ CC  G++QLP +K  P +L+ L 
Sbjct  734  YLDEGDPTYICDYCGAKMWYGERIEKKRMSKKPKFSLCCGLGQVQLPLLKESPEILKILL  793

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
              D+E S +F  NIR+ N +F FTSLGG+V+R +  G  P +F++ G+NYH +GSL P  
Sbjct  794  HGDDEISSYFRENIRQLNMVFSFTSLGGKVDRCLPQGRGPKMFQLQGENYHLMGSLKPPA  853

Query  866  GSMTKLAQ  889
            G   K +Q
Sbjct  854  GEEPKFSQ  861



>ref|XP_007221236.1| hypothetical protein PRUPE_ppb022397m2g, partial [Prunus persica]
 gb|EMJ22435.1| hypothetical protein PRUPE_ppb022397m2g, partial [Prunus persica]
Length=382

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 88/175 (50%), Gaps = 34/175 (19%)
 Frame = +2

Query  500  HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
              Y DFG+  H C YCGALFW  E   Q      P +T CC +GKI+L R K        
Sbjct  3    QEYADFGEKNHKCIYCGALFWLQESIKQRSKNNEPLFTLCCQQGKIKLQRKK--------  54

Query  680  LYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
                    S  F  NIR YN+MF FTS+G ++++SIN G+SP +F+ISGQ +H +GSL+P
Sbjct  55   --------SVLFRENIRVYNSMFAFTSMGAKIDKSINNGSSPYVFKISGQVHHLMGSLLP  106

Query  860  GGGSMTKLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLV  970
              G   K AQ  +                   +  + +NIV+ L  M D  N L+
Sbjct  107  LEGQCPKFAQLYIYDTHNEVMNRLDVVNCNQKNEKLDQNIVKGLIQMFDETNELI  161



>emb|CAE02205.2| OSJNBa0095H06.12 [Oryza sativa Japonica Group]
Length=1724

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 109/201 (54%), Gaps = 24/201 (12%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQN--VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             D+G   + C  C A FW  E+  ++  +T+    Y  CC  GKI +P    PP  L SL 
Sbjct  227   DYGPPEYRCRMCAAQFWYQEQCKKDSAITKRRVCYNLCCKGGKIFVPPFAQPPEPLNSLL  286

Query  686   FYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
              +D + +S+HF+ +IR+YN++F FTS+G  ++ S+N G  P +F+I+GQ YH IGSL+P 
Sbjct  287   KFDGDARSKHFLQHIRQYNSLFSFTSMGADIDDSLNQGGGPYVFKINGQVYHRIGSLLPN  346

Query  863   GGSMTKLA-------QRDVNSR------------DIHENIVEELKNMLDGNNVLVKCFRM  985
               +  K A       Q +V +R            D+   I  EL +MLD  N LVK FR+
Sbjct  347   EDNPPKFAQLYIYDTQNEVQNRMLAVLGEENGSCDLDPEIAAELLDMLDNCNPLVKQFRL  406

Query  986   ARTEI--QSNPVVAVKMNLIG  1042
              R  +    +  +A+K+++ G
Sbjct  407   TRDRLAEHGDEQLAIKISIPG  427



>ref|XP_009760977.1| PREDICTED: uncharacterized protein LOC104213222 [Nicotiana sylvestris]
Length=348

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 83/138 (60%), Gaps = 18/138 (13%)
 Frame = +2

Query  701   QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTK  880
             +S++F  NIR YN++F FTS+GG+V+ S+N    P  FR+SGQNYH IGSL+P  GS  K
Sbjct  198   KSKYFRENIRTYNSIFAFTSMGGKVDFSVNKTKGPRTFRLSGQNYHQIGSLLPPEGSSPK  257

Query  881   LAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQS  1006
              AQ        +V +R            +H  IV ELK MLD NNVL K FRM R + Q+
Sbjct  258   FAQLYIYDTENEVENRIHAISRGEMNNQLHVEIVNELKQMLDDNNVLAKSFRMVRDQFQT  317

Query  1007  NPVVAVKMNLIGRRNKDG  1060
             +    V++ LIG+R  DG
Sbjct  318   DGTSNVRLRLIGKRGSDG  335



>ref|XP_009120083.1| PREDICTED: uncharacterized protein LOC103845004 [Brassica rapa]
Length=675

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 93/182 (51%), Gaps = 20/182 (11%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y D GD   +C +C A  W  +R  +      P +T CC  GK+ LP + N P  L +L 
Sbjct  109  YYDDGDPGWNCTFCQAYMWYGKRIVKRRRSSKPVFTMCCKRGKVVLPWLANTPMDLMTLL  168

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               ++ S+H+   IR YN MF FTSLGG++  SIN G+ P +FR+SG+NYH IG +VP  
Sbjct  169  CKGDKLSKHYREFIRAYNMMFSFTSLGGKIYHSINNGHGPFVFRMSGENYHRIGDIVPEP  228

Query  866  GSMTKLAQRDV--------------------NSRDIHENIVEELKNMLDGNNVLVKCFRM  985
            G   K +   +                     ++ + E +V  LKNMLD  N  VK FR 
Sbjct  229  GQAPKFSHLYIVDTLNEIKNRLDAYAGSNRAAAKKLREPLVLLLKNMLDQCNPHVKAFRS  288

Query  986  AR  991
            AR
Sbjct  289  AR  290



>emb|CDY04215.1| BnaC06g26000D [Brassica napus]
Length=769

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 8/141 (6%)
 Frame = +2

Query  458  KTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKI  637
            +T CKE          Y+D GD  ++C+ CGA+ W  ER N++     P ++ CC +G++
Sbjct  482  QTSCKEL--------GYIDDGDPTYTCSNCGAIMWFVERINKSQKTRKPIFSLCCMQGQV  533

Query  638  QLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFR  817
            QLP +K PP ++  L   D+  S+HF  N R YN +F FTS+GG   R+   G  P +F+
Sbjct  534  QLPLLKEPPEIITRLLTGDDPLSKHFQKNTRPYNMVFSFTSIGGNCERAAQKGCGPQMFQ  593

Query  818  ISGQNYHWIGSLVPGGGSMTK  880
            I G+NYH +GSL P  G+ T+
Sbjct  594  IHGENYHLVGSLKPNDGADTE  614



>emb|CDX82848.1| BnaC01g12980D [Brassica napus]
Length=634

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 105/205 (51%), Gaps = 19/205 (9%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
              YLD GD  + C+YCGA  W  ER  +      PK++ CC  G++QLP +K  P VL  L
Sbjct  42    EYLDEGDPTYICDYCGAKMWYGERIEKKRKIKKPKFSLCCGLGQVQLPLLKESPEVLPRL  101

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                +++ SR+F  NIR+ N +F FTSLGG+V+R +  G  P +F++ G+NYH +GSL P 
Sbjct  102   LHGEDDMSRYFRENIRQINMVFSFTSLGGKVDRCVLQGRGPKMFQLQGENYHLMGSLKPP  161

Query  863   GGSMTKLAQ-RDVNSRDIHEN---IVEELKNMLDGN--------------NVLVKCFRMA  988
              G     +Q   V++ +  EN   I+ + K  +D                 +L K   M 
Sbjct  162   DGEEANFSQLYIVDTENGIENRAAIIGKYKKSVDKAKKESLRKQVIQKIVEMLTKLIHMC  221

Query  989   RTEIQ-SNPVVAVKMNLIGRRNKDG  1060
                 Q +NP     M ++  R KDG
Sbjct  222   INSAQHTNPETTFHMRIVSSREKDG  246



>ref|XP_002453868.1| hypothetical protein SORBIDRAFT_04g020125 [Sorghum bicolor]
 gb|EES06844.1| hypothetical protein SORBIDRAFT_04g020125 [Sorghum bicolor]
Length=1822

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 106/199 (53%), Gaps = 24/199 (12%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHER--SNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLY  685
             +G  ++ C YCGA+FW  ER  S   V R    Y  CC  GKI L   +NPP P+   L 
Sbjct  18    YGGPSNECPYCGAVFWFQERVKSASAVARRKIVYNLCCKGGKIDLKPYRNPPRPLCDLLR  77

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + ++R F+  IR YN++F FTSLG  V+++IN G +P +F+I+G  +H IG+L+P  
Sbjct  78    FDGDARTRRFMKQIRSYNSLFAFTSLGASVDKTINNGTAPYVFKINGVVHHRIGTLLPKH  137

Query  866   GSMTKLAQRDVNSRDIHE--------------------NIVEELKNMLDGNNVLVKCFRM  985
             GS  K AQ  +   + HE                    +I + L +ML+ +N LV+ FR 
Sbjct  138   GSRPKFAQLYIYDPE-HEAQNRLHMFADDACAADQPDPDIAKSLLDMLNEHNQLVRAFRY  196

Query  986   ARTEIQSNPVVAVKMNLIG  1042
             AR  ++      + + L+G
Sbjct  197   ARERLEQEGDQKITLRLLG  215



>gb|EMS67201.1| hypothetical protein TRIUR3_23959 [Triticum urartu]
Length=1323

 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 98/184 (53%), Gaps = 19/184 (10%)
 Frame = +2

Query  566   HERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDN-EQSRHFINNIRRYNN  742
             H    Q+ +   P + +CC +GKI LP  K PPP L SL      E S ++  NIR YN+
Sbjct  3     HGEKLQSSSSTQPSFGQCCKQGKIILPPFKEPPPYLTSLLTRGGGEISANYRKNIRSYNS  62

Query  743   MFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV--------  898
             MF FTS+GG +++ IN G  P +FR++GQN H IG+L+P  G+  +  Q  +        
Sbjct  63    MFAFTSMGGTLDKEINKGRGPYVFRLNGQNRHQIGTLLPEEGNKPRFQQLYIYDTKNEIQ  122

Query  899   --------NSRD--IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRR  1048
                       RD  + E IV  L  MLD NN L + FRMAR   + N    + + L+G R
Sbjct  123   NRIEASRSGKRDASLDEKIVSGLLTMLDKNNTLAQSFRMARDRFKENDYNNLTLRLLGDR  182

Query  1049  NKDG  1060
             ++DG
Sbjct  183   DQDG  186



>ref|XP_002449633.1| hypothetical protein SORBIDRAFT_05g020450 [Sorghum bicolor]
 gb|EES08621.1| hypothetical protein SORBIDRAFT_05g020450 [Sorghum bicolor]
Length=479

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 102/203 (50%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTR--GLPKYTKCCYEGKIQLPRMKNPPPVLQSLY-  685
             +G   + C YC A+FW  E   Q   R  G P Y  CC  GKI +P  +  P  L SL  
Sbjct  15    YGPPQYRCPYCQAIFWLREGVKQGSRRQSGQPIYNNCCKGGKIVIPPFRPRPEPLTSLAR  74

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             F  + +   F+ NIR+YN +F FTS+G  ++RS+N G  P +F++SGQ +H IGSL+P  
Sbjct  75    FNGDARCNRFMKNIRQYNCLFAFTSMGANIDRSMNDGRGPPVFKVSGQVHHRIGSLLPLQ  134

Query  866   GSMTK-------------------LAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
             G+  K                   L Q + +   +  +I+E L +MLD +N   + FR+A
Sbjct  135   GAPPKFIQLYVYDTANEIRNRIQALDQTETSHGGLDTSIIESLISMLDEHNPFARQFRIA  194

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +Q        + +IG R  D
Sbjct  195   RDRLQEYGDEEFVIRIIGPREGD  217



>dbj|BAD68127.1| helicase-like protein [Oryza sativa Japonica Group]
Length=1427

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 106/198 (54%), Gaps = 22/198 (11%)
 Frame = +2

Query  530   HSCNYCGALFWRHERSNQNVTR--GLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF-YDNE  700
             + C +C A+F   ER+ +   +  G   Y+ CC   KI++P  +NPP  L  L    ++ 
Sbjct  4     YKCKHCNAIFCFEERNKRETKKRKGEIIYSNCCKNNKIKIPPFQNPPETLARLLNNKEDN  63

Query  701   QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTK  880
              S+HF+  IR+YN++F FTS+GG ++++IN G+ P +FR++GQ +H IG L+P    + K
Sbjct  64    LSKHFMQKIRQYNSLFSFTSMGGTIDKNINNGDGPYVFRVNGQIHHRIGCLLPKPNEIPK  123

Query  881   LAQ-------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQ  1003
              A+                    ++ S DI+  IVE+LK M D  N LVK FR AR   +
Sbjct  124   FAELYIFDTKNEIENRIHALNKEEMGSTDINPYIVEQLKKMFDEYNPLVKTFRYARDLFE  183

Query  1004  SNPVVAVKMNLIGRRNKD  1057
              +  V   + +IG    D
Sbjct  184   EHKGVDFSIRIIGADKGD  201



>ref|XP_003593180.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1626

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 103/202 (51%), Gaps = 19/202 (9%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQN-VTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             LD G     C +C A  W  ER+ ++       +++ CC +G + +P ++  P +L SL 
Sbjct  212   LDLGYPEIQCKWCKAQVWIEERAEKSRPPNDSTEFSICCQKGFVDIPLLEETPKLLVSLL  271

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                  +S+H+  NIR YN+MF FTSLGG+V   +N GN P  F +SGQNYH IGSL+P  
Sbjct  272   NGTEPRSKHYQQNIRAYNSMFAFTSLGGKVFSKLNNGNGPPQFILSGQNYHRIGSLLPEP  331

Query  866   GSMTKLAQRDV--------NSRDIHE----------NIVEELKNMLDGNNVLVKCFRMAR  991
             G+  K AQ  +        N   + E          ++VE+LK MLD  N L K FR  R
Sbjct  332   GTTPKFAQLYIYDTQNEVQNRTRVFESEGGEGGFDLSLVEDLKQMLDQCNPLCKSFRKIR  391

Query  992   TEIQSNPVVAVKMNLIGRRNKD  1057
               +       + + L  +R KD
Sbjct  392   DLVDKGSPPKMALRLFRKREKD  413



>gb|KEH17059.1| hypothetical protein MTR_0048s0090 [Medicago truncatula]
Length=568

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 92/175 (53%), Gaps = 18/175 (10%)
 Frame = +2

Query  503  SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             YL+ G   + C  CGA+ W  ER  ++    +P+++ CC +G++ LP  ++ P  L  +
Sbjct  393  EYLNIGGPTYFCQKCGAMMWYEERVPKHTRPVIPRFSMCCLKGRVVLPPYEHLPQFLHDM  452

Query  683  YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
            Y   +  SR F+NNIR +N+MF FTS+GGRVN   N G +P +F ++G+NYH IGSL+P 
Sbjct  453  YHKHDRVSRFFMNNIRSFNSMFAFTSMGGRVNNEQNNGKAPPMFVMNGENYHLIGSLLPM  512

Query  863  GGSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVK  973
                 K AQ                   D    D+   I+  LK +LD  N  V+
Sbjct  513  PEKPPKFAQLYIYHTDNEISNRMAAVSMDDGHFDLKNMIIGNLKELLDEYNPYVQ  567



>gb|AAU44208.1| unknown protein [Oryza sativa Japonica Group]
Length=1525

 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 94/163 (58%), Gaps = 19/163 (12%)
 Frame = +2

Query  629   GKIQLPRMKNPPPVLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSP  805
             GK+ LP +K PP  L +L   +  ++SR++++NIR YN+MF FTS+GG+V+R IN G+ P
Sbjct  165   GKVDLPTLKKPPTYLSNLMCKEKGKRSRNYMDNIRVYNSMFAFTSMGGKVDREINNGSGP  224

Query  806   SIFRISGQNYHWIGSLVPGGGSMTKLAQRDV------------------NSRDIHENIVE  931
              +FR++GQNYH IG+L+P  G   + AQ  +                  N   I  +IV 
Sbjct  225   YVFRMNGQNYHRIGTLLPEEGDKPRWAQLYIYDTENEVKNRIDASTSSHNRESIDSHIVL  284

Query  932   ELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
              LKNMLD  NVL + FRMAR   +      V + LI +R  DG
Sbjct  285   GLKNMLDRENVLAQTFRMARDRFKEGDYHNVSLRLIRKRGGDG  327



>ref|XP_002452166.1| hypothetical protein SORBIDRAFT_04g021060 [Sorghum bicolor]
 gb|EES05142.1| hypothetical protein SORBIDRAFT_04g021060 [Sorghum bicolor]
Length=479

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 103/203 (51%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTR--GLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G   + C YC A+FW  E   Q   R  G P Y  CC  GKI +P  +  P  L SL  
Sbjct  15    YGPPQYRCPYCQAIFWLREGVKQGSVRRSGQPIYNSCCKGGKIVIPPFRPRPEPLASLAR  74

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             ++ + +   F+ NIR+YN +F FTS+G  ++RS+N G  P +F++SGQ +H IGSL+P  
Sbjct  75    FNGDGRCNRFMKNIRQYNCLFAFTSMGANIDRSMNDGRGPPVFKVSGQVHHRIGSLLPLQ  134

Query  866   GS-------------------MTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
             G+                   M  + Q + +   +  +I++ L +MLD +N   + FR+A
Sbjct  135   GTPPKFIQLYVYDTANEIRNRMQAVDQTETSHGGLDTSIIQSLISMLDEHNPFARQFRIA  194

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +Q        + +IG R  D
Sbjct  195   RDRLQQYGDEEFVIRIIGPREGD  217



>ref|XP_009781233.1| PREDICTED: uncharacterized protein LOC104230189 [Nicotiana sylvestris]
Length=1177

 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 98/185 (53%), Gaps = 15/185 (8%)
 Frame = +2

Query  551   ALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNI  727
              LF+  +   +      PK++ CC EG ++L  +  PPP L+ L   D+ Q   +F   I
Sbjct  79    VLFYGMKNEQKTTQTSHPKFSLCCSEGCVRLSLLTEPPPYLKYLLGTDSGQLGINFRKTI  138

Query  728   RRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ------  889
             R YN+MF F S+GGR++ SIN    P +FR+SGQNYH  GSL+P  G   + AQ      
Sbjct  139   RAYNSMFAFISIGGRIDGSINRSKGPYVFRMSGQNYHHTGSLLPEIGKKPQFAQLYIYDT  198

Query  890   -RDVNSR-------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGR  1045
               ++++R       DI   +V EL  MLD +N+LVK  RM     + +P     + L+  
Sbjct  199   KNEISNRMSWLLQEDIDPKVVHELSQMLDEHNILVKTLRMVMDRYREHPESVFHLWLLSD  258

Query  1046  RNKDG  1060
             R +DG
Sbjct  259   RTRDG  263



>ref|XP_002878906.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 93/178 (52%), Gaps = 22/178 (12%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C +C AL W  E++  + + G P +T CC +G+++LP +K PPP L+  Y + N  S+ F
Sbjct  128   CPHCKALVWYSEKTGNDPSTGEPIFTICCQQGRVKLPPIKQPPPYLE--YLHAN--SKTF  183

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
               NIR YN++  FTS+G +++ S+     P +FRI GQ +H IGSL+P  G   K  Q  
Sbjct  184   RINIRIYNSILAFTSMGAQIDHSVTYATGPPVFRIHGQVFHRIGSLLPMPGQNPKFLQMY  243

Query  890   ----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
                             R  ++  + E+IV  L  MLD +N L   FR AR     N V
Sbjct  244   IIDTENEVSNRINTMSRRDSAAQLEEDIVAGLIEMLDEHNCLCMFFRKARDRFNGNNV  301



>ref|XP_006383763.1| hypothetical protein POPTR_0005s27010g, partial [Populus trichocarpa]
 gb|ERP61560.1| hypothetical protein POPTR_0005s27010g, partial [Populus trichocarpa]
Length=1442

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 103/187 (55%), Gaps = 9/187 (5%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y+DFGD  + C +C ALFW  ER  ++ ++  P +T CC  GK+ LP  +  P  L +L 
Sbjct  110   YIDFGDKTYKCKHCNALFWLQERLARS-SKTNPCFTLCCNNGKVVLPAPQETPNYLDNLL  168

Query  686   FYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               +N   S+ F   IR YN+MF FTS+G  V+ S+N+     +F+++G  +H++GSL+P 
Sbjct  169   NPNNGSLSKKFRREIRAYNSMFAFTSMGAVVDHSVNSRPGSYVFKVNGYCHHFMGSLLPM  228

Query  863   GGSMTKLAQRDVNSRDIHENIVEELKN-MLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
                  K AQ  +   D       E+ N MLD +N LV+ FR AR       V   K+ LI
Sbjct  229   DNKGPKFAQLYIFDTD------NEVSNRMLDSSNQLVRLFRHARQRFGDVDVPEFKLRLI  282

Query  1040  GRRNKDG  1060
             G+R+ D 
Sbjct  283   GKRDDDS  289



>ref|XP_010419309.1| PREDICTED: uncharacterized protein LOC104705014 [Camelina sativa]
Length=599

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 113/224 (50%), Gaps = 35/224 (16%)
 Frame = +2

Query  443   QYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YTK  616
             +Y I +TK K         H     G+   +C YC AL W+ E  +Q  TR + K  ++ 
Sbjct  31    RYTITETKGKR--------HRTNPVGNTLVNCRYCDALMWQAE--SQRKTRDITKLSFSI  80

Query  617   CCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTG  796
             CC+ G++ LP+MK  PP L  L      +  +F+ +IR +N++F FTS+G +V+ SIN  
Sbjct  81    CCHAGRVSLPKMKETPPYLDKLL-----KDANFLQHIRTFNSLFAFTSMGAKVDESINRR  135

Query  797   NSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDVNSR-----------DIHEN  922
               P  +R+ G+NYH +GSL+P  G   K  Q        +V +R              E+
Sbjct  136   PGPYCYRVHGKNYHRLGSLLPIDGESPKFLQLYIFDTTNEVQNRIKALTNGKSLTPPDES  195

Query  923   IVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNK  1054
             I+  L  MLD  N L K +RMAR + +      + + L+G+R +
Sbjct  196   IICGLLEMLDDTNELAKIYRMARDQHEEADPTEMSIRLVGQRQR  239



>ref|XP_003622843.1| Helicase-like protein [Medicago truncatula]
Length=1757

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 96/189 (51%), Gaps = 14/189 (7%)
 Frame = +2

Query  497   FHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQ  676
                Y D GD    C  CGA  W  ER +++ +   P +  CC +GK+QLP ++ PPPVL+
Sbjct  409   LQDYFDIGDPDCICQQCGAEMWYLERKHKSKSTETPLFQLCCGDGKVQLPLLRQPPPVLK  468

Query  677   SLYF-YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSL  853
              L F  ++E S+ F  + R YN+MF F+S G + +  +  G  P   RI GQ  H IGS+
Sbjct  469   HLLFDQESEDSKKFQQHTRMYNSMFAFSSPGMKFDDKVAKGRGPPTMRIQGQTCHRIGSM  528

Query  854   VPGGGSMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMN  1033
             +P  G   K AQ  +   +       E++N + G       F MAR  ++   +  +K+ 
Sbjct  529   LPIEGEQPKYAQLYIYDTE------NEIQNRIRG-------FGMARDILKGGHIHDLKIK  575

Query  1034  LIGRRNKDG  1060
             LI  R  DG
Sbjct  576   LISERKSDG  584



>emb|CDX75766.1| BnaC03g38490D [Brassica napus]
Length=542

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 94/186 (51%), Gaps = 24/186 (13%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+D GD  + C +CGA+ W  ER  +      PK+  CC +G++QLP +K  P +L  L 
Sbjct  223  YIDEGDPTYKCEHCGAIMWYGERIEKKRKTKTPKFALCCGQGQVQLPLLKQSPDILSKLL  282

Query  686  FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
               +E S+++  NIR+ N +F FT LGG+++RS   G  P +  + G+NYH +GSL P  
Sbjct  283  NDKDEISKYYRKNIRQINMVFSFTLLGGKIDRSAPQGAGPKMVVLQGENYHLMGSLKPPP  342

Query  866  GSMTKLAQ-------RDVNSR-----------------DIHENIVEELKNMLDGNNVLVK  973
            G   K  Q        ++++R                  + + ++E +  MLD  N  V 
Sbjct  343  GGDPKFGQFYIVDTEDEIDNRASIIGKYKKKREKAKKERLRKQVIERIVKMLDEVNPYVH  402

Query  974  CFRMAR  991
             FR AR
Sbjct  403  QFRSAR  408



>ref|XP_010497042.1| PREDICTED: uncharacterized protein LOC104774077, partial [Camelina 
sativa]
Length=822

 Score =   116 bits (291),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 97/191 (51%), Gaps = 24/191 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER N+      P +T CC EG+++LP ++  P +L +L   ++E SRHF  NIR YN
Sbjct  2     WYDERINKQKNARKPVFTLCCGEGQVKLPFLQKTPELLVALLTNNDELSRHFRENIRAYN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDV  898
              +F FTSLGG+  +    G  P++F++ G+NYH +GS+ P  G + K  Q        +V
Sbjct  62    MIFSFTSLGGKTEKCCAPGRGPNMFQLQGENYHLMGSMQPEDGELPKFQQLYIVDTENEV  121

Query  899   NSR-----------------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
             ++R                  +   ++E++  MLD  N  V  +R AR    +NP     
Sbjct  122   DNRATIMNKGKNSAKYKKKQKLRRELIEKIMKMLDDVNPYVNTYRSARDRFNTNPDETFH  181

Query  1028  MNLIGRRNKDG  1060
             M ++  R KDG
Sbjct  182   MRIVSSREKDG  192



>emb|CDX84973.1| BnaC05g20820D [Brassica napus]
Length=586

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 98/187 (52%), Gaps = 25/187 (13%)
 Frame = +2

Query  572   RSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFC  751
             ++ + + +G P Y KC Y G++QLP +K  P +L+ L   D+E S++F  NIR+ N +F 
Sbjct  161   KTTKYLDKGDPTY-KCDYCGQVQLPLLKESPEILKRLLHGDDEISKYFQENIRQLNMVFS  219

Query  752   FTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDVNSR-  907
             FTSLGG+V+R +  G+ P +F++ G+NYH +GSL P  G   K +Q        +++ R 
Sbjct  220   FTSLGGKVDRCVPQGHGPKMFQLQGENYHLMGSLKPPAGEEAKFSQLYIVDIENEIDKRA  279

Query  908   ----------------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
                              + + + E +  MLD  N  V  FR AR    +NP     M ++
Sbjct  280   SIIGKYKKKADKAKKESLRKKVTEMIVEMLDQVNPYVHQFRSARDRFNTNPETTFHMRIV  339

Query  1040  GRRNKDG  1060
               R KDG
Sbjct  340   SSREKDG  346



>ref|XP_008650020.1| PREDICTED: uncharacterized protein LOC103630742 isoform X2 [Zea 
mays]
Length=472

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 101/201 (50%), Gaps = 21/201 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY-FY  691
              G   + C +C ALFW  E ++ N   G+ +Y  CC  GK+ +P     P  L SL  F+
Sbjct  13    LGTPDYECQHCHALFWHAEHNSSN-RYGIVQYYNCCKGGKLSIPSYTPRPEPLASLSKFH  71

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
              +  S+ F+ +IR+YN +F FTS+G +++ ++N G  P +F+I GQ +H IGSL+P  GS
Sbjct  72    GDSISKRFMRSIRQYNCLFAFTSMGAQIDNTMNDGRGPPLFKICGQVHHRIGSLLPSDGS  131

Query  872   MTKLAQ-------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
               K  Q                    ++ +  +  +I+EEL  MLD  N   K FRMAR 
Sbjct  132   SPKYLQLYIYDTANEVQNRLKCLNSNNMTAEVLDPSIIEELMKMLDECNPFAKTFRMARD  191

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +         + +IG +  D
Sbjct  192   RMAEYGDENFIIRIIGAKEGD  212



>ref|XP_004301743.1| PREDICTED: uncharacterized protein LOC101302173 [Fragaria vesca 
subsp. vesca]
Length=854

 Score =   116 bits (291),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 103/202 (51%), Gaps = 27/202 (13%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y DFGD    C +CGA +W++E++     RG+  YT CC  G+++LP     PP L++L 
Sbjct  198   YKDFGDNTFQCVHCGAYYWQNEKN----MRGI--YTGCCRGGRVKLPPPNTTPPFLENL-  250

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                   + +F +NIR YN+MF FTS+G  + + IN G+ P +F+I GQ +H +GS++P  
Sbjct  251   ---LNLNNNFRDNIRLYNSMFTFTSMGANIEKHINDGSGPYVFKICGQVHHLMGSILPIN  307

Query  866   GSMTKLAQ-----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
             G   K AQ                 R    + I  NIV+ L  M D  N L K FR  R 
Sbjct  308   GQPPKYAQLYVYDTRNEVSNRINALRPNKKQRIDPNIVKGLIEMFDEINELAKLFRNIRD  367

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
             + + N + +  M  + R   D 
Sbjct  368   KFEDNSLPSFNMTFLSRGPSDS  389



>ref|XP_010320516.1| PREDICTED: uncharacterized protein LOC101245841 [Solanum lycopersicum]
Length=903

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 15/159 (9%)
 Frame = +2

Query  629   GKIQLPRMKNPPPVLQSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSP  805
             G++QLP ++ PPP L+ L   ++ Q   +F  NIR YN+MF FTS+GGRV+ SIN    P
Sbjct  4     GRVQLPLLREPPPYLKYLLGKESGQLGINFRKNIRAYNSMFAFTSIGGRVDGSINHSKGP  63

Query  806   SIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDVNSR-------DIHENIVEELKN  943
              +FR  GQNYH IGSL+P  G   + AQ        ++N+R       DI   IV+ L  
Sbjct  64    YVFRTCGQNYHRIGSLLPEIGKRPQSAQLYIYDTENEINNRMNCLLEGDIDPEIVQGLSV  123

Query  944   MLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             ML+ +N+LVK FRMAR   + +P    ++ L+  R  DG
Sbjct  124   MLEEHNILVKTFRMARDRYKEHPEREFRLRLLSNRTTDG  162



>gb|AAD32757.1| putative helicase [Arabidopsis thaliana]
Length=1241

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 99/186 (53%), Gaps = 19/186 (10%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER N+      PK++ CC +G ++LP +   P +++ L   D+   RHF  NIR YN
Sbjct  3     WYDERVNKRRKSKKPKFSLCCLQGSVKLPFLTESPELIRELLSCDDALRRHFRENIRAYN  62

