BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25759_g2_i2 len=894 path=[8464:0-104 5231:105-126 942:127-155
3502:156-345 10637:346-389 5510:390-407 10708:408-416 5536:417-425
4260:426-443 5562:444-446 5565:447-507 10780:508-547 10804:548-549
5668:550-576 10809:577-594 10827:595-613 10856:614-635 155:636-680
10901:681-723 10957:724-725 10166:726-808 5922:809-848 5962:849-872
4568:873-873 5986:874-893]

Length=894
                                                                      Score     E

ref|XP_009768587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   4e-132   
ref|XP_009600230.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   1e-129   
ref|XP_002529304.1|  Desacetoxyvindoline 4-hydroxylase, putative        384   5e-129   Ricinus communis
ref|XP_004246496.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   5e-127   
ref|XP_006341094.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   4e-125   
ref|XP_007223277.1|  hypothetical protein PRUPE_ppa007265mg             373   1e-124   
ref|XP_008222546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   2e-124   
gb|KDP40304.1|  hypothetical protein JCGZ_02302                         371   5e-124   
ref|XP_008222545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    371   6e-124   
ref|XP_008222541.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   1e-123   
gb|AAD38147.1|AF139500_1  unknown                                       370   1e-123   Prunus armeniaca
ref|XP_011030520.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   2e-123   
ref|XP_007226473.1|  hypothetical protein PRUPE_ppa027196mg             369   3e-123   
ref|XP_008222547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   3e-123   
ref|XP_007223369.1|  hypothetical protein PRUPE_ppa007487mg             369   6e-123   
emb|CAN66433.1|  hypothetical protein VITISV_027452                     368   6e-123   Vitis vinifera
ref|XP_008338503.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    368   9e-123   
ref|XP_002315712.2|  hypothetical protein POPTR_0010s08390g             367   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009379006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    367   2e-122   
ref|XP_010650056.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    364   3e-121   
ref|XP_008224381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   5e-121   
emb|CBI23590.3|  unnamed protein product                                363   1e-120   
ref|XP_008365367.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   1e-120   
emb|CBI23594.3|  unnamed protein product                                361   1e-120   
ref|XP_010650057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    362   1e-120   
ref|XP_006420179.1|  hypothetical protein CICLE_v10005202mg             362   2e-120   
gb|KDO44340.1|  hypothetical protein CISIN_1g017376mg                   361   4e-120   
ref|XP_006489565.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   9e-120   
ref|XP_004246497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   3e-119   
ref|XP_007223295.1|  hypothetical protein PRUPE_ppa007267mg             359   3e-119   
ref|XP_006341091.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   4e-119   
ref|XP_006341092.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   5e-119   
ref|XP_002529305.1|  Desacetoxyvindoline 4-hydroxylase, putative        358   5e-119   Ricinus communis
ref|XP_002284638.2|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    368   1e-118   Vitis vinifera
ref|XP_008224382.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   1e-118   
ref|XP_004299419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   1e-118   
ref|XP_009347727.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   2e-118   
ref|XP_008224380.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    357   2e-118   
ref|XP_007035061.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    356   4e-118   
emb|CBI23588.3|  unnamed protein product                                353   4e-118   
ref|XP_008438545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    356   9e-118   
ref|XP_002284582.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   1e-117   Vitis vinifera
ref|XP_009784072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   1e-117   
ref|XP_003521041.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   1e-117   
ref|XP_010104048.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    355   2e-117   
ref|XP_004167607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   8e-117   
ref|XP_008367169.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   8e-117   
gb|KHN10894.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        353   1e-116   
ref|XP_010672757.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   1e-116   
ref|XP_004296613.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   1e-116   
ref|XP_011073514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   1e-116   
ref|XP_004134415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   2e-116   
ref|XP_006341093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   2e-116   
ref|XP_009591157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   3e-116   
ref|XP_004246493.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   3e-116   
emb|CDO99200.1|  unnamed protein product                                347   6e-116   
ref|XP_004297996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   7e-116   
ref|XP_010274816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   7e-116   
ref|XP_010680231.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   1e-115   
