BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25761_g5_i2 len=255 path=[31079:0-141 11868:142-230 11957:231-254]

Length=255
                                                                      Score     E

ref|XP_009770196.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  54.3    1e-06   
ref|XP_009770194.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  54.3    2e-06   
ref|XP_009770195.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  54.3    2e-06   
ref|XP_009601717.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  53.9    4e-06   
ref|XP_009601705.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  53.9    4e-06   
emb|CAN82989.1|  hypothetical protein VITISV_011715                   53.5    6e-06   Vitis vinifera
ref|XP_009802731.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    6e-06   
ref|XP_010651134.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  52.8    8e-06   
ref|XP_010651133.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  51.2    3e-05   
emb|CBI16282.3|  unnamed protein product                              51.2    3e-05   
ref|XP_011089334.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  51.2    3e-05   
emb|CDP07144.1|  unnamed protein product                              50.8    4e-05   
ref|XP_011089333.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  50.1    7e-05   
ref|XP_011089332.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  50.1    7e-05   
ref|XP_011089331.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like ...  50.1    7e-05   
ref|XP_010253567.1|  PREDICTED: E3 SUMO-protein ligase SIZ1           49.7    1e-04   
gb|EYU36200.1|  hypothetical protein MIMGU_mgv1a001379mg              49.3    1e-04   
ref|XP_011089338.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  48.5    2e-04   
ref|XP_011089337.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  48.5    2e-04   
ref|XP_006343451.1|  PREDICTED: E3 SUMO-protein ligase SIZ1-like      48.5    2e-04   
gb|EYU18862.1|  hypothetical protein MIMGU_mgv1a020020mg              48.1    4e-04   
ref|XP_009787730.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  47.0    7e-04   
ref|XP_009338274.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  47.0    8e-04   
ref|XP_009338271.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  47.0    8e-04   
ref|XP_009338273.1|  PREDICTED: E3 SUMO-protein ligase SIZ1 isofo...  47.0    9e-04   



>ref|XP_009770196.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009770197.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X3 [Nicotiana 
sylvestris]
Length=309

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDSS+ + K+EIED+Y+M KI+CPCGS+LQTE+MI+  D
Sbjct  92   SDSSNVKLKEEIEDTYQM-KIRCPCGSSLQTETMIQCED  129



>ref|XP_009770194.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X1 [Nicotiana 
sylvestris]
Length=386

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDSS+ + K+EIED+Y+M KI+CPCGS+LQTE+MI+  D
Sbjct  92   SDSSNVKLKEEIEDTYQM-KIRCPCGSSLQTETMIQCED  129



>ref|XP_009770195.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X2 [Nicotiana 
sylvestris]
Length=382

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDSS+ + K+EIED+Y+M KI+CPCGS+LQTE+MI+  D
Sbjct  88   SDSSNVKLKEEIEDTYQM-KIRCPCGSSLQTETMIQCED  125



>ref|XP_009601717.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=883

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIK  143
            SDSS+ + K+EIED+Y+M KI+CPCGS+LQTE+MI+
Sbjct  92   SDSSNVKLKEEIEDTYQM-KIRCPCGSSLQTETMIQ  126



>ref|XP_009601705.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=887

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIK  143
            SDSS+ + K+EIED+Y+M KI+CPCGS+LQTE+MI+
Sbjct  96   SDSSNVKLKEEIEDTYQM-KIRCPCGSSLQTETMIQ  130



>emb|CAN82989.1| hypothetical protein VITISV_011715 [Vitis vinifera]
Length=1280

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SDSS+ +FK+E+EDSY   KI+CPCGS L  E+M+K  D
Sbjct  268  LSDSSNVKFKEELEDSYNDMKIRCPCGSALPNETMLKCDD  307



>ref|XP_009802731.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104248214 
[Nicotiana sylvestris]
Length=1521

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -3

Query  250   SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SD+++ + K+EIEDSY+M KI+CPCGS+LQTE+MI+  D
Sbjct  1148  SDNNNVKLKEEIEDSYQM-KIRCPCGSSLQTETMIQCED  1185



>ref|XP_010651134.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X2 [Vitis vinifera]
Length=852

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SDSS+ +FK+E+EDSY   KI+CPCGS L  E+M+K  D
Sbjct  91   LSDSSNVKFKEELEDSYNDMKIRCPCGSALPNETMLKCDD  130



>ref|XP_010651133.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X1 [Vitis vinifera]
Length=876

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SDSS+ +FK+E+EDSY   KI+CPCGS L  E+M+K  D
Sbjct  91   LSDSSNVKFKEELEDSYNDMKIRCPCGSALPNETMLKCDD  130



>emb|CBI16282.3| unnamed protein product [Vitis vinifera]
Length=878

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SDSS+ +FK+E+EDSY   KI+CPCGS L  E+M+K  D
Sbjct  91   LSDSSNVKFKEELEDSYNDMKIRCPCGSALPNETMLKCDD  130



>ref|XP_011089334.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X1 [Sesamum indicum]
 ref|XP_011089336.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X1 [Sesamum indicum]
Length=877

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDS++ + K+E ED Y+M+KI+C CGSTL T+SMIK  D
Sbjct  92   SDSTNIKCKEEAEDCYQMEKIRCVCGSTLPTDSMIKCED  130