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ----------  889
              +F  TSLGG+V+RS   G  P+ F++ G NYH IGS++PG G   K +Q          
Sbjct  63    MLFSMTSLGGKVDRSNPQGKGPNQFQLHGANYHLIGSMLPGEGDYAKFSQLYIVDTGNEV  122

Query  890   --RDVNSR------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGR  1045
               R  N +       + ++++E+L  MLD  N  ++ FR+A+ ++ SN      M ++  
Sbjct  123   ENRSTNPKKATFKNQVRKDLIEKLIRMLDACNPYIENFRLAKYKLDSNNGEPFYMQIVSD  182

Query  1046  R-NKDG  1060
             R  KDG
Sbjct  183   RVGKDG  188



>emb|CDY45352.1| BnaA09g12370D [Brassica napus]
Length=517

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 92/192 (48%), Gaps = 23/192 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C  CGAL W+ E + ++      ++T CC +G+I+LP M+ PPPVL+ L      Q + 
Sbjct  71    ECPSCGALVWQSESTGRDPRTKELRFTICCNQGQIKLPPMRQPPPVLEKLL-----QCKQ  125

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F   IR YN +  FTS+G  ++ S+  G  P  FRI GQ YH IGSL+P  G   K  Q 
Sbjct  126   FRETIRVYNALLAFTSIGANIDYSVVFGRGPFTFRIQGQTYHRIGSLIPKPGLPPKYLQL  185

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              +  +     E  ++ L  M+D NN L K FR  R   ++N   
Sbjct  186   YIFDTANEVKNRLEALGQTTSEEKATEATLKVLIEMVDTNNCLAKVFRRVRDRYEANSEE  245

Query  1019  AVKMNLIGRRNK  1054
                ++LI  + K
Sbjct  246   DFTISLISDKGK  257



>gb|AFW61004.1| hypothetical protein ZEAMMB73_411669 [Zea mays]
Length=769

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 95/201 (47%), Gaps = 20/201 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYD  694
              G   + C++C A+FW  ER           Y  CC  GKI +P  +  P  L SL  +D
Sbjct  44    LGKPEYECSHCHAIFWYAERVRNRQRDSSIVYNNCCKGGKIIIPPYRPRPEPLSSLARFD  103

Query  695   NE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
              +  S+  I NIR+YN +F FTS+G +++ S+N G  P +F+I GQ +H IGSL+P  GS
Sbjct  104   GDITSKKIIRNIRQYNCLFAFTSMGAQIDNSVNDGRGPPLFKICGQVHHRIGSLLPSDGS  163

Query  872   -------------------MTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                                M  L   D N   +   IV  L  MLD +N   K FRMAR 
Sbjct  164   SPKFIQLYIYDTANEIQNRMNSLGNNDRNDGGLDPVIVNGLIKMLDDHNPFAKKFRMARD  223

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +  N      + LIG +  D
Sbjct  224   RLADNESEDFIIRLIGAKEGD  244



>emb|CDX74430.1| BnaA04g09590D [Brassica napus]
Length=472

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 92/192 (48%), Gaps = 23/192 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C  CGAL W+ E + ++      ++T CC +G+I+LP M+ PPPVL+ L      Q + 
Sbjct  26    ECPSCGALVWQSESTGRDPRTKELRFTICCNQGQIKLPPMRQPPPVLEKLL-----QCKQ  80

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F   IR YN +  FTS+G  ++ S+  G  P  FRI GQ YH IGSL+P  G   K  Q 
Sbjct  81    FRETIRVYNALLAFTSIGANIDYSVVFGRGPFTFRIQGQTYHRIGSLIPKPGLPPKYLQL  140

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              +  +     E  ++ L  M+D NN L K FR  R   ++N   
Sbjct  141   YIFDTANEVKNRLEALGQTTSEGKATEATLKVLIEMVDTNNCLAKVFRRVRDRYEANSEE  200

Query  1019  AVKMNLIGRRNK  1054
                ++LI  + K
Sbjct  201   DFTISLISDKGK  212



>ref|XP_003619589.1| Defensin-like protein [Medicago truncatula]
Length=1645

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 89/200 (45%), Gaps = 39/200 (20%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C  CGA  W  ER N++     PK+  CC +G IQLP ++ PP       
Sbjct  283   YYDIGDPVIECQQCGACMWYQERKNKSRESANPKFGLCCGDGTIQLPYLRKPPAF-----  337

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                                MF F+SLG +V+++I  G  P   RI GQ  H IGS++P  
Sbjct  338   -------------------MFAFSSLGFKVDKNIRRGRGPPTIRIQGQACHRIGSMIPMP  378

Query  866   GSMTKLAQRDV---------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
             G   K AQ  +               N+  +   ++  L+ MLD NNV  K FRMAR  +
Sbjct  379   GRPPKFAQLYIYDTENELQHRLQGLSNANQLDIQMIAALQKMLDENNVHAKSFRMARDRL  438

Query  1001  QSNPVVAVKMNLIGRRNKDG  1060
                 V  +K+ LI  R  DG
Sbjct  439   SEGDVQNLKLKLISERTTDG  458



>ref|XP_006459769.1| hypothetical protein AGABI2DRAFT_116714 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV47900.1| hypothetical protein AGABI2DRAFT_116714 [Agaricus bisporus var. 
bisporus H97]
Length=357

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 97/184 (53%), Gaps = 16/184 (9%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             +C +CGAL W  E+  ++     PK+  CC+EG+I LP+ ++PP  +Q L+      +R 
Sbjct  40    ACAHCGALHWIGEKLARSSDHS-PKFGMCCHEGQISLPQRQDPPRHIQELFLSQEPHARE  98

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F  NI +YN  F FTSLG     S+N G  P +F I+G+  HW GSLVP  G + K AQ 
Sbjct  99    FRENIWKYNRAFSFTSLGVNEVHSVNNGRGPPVFCITGELCHWSGSLVPHNGQLPKYAQL  158

Query  890   -----------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV---AVK  1027
                        R   ++D+ E I+E L+  L  ++     +R A   ++ +P +    V 
Sbjct  159   YIYEPREALAARMQQNQDLDEQIMETLQTFLLQHHQYAPVYRHAWEILRLHPNIENHTVT  218

Query  1028  MNLI  1039
             ++LI
Sbjct  219   LHLI  222



>ref|XP_003622731.1| hypothetical protein MTR_7g051410 [Medicago truncatula]
Length=302

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 93/165 (56%), Gaps = 18/165 (11%)
 Frame = +2

Query  620   CYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGN  799
             C +G+I++   K PP  L  LY   + +S+ F+ NIR +N+MF FTS+GG ++++ N GN
Sbjct  3     CMQGRIEIAPFKRPPKGLYDLYHKKDRKSKFFLENIRSFNSMFSFTSMGGNIDKTNNNGN  62

Query  800   SPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRD------------------IHENI  925
             +P I+ ++G+NY+ I SL+P  G+  K A+  +   D                  +   I
Sbjct  63    APPIYVLNGENYNRIRSLLPTPGNGPKFARLYIYDTDNELKNRMAAVGMEDDRHSLKSAI  122

Query  926   VEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             VEEL+NMLD  N   K  R+AR ++  N    +K+ ++G+R  DG
Sbjct  123   VEELRNMLDNINSFAKSCRLARDKLLQNDAPEIKLRILGKRGYDG  167



>ref|XP_002464527.1| hypothetical protein SORBIDRAFT_01g020130 [Sorghum bicolor]
 gb|EER91525.1| hypothetical protein SORBIDRAFT_01g020130 [Sorghum bicolor]
Length=1318

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 91/167 (54%), Gaps = 19/167 (11%)
 Frame = +2

Query  617   CCYEGKIQLPRMKNPPPVLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINT  793
             CC +G++ LP +K PP  L SL   D  + S ++  NIR YN+MF  TS+GG V+++IN 
Sbjct  19    CCKQGRVTLPPLKEPPSYLASLLAVDGGKSSANYQQNIRSYNSMFALTSMGGSVDKNINK  78

Query  794   GNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV--NSRDIH----------------E  919
             G  P +FR+ GQNYH IG+L+P  G   +  Q  +     +IH                E
Sbjct  79    GRGPYVFRLKGQNYHHIGTLLPQEGDKPRFQQLYIYDTKNEIHNRLQVSRSGECSAPLDE  138

Query  920   NIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             +I+  L  ML+ NN LV+ FRMAR   + +    + + LI  R +DG
Sbjct  139   SIITSLVTMLNENNTLVQSFRMARDRFEGHEYHNLTLRLIDNREQDG  185



>ref|XP_009129377.1| PREDICTED: uncharacterized protein LOC103854199 [Brassica rapa]
Length=1418

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 93/191 (49%), Gaps = 24/191 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER N       PK+  CC +G++QLP +K+ P +L+ L    +EQSR+F +NIR  N
Sbjct  2     WYGERINNKKHTRKPKFALCCGQGQVQLPLLKDSPAILKQLLHGSDEQSRYFRDNIRAIN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRD---  910
              +F FTSLGG+ + S   G+ P +  + G+NYH +GSL P  G   K  Q  +   +   
Sbjct  62    MVFSFTSLGGKFDHSAPKGSGPKMIVLQGENYHLMGSLKPPAGDPAKFGQLYIVDTENEV  121

Query  911   ---------------------IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
                                  I   +++ L  ML+  N  V  FR A+   ++NP+    
Sbjct  122   ANRASIIGRYKKSAEKAKKESIRNQVIQSLMTMLNEVNPYVHQFRSAKDRFETNPLETFH  181

Query  1028  MNLIGRRNKDG  1060
             M +I  R KDG
Sbjct  182   MRIISSRAKDG  192



>ref|XP_008650018.1| PREDICTED: uncharacterized protein LOC103630742 isoform X1 [Zea 
mays]
 ref|XP_008650019.1| PREDICTED: uncharacterized protein LOC103630742 isoform X1 [Zea 
mays]
Length=670

 Score =   114 bits (284),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 101/201 (50%), Gaps = 21/201 (10%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY-FY  691
              G   + C +C ALFW  E ++ N   G+ +Y  CC  GK+ +P     P  L SL  F+
Sbjct  13    LGTPDYECQHCHALFWHAEHNSSN-RYGIVQYYNCCKGGKLSIPSYTPRPEPLASLSKFH  71

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
              +  S+ F+ +IR+YN +F FTS+G +++ ++N G  P +F+I GQ +H IGSL+P  GS
Sbjct  72    GDSISKRFMRSIRQYNCLFAFTSMGAQIDNTMNDGRGPPLFKICGQVHHRIGSLLPSDGS  131

Query  872   MTKLAQ-------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
               K  Q                    ++ +  +  +I+EEL  MLD  N   K FRMAR 
Sbjct  132   SPKYLQLYIYDTANEVQNRLKCLNSNNMTAEVLDPSIIEELMKMLDECNPFAKTFRMARD  191

Query  995   EIQSNPVVAVKMNLIGRRNKD  1057
              +         + +IG +  D
Sbjct  192   RMAEYGDENFIIRIIGAKEGD  212



>emb|CDY44893.1| BnaA02g13890D [Brassica napus]
Length=506

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 92/191 (48%), Gaps = 23/191 (12%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  CGAL W+ E + ++      ++T CC +G+I+LP M+ PPPVL+ L      Q + F
Sbjct  61    CPSCGALVWQSESTGRDPRTKELRFTICCNQGQIKLPPMRQPPPVLEKLL-----QCKQF  115

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
                IR YN +  FTS+G  ++ S+  G  P  FRI GQ YH IGSL+P  G   K  Q  
Sbjct  116   RETIRVYNALLAFTSIGANIDYSVVFGRGPFTFRIQGQTYHRIGSLIPKPGLPPKYLQLY  175

Query  890   ----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
                             +  +     E  ++ L  M+D NN L K FR  R   ++N    
Sbjct  176   IFDTANEVKNRLEALGQTTSEGKATEATLKVLIEMVDTNNCLAKVFRRVRDRYEANSEED  235

Query  1022  VKMNLIGRRNK  1054
               ++LI  + K
Sbjct  236   FTISLISDKGK  246



>ref|XP_010474186.1| PREDICTED: uncharacterized protein LOC104753664 [Camelina sativa]
Length=1230

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 96/191 (50%), Gaps = 24/191 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER N+      P +T CC EG ++LP ++  P +L +L   ++E SRHF  NIR YN
Sbjct  2     WYDERINKQKNARKPVFTLCCGEGHVKLPFLQKTPELLVALLTNNDELSRHFRENIRAYN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDV  898
              +F FTSLGG+V +    G  P++F++ G+NYH +GS+ P  G + K  Q        +V
Sbjct  62    MIFSFTSLGGKVEKCCAPGRGPNMFQLQGENYHLMGSMRPEDGELPKFQQLYIVDTENEV  121

Query  899   NSR-----------------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
             ++R                  +   ++E++  MLD  N  V  FR  R    +NP     
Sbjct  122   DNRATIMNKGKDTAKYKKKQKLRRELIEKIMKMLDDVNPYVNKFRSGRDRFNTNPHETFH  181

Query  1028  MNLIGRRNKDG  1060
             M ++  R KDG
Sbjct  182   MRIVSSRYKDG  192



>ref|XP_008378701.1| PREDICTED: uncharacterized protein LOC103441779 [Malus domestica]
Length=2043

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 95/184 (52%), Gaps = 19/184 (10%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
            Y+DFG     C YC ALFW  E+S +N +    ++T CC   K++ PR K   P L  L 
Sbjct  133  YVDFGLRNCQCQYCXALFWSXEQSAKNASSXTLQFTTCCMSQKVKFPRXKPTXPYLDDLL  192

Query  686  FYDNEQSR-HFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               N ++   F  NIR YN+M   TS+G +V+ SIN G  P +F+I+ Q +H +GSL+P 
Sbjct  193  NPKNSRNXLQFKTNIRSYNSMMXLTSMGAKVDASINKGRGPYVFKINXQVHHLMGSLLPL  252

Query  863  GGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMA  988
             G   K A       Q +V++R            +  ++V+ L  MLD  N + K FR A
Sbjct  253  EGEXPKFAQLYIHDTQNEVSNRIGCFSGSETVEKLDHHVVDXLIKMLDXCNEVXKJFRXA  312

Query  989  RTEI  1000
            R  I
Sbjct  313  RDMI  316



>gb|ABA99349.2| AT hook motif-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=908

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 115/223 (52%), Gaps = 25/223 (11%)
 Frame = +2

Query  440   FQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YT  613
             F Y+I K   +  K    T+     +G   + CN+CGALFW  ER     +    +  Y 
Sbjct  399   FTYSIPKEHMQILKA---TYPDRSYYGGLDYECNHCGALFWYQERVVSQSSHRAKRIAYN  455

Query  614   KCCYEGKIQLPRMKNPPPVLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSIN  790
              CC  GKI LP  K  PP+LQ L  +D   +S  F+  IR+YN++F FTSLG  ++RSIN
Sbjct  456   LCCRGGKISLPPPKPFPPILQDLIRFDGGARSNSFMRLIRQYNSLFAFTSLGANIDRSIN  515