ref|XP_008354408.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   3e-115   
ref|XP_006283978.1|  hypothetical protein CARUB_v10005101mg             348   3e-115   
ref|XP_011040547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   4e-115   
ref|XP_011091187.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   6e-115   
ref|XP_010262283.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   2e-114   
ref|XP_006354512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   4e-114   
ref|XP_002317688.1|  hypothetical protein POPTR_0011s15970g             346   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011073515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   9e-114   
gb|KHG16548.1|  hypothetical protein F383_20832                         345   1e-113   
ref|XP_007035060.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    345   1e-113   
gb|AET01263.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    345   3e-113   
ref|XP_010026850.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    344   3e-113   
ref|XP_003626787.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    343   4e-113   
ref|XP_010556890.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    343   4e-113   
ref|XP_002315713.1|  hypothetical protein POPTR_0010s08410g             343   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010023989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    343   8e-113   
ref|XP_007149297.1|  hypothetical protein PHAVU_005G058400g             342   8e-113   
ref|XP_011091183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    343   1e-112   
ref|XP_011091184.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    342   1e-112   
ref|XP_003626788.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    342   2e-112   
ref|XP_007035057.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    342   2e-112   
ref|XP_008224379.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   2e-112   
gb|AES66420.2|  2OG-Fe(II) oxygenase family oxidoreductase              342   3e-112   
ref|XP_007035064.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    341   3e-112   
ref|XP_007035072.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    341   3e-112   
ref|XP_002284663.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   4e-112   Vitis vinifera
ref|XP_010457801.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    341   4e-112   
gb|KEH18776.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    341   4e-112   
ref|XP_010093410.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    341   4e-112   
ref|XP_004510134.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   5e-112   
ref|XP_010023981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   6e-112   
ref|XP_004247920.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   7e-112   
ref|XP_010457800.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    340   8e-112   
ref|NP_172150.1|  2-oxoglutarate-dependent dioxygenase-like protein     340   9e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CAN66006.1|  hypothetical protein VITISV_042886                     340   9e-112   Vitis vinifera
gb|AAK44137.1|AF370322_1  putative oxidoreductase                       340   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010668102.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    339   1e-111   
ref|XP_010026859.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    339   2e-111   
ref|XP_006304979.1|  hypothetical protein CARUB_v10011473mg             338   2e-111   
ref|XP_002889612.1|  hypothetical protein ARALYDRAFT_470684             339   3e-111   
ref|XP_006420182.1|  hypothetical protein CICLE_v10006571mg             338   3e-111   
ref|XP_004296614.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   3e-111   
gb|KDO44344.1|  hypothetical protein CISIN_1g017697mg                   338   4e-111   
emb|CBI23601.3|  unnamed protein product                                339   5e-111   
gb|KDP40305.1|  hypothetical protein JCGZ_02303                         338   5e-111   
ref|XP_010435699.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   5e-111   
ref|XP_006354515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    338   6e-111   
ref|XP_006598206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   1e-110   
ref|XP_007035066.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    337   1e-110   
gb|AFK38092.1|  unknown                                                 337   1e-110   
emb|CAN67227.1|  hypothetical protein VITISV_000872                     337   2e-110   Vitis vinifera
ref|XP_010650061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    337   2e-110   
ref|NP_172147.2|  2-oxoglutarate-dependent dioxygenase-like protein     337   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626790.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    336   2e-110   
gb|EYU32538.1|  hypothetical protein MIMGU_mgv1a008409mg                337   2e-110   
gb|ABK96309.1|  unknown                                                 336   2e-110   Populus trichocarpa x Populus deltoides
ref|XP_010475402.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   3e-110   
ref|XP_010440899.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   3e-110   
ref|XP_010326756.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   3e-110   
ref|XP_010262281.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    336   4e-110   
emb|CAN80594.1|  hypothetical protein VITISV_017626                     335   6e-110   Vitis vinifera
ref|XP_010475400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    335   7e-110   