>emb|CDP07144.1| unnamed protein product [Coffea canephora]
Length=874

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            S+ S+ + K+EIEDSY+ +KI+CPCGS+L  E+MIK  D
Sbjct  92   SECSNVKLKEEIEDSYQTEKIRCPCGSSLPNETMIKCED  130



>ref|XP_011089333.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X3 [Sesamum 
indicum]
Length=874

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SD+S+ R K+E ED ++M+KI+C CGSTL T+SMIK  D
Sbjct  92   SDNSNIRPKEETEDRHQMEKIRCLCGSTLPTDSMIKCED  130



>ref|XP_011089332.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X2 [Sesamum 
indicum]
Length=876

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SD+S+ R K+E ED ++M+KI+C CGSTL T+SMIK  D
Sbjct  90   SDNSNIRPKEETEDRHQMEKIRCLCGSTLPTDSMIKCED  128



>ref|XP_011089331.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform X1 [Sesamum 
indicum]
Length=878

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SD+S+ R K+E ED ++M+KI+C CGSTL T+SMIK  D
Sbjct  92   SDNSNIRPKEETEDRHQMEKIRCLCGSTLPTDSMIKCED  130



>ref|XP_010253567.1| PREDICTED: E3 SUMO-protein ligase SIZ1 [Nelumbo nucifera]
Length=877

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMD-KIQCPCGSTLQTESMIKVLD  134
            SD S+ + K+E++DS++MD KI+CPCGS+L TESMI+  D
Sbjct  96   SDISNVKLKEEVDDSFQMDLKIRCPCGSSLATESMIQCED  135



>gb|EYU36200.1| hypothetical protein MIMGU_mgv1a001379mg [Erythranthe guttata]
Length=830

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
             SDS++   K+EI DSY+MDKI+C CGS L T++MIK  D
Sbjct  16   LSDSTTVIPKEEIVDSYQMDKIRCLCGSGLPTDTMIKCED  55



>ref|XP_011089338.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X3 [Sesamum indicum]
Length=835

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDS++ + K+E ED Y+M+KI+C CGSTL T+SMIK  D
Sbjct  92   SDSTNIKCKEEAEDCYQMEKIRCVCGSTLPTDSMIKCED  130



>ref|XP_011089337.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X2 [Sesamum indicum]
Length=841

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDS++ + K+E ED Y+M+KI+C CGSTL T+SMIK  D
Sbjct  92   SDSTNIKCKEEAEDCYQMEKIRCVCGSTLPTDSMIKCED  130



>ref|XP_006343451.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Solanum tuberosum]
Length=853

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIK  143
            SDSS+ + K+EIED+Y+M+ I+C CGS+LQ E+MI+
Sbjct  89   SDSSNVKLKEEIEDTYQME-IRCLCGSSLQAETMIQ  123



>gb|EYU18862.1| hypothetical protein MIMGU_mgv1a020020mg, partial [Erythranthe 
guttata]
Length=874

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SD+++ +FK+E E+S++++KI+C CGSTL T+SM+K  D
Sbjct  82   SDNTNIKFKEETEESFQLEKIRCLCGSTLPTDSMVKCED  120



>ref|XP_009787730.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X3 [Nicotiana 
sylvestris]
Length=833

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  250  SDSSSARFKDEIEDSYKMDKIQCPCGSTLQTESMIKVLD  134
            SDSS+ + K+EIEDS    KI+C C S+LQTE+MI+  D
Sbjct  92   SDSSNVKLKEEIEDSSYHMKIRCVCASSLQTETMIQCED  130



>ref|XP_009338274.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X3 [Pyrus x bretschneideri]
Length=843

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 8/56 (14%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMD-KIQCPCGSTLQTESMIKVLDTCIFPPR--VRLHLG  95
             SDSS+ + K EIED Y+ D K++C CG++L+TESMIK  D     PR  V  H+G
Sbjct  91   ISDSSNVKIKGEIEDPYQSDIKVRCLCGNSLETESMIKCED-----PRCQVWQHMG  141



>ref|XP_009338271.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X1 [Pyrus x bretschneideri]
Length=879

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 8/56 (14%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMD-KIQCPCGSTLQTESMIKVLDTCIFPPR--VRLHLG  95
             SDSS+ + K EIED Y+ D K++C CG++L+TESMIK  D     PR  V  H+G
Sbjct  91   ISDSSNVKIKGEIEDPYQSDIKVRCLCGNSLETESMIKCED-----PRCQVWQHMG  141



>ref|XP_009338273.1| PREDICTED: E3 SUMO-protein ligase SIZ1 isoform X2 [Pyrus x bretschneideri]
Length=876

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 8/56 (14%)
 Frame = -3

Query  253  FSDSSSARFKDEIEDSYKMD-KIQCPCGSTLQTESMIKVLDTCIFPPR--VRLHLG  95
             SDSS+ + K EIED Y+ D K++C CG++L+TESMIK  D     PR  V  H+G
Sbjct  91   ISDSSNVKIKGEIEDPYQSDIKVRCLCGNSLETESMIKCED-----PRCQVWQHMG  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507510111836