Query  791   TGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV------------------NSRDIH  916
             TG    +FRI+G  +H IGSLV   G   + AQ  +                  +  D+ 
Sbjct  516   TGQGHYVFRINGVVHHRIGSLVTAPGQRPEFAQLYIYDTANELQNRLNIFYHTDDPGDVP  575

Query  917   EN-IVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIG  1042
             +  IV+EL +MLD  N LV+ FR+AR ++ S     + + LIG
Sbjct  576   DPVIVQELISMLDQFNPLVQQFRLARDKLLSPSAPEIAIKLIG  618



>ref|XP_009145084.1| PREDICTED: uncharacterized protein LOC103868766 [Brassica rapa]
Length=1251

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 86/168 (51%), Gaps = 20/168 (12%)
 Frame = +2

Query  617   CCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTG  796
             CC  GK++LP + N P  L +L    +E S+H+   IR YN MF FTSLGG++  SIN G
Sbjct  2     CCKRGKVELPWLANTPMDLMTLLCKGDELSKHYREFIRAYNMMFSFTSLGGKIYHSINNG  61

Query  797   NSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV--------------------NSRDIH  916
             + P +FR+SG+NYH IG +VP  G   K +Q  +                     ++ + 
Sbjct  62    HGPFVFRMSGENYHRIGDIVPEPGQAPKFSQLYIIDTLNEIKNRLDAYAGSDRAAAKKLR  121

Query  917   ENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             E +V  LKNMLD  N  VK FR AR           +M LI  R  DG
Sbjct  122   EPLVLLLKNMLDQCNPHVKAFRSARDRFDVEGSTGYRMRLIESRQSDG  169



>gb|KHN29779.1| UDP-glucose flavonoid 3-O-glucosyltransferase 6, partial [Glycine 
soja]
Length=464

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +2

Query  512  DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
            D GD A  C +C A  W +ER +++     PK++ CC + K++LP ++NPP  L+ L F 
Sbjct  1    DLGDQAMQCRHCNAKMWYNERISKDKNTTSPKFSLCCGDDKVELPLLQNPPKHLERLLFD  60

Query  692  DNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
            DN   S+++  NIR YN MF FTS G ++++SIN    P   RI GQ  H IGSL+P  G
Sbjct  61   DNATDSKNYQYNIRTYNMMFAFTSTGIKLDKSINETKGPPTIRIQGQPCHRIGSLLPMPG  120

Query  869  SMTKLAQ  889
               K AQ
Sbjct  121  KQPKFAQ  127



>ref|XP_004301603.1| PREDICTED: uncharacterized protein LOC101297450 [Fragaria vesca 
subsp. vesca]
Length=337

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 11/135 (8%)
 Frame = +2

Query  506  YLDFGDAAHSCNYCGALFWRHE------RSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPP  667
            Y D GD++  CN+CGA FW  E      R+N N     P Y+ CC +G+IQ+P   + PP
Sbjct  163  YKDSGDSSFQCNHCGAYFWIGEALISSVRTNNNA----PIYSGCCLKGEIQIPLSDSTPP  218

Query  668  VLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWI  844
             LQ L   +N  QS  F  NIR YN+MFCFTS+G ++   +N  + P +F+I GQ +H +
Sbjct  219  FLQQLLDPNNGRQSLLFRENIRVYNSMFCFTSMGAKIESDMNKRSGPYVFKICGQIHHMM  278

Query  845  GSLVPGGGSMTKLAQ  889
            GS +P  G   K AQ
Sbjct  279  GSALPSEGERPKYAQ  293



>ref|XP_009119505.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103844472 
[Brassica rapa]
Length=2286

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 99/181 (55%), Gaps = 17/181 (9%)
 Frame = +2

Query  569   ERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMF  748
             ER N++     P +T CC +G++QLP +K  P +++ L   D++ + HF  N R YN +F
Sbjct  873   ERINKSRKSRKPIFTLCCMQGQVQLPLLKKKPELMERLLNGDDKLNNHFQRNTRPYNMVF  932

Query  749   CFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-RDVNSRDIHEN-  922
              FTS+GG+V+RS+  G  P +F++ G+NYH +GSL P  G+  K  Q   V++ +  EN 
Sbjct  933   SFTSIGGKVDRSLPKGLGPKMFQLQGENYHRLGSLKPPDGNSAKFGQLYIVDTENEAENR  992

Query  923   ---------------IVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
                            I++++  MLD  N  V  FR AR  +  NP   + M ++  R KD
Sbjct  993   VNILSKGKKDGLKKEIIQKIIAMLDEVNPYVSKFRQARHRLDDNPKSTLHMRIVSDRLKD  1052

Query  1058  G  1060
             G
Sbjct  1053  G  1053



>ref|XP_003607945.1| Helicase-like protein [Medicago truncatula]
Length=1651

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 102/200 (51%), Gaps = 15/200 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD +  C  CGA  W  ER  ++     P++  CC  GKIQ+P +  PPP+L  L 
Sbjct  264   YSDIGDPSFECRKCGACMWYQERRRKSRESSNPEFGMCCGNGKIQIPFLPTPPPLLNDLM  323

Query  686   FYD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             F + + +S+ F  NIR YN+MF F+S G +V++ +  G  P   RI GQ+ H +GS++P 
Sbjct  324   FNNYSTESKQFNQNIRLYNSMFAFSSPGFKVDKGVIPGRGPPTIRIQGQSCHRMGSMIPA  383

Query  863   GGSMTKLAQRDVNSRD--------------IHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
              G   K AQ  +   D              ++   V +L+ MLD  N   K FR AR  +
Sbjct  384   AGKTPKFAQLYIFDTDNELQNRVQGIRNPNLNMQTVSKLQQMLDDTNCHAKSFRKARDRL  443

Query  1001  QSNPVVAVKMNLIGRRNKDG  1060
             +   V  +K+ LI  R  DG
Sbjct  444   RQGNVENLKLKLISDRTTDG  463



>ref|XP_004308435.1| PREDICTED: uncharacterized protein LOC101290818 [Fragaria vesca 
subsp. vesca]
Length=1386

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 100/191 (52%), Gaps = 14/191 (7%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD  + C  C A++W +E S Q        YT+CC EG+++LP  +  P  L+ L 
Sbjct  95    YQDMGDMTNICIDCDAMYWSNE-SKQVPKNSALVYTECCKEGRVRLPSARPTPAFLEELL  153

Query  686   FYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                N  QS  F  NIR YN MF FTS+G  V+ S+  G  PS+++I GQ YH +GSL+P 
Sbjct  154   DPRNGGQSSGFRENIRAYNTMFAFTSIGANVDPSVTDGLGPSVYKICGQVYHLMGSLIPP  213

Query  863   GGSMTKLA-------QRDVNSRD-----IHENIVEELKNMLDGNNVLVKCFRMARTEIQS  1006
              G   K A       Q +V +R      ++E IV+ L  M +  N LV+ +R  R +   
Sbjct  214   EGESPKFAQLYIYDTQNEVENRQRVVQGLNEFIVQGLITMFNETNELVRFYRTIRDKYDD  273

Query  1007  NPVVAVKMNLI  1039
               + ++ + ++
Sbjct  274   RSLRSLSLTIL  284



>ref|XP_003600273.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1634

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 106/215 (49%), Gaps = 35/215 (16%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLP-KYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             + FG    +C  C A  W  ERS ++  RG+   ++ CC +GK++LP +  PP +L SL 
Sbjct  246   IHFGQPEFTCKRCFAELWYEERSEKS-RRGIDIDFSICCQKGKVELPLITRPPRLLLSLI  304

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYH---------  838
                + +S+HF +N R YNNMF FTS+GG +  +IN G  P  F + GQNYH         
Sbjct  305   NGYDRRSKHFKDNYRAYNNMFAFTSMGGNIQTTINNGGGPPQFILVGQNYHRIVTNNGEQ  364

Query  839   ------WIGSLVPGGGSMTKLAQ-----------------RDVNSRD-IHENIVEELKNM  946
                    IGSL+P  G+  K AQ                 R  NS D I  ++V++L  M
Sbjct  365   VNSLFTRIGSLLPEPGTTPKFAQLYIYDTQNEVENRAGHFRSGNSSDKIDISLVKDLTKM  424

Query  947   LDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRN  1051
             +D  N L K FR  R  +++    ++ +    R N
Sbjct  425   IDEYNPLSKSFRKVRDMVKAGNAPSLALRFRKRAN  459



>ref|XP_003606875.1| Helicase-like protein [Medicago truncatula]
Length=1674

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 102/200 (51%), Gaps = 15/200 (8%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD +  C  CGA  W  ER  ++     P++  CC  GKIQ+P +  PPP+L  L 
Sbjct  264   YSDIGDPSFECRKCGACMWYQERRRKSRESSNPEFGMCCGNGKIQIPFLPTPPPLLNDLM  323

Query  686   FYD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
             F + + +S+ F  NIR YN++F F+S G +V++ I  G  P   RI GQ+ H +GS++P 
Sbjct  324   FNNYSTESKQFNQNIRLYNSIFAFSSPGFKVDKGIIPGRGPPTIRIQGQSCHRMGSMIPA  383

Query  863   GGSMTKLAQRDVNSRD--------------IHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
              G   K AQ  +   D              ++   V +L+ MLD  N   K FR AR  +
Sbjct  384   AGKTPKFAQLYIFDTDNELQNRVQGIRNPNLNMQTVTKLQQMLDDTNCHAKSFRKARDRL  443

Query  1001  QSNPVVAVKMNLIGRRNKDG  1060
             +   V  +K+ LI  R  DG
Sbjct  444   RQGNVENLKLKLISDRTTDG  463



>ref|XP_004306651.1| PREDICTED: uncharacterized protein LOC101307332 [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 101/199 (51%), Gaps = 25/199 (13%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y DFGD +  C +C A +WR E++    TRG+  YT CC  G+++L   K  P  L+ L 
Sbjct  171   YKDFGDNSFQCIHCNAYYWRDEKN----TRGV--YTGCCKGGQVRLQPSKPTPTFLEHLL  224

Query  686   FYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINT-GNSPSIFRISGQNYHWIGSLVP  859
               +N  +   F  NIR YN+MF FTS+G  + + IN  G+ P +F+I GQ YH +GS++P
Sbjct  225   DPNNGAKGTRFRENIRVYNSMFAFTSMGADIVKDINKNGSGPYVFKICGQVYHLMGSVLP  284

Query  860   GGGSMTKLAQRDV-----------------NSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
               G   K AQ  V                   + I  +IV  L  M D  N L K FR  
Sbjct  285   LDGKPPKFAQLYVYDTKNEISNRINALNPNKKQRIDPHIVSGLIQMFDEINELTKLFRSI  344

Query  989   RTEIQSNPVVAVKMNLIGR  1045
             R + +++ + +  M ++ R
Sbjct  345   RDKFENDSLPSFSMTMLSR  363



>gb|KDQ27730.1| hypothetical protein PLEOSDRAFT_1042559, partial [Pleurotus ostreatus 
PC15]
Length=265

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = +2

Query  536  CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
            C +CGAL W  ER N++   G+P +  CC  GK++LP  + PP  LQ L   D+ Q+R F
Sbjct  5    CQHCGALHWADERVNRSRRTGIPNFGMCCDHGKVRLPAPQAPPHTLQGLLEADDAQAREF  64

Query  716  INNIRRYNNMFCFTSLGGRVNRSIN------TGNSPSIFRISGQNYHWIGSLVPGGG---  868
             +NIR YN    FTSLG R + SIN       G S  +FRI GQ  H  G+L  G G   
Sbjct  65   RHNIRAYNMALAFTSLGVREDSSINQRNGRRMGGSTWVFRIQGQLSHHSGALEAGEGRAP  124

Query  869  ---------SMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
                         L QR + +  +  + +E L+NML   +     F+ A
Sbjct  125  SYAQLYVYDPQAALQQRMLRNNALRRDTMEALQNMLSVTHRYASVFKHA  173



>dbj|BAD87158.1| DNA binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD87333.1| DNA binding protein-like [Oryza sativa Japonica Group]
Length=1083

 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 101/196 (52%), Gaps = 42/196 (21%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY-FY  691
             +G   + C YCGA+FW  ER                      LP+++ PP  L++L  F 
Sbjct  206   YGAPTYECLYCGAVFWFQER----------------------LPKLREPPEPLKTLLKFN  243

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
              + +S+ F+  +R YN+MF FTS+G  V+R+IN G++P +F+I+G  +H IGSL+P  G 
Sbjct  244   GDARSKRFLRQVRSYNSMFAFTSMGATVDRTINNGSAPYVFKINGVVHHKIGSLLPAQGR  303

Query  872   MTKLAQRDV--------NSRDIHEN-----------IVEELKNMLDGNNVLVKCFRMART  994
               + AQ  +        N  +I EN           IV+ L  MLD +N+LV+ FR AR 
Sbjct  304   RPQFAQLYIYDPENEIQNRINIFENDGSNSDKADPAIVDALCTMLDSHNILVQKFRYARE  363

Query  995   EIQSNPVVAVKMNLIG  1042
              +  N    + + L+G
Sbjct  364   RLNENGNQRLTLRLMG  379



>emb|CDY20262.1| BnaC04g36940D [Brassica napus]
Length=273

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 90/189 (48%), Gaps = 22/189 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C YC AL W  E+     +   P ++ CC +G+++LP   +PP             S H
Sbjct  64    ECPYCRALVWEQEKKGSRGSNRTPLFSICCQQGRVKLPPEPHPP----HSLASLRSSSAH  119

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F +NIR YN++  FTS+G +++  +     P   RI GQN H IGSLVP  G   K +Q 
Sbjct  120   FQHNIRTYNSILAFTSMGAKLDSKVMHKAGPFTLRIHGQNAHKIGSLVPQAGKPPKFSQL  179

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              R   + ++  +IV++L   +D NN + K FR AR   +++   
Sbjct  180   YIFDTANEVKNRIATVKRTTKAGELDPDIVKQLIETMDANNCIAKVFRKARDAHENSSCP  239

Query  1019  AVKMNLIGR  1045
               ++ LIG+
Sbjct  240   EFRIRLIGQ  248



>ref|XP_007334868.1| hypothetical protein AGABI1DRAFT_47875, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM74497.1| hypothetical protein AGABI1DRAFT_47875, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=171

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 70/119 (59%), Gaps = 1/119 (1%)
 Frame = +2

Query  533  SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
            +C +CGAL W  E+  ++     PK+  CC+EG+I LP+ ++PP  +Q L+      +R 
Sbjct  40   ACAHCGALHWIGEKLARSSDHS-PKFGMCCHEGQISLPQRQDPPRHIQELFLSQEPHARE  98

Query  713  FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
            F  NI +YN  F FTSLG     S+N G  P +F I+G+  HW GSLVP  G + K AQ
Sbjct  99   FRENIWKYNRAFSFTSLGVNEVHSVNNGRGPPVFCITGELCHWSGSLVPHNGQLPKYAQ  157



>ref|XP_004296079.1| PREDICTED: uncharacterized protein LOC101300808 [Fragaria vesca 
subsp. vesca]
Length=754