ref|XP_006294352.1|  hypothetical protein CARUB_v10023369mg             336   9e-110   
ref|XP_002881136.1|  hypothetical protein ARALYDRAFT_482001             334   1e-109   
ref|XP_003626795.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    334   1e-109   
ref|XP_010650062.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    334   1e-109   
ref|XP_002315711.2|  hypothetical protein POPTR_0010s08380g             334   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_003635549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    334   2e-109   
gb|AFK35571.1|  unknown                                                 333   2e-109   
ref|XP_002889610.1|  predicted protein                                  333   3e-109   
ref|XP_006489571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   3e-109   
ref|XP_010486415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   4e-109   
ref|XP_006417896.1|  hypothetical protein EUTSA_v10009596mg             336   4e-109   
ref|XP_009119310.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   6e-109   
ref|XP_007149298.1|  hypothetical protein PHAVU_005G058500g             332   1e-108   
ref|XP_011091222.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   1e-108   
ref|XP_003596174.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    332   1e-108   
ref|XP_003596176.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    332   1e-108   
ref|XP_007221652.1|  hypothetical protein PRUPE_ppb006192mg             332   2e-108   
gb|KFK42981.1|  hypothetical protein AALP_AA1G064100                    332   2e-108   
emb|CBI33261.3|  unnamed protein product                                327   2e-108   
gb|AFK46776.1|  unknown                                                 331   2e-108   
ref|XP_011030519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   2e-108   
ref|XP_009119308.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   2e-108   
emb|CDX71101.1|  BnaC03g11850D                                          331   2e-108   
ref|XP_010450550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   2e-108   
ref|XP_007227098.1|  hypothetical protein PRUPE_ppa025648mg             330   2e-108   
ref|XP_010262287.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   3e-108   
emb|CBI23604.3|  unnamed protein product                                327   3e-108   
gb|KCW60394.1|  hypothetical protein EUGRSUZ_H03111                     328   3e-108   
ref|XP_008224374.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    332   4e-108   
ref|XP_004247708.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   4e-108   
ref|XP_006354516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    331   4e-108   
emb|CDO99213.1|  unnamed protein product                                330   5e-108   
gb|KFK31253.1|  hypothetical protein AALP_AA6G088500                    330   5e-108   
ref|XP_010557155.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   5e-108   
ref|XP_009119045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   7e-108   
ref|XP_003596185.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    329   1e-107   
ref|XP_010023986.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    330   1e-107   
gb|AFK38415.1|  unknown                                                 329   1e-107   
ref|XP_002529301.1|  Desacetoxyvindoline 4-hydroxylase, putative        329   2e-107   Ricinus communis
ref|XP_006350684.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   2e-107   
emb|CBI23596.3|  unnamed protein product                                328   2e-107   
ref|XP_006354513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   2e-107   
gb|AFK38250.1|  unknown                                                 328   2e-107   
ref|XP_010904577.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   4e-107   
ref|XP_010023982.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   4e-107   
ref|XP_010672098.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   4e-107   
ref|XP_002889611.1|  predicted protein                                  328   4e-107   
ref|NP_180642.1|  2-oxoglutarate dependent oxygenase-like protein       328   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779114.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    328   5e-107   
dbj|BAB68392.1|  CmE8                                                   328   6e-107   Cucumis melo [Oriental melon]
ref|XP_009119312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   7e-107   
emb|CDY18226.1|  BnaC05g02490D                                          327   8e-107   
ref|XP_008438542.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    328   1e-106   
gb|EYU42211.1|  hypothetical protein MIMGU_mgv1a008992mg                327   1e-106   
ref|XP_010414213.1|  PREDICTED: probable 2-oxoacid dependent diox...    327   1e-106   
ref|XP_007152331.1|  hypothetical protein PHAVU_004G120900g             327   1e-106   
ref|XP_008391709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   1e-106   
ref|XP_010457799.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   1e-106   
ref|XP_002529300.1|  Desacetoxyvindoline 4-hydroxylase, putative        327   1e-106   Ricinus communis
gb|AFK45613.1|  unknown                                                 326   2e-106   
ref|XP_004511093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    327   2e-106   
gb|KDP40307.1|  hypothetical protein JCGZ_02305                         327   2e-106   
emb|CDY09965.1|  BnaC08g44860D                                          326   2e-106   
ref|XP_009626886.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    326   3e-106   
ref|XP_010469792.1|  PREDICTED: probable 2-oxoacid dependent diox...    325   3e-106   
emb|CDY06221.1|  BnaA09g49820D                                          326   3e-106   
ref|XP_009118527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   3e-106   
ref|XP_009761530.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    326   3e-106   
ref|XP_010435700.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   3e-106   
ref|XP_003626775.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    325   4e-106   
ref|XP_010475401.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    326   4e-106   
ref|XP_011029844.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   4e-106   
ref|XP_006305137.1|  hypothetical protein CARUB_v10009503mg             325   5e-106   
ref|XP_006379886.1|  hypothetical protein POPTR_0008s16530g             325   5e-106   
ref|XP_004488811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   7e-106   
emb|CDX88705.1|  BnaA03g09440D                                          325   7e-106   
ref|XP_010510283.1|  PREDICTED: probable 2-oxoacid dependent diox...    324   8e-106   
ref|XP_009131992.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    325   8e-106   
ref|XP_010557154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   8e-106   
ref|XP_011029845.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    325   9e-106   
ref|XP_009118490.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   9e-106   
ref|XP_009118492.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-105   
gb|KCW60401.1|  hypothetical protein EUGRSUZ_H03119                     324   1e-105   
ref|XP_003548216.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   1e-105   
ref|XP_007223357.1|  hypothetical protein PRUPE_ppa007457mg             324   1e-105   
ref|XP_008372316.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    324   2e-105   
emb|CDX71103.1|  BnaC03g11870D                                          323   2e-105   
gb|KFK42982.1|  hypothetical protein AALP_AA1G064200                    323   2e-105   
ref|XP_009119044.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   2e-105   
ref|XP_003632020.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    333   3e-105   
ref|NP_172149.1|  2-oxoglutarate-dependent dioxygenase-like protein     323   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892212.1|  hypothetical protein ARALYDRAFT_470414             322   3e-105   
emb|CDX71105.1|  BnaC03g11890D                                          323   3e-105   
ref|XP_009379005.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   3e-105   
ref|XP_010023987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   4e-105   
ref|XP_010650059.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   4e-105   
emb|CDO99201.1|  unnamed protein product                                318   4e-105   
ref|NP_001154315.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    323   5e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23597.3|  unnamed protein product                                323   5e-105   
ref|NP_180641.1|  2-oxoglutarate dependent oxygenase-like protein       322   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483594.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   7e-105   
emb|CBI23598.3|  unnamed protein product                                318   7e-105   
ref|XP_009599435.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   7e-105   
ref|XP_004134074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   1e-104   
ref|XP_004247709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    322   1e-104   
ref|XP_009141108.1|  PREDICTED: probable 2-oxoacid dependent diox...    322   1e-104   
ref|XP_010026853.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    329   1e-104   
ref|XP_010475404.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    321   2e-104   
emb|CDX97789.1|  BnaC04g41500D                                          321   2e-104   
gb|EYU32968.1|  hypothetical protein MIMGU_mgv1a008832mg                321   3e-104   
ref|XP_009347725.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-104   
ref|XP_008380113.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   3e-104   
gb|KFK27480.1|  hypothetical protein AALP_AA8G389000                    320   4e-104   
ref|XP_009619591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   4e-104   
ref|XP_007152332.1|  hypothetical protein PHAVU_004G121000g             320   6e-104   
ref|XP_010457797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   6e-104   
ref|XP_010093411.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    319   6e-104   
ref|XP_003626796.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    319   9e-104   
ref|XP_003529012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   1e-103   
ref|XP_003628028.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    320   1e-103   
ref|XP_010274803.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    320   1e-103   
ref|XP_010486403.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   2e-103   
ref|XP_006493816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    319   2e-103   
ref|XP_007035062.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    319   2e-103   
emb|CDY10161.1|  BnaC05g04040D                                          318   2e-103   
gb|KFK42979.1|  hypothetical protein AALP_AA1G063900                    318   2e-103   
gb|KFK31257.1|  hypothetical protein AALP_AA6G088800                    318   3e-103   
ref|XP_009802072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   3e-103   