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 102/205 (50%), Gaps = 21/205 (10%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNV--TRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
             Y D GD++  C +CGA FW+ E    N+     +P YT CC +G+IQ+    + PP LQ 
Sbjct  29    YKDSGDSSFGCGHCGAYFWKGEALANNIRTNNTVPIYTGCCQKGEIQILSSDSTPPFLQQ  88

Query  680   LYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLV  856
             L   +N  +S  F  NIR YN+MF FTS+G +++  +N  + P +F+I GQ +H +GS +
Sbjct  89    LLDPNNGRRSILFRENIRVYNSMFAFTSMGAKIDYDLNRRSGPYVFKICGQIHHLMGSAL  148

Query  857   PGGGSMTKLAQ---RDVN---------------SRDIHENIVEELKNMLDGNNVLVKCFR  982
             P  G   K AQ    D N               ++    +IV  L  M D  N L K +R
Sbjct  149   PVEGERPKYAQLYIYDTNNEVSNRMDAIDPCHTNKKTKPDIVGGLIQMFDEINELAKEYR  208

Query  983   MARTEIQSNPVVAVKMNLIGRRNKD  1057
               R + +   +    M ++G +  D
Sbjct  209   NVRDKFEDESLSLFNMTILGGQPTD  233



>ref|XP_008359618.1| PREDICTED: uncharacterized protein LOC103423324 [Malus domestica]
Length=1484

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 105/208 (50%), Gaps = 24/208 (12%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNV----TRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
             Y+DFG     C YC ALFW  E++ ++     +   P++T CC   K+   R K     L
Sbjct  139   YVDFGLRDCQCQYCNALFWPAEQTKKHAKHTSSVSTPQFTACCMSNKVHFARAKPTXAYL  198

Query  674   QSLYFYDNEQS-RHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGS  850
             + L    N Q+   F  NIR YN++   TS+G +V+ SIN    P +F+I+G  +H +GS
Sbjct  199   EHLLNPMNSQAFLKFKTNIRSYNSIMALTSMGXKVDPSINKRRGPYVFKINGXVHHLMGS  258

Query  851   LVPGGGSMTKLA-------QRDVNSR-----------DIHENIVEELKNMLDGNNVLVKC  976
             L+P  G   K A       Q +VN+R            + + IV +L  MLD  N +VK 
Sbjct  259   LLPPEGXDPKFAXLYIYDTQNEVNNRINCFNGSEPSEKLDQQIVGDLIKMLDECNEVVKL  318

Query  977   FRMARTEIQSNPVVAVKMNLIG-RRNKD  1057
             FR+AR  I    +  +++ L G + N+D
Sbjct  319   FRLARDRINEGSISNLRLRLYGAQSNRD  346



>ref|XP_009117965.1| PREDICTED: uncharacterized protein LOC103843024 [Brassica rapa]
Length=1421

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 95/191 (50%), Gaps = 24/191 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W  ER  +      PK++ CC  G++QLP +K  P +L+ L   D+E S +F  NIR+ N
Sbjct  2     WYGERIEKKRKSKKPKFSLCCGLGQVQLPLLKESPDILKRLLHGDDEISSYFRENIRQLN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RDV  898
              +F FTSLGG+V+R +  G  P +F++ G+NYH +GSL P  G   K +Q        ++
Sbjct  62    MVFSFTSLGGKVDRCVPQGRGPKMFQLQGENYHLMGSLKPPAGEEPKFSQLYIVDTETEI  121

Query  899   NSRD-----------------IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
             + R                  +   ++E +  ML+  N  V  FR AR    +NP     
Sbjct  122   DKRASIIGKYKKKADKAKKQGLRNKVIEMIVEMLNQVNPYVHQFRSARDRFNTNPETTFH  181

Query  1028  MNLIGRRNKDG  1060
             M +I  R KDG
Sbjct  182   MRIISSREKDG  192



>ref|XP_007860217.1| hypothetical protein GLOTRDRAFT_30816, partial [Gloeophyllum 
trabeum ATCC 11539]
 gb|EPQ61091.1| hypothetical protein GLOTRDRAFT_30816, partial [Gloeophyllum 
trabeum ATCC 11539]
Length=445

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +2

Query  533  SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             C +CGAL WR ER +++  R  P +  CC  G+++LP     P +L+ L+  ++ Q+R 
Sbjct  4    ECIFCGALHWRLERLSKSTERS-PTFGLCCDSGQVRLPAFDTAPYLLRRLFVANDPQARE  62

Query  713  FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
            F  NIR+YN    FTSLG  ++ S+NTG  P +FR+ G+ YH  GSL+P  G+    AQ
Sbjct  63   FRENIRQYNAALAFTSLGVTIDDSVNTGRGPYVFRVHGELYHQAGSLLPPEGTPPAYAQ  121



>emb|CDY67942.1| BnaCnng57090D [Brassica napus]
Length=433

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 83/163 (51%), Gaps = 19/163 (12%)
 Frame = +2

Query  629   GKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPS  808
             GK++LP ++ PP  L  L +   E   HF   IR YN MF FTSLGG+VN SIN G  P 
Sbjct  16    GKVKLPLLRAPPTSLLKLLYNKGEMRNHFREFIRAYNMMFSFTSLGGKVNNSINNGAGPY  75

Query  809   IFRISGQNYHWIGSLVPGGGSMTKLAQ------------------RDVNSRDIHENIVEE  934
             +F++ G+NYH IG ++PG        Q                  R  ++  I   IVE 
Sbjct  76    LFQLCGENYHLIGDMLPGPDKNPAFLQLYIHDTANEISNRMAAYGRTGSTEKIKRQIVEI  135

Query  935   LKNMLDGNNVLVKCFRMARTEIQ-SNPVVAVKMNLIGRRNKDG  1060
             LKNMLD NN  V  FR AR  ++ S     +++ L   R+ DG
Sbjct  136   LKNMLDANNCYVGAFRSARERLEVSGAGRRMRLVLASGRSTDG  178



>gb|KEH19332.1| AT hook motif protein, putative [Medicago truncatula]
Length=258

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 99/195 (51%), Gaps = 48/195 (25%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  CGA+ W  ER  +      P+++ CC +G I+  ++                     
Sbjct  28    CKQCGAMMWYDERIQKPYNPKKPRFSLCCMDGNIKNGKINT-------------------  68

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
                    + MF FTSLGG++N S+N GN+P +F ++G+NYH +GSL+P  GS  K AQ  
Sbjct  69    -------SMMFSFTSLGGKINTSMNDGNAPPMFIMNGENYHQMGSLLPQDGSQPKFAQLY  121

Query  890   ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
                               +DV+S  ++ +IVE++K +LD  N   + +RM R ++++N +
Sbjct  122   IYDTNNEVANRMSVVGMDKDVSS--LNSSIVEDIKQILDSCNPYAQAYRMVRDKLRTNDM  179

Query  1016  VAVKMNLIGRRNKDG  1060
               +K+ ++G+R +D 
Sbjct  180   PNLKLRILGKRGRDA  194



>gb|ABA97027.1| hypothetical protein LOC_Os12g16620 [Oryza sativa Japonica Group]
Length=420

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (53%), Gaps = 26/177 (15%)
 Frame = +2

Query  515  FGDAAHSCNYCGALFWRHERSNQNVT----RGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
            +G  AH C YCGA FW  +   +  +    RG  ++  CC  GK+ LP +K+PPP L  L
Sbjct  40   YGPPAHVCQYCGAQFWYQKSVKRPYSNSSDRGHIRFHLCCRGGKVCLPYLKHPPPFLAKL  99

Query  683  YFYDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVP  859
               + +  S++ + +IR YN++F FTSLG +++  IN G  P +F+I+GQ +H IGSL+P
Sbjct  100  LDPNGDILSKYILKSIRSYNSLFAFTSLGAKIDYGINKGPGPYVFKINGQVHHRIGSLLP  159

Query  860  GGGSMTKLAQ-------RDVNSR--------------DIHENIVEELKNMLDGNNVL  967
              G     AQ        +V++R               + + IVE L  M D +N L
Sbjct  160  EEGESLGYAQLYIVDIENEVHNRISIFDKDRDCDDDNGVDKKIVEGLIRMFDESNEL  216



>emb|CDY19188.1| BnaC05g13890D [Brassica napus]
Length=359

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 87/160 (54%), Gaps = 23/160 (14%)
 Frame = +2

Query  629   GKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPS  808
             G+++LP ++ PPPVL+ L     +    F NNIR YN++  FTS+G +++ ++ +G+ P 
Sbjct  36    GRVKLPPVRQPPPVLEKL-----QDESSFRNNIRVYNSILAFTSIGAKIDHTVTSGSGPP  90

Query  809   IFRISGQNYHWIGSLVPGGGSMTKL------------------AQRDVNSRDIHENIVEE  934
              FRI GQNYH IGSL+P  G+  K                    QR  +S  + E IV++
Sbjct  91    TFRIQGQNYHRIGSLIPTSGNPPKFLQLYIVDTSNEVSNRIQSLQRTPSSGPLQEGIVKQ  150

Query  935   LKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNK  1054
             L +MLD +N L + FR AR + ++       + L+  + K
Sbjct  151   LIDMLDSSNHLCQIFRKARDQYETAGAKEFTIRLVANQGK  190



>ref|XP_002446060.1| hypothetical protein SORBIDRAFT_06g001180 [Sorghum bicolor]
 gb|EES10388.1| hypothetical protein SORBIDRAFT_06g001180 [Sorghum bicolor]
Length=1106

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 22/203 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPK--YTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +G     C+YCGA+FW  ER    +        Y  CC  G+I +P  +     L SL  
Sbjct  32    YGPPDFRCSYCGAVFWYRERLRPEMPCHASNVIYNNCCKAGRIVIPPFQPRLEPLASLAK  91

Query  689   YDNE-QSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
             +D + +S  F+ NIR+YN +F FTS+G  ++RS+N G+ P +F+I GQ +H IGSL+P  
Sbjct  92    FDGDARSNRFMKNIRQYNCLFAFTSMGANIDRSMNDGHGPPVFKICGQVHHRIGSLLPLD  151

Query  866   GSMTKLAQ-------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMA  988
                 K  Q                    D +  ++  ++V+ L  M+D +N L K FR A
Sbjct  152   SEPPKFIQLYVYDTSNEVANRLHALDPSDASGANLDVSVVQALTRMIDQHNPLAKKFRHA  211

Query  989   RTEIQSNPVVAVKMNLIGRRNKD  1057
             R  +  +      + +IG R  D
Sbjct  212   RDRLLEHGDEEFIIRIIGAREGD  234



>ref|XP_009107547.1| PREDICTED: uncharacterized protein LOC103833199 [Brassica rapa]
Length=983

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 91/191 (48%), Gaps = 23/191 (12%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  CGAL W+ E + ++      ++T CC +G+I+LP M+ PPPVL+ L      Q + F
Sbjct  542   CPSCGALVWQSESTGRDPRTKELRFTICCNQGQIKLPPMRQPPPVLEKLL-----QCKQF  596

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
                IR YN +  FTS+G  ++ S+     P  FRI G+ YH IGSL+P  G   K  Q  
Sbjct  597   RETIRVYNALLAFTSIGANIDYSVVFCRGPFTFRIQGKTYHRIGSLIPNPGLPPKYLQLY  656

Query  890   ----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
                             +  +     E  ++ L  M+D NN L K FR  R   ++N    
Sbjct  657   IFDTVNEVKNRLEALGQTTSEGKATEATLKVLIEMVDTNNCLAKVFRRVRDRYEANSEED  716

Query  1022  VKMNLIGRRNK  1054
               ++LI  + K
Sbjct  717   FTISLIFDKGK  727



>gb|AAD15468.1| putative helicase [Arabidopsis thaliana]
Length=1265

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 97/188 (52%), Gaps = 24/188 (13%)
 Frame = +2

Query  557   FWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRY  736
              W  ER  +  T+    +T CC EG ++LP +K  P +L++L   ++  S+H+ +N R +
Sbjct  1     MWYDERIRKKETKKESGFTLCCGEGSVKLPFLKESPDLLKNLLSGNHPLSKHYRDNARTF  60

Query  737   NNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-------RD  895
             N +F  TSLGG+V++S+  G  P++FR+ G NYH IGSL P  G   K +Q        +
Sbjct  61    NMVFAVTSLGGKVDKSMPKGRGPAMFRLQGGNYHLIGSLKPTPGDYAKYSQLYIVDTENE  120

Query  896   VNSRDI-----------------HENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAV  1024
             V +R I                  +N++E +  ML+  N  V+ FR AR  IQ+N     
Sbjct  121   VENRAIVIGKGKIAKPASGKPNLDKNLIEVIIKMLNRCNPYVRKFRTARERIQTNDEEPF  180

Query  1025  KMNLIGRR  1048
              M +I  R
Sbjct  181   HMRIIADR  188



>ref|XP_011003936.1| PREDICTED: uncharacterized protein LOC105110557 [Populus euphratica]
Length=267

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 84/155 (54%), Gaps = 19/155 (12%)
 Frame = +2

Query  650   MKNPPPVLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISG  826
             M+  PP+L  L    N   S+ F +NIR YN+MF FTS+G +++ S+N   +P +F+ISG
Sbjct  1     MQPTPPILDFLLDPSNGSASKKFRDNIRAYNSMFAFTSMGAKIDTSVNDQPAPYVFKISG  60

Query  827   QNYHWIGSLVPGGGSMTKLAQ------------------RDVNSRDIHENIVEELKNMLD  952
               +H +GSL+P  G   K AQ                  R+  S  + ENIV +L  MLD
Sbjct  61    HCHHLMGSLLPVDGESPKFAQLYVFDTAHEVANRLLPFTRNSKSSSLDENIVVDLLRMLD  120

Query  953   GNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
               N L K FR AR + Q+   V  K+ L+G+R+ D
Sbjct  121   ETNELAKLFRKARDKTQNIQSVDYKLRLLGKRSHD  155



>emb|CDY00429.1| BnaC07g13970D [Brassica napus]
Length=508

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 93/205 (45%), Gaps = 30/205 (15%)
 Frame = +2

Query  446   YNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCY  625
             ++ VKTK K  K        Y+D GD  ++C +CGA+ W +ER N++  R  P +T C  
Sbjct  117   FSEVKTKVKPVKA---KEDDYVDEGDPTYTCVHCGAIMWNNERINKSKYRKKPIFTLC--  171

Query  626   EGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSP  805
                                  + +  S+HF  N R YN +F FTSLGG+V  S+N G  P
Sbjct  172   ---------------------WTDSLSKHFQRNTRPYNMVFSFTSLGGKVENSLNKGRGP  210

Query  806   SIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRM  985
              +F++ G+NYH  GSL P  G   K  Q  +      EN VE   N L  +         
Sbjct  211   QMFQLHGENYHLSGSLTPPEGDYAKFGQLYIVDTST-ENEVENRSNALSKSKKSSSD---  266

Query  986   ARTEIQSNPVVAVKMNLIGRRNKDG  1060
              R     NP     M L+ R +KDG
Sbjct  267   TRERFLENPEKTFHMRLVSRSDKDG  291



>emb|CDY24448.1| BnaC05g35060D [Brassica napus]
Length=273

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 91/190 (48%), Gaps = 23/190 (12%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  C A+ W  E   Q   +    ++ CC +G+++LP  + PP  L+ L    N     F
Sbjct  86    CPVCQAIVWIAEAVVQETEKSPRMFSICCQQGRVKLPPRRQPPSPLKELLDKSN-----F  140