ref|NP_171933.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    317   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023980.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   3e-103   
ref|XP_004167606.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    318   3e-103   
ref|XP_004134077.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   4e-103   
emb|CDO99204.1|  unnamed protein product                                325   4e-103   
gb|KFK42977.1|  hypothetical protein AALP_AA1G063700                    318   4e-103   
ref|XP_006420907.1|  hypothetical protein CICLE_v10005201mg             318   4e-103   
emb|CDX88706.1|  BnaA03g09430D                                          318   4e-103   
ref|NP_001241514.1|  uncharacterized protein LOC100792296               318   5e-103   
ref|XP_006588550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   7e-103   
gb|KHN28456.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       317   7e-103   
ref|NP_001241230.1|  uncharacterized protein LOC100790198               317   8e-103   
ref|XP_004134416.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   9e-103   
ref|XP_010457796.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   9e-103   
ref|XP_009131991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   1e-102   
ref|XP_010483593.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   1e-102   
ref|XP_004171996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    317   2e-102   
ref|XP_010483596.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   2e-102   
ref|XP_010457795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    316   2e-102   
ref|XP_002529299.1|  Desacetoxyvindoline 4-hydroxylase, putative        325   3e-102   Ricinus communis
emb|CDY60661.1|  BnaA10g27740D                                          315   3e-102   
ref|XP_009141104.1|  PREDICTED: probable 2-oxoacid dependent diox...    315   4e-102   
ref|NP_200762.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    315   4e-102   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00443.1|  putative 1-aminocyclopropane-1-carboxylate oxidase     314   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   6e-102   
ref|XP_010904576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   7e-102   
ref|XP_006378347.1|  hypothetical protein POPTR_0010s08400g             315   7e-102   
ref|XP_008438548.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    315   8e-102   
ref|XP_009765554.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   1e-101   
ref|XP_010486383.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   1e-101   
ref|XP_009119046.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    314   1e-101   
ref|NP_001234624.1|  2-oxoglutarate-dependent dioxygenase               314   1e-101   
ref|XP_008224375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    323   2e-101   
ref|XP_006418135.1|  hypothetical protein EUTSA_v10009937mg             313   2e-101   
emb|CDX88708.1|  BnaA03g09410D                                          314   2e-101   
emb|CDY60666.1|  BnaA10g27780D                                          313   2e-101   
ref|XP_008438546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   2e-101   
ref|XP_009131989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   2e-101   
ref|XP_008438543.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    313   3e-101   
ref|NP_200761.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    313   4e-101   
ref|XP_002866335.1|  predicted protein                                  313   4e-101   
ref|XP_003628030.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    313   6e-101   
gb|KDO44343.1|  hypothetical protein CISIN_1g017182mg                   313   6e-101   
gb|KDP40308.1|  hypothetical protein JCGZ_02306                         312   6e-101   
ref|XP_006489566.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   7e-101   
ref|XP_007226673.1|  hypothetical protein PRUPE_ppa021125mg             311   8e-101   
ref|XP_002866336.1|  oxidoreductase                                     311   9e-101   
ref|XP_009379007.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   2e-100   
ref|XP_010443713.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   2e-100   
emb|CDY18221.1|  BnaC05g02440D                                          310   2e-100   
ref|XP_008438549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    312   2e-100   
ref|XP_006279819.1|  hypothetical protein CARUB_v10028097mg             311   2e-100   
ref|XP_007134370.1|  hypothetical protein PHAVU_010G042000g             311   2e-100   
gb|KFK42978.1|  hypothetical protein AALP_AA1G063800                    311   2e-100   
ref|XP_011091186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    311   3e-100   
gb|KFK42773.1|  hypothetical protein AALP_AA1G037700                    310   3e-100   
ref|XP_010457480.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   4e-100   
ref|XP_010025844.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    310   4e-100   
ref|XP_007149296.1|  hypothetical protein PHAVU_005G058300g             310   4e-100   
ref|XP_006306485.1|  hypothetical protein CARUB_v10012463mg             309   5e-100   
ref|XP_006351987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    310   5e-100   
ref|XP_009619590.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    310   6e-100   
ref|XP_010457793.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   1e-99    
ref|XP_006367031.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   1e-99    
ref|XP_010413414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   1e-99    