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
              + IR  N M  FTS+GG+++ S+     P  FR+ GQ +H IGSL+P  G   +  Q  
Sbjct  141   KSIIRIANGMLAFTSMGGQIDNSVTNSCGPYAFRLHGQTHHKIGSLLPPDGKFPQYLQLY  200

Query  890   ----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
                             +  ++ +I +N+V +L  MLD NN L K FR AR  + S   V 
Sbjct  201   IVDTDNEVANRKKAFSKGTSALEIDDNLVVDLIKMLDENNHLAKTFRHARDRVLSGGAVE  260

Query  1022  VKMNLIGRRN  1051
               + L+ +++
Sbjct  261   FSVRLVNQKH  270



>ref|XP_009150787.1| PREDICTED: uncharacterized protein LOC103874120 [Brassica rapa]
Length=269

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 93/191 (49%), Gaps = 23/191 (12%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C  C A+ W  E   Q   +    ++ CC +G+++LP  + PP  L+ L    N     F
Sbjct  84    CPNCQAIVWIAEAVVQETEKSPRMFSICCQQGRVKLPPRRQPPSPLKELLDKSN-----F  138

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
              + IR  N M  FTS+GG+++ S+   + P  FR+ GQ +H IGSL+P  G   +  Q  
Sbjct  139   KSIIRIANGMLAFTSMGGQIDNSVTNSSGPYAFRLHGQTHHKIGSLLPPDGRFPQYLQLY  198

Query  890   ----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
                             +  ++ +I +++V +L  MLD NN L K FR AR  + S   V 
Sbjct  199   IVDTDNEVANRKKAFSKGTSALEIDDSLVADLIKMLDENNHLAKTFRHARDRVLSGGTVE  258

Query  1022  VKMNLIGRRNK  1054
               + L+ ++++
Sbjct  259   FTVRLVNQKHR  269



>ref|XP_009107548.1| PREDICTED: uncharacterized protein LOC103833200 [Brassica rapa]
Length=1402

 Score =   105 bits (263),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 60/170 (35%), Positives = 86/170 (51%), Gaps = 23/170 (14%)
 Frame = +2

Query  536  CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
            C  CGAL W  E + ++   G   +T CC  G+I+LP +  PPP+L+ L      Q R F
Sbjct  75   CTKCGALMWTSESTGKDFKTGELTFTICCNHGQIKLPPINQPPPMLEELL-----QQRWF  129

Query  716  INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
             + IR YN++  FTS+G +++ ++     P   RI GQ +H IGSL+P  G   +  Q  
Sbjct  130  RDTIRVYNSVLAFTSIGMKMDYTVVNAPGPYTIRIQGQTHHRIGSLLPRQGRPPEYLQLY  189

Query  890  -----RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMAR  991
                  +V +R           ++ E  +E L  MLD NN L K FR AR
Sbjct  190  IFDTGNEVRNRLNAMGQTSTEGNLDETTLERLIEMLDENNCLAKLFRRAR  239



>ref|XP_006461161.1| hypothetical protein AGABI2DRAFT_54678, partial [Agaricus bisporus 
var. bisporus H97]
 gb|EKV47511.1| hypothetical protein AGABI2DRAFT_54678, partial [Agaricus bisporus 
var. bisporus H97]
Length=219

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 85/161 (53%), Gaps = 15/161 (9%)
 Frame = +2

Query  602   PKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNR  781
             PK+  CC+EG+I LP+ ++PP  +Q L+      +R F  NI +YN  F FTSLG     
Sbjct  1     PKFGMCCHEGQISLPQRQDPPRHIQELFLSQEPHAREFRENIWKYNRAFSFTSLGVNEVH  60

Query  782   SINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ------------RDVNSRDIHENI  925
             S+N G  P +F I+G+  HW GSLVP  G + K AQ            R   ++D+ E I
Sbjct  61    SVNNGRGPPVFCITGELCHWSGSLVPHNGQLPKYAQLYIYEPREALAARMQQNQDLDEQI  120

Query  926   VEELKNMLDGNNVLVKCFRMARTEIQSNPVV---AVKMNLI  1039
             +E L+  L  ++     +R A   ++ +P +    V ++LI
Sbjct  121   METLQTFLLQHHQYAPVYRHAWEILRLHPNIENHTVTLHLI  161



>emb|CDX93905.1| BnaC04g20640D [Brassica napus]
Length=383

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 90/193 (47%), Gaps = 25/193 (13%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C  CGAL W+ E + ++       ++ CC +G+I+LP ++ PPPVL+ L      Q + 
Sbjct  37    ECPSCGALVWQSESTGRDPKTKELHFSICCNQGQIKLPPLRQPPPVLEKLL-----QCKQ  91

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG--------  868
             F   IR YN +  FTS+G +++ S+  G     FRI GQ YH I SL+P  G        
Sbjct  92    FRETIRVYNALLAFTSIGAKLDYSVVFGRGQFTFRIQGQTYHCIVSLIPKPGLPPNYLQL  151

Query  869   -----------SMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
                         +  L Q     +   E  ++ L  M+D NN L K FR  R   ++N  
Sbjct  152   YIFDTANEVKNRLEALGQTTSEGK-ADEATLKVLIEMMDANNCLAKVFRRVRDRNEANSE  210

Query  1016  VAVKMNLIGRRNK  1054
                 ++LI  + K
Sbjct  211   QDFTISLISDKGK  223



>ref|XP_006389497.1| hypothetical protein POPTR_0022s00390g [Populus trichocarpa]
 gb|ERP48411.1| hypothetical protein POPTR_0022s00390g [Populus trichocarpa]
Length=1748

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 85/156 (54%), Gaps = 19/156 (12%)
 Frame = +2

Query  650   MKNPPPVLQSLYFYDN-EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISG  826
             M+  PP+L  L    N   S+ F +NIR YN+MF FTS+G +++ S+N   +P +F+ISG
Sbjct  139   MQPTPPILDFLLDPSNGSASKKFRDNIRAYNSMFAFTSMGAKIDTSVNDQPTPYVFKISG  198

Query  827   QNYHWIGSLVPGGGSMTKLAQ------------------RDVNSRDIHENIVEELKNMLD  952
               +H +GSL+P  G   K AQ                  RD  S  + ENIV +L  ML+
Sbjct  199   HCHHLMGSLLPVDGESPKFAQLYVFDTAHEVANRLLPFTRDSKSSSLDENIVVDLLRMLN  258

Query  953   GNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
               N L K FR AR + Q+   V  K++L+G+RN D 
Sbjct  259   ETNELAKLFRKARDKTQNIQSVDYKLHLLGKRNHDS  294



>gb|EXX56857.1| Pif1p [Rhizophagus irregularis DAOM 197198w]
Length=1449

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 92/194 (47%), Gaps = 15/194 (8%)
 Frame = +2

Query  512   DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
             D G     C +CGA FW  E+ N +  R  P ++ CC  GK+ L  +  PP  L +LY  
Sbjct  121   DLGRIDQICVHCGAKFWMEEK-NHSSNRTFPTFSICCAHGKVLLLPLTEPPSYLLNLYTS  179

Query  692   DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
                 +  F  NIRRYNN+   TS G  ++     G   S FRI GQ YH IG L+P  G 
Sbjct  180   SESDAISFRKNIRRYNNVLACTSFGTNIDTF--HGQGISNFRIHGQVYHRIGPLLPEEGH  237

Query  872   MTKLAQ-------RDVNSR-----DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
                 AQ        ++ +R     ++ E I+  L NM+D  N  ++ FR  R  IQ+N  
Sbjct  238   QPAFAQLYIYDSVHEIENRHNVMQELDEKILLNLLNMMDECNPYIQNFRHVRDLIQTNVP  297

Query  1016  VAVKMNLIGRRNKD  1057
               + M +   R +D
Sbjct  298   DEIFMVIYADRTQD  311



>emb|CDY55230.1| BnaCnng28530D [Brassica napus]
Length=566

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  602  PKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNR  781
            P ++ CC +G++QLP +K PP VL+ L   D+  S+HF  N+R YN  F FT LGG+V R
Sbjct  453  PTFSLCCLQGQVQLPLLKEPPLVLKKLMEGDDILSKHFQKNMRPYNMAFSFTPLGGKVER  512

Query  782  SINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
            S+  G  PS+F++ G+NYH +GSL P  G+  K  Q
Sbjct  513  SVEKGIGPSMFQLQGENYHLMGSLQPNDGNEAKFGQ  548



>ref|XP_009137136.1| PREDICTED: uncharacterized protein LOC103861187 [Brassica rapa]
Length=1477

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 95/193 (49%), Gaps = 22/193 (11%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C  C AL W  E+        +P ++ CC +G+++LP     PP L++L       S+H
Sbjct  62    ECPLCHALVWEKEKKGTRGPNRIPLFSICCQQGRVKLPPEPEAPPALKTLLL----SSKH  117

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F ++IR YN++  FTS+G +++ S+     P  FRI GQN H IGSLVPG G   K +Q 
Sbjct  118   FQHDIRTYNSILAFTSMGAQIDHSVMHKTGPFTFRIHGQNAHRIGSLVPGAGQPPKFSQL  177

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              R     ++  NIV+EL   +D +N L K FR AR   +++   
Sbjct  178   YIIDTANEIKNRISTVKRTATVGELDPNIVKELIETMDTHNCLTKIFRKARDIHETDSCQ  237

Query  1019  AVKMNLIGRRNKD  1057
                + L G+  +D
Sbjct  238   EFSIRLKGKSKRD  250



>gb|ESA22057.1| hypothetical protein GLOINDRAFT_45157, partial [Rhizophagus irregularis 
DAOM 181602]
Length=383

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 90/188 (48%), Gaps = 15/188 (8%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             +C YCGA FW  E+ N+N +   P ++ C   GK++L  +  PPP L +LY   +  +  
Sbjct  4     TCIYCGAKFWMEEK-NRNSSLASPAFSICYAHGKVRLAPLIVPPPYLLNLYTSSDSDAVS  62

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQR  892
             F  NIRRYNN+   TS G  +N  +  G   S FRI GQ YH I SL+P  G     AQ 
Sbjct  63    FRKNIRRYNNVLACTSFGADIN--VIAGQGISDFRIHGQVYHRISSLLPEDGLQPAFAQL  120

Query  893   DVNS------------RDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNL  1036
              +               D+++ I+  L  MLD  N  ++ F   R  IQ N    + M +
Sbjct  121   YIYDTEHENANRHNVMSDLNDGILHNLLIMLDECNPYIRNFCRVRDLIQMNVPDEIFMVI  180

Query  1037  IGRRNKDG  1060
                R +D 
Sbjct  181   HADRTRDS  188



>ref|XP_009138227.1| PREDICTED: uncharacterized protein LOC103862283 [Brassica rapa]
Length=1504

 Score =   102 bits (255),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 95/193 (49%), Gaps = 25/193 (13%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLYFYDNEQSR  709
             SC  CGAL W  E +    +R   +++ CC  G+++LP ++ PP P+L+ L      +S 
Sbjct  86    SCPSCGALLWNAEATGVQTSRDAKQFSLCCQRGRVRLPPVREPPSPLLELL------ESP  139

Query  710   HFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
              F  +IR  N++  FTS+G +V+ S+     P  FR+ GQ  H IGS++P  G+  +  Q
Sbjct  140   KFRPHIRVANSLLAFTSMGAQVDHSVTGTPGPFTFRVHGQIIHRIGSMLPEDGNDPEYLQ  199

Query  890   RDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
               +   D                  + + ++ +L  MLD NN L K FR AR   +S   
Sbjct  200   LYIFDTDNELENRKRSFTKGSSTLAVEDTVIAQLIEMLDTNNHLAKTFRHARDRFRSTGK  259

Query  1016  VAVKMNLIGRRNK  1054
             +   + L+ + N+
Sbjct  260   IEFSITLVSQPNR  272



>emb|CDY70093.1| BnaCnng66670D [Brassica napus]
Length=673

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 99/225 (44%), Gaps = 65/225 (29%)
 Frame = +2

Query  458   KTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKI  637
             KTK KE         +Y+D GDA  +C YCGA+ W  ER N+ +                
Sbjct  231   KTKPKE--------DAYIDEGDATFTCTYCGAIMWFGERLNRRL----------------  266

Query  638   QLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFR  817
                + +NP              ++HF  N R YN +F FTSLGG+V+R++  G  P++  
Sbjct  267   ---KTRNP--------------NKHFQRNTRAYNMVFSFTSLGGKVDRAVRKGKGPNMLV  309

Query  818   ISGQNYHWIGSLVPGGGSMTKLAQ-----------------------RDVNSRD-IHENI  925
             + G+NYH IGSL P  G+  K  Q                       +    RD + + I
Sbjct  310   LQGENYHLIGSLQPPTGNDAKFGQLYIVDTENETENRTNALSKGGQKKAYKKRDGLKKEI  369

Query  926   VEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             ++ L  ML+  N  VK FR A+     NP  +  M ++  R KDG
Sbjct  370   IDLLIKMLNETNPYVKQFRSAKDRFTINPKDSFHMRIVSDRAKDG  414



>gb|KDQ08676.1| hypothetical protein BOTBODRAFT_75354, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=275

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 91/180 (51%), Gaps = 21/180 (12%)
 Frame = +2

Query  506  YLDFGDAAHS-------CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPP  664
            +++   +AHS       C +CGAL WR ER  ++ T   P++  CC  GK+QL  M   P
Sbjct  3    FVEAAASAHSLGPMNVQCPHCGALHWRSERLTRS-TVANPQFGTCCVRGKVQLEPMPPLP  61

Query  665  PVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWI  844
              L +L++  +  ++ F  NIR+YN  F F S+G +V+RS   G  P  FRI G  +H I
Sbjct  62   ATLHTLFYAQSPSAKEFRKNIRQYNAAFAFASVGMKVDRSF-AGRGPYTFRIHGTLHHII  120

Query  845  GSLVPGGGSMTKLAQRDVNSRDI------------HENIVEELKNMLDGNNVLVKCFRMA  988
            G+++P  G     AQ  ++  D+            +   ++E++  L  +N   + ++ A
Sbjct  121  GTMLPQPGHAPSYAQLWIHDPDVALDHRMVRNAERNATTMQEIQQALLQHNQYARLYKTA  180



>ref|XP_009135954.1| PREDICTED: uncharacterized protein LOC103860104 [Brassica rapa]
Length=1492

 Score =   102 bits (253),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 59/192 (31%), Positives = 93/192 (48%), Gaps = 22/192 (11%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C +C AL W  E+         P ++ CC +G+++L      PP L+SL       S HF
Sbjct  67    CPFCHALVWEKEKKGTRGPNRTPLFSICCQQGRVKLKPETEAPPALKSLLL----TSTHF  122

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
              ++IR YN++  FTS+G +++ S+     P   RI GQN H IGSLVP  G   + +Q  
Sbjct  123   QHDIRTYNSILAFTSMGAQLDHSVMHKTGPFTLRIHGQNAHRIGSLVPEPGRRPQFSQLY  182

Query  890   -----RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA  1021
                   +V +R            +  N+V+ L   +D +N L K FR AR   +++    
Sbjct  183   IVDTANEVQNRLSTVKRTGKTGQLDPNVVKLLIETMDAHNCLTKIFRKARDIHETDSCQD  242

Query  1022  VKMNLIGRRNKD  1057
               + LIG+  ++
Sbjct  243   FSIRLIGQSKRN  254



>gb|AAT85232.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1396

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 94/187 (50%), Gaps = 18/187 (10%)
 Frame = +2

Query  494  TFHSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVL  673
            T  S L  G    +C YCGALFW  ER+        P Y KCC  G ++LP  + PP  L
Sbjct  201  TIFSPLYLGGPDQTCRYCGALFWYEERARGQGQVTSPVYNKCCRGGSVRLPPYRPPPEPL  260

Query  674  QSLYFYDNEQ-SRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGS  850
             SL    N   S HF +NIR YN++F  TS+G  + RSIN G  P +F+ISGQ  H IGS
Sbjct  261  LSLLTGQNHALSAHFFDNIRCYNSIFAMTSMGVNIIRSINDGGGPYVFKISGQLCHRIGS  320

Query  851  LVPGGGSMTKLAQRDV-----------------NSRDIHENIVEELKNMLDGNNVLVKCF  979
            L+P  G+  +  Q  +                  S   +E+++     MLD NN +V+ F
Sbjct  321  LIPRHGAWPEYCQLYIFDTENEVQNRMGVASVRGSFQPNEDVIRSFMRMLDMNNPIVQVF  380

Query  980  RMARTEI  1000
            R AR  +
Sbjct  381  RTARDRL  387



>dbj|BAB02793.1| helicase-like protein [Arabidopsis thaliana]
Length=1428

 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 97/192 (51%), Gaps = 25/192 (13%)
 Frame = +2

Query  560   WRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYN  739
             W +ER N+      PK++ CC +G ++LP +K  P +++ L   ++  SRH+   IR YN
Sbjct  2     WFNERINKKSNSENPKFSLCCGQGSVKLPFLKESPELIKKLLKGNDALSRHYRQFIRIYN  61

Query  740   NMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV-------  898
              +F  TSLGG+V++S+  G  P++FR+ G NYH IGSL P  G   K +Q  +       
Sbjct  62    MIFAMTSLGGKVDKSMPKGRGPAMFRLQGGNYHQIGSLKPKDGDYAKYSQLYIVDTENEV  121

Query  899   -----------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVK  1027
                                +++++ +++ +  ML+  N  V+ FR AR  I S       
Sbjct  122   ENRANVIGKGNNGSSTKGKKNLNKQLIDAIIKMLNQVNPYVEKFRSARERIDSTNDEPFH  181

Query  1028  MNLIG-RRNKDG  1060
             M ++  R+  DG
Sbjct  182   MRIVSDRKGTDG  193



>emb|CDY67005.1| BnaAnng23430D, partial [Brassica napus]
Length=1595

 Score =   101 bits (251),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 95/193 (49%), Gaps = 25/193 (13%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPP-PVLQSLYFYDNEQSR  709
             SC  CGAL W  E +    +R   +++ CC  G+++LP ++ PP P+L+ L      +S 
Sbjct  218   SCPSCGALLWNAEATGVQTSRDAKQFSLCCQRGRVRLPPVREPPSPLLELL------ESP  271

Query  710   HFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
              F  +IR  N++  FTS+G +V+ S+     P  FR+ GQ  H IGS++P  G+  +  Q
Sbjct  272   KFRPHIRVANSLLAFTSMGAQVDHSVTGTPGPFTFRVHGQIIHRIGSMLPEDGNDPEYLQ  331

Query  890   RDVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
               +   D                  + + ++ +L  MLD NN L K FR AR   +S   
Sbjct  332   LYIFDTDNELENRKRSFTKGSSTLAVEDTVIAQLIEMLDINNHLAKTFRHARDRFRSTGK  391

Query  1016  VAVKMNLIGRRNK  1054
             +   + L+ + N+
Sbjct  392   IEFSITLVSQPNR  404



>gb|AET02330.2| replication factor-A carboxy-terminal domain protein [Medicago 
truncatula]
Length=678

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 96/190 (51%), Gaps = 14/190 (7%)
 Frame = +2

Query  500   HSYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS  679
              +Y+D G     C  CG+  W +ER+++      P ++ CC +G + L  ++ PP  L+ 
Sbjct  275   QTYMDLGHPNFECEKCGSTMWSNERADKPYRPRKPTFSLCCLKGDVSLEFLEQPPDYLKE  334

Query  680   LYFYD-NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQN--YHWIGS  850
             L  Y     S  F   IR YN++F FT++G +++ ++N      ++    +N   + + S
Sbjct  335   LLAYKGGRHSVKFREKIRAYNSIFAFTAMGAKIDNTMNLRPGLYLYVHDTENEIQNRLSS  394

Query  851   LVPGGGSMTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKM  1030
             L   GG +         +RD+  +IV  LK+MLD NN + K FRMAR  +       V++
Sbjct  395   L--NGGKI---------ARDLAADIVRRLKDMLDMNNSVAKLFRMARDRLSVPENKEVRI  443

Query  1031  NLIGRRNKDG  1060
              LIG R+ D 
Sbjct  444   RLIGTRSNDS  453



>gb|KDQ32681.1| hypothetical protein PLEOSDRAFT_153646 [Pleurotus ostreatus PC15]
Length=492

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 2/126 (2%)
 Frame = +2

Query  515  FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYD  694
             G     C +C AL W+ ER   + TR  P++  CCY+GKIQL  ++ PP  L +L   +
Sbjct  105  LGKMDLECQHCHALHWKDERLTSS-TRNSPQFGMCCYQGKIQLASLEAPPLELDNLLRDN  163

Query  695  NEQSRHFINNIRRYNNMFCFTSLGGRVNRSINT-GNSPSIFRISGQNYHWIGSLVPGGGS  871
            +  S+ F  NIRRYNN    TSLG +++ SIN  G  P +F+I G+  H  G+L+P  G 
Sbjct  164  SPASKEFRENIRRYNNALAMTSLGCKIDDSINRGGGGPYMFKIQGRLTHLAGALLPEEGQ  223

Query  872  MTKLAQ  889
            + + AQ
Sbjct  224  LPQYAQ  229



>emb|CAZ96142.1| conserved hypothetical protein [Saccharum hybrid cultivar R570]
Length=528

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 87/185 (47%), Gaps = 21/185 (11%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             L  G    +C +CGA FW  E+     T   P Y +CC  G I LP  + P      L+ 
Sbjct  12    LYLGGPTCTCPHCGARFWLEEQVRGCRTTN-PVYNRCCRGGSIVLPSYRPP--PQPLLHL  68

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
                E   HF +NIRRYN+MF  TS+G +V  +IN G+ P +F+ISGQ  H +GSL+P  G
Sbjct  69    LTREDPSHFFDNIRRYNSMFAMTSMGVKVINAINDGHGPYVFKISGQLCHRVGSLIPAHG  128

Query  869   SMTKLAQ----------------RDVNSRDIH--ENIVEELKNMLDGNNVLVKCFRMART  994
                +  Q                 +    D H  E +V     M D +N +VK FR AR 
Sbjct  129   KRPEYCQLYIFDTGNEIQNRMTVAEAQRADFHPNEALVAAFIAMFDTHNPIVKTFRTARD  188

Query  995   EIQSN  1009
              + + 
Sbjct  189   RLAAT  193



>gb|KDR65039.1| hypothetical protein GALMADRAFT_82350 [Galerina marginata CBS 
339.88]
Length=287

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +2

Query  536  CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
            C YCGAL W  ER +++ ++  PK+  CC+ GKI LP+++NPP  L       ++ S+ F
Sbjct  5    CEYCGALHWLDERISKS-SKCSPKFGMCCFSGKINLPKLENPPQELMGFLTGMDDASKKF  63

Query  716  INNIRRYNNMFCFTSLGGRVNRSIN-TGNSPSIFRISGQNYHWIGSLVPG  862
             +NIRRYNN    TS+G + + +IN  G  P +F+I G+  H+ GSL+P 
Sbjct  64   RSNIRRYNNALAMTSVGVKQDHAINQQGGGPWLFKIQGKLSHFAGSLLPA  113



>emb|CDY25439.1| BnaC09g39540D [Brassica napus]
Length=602

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 93/210 (44%), Gaps = 57/210 (27%)
 Frame = +2

Query  503   SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
             +Y+D GDA  +C YCGA+ W  ER N+ +                   + +NP       
Sbjct  167   AYIDEGDATFTCTYCGAIMWFGERLNRRL-------------------KTRNP-------  200

Query  683   YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
                     +HF  N R YN +F FTSLGG+V+R++  G  P++  + G+NYH IGSL P 
Sbjct  201   -------KKHFQRNTRAYNMVFSFTSLGGKVDRAVRKGKGPNMLVLQGENYHLIGSLQPP  253

Query  863   GGSMTKLAQ-----------------------RDVNSRD-IHENIVEELKNMLDGNNVLV  970
              G+  K  Q                       +    RD +++ +++ L  ML+  N  V
Sbjct  254   TGNDVKFGQLYIVDTENETENQTNALSKGGQKKAYKKRDGLNKEVIDLLIKMLNETNPYV  313

Query  971   KCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             K FR  +     NP  +  M ++  R KDG
Sbjct  314   KQFRSTKDRFTINPKDSFHMRIVSDRAKDG  343



>emb|CDX96947.1| BnaC02g30850D [Brassica napus]
Length=1559

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 93/191 (49%), Gaps = 23/191 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             SC  C AL W  E    ++ RG  +++ CC +G+++LP ++  P  L+ L      QS  
Sbjct  215   SCPSCHALLWAGEAVGGDINRGEGQFSICCQQGRVRLPPVREAPSPLKELL-----QSNK  269

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQR  892
             F  NIR  N++  FTS+G  V+ S+   + P  +R++G   H IGSL+P  G++ +  Q 
Sbjct  270   FRPNIRVANSLLAFTSMGANVDHSVTGTSGPFTYRVNGHVIHRIGSLLPDDGALPEYLQL  329

Query  893   DVNSRD------------------IHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
              +   D                  I ++I+ +L  M+D +N L K FR AR   +    +
Sbjct  330   YIFDTDNELENRKRAFTQGSSSLAIPDSIIVQLIEMMDKHNHLAKTFRHARDRFKETGTI  389

Query  1019  AVKMNLIGRRN  1051
                + L+ + N
Sbjct  390   EYSITLVSQTN  400



>ref|XP_001830517.2| hypothetical protein CC1G_13042 [Coprinopsis cinerea okayama7#130]
 gb|EAU91301.2| hypothetical protein CC1G_13042 [Coprinopsis cinerea okayama7#130]
Length=900

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +2

Query  512  DFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFY  691
            D G  +  C +CGA  W  ER   +   G PK+  CC + +IQLP++  PP  L      
Sbjct  40   DLGRMSFVCAHCGAAHWYQERLAASPKNGPPKFASCCAQNQIQLPQLPRPPYPLDRYLTE  99

Query  692  DNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS  871
             +  SR F  +I +YN  F FTSLG + + S+N GN P +FRISG+ +H  G+L+   G 
Sbjct  100  QDPVSRKFREDIWKYNRTFLFTSLGVQQDHSVNRGNGPPVFRISGELHHNSGALMAPAGM  159

Query  872  MTKLAQ  889
            + + +Q
Sbjct  160  VPRYSQ  165



>ref|XP_009135997.1| PREDICTED: uncharacterized protein LOC103860150 [Brassica rapa]
Length=1523

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 58/193 (30%), Positives = 96/193 (50%), Gaps = 25/193 (13%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPK-YTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSR  709
             +C+ C A+ W  E   +  TR  P+ ++ CC +G+++LP  + PP  L+ L         
Sbjct  111   TCSACQAIVWVGEAVVKE-TRNSPRMFSICCQQGRVKLPPRRQPPSPLKELL-----DRP  164

Query  710   HFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ  889
              F+  IR  N M  FTS+GG+++ ++     P  FR+ GQ +H IGSL+P  G+  +  Q
Sbjct  165   SFMLQIRVANGMLSFTSMGGQIDHTVTGTPGPFAFRLHGQTHHRIGSLLPPEGNTPQFLQ  224

Query  890   ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV  1015
                               +  +S +I +N++  L  MLD NN L K FR AR  + S   
Sbjct  225   LYIVDTENEVTNRKKAFSKGTSSVEIDDNLIAGLIKMLDENNHLAKTFRHARDRLLSGDA  284

Query  1016  VAVKMNLIGRRNK  1054
             V   + L+ ++++
Sbjct  285   VEFSITLVNQKHR  297



>gb|ABA95256.2| helicase, putative [Oryza sativa Japonica Group]
Length=1643

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 18/162 (11%)
 Frame = +2

Query  629   GKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPS  808
             G+I LP    PP  + +L    +  S HF+ +IRRYN+MF  TS+G ++  SIN G+ P 
Sbjct  62    GRISLPSYNPPPEPILNLLTSASSLSNHFLQHIRRYNSMFAMTSMGAKIIESINDGHGPY  121

Query  809   IFRISGQNYHWIGSLVPGGGSMTKLAQRDV---------------NSRD---IHENIVEE  934
             +F+ISGQ  H +GSL+P  G   + AQ  +               +SRD    +E IV  
Sbjct  122   VFKISGQICHRVGSLIPSQGRRPEYAQLYIFDTENEISNRINIASSSRDSFHANEEIVRS  181

Query  935   LKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKDG  1060
             L  M D +N +VK FR AR  +  N     K+ L G  +  G
Sbjct  182   LIEMFDTHNPIVKLFRTARERLSENESDHYKIRLFGSTDAHG  223



>emb|CDX81603.1| BnaC02g19070D [Brassica napus]
Length=465

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 82/180 (46%), Gaps = 45/180 (25%)
 Frame = +2

Query  503  SYLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSL  682
            +Y D GD    C  C ALFW +ER +++    +P +T CC  GKI+LP ++ PP  LQ L
Sbjct  228  AYKDDGDLTFKCPKCQALFWYNERVSKSRHASIPVFTMCCMRGKIKLPLLQEPPEFLQDL  287

Query  683  YFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPG  862
               D+                             IN G  P +F++ G+N+H IGS+ P 
Sbjct  288  LTKDDA---------------------------IINMGKGPKVFKLHGENFHLIGSMKPK  320

Query  863  GGSMTKLAQ-------RDVNSR-----------DIHENIVEELKNMLDGNNVLVKCFRMA  988
                 K +Q        +V +R            I E++VEEL NML  +NV VK FR A
Sbjct  321  PTESAKFSQLYIHDTENEVQNRIAALSGNSQKSKIREDLVEELMNMLRDSNVHVKTFRSA  380



>emb|CDY60422.1| BnaCnng36250D [Brassica napus]
Length=797

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 91/192 (47%), Gaps = 23/192 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             +C  C A+ W  E   Q       +++ CC +G++ LP  + PP  L+ L      +   
Sbjct  610   TCPDCKAIVWNAEAVVQETQNSPRRFSICCQQGRVNLPPRRQPPSPLKELL-----EKSS  664