ref|XP_002889500.1|  hypothetical protein ARALYDRAFT_470412             308   1e-99    
emb|CDY06654.1|  BnaA10g04330D                                          318   1e-99    
ref|XP_004247710.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   2e-99    
ref|XP_010262288.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    309   2e-99    
emb|CDY60668.1|  BnaA10g27790D                                          308   2e-99    
emb|CDX86638.1|  BnaC08g00650D                                          308   2e-99    
ref|XP_006367030.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   2e-99    
ref|XP_004134076.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   3e-99    
ref|XP_006292553.1|  hypothetical protein CARUB_v10018789mg             308   3e-99    
ref|XP_010102247.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    308   3e-99    
ref|XP_006354514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    308   4e-99    
ref|XP_004236794.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    307   5e-99    
ref|XP_007030469.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    306   1e-98    
ref|XP_010455136.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    306   1e-98    
ref|XP_010457792.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    306   2e-98    
gb|KCW60386.1|  hypothetical protein EUGRSUZ_H03102                     303   2e-98    
gb|KFK42775.1|  hypothetical protein AALP_AA1G037900                    305   2e-98    
ref|XP_009796112.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   2e-98    
ref|XP_008367206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   3e-98    
emb|CDY29637.1|  BnaA04g17900D                                          303   5e-98    
ref|XP_009116811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    305   6e-98    
ref|XP_006282023.1|  hypothetical protein CARUB_v10028262mg             304   6e-98    
ref|XP_006354526.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    301   7e-98    
ref|XP_006352055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    304   7e-98    
ref|XP_006420181.1|  hypothetical protein CICLE_v10005008mg             306   7e-98    
ref|NP_171930.1|  1-aminocyclopropane-1-carboxylate oxidase-like 6      303   1e-97    
ref|XP_009111110.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    303   1e-97    
ref|XP_006294467.1|  hypothetical protein CARUB_v10023479mg             303   2e-97    
ref|XP_010494329.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    303   2e-97    
ref|XP_010026848.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    300   2e-97    
ref|XP_004236795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    303   3e-97    
gb|KFK42774.1|  hypothetical protein AALP_AA1G037800                    302   5e-97    
ref|XP_006400948.1|  hypothetical protein EUTSA_v10012808mg             312   5e-97    
ref|XP_004513523.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    302   6e-97    
ref|XP_002863651.1|  hypothetical protein ARALYDRAFT_917302             302   7e-97    
ref|XP_003590085.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    301   1e-96    
ref|XP_004171997.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    300   1e-96    
gb|EMT14845.1|  1-aminocyclopropane-1-carboxylate oxidase-1-like ...    297   2e-96    
ref|XP_004247706.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    301   2e-96    
gb|AAF24827.1|AC007592_20  F12K11.6                                     323   2e-96    
gb|AES60336.2|  2OG-Fe(II) oxygenase family oxidoreductase              300   2e-96    
ref|XP_004134073.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    301   4e-96    
ref|XP_004491714.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    300   5e-96    
ref|XP_007225869.1|  hypothetical protein PRUPE_ppa010219mg             296   5e-96    
ref|XP_010556889.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    299   7e-96    
emb|CDY10212.1|  BnaC05g04550D                                          309   7e-96    
ref|XP_010442019.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    299   8e-96    
ref|XP_010481858.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    299   9e-96    
gb|KFK42776.1|  hypothetical protein AALP_AA1G038000                    298   1e-95    
ref|XP_006296340.1|  hypothetical protein CARUB_v10025512mg             298   1e-95    
ref|XP_003532286.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   1e-95    
ref|XP_009802074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   2e-95    
ref|XP_008224378.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   2e-95    
gb|KCW60387.1|  hypothetical protein EUGRSUZ_H03103                     297   2e-95    
ref|XP_004134075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    298   3e-95    
emb|CAA58151.1|  2A6                                                    297   4e-95    
gb|AFK38498.1|  unknown                                                 297   4e-95    
ref|XP_003591799.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    297   5e-95    
ref|NP_199157.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    297   5e-95    
gb|AES60333.2|  aminocyclopropanecarboxylate oxidase                    296   6e-95    
ref|XP_010023978.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    297   6e-95    
emb|CBI23591.3|  unnamed protein product                                291   6e-95    
ref|NP_171840.2|  1-aminocyclopropane-1-carboxylate oxidase-like 5      297   9e-95    
gb|AFW57847.1|  hypothetical protein ZEAMMB73_319469                    296   1e-94    
ref|XP_006418138.1|  hypothetical protein EUTSA_v10008015mg             296   1e-94    