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F   IR  N M  FTS+GG+++ S+     P  FR+ GQ +H IGSL+P  G   + +Q 
Sbjct  665   FKILIRVANGMLAFTSMGGQIDNSVTNTPGPFSFRLHGQTHHRIGSLLPPEGKPPQFSQL  724

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              +  ++  + +++V+ L  MLD +N L K FR AR  I S   V
Sbjct  725   YIVDTEHEIANRKKSFNKGTSALAVDDDLVDSLIKMLDEHNPLAKTFRHARDRILSGDTV  784

Query  1019  AVKMNLIGRRNK  1054
                + L+ ++++
Sbjct  785   EFSITLVNQKHR  796



>ref|XP_003609074.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=1531

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 90/202 (45%), Gaps = 44/202 (22%)
 Frame = +2

Query  509   LDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYF  688
             +D G     C  CG+  W +ER+++      P ++ CC +G + L  ++ PP  L+ L  
Sbjct  1     MDLGHPNFECEKCGSTMWYNERADKPRRPRNPTFSLCCLKGDVSLEFLEQPPDYLKELLA  60

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             Y  + +                          +N    P +++ISGQNYH IG L+PG G
Sbjct  61    YKGDNT--------------------------VNLRPGPYVYKISGQNYHKIGGLIPGQG  94

Query  869   SMTKLAQ---RDV---------------NSRDIHENIVEELKNMLDGNNVLVKCFRMART  994
                K +Q    D                 +RD+  +IV  LK+MLD NN + K FRMAR 
Sbjct  95    KQPKFSQLFFHDTENEIQNRLSSLNGGKTARDLDADIVRRLKDMLDMNNSVAKLFRMARD  154

Query  995   EIQSNPVVAVKMNLIGRRNKDG  1060
              + +     V++ LIG R+ D 
Sbjct  155   RLSAPDNKEVRIRLIGTRSNDS  176



>ref|XP_003600221.1| Helicase-like protein [Medicago truncatula]
Length=1694

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 83/200 (42%), Gaps = 50/200 (25%)
 Frame = +2

Query  506   YLDFGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLY  685
             Y D GD    C  CGA  W  ER N++     PK+  CC +G IQLP ++ PP +L    
Sbjct  283   YYDIGDPVIECQRCGACMWYQERKNKSRESANPKFGLCCGDGTIQLPYLRKPPALL----  338

Query  686   FYDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGG  865
                        ++IRR                    G  P   RI GQ  H IGS++P  
Sbjct  339   -----------SHIRR--------------------GRGPPTIRIQGQACHRIGSMIPMP  367

Query  866   GSMTKLAQRDV---------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
             G   K AQ  +               N+  +   ++  L+ MLD NNV  K FRMAR  +
Sbjct  368   GRPPKFAQLYIYDTENELQHRLQGLSNANLLDIQMIAALQKMLDENNVHAKSFRMARDRL  427

Query  1001  QSNPVVAVKMNLIGRRNKDG  1060
                 V  +K+ LI  R  DG
Sbjct  428   SEGDVQNLKLKLISERTTDG  447



>gb|ERZ98206.1| hypothetical protein GLOINDRAFT_51202, partial [Rhizophagus irregularis 
DAOM 181602]
Length=242

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (51%), Gaps = 14/174 (8%)
 Frame = +2

Query  578   NQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFT  757
             NQN +   PK+  CC  GK++L  + +PPP L  LY     ++  F  NIR YN +   T
Sbjct  3     NQNSSLSSPKFAMCCAGGKVRLAPVLDPPPYLLDLYTSSCSEAISFRKNIRAYNGILACT  62

Query  758   SLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDV------NS-----  904
             S G  ++ S   G   S F+I GQ YH +GSL+P  G      Q  +      NS     
Sbjct  63    SFGANIDESFQ-GQGVSNFKIHGQIYHRVGSLMPDEGQKPVFVQLYIYDTDHENSNRLHV  121

Query  905   -RDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVA-VKMNLIGRRNKDG  1060
              RD++  +++ L+NMLD +N  ++ FR  R  +Q++   A + M +   R+ D 
Sbjct  122   MRDLNAEMLQNLQNMLDTSNPYIQNFRQVRDLLQNDADSAEISMRIFCDRSNDA  175



>ref|XP_009130289.1| PREDICTED: uncharacterized protein LOC103855081 [Brassica rapa]
Length=1590

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/191 (28%), Positives = 94/191 (49%), Gaps = 23/191 (12%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             SC  C AL W  E    ++ RG  +++ CC +G+++LP ++  P  L+ L      +S  
Sbjct  129   SCPSCHALLWAGEAVGGDINRGEGQFSICCQQGRVRLPPVREAPSPLKELL-----ESHK  183

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ-  889
             F   IR  N++  FTS+G  V+ S+   + P  +R++GQ  H IGSL+P  G++ +  Q 
Sbjct  184   FRAQIRVANSLLAFTSMGANVDHSVTGTSGPFTYRVNGQVIHRIGSLLPEDGALPEYLQL  243

Query  890   -----------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVV  1018
                              +  +S  I ++++ +L  M+D +N L K FR AR   +    +
Sbjct  244   YIFDTDNELENRKRAFTQGTSSLAIPDSVIVQLIEMMDIHNHLAKTFRHARDRFKDTGTI  303

Query  1019  AVKMNLIGRRN  1051
                + L+ + N
Sbjct  304   EYSITLVSQTN  314



>emb|CDY46030.1| BnaA02g16960D [Brassica napus]
Length=1029

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 90/203 (44%), Gaps = 34/203 (17%)
 Frame = +2

Query  533   SCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
              C  CGAL W+ E + ++      ++T CC +G+I+LP ++ PPP+L  L      + + 
Sbjct  74    ECPSCGALVWQSESTGRDPRTKELRFTICCNQGQIKLPPLRQPPPMLAKLL-----KCKQ  128

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTG-----------NSPSIFRISGQNYHWIGSLVP  859
             F   IR YN +  FTS+G  ++ S+  G             P  FRI GQ YH IGSL+P
Sbjct  129   FRETIRVYNALIAFTSIGANIDYSVFFGRGPFTFRIQGQTGPLTFRIQGQTYHRIGSLIP  188

Query  860   GGGSMTKLAQ------------------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRM  985
               G   K  Q                  +  +     E  ++ L  M+D  N L K FR 
Sbjct  189   KPGLPPKYLQLYIFDTANEVKNQLEALGQTTSEGKADEATLKVLIEMVDAKNCLAKVFRR  248

Query  986   ARTEIQSNPVVAVKMNLIGRRNK  1054
              R   ++N      ++LI  + K
Sbjct  249   VRDRYETNSGEDFTISLISDKGK  271



>gb|EPT05482.1| hypothetical protein FOMPIDRAFT_1091844, partial [Fomitopsis 
pinicola FP-58527 SS1]
Length=251

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 96/189 (51%), Gaps = 16/189 (8%)
 Frame = +2

Query  536   CNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHF  715
             C YC AL +  ER + +  R  PK+  CC +G+I LP     P  L+ L+   +  S+HF
Sbjct  5     CPYCAALHFPGERLSHSSRRN-PKFGMCCLQGQIDLPAFTPVPESLRRLFTRTDALSKHF  63

Query  716   INNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ--  889
               +IR+YNN F FTS+  +V+++I  G+ P  FRI G  +H +GSL+P        AQ  
Sbjct  64    HEHIRQYNNAFAFTSVAVQVDQAILNGSGPYSFRIHGSLHHRMGSLLPNENQPPAFAQLY  123

Query  890   ----------RDVNSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPV---VAVKM  1030
                       R+  + ++  +++  L+++   +N  V  ++ A   +   P    V ++ 
Sbjct  124   IHDPHAALQTRNNRNDNLKPSVMNVLQDLFLEHNPFVPLYKRAYEVLHEKPPEERVNLEA  183

Query  1031  NLIGRRNKD  1057
              +I R ++D
Sbjct  184   AIILRESED  192



>ref|XP_007219813.1| hypothetical protein PRUPE_ppa026702mg, partial [Prunus persica]
 gb|EMJ21012.1| hypothetical protein PRUPE_ppa026702mg, partial [Prunus persica]
Length=1236

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 18/139 (13%)
 Frame = +2

Query  698   EQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMT  877
             ++S  F  NIR YN+MF FTS+G ++++SIN G+SP +F+ISGQ +H +GSL+P  G   
Sbjct  9     KKSVLFRENIRVYNSMFAFTSMGAKIDKSINNGSSPYVFKISGQVHHLMGSLLPPEGQCL  68

Query  878   KLAQRDV------------------NSRDIHENIVEELKNMLDGNNVLVKCFRMARTEIQ  1003
             K AQ  +                   +  + +NIVE L  M D  N LVK FR  R + +
Sbjct  69    KFAQLYIYDTHNEVMNRLDAVNCNQKNEKLDQNIVEGLIQMFDQTNELVKLFRTIRDKFE  128

Query  1004  SNPVVAVKMNLIGRRNKDG  1060
                +  +K+ L+GR++ D 
Sbjct  129   KGSLPPLKITLLGRQSNDS  147



>ref|XP_007407747.1| hypothetical protein MELLADRAFT_104602 [Melampsora larici-populina 
98AG31]
 gb|EGG08773.1| hypothetical protein MELLADRAFT_104602 [Melampsora larici-populina 
98AG31]
Length=312

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 104/230 (45%), Gaps = 31/230 (13%)
 Frame = +2

Query  416   CFAVR--CENFQYNIVKTKCKEFKYGF*TFHSYLDFGDAAHSCNYCGALFWRHERSNQNV  589
             C AVR   EN +  ++K    E  Y         + G+  + C +CGA  W  E+     
Sbjct  3     CIAVRRTKENHETILLKKFKNEIPY---------NIGECNNICEHCGAAHWLKEKVAAKG  53

Query  590   TRGLPKYTKCCYEGKIQLPRMK-NPPPV---LQSLYFYDNEQSRHFINNIRRYNNMFCFT  757
                   Y+ CC  G+++LP+   N PPV   LQ L   D+  SR F +NIR YNN   FT
Sbjct  54    ITSPAHYSMCCRGGQVELPQHYFNFPPVPEFLQDLLTEDDAVSRRFRDNIRAYNNGLSFT  113

Query  758   SLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQRDVNSRDIHE------  919
             SLG  ++ S+N       F++ GQ  H +G+++P  G     AQ  V   ++ +      
Sbjct  114   SLGTEIDHSVNGPYGVRCFKMKGQLVHKMGTILPADGKEAAFAQIYVMGPELEDEAGHRV  173

Query  920   ----------NIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLI  1039
                       NI++ L++ +D  N   K FR A    + +  V +++  I
Sbjct  174   NMTGVEGLDVNIMKALQDFMDEYNPYAKQFRSAYKIWKRDDTVTIRLKTI  223



>ref|XP_008037664.1| hypothetical protein TRAVEDRAFT_147095, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW59201.1| hypothetical protein TRAVEDRAFT_147095, partial [Trametes versicolor 
FP-101664 SS1]
Length=388

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 17/188 (9%)
 Frame = +2

Query  536   CNYCGALFWRHER-SNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRH  712
             C +C A  W  ER S  + +R  P +  CC +G++ L  +  PP  L++L   D  Q+  
Sbjct  5     CVHCQAHHWIAERLSESSASR--PLFGFCCDKGQVALEPLPEPPLALRTLLTGDTPQAVE  62

Query  713   FINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGGS-------  871
             F NNIR+YN  F FTSLG  ++ S+ TG+ P +FRI G+  H  GSL+P  G+       
Sbjct  63    FRNNIRQYNAAFAFTSLGVAIDDSVTTGHGPYVFRIHGELCHRSGSLLPAEGNPPSYAQL  122

Query  872   -----MTKLAQRDVNSRDIHENIVEELKNMLDGNNVLVKCFRMART--EIQSNPVVAVKM  1030
                     LA+R   + ++  + ++ ++ ML   +     +R A     +Q +  +AV++
Sbjct  123   YIFDPRLALAERVRRNANLRRDTLQRIQAMLSATHRYAAIYRHAHEVLSLQEDADLAVRL  182

Query  1031  NLIGRRNK  1054
              +   R++
Sbjct  183   AVQPNRDR  190



>gb|ABD65047.1| hypothetical protein 26.t00109 [Brassica oleracea]
Length=261

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 81/170 (48%), Gaps = 22/170 (13%)
 Frame = +2

Query  602   PKYTKCCYEGKIQLPRMKNPPPVLQSLYFYDNEQSRHFINNIRRYNNMFCFTSLGGRVNR  781
             P ++ CC +G+++LP     P VL++L       S HF ++IR YN++  FTS+G +++ 
Sbjct  18    PLFSICCQQGRVKLPPEPEAPHVLKTLLL----TSTHFQHDIRTYNSILAFTSMGAQIDH  73

Query  782   SINTGNSPSIFRISGQNYHWIGSLVPGGGSMTKLAQ------------------RDVNSR  907
             S+     P  FRI GQN H IGSLVP      K  Q                  R     
Sbjct  74    SVMHKTGPFTFRIHGQNAHRIGSLVPQAEQPPKFNQLYIVDTANEVQNRISTVKRTAKVG  133

Query  908   DIHENIVEELKNMLDGNNVLVKCFRMARTEIQSNPVVAVKMNLIGRRNKD  1057
             ++  NIV+ L   +D +N L K FR AR   +++        L G+  +D
Sbjct  134   ELDPNIVKALIETMDTHNCLTKIFRKARDIHETDSCQEFSKRLKGKSKRD  183



>ref|XP_007416731.1| hypothetical protein MELLADRAFT_39963 [Melampsora larici-populina 
98AG31]
 gb|EGF99940.1| hypothetical protein MELLADRAFT_39963 [Melampsora larici-populina 
98AG31]
Length=309

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 95/198 (48%), Gaps = 21/198 (11%)
 Frame = +2

Query  515   FGDAAHSCNYCGALFWRHERSNQNVTRGLPKYTKCCYEGKIQLPRMKNPPPVLQS--LYF  688
              G+  H C +CGAL W  ER+          Y+ CC +G + LP  +   P L    L  
Sbjct  31    LGEQNHECQHCGALRWGEERTKLKSKHQEETYSNCCQQGSVTLPWGEFEGPTLPDSLLKL  90

Query  689   YDNEQSRHFINNIRRYNNMFCFTSLGGRVNRSINTGNSPSIFRISGQNYHWIGSLVPGGG  868
             Y  E  + F +NI  YNN   FTSLG +V++S+      + FR+SGQ  H IGS +P   
Sbjct  91    YTGE-DKEFQDNITHYNNTLSFTSLGVKVDQSVAGQKGINTFRVSGQLAHRIGSALPAAK  149

Query  869   SMTKLAQ---------RDVNSR-------DIHENIVEELKNMLDGNNVLVKCFRMARTEI  1000
              +   AQ          +V+ R       ++ + I+ EL+N+L+  N   +  + + T +
Sbjct  150   KIPSFAQIYVVGDGGEGEVDVRLGHFKKNNLSKEIMLELQNVLNDVNPYAEFLKSSATVL  209

Query  1001  QSNPVVAVKMNLI--GRR  1048
             +S P + + +  +  G+R
Sbjct  210   ESRPSLRIMLKTLPPGKR  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2460719396736