ref|NP_001140812.1|  uncharacterized protein LOC100272887               296   1e-94    
ref|XP_006356486.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    296   1e-94    
gb|AET01270.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    295   2e-94    
emb|CBI23595.3|  unnamed protein product                                290   2e-94    
ref|XP_010455168.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   2e-94    
ref|XP_010482010.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   2e-94    
ref|XP_004499952.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   2e-94    
ref|XP_009118653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   2e-94    
ref|XP_010469070.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   2e-94    
ref|NP_180115.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    295   3e-94    
ref|XP_004309371.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    296   3e-94    
emb|CDY32542.1|  BnaA09g50540D                                          295   3e-94    
gb|KHN12250.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       295   3e-94    
ref|XP_002446161.1|  hypothetical protein SORBIDRAFT_06g002900          295   3e-94    
ref|XP_003579920.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   3e-94    
gb|KEH17198.1|  2OG-Fe(II) oxygenase family oxidoreductase              295   3e-94    
gb|KFK42980.1|  hypothetical protein AALP_AA1G064000                    295   3e-94    
ref|XP_011091188.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   3e-94    
ref|XP_010026849.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    297   4e-94    
ref|XP_002276339.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    294   4e-94    
ref|XP_010512484.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    295   5e-94    
ref|XP_004309351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    296   6e-94    
ref|XP_002446164.1|  hypothetical protein SORBIDRAFT_06g002930          294   7e-94    
emb|CDY09963.1|  BnaC08g44880D                                          294   8e-94    
ref|XP_009141107.1|  PREDICTED: probable 2-oxoacid dependent diox...    293   9e-94    
gb|EMT16499.1|  1-aminocyclopropane-1-carboxylate oxidase-1-like ...    293   1e-93    
ref|XP_009141106.1|  PREDICTED: probable 2-oxoacid dependent diox...    293   1e-93    
ref|XP_009119544.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    293   1e-93    
gb|KEH32248.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    293   1e-93    
gb|KEH41138.1|  2OG-Fe(II) oxygenase family oxidoreductase              293   2e-93    
ref|XP_010326755.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    293   2e-93    
gb|KEH22659.1|  2OG-Fe(II) oxygenase family oxidoreductase              293   2e-93    
ref|XP_004975140.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    293   2e-93    
ref|XP_009119545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    292   2e-93    
gb|KHN10999.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       291   3e-93    
ref|XP_007035068.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    292   4e-93    
ref|XP_008224473.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    292   6e-93    
gb|AAC49827.1|  desacetoxyvindoline 4-hydroxylase                       292   7e-93    
gb|AAC49826.1|  desacetoxyvindoline 4-hydroxylase                       292   8e-93    
ref|XP_010668459.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   1e-92    
ref|XP_007223367.1|  hypothetical protein PRUPE_ppa007477mg             291   1e-92    
ref|XP_009379001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    291   1e-92    
gb|KEH22083.1|  2OG-Fe(II) oxygenase family oxidoreductase              291   2e-92    
sp|O04847.2|DV4H_CATRO  RecName: Full=Deacetoxyvindoline 4-hydrox...    291   2e-92    
ref|XP_010455146.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   2e-92    
ref|NP_191699.1|  1-aminocyclopropane-1-carboxylate oxidase-like 8      290   2e-92    
ref|XP_006586236.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   2e-92    
gb|ACU19421.1|  unknown                                                 290   2e-92    
ref|XP_004299418.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   2e-92    
gb|ACR10277.1|  2-oxoacid-dependent dioxygenase                         290   2e-92    
emb|CDY47116.1|  BnaC04g13730D                                          293   2e-92    
ref|XP_006489612.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    291   3e-92    
ref|XP_009132898.1|  PREDICTED: probable 2-oxoacid dependent diox...    290   3e-92    
ref|XP_002276308.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   3e-92    
gb|AES60332.2|  1-aminocyclopropane-1-carboxylate oxidase               290   3e-92    
ref|XP_008438547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   3e-92    
ref|XP_007140617.1|  hypothetical protein PHAVU_008G127200g             290   5e-92    
gb|KHN27714.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        288   5e-92    
ref|XP_008391183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    289   6e-92    
ref|XP_003590082.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    290   7e-92    
ref|XP_003596167.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    288   7e-92    
ref|XP_006598207.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    289   8e-92    
gb|AES62052.2|  2OG-Fe(II) oxygenase family oxidoreductase              289   8e-92    
ref|XP_009141105.1|  PREDICTED: probable 2-oxoacid dependent diox...    288   8e-92    
ref|XP_006400950.1|  hypothetical protein EUTSA_v10013883mg             289   9e-92    
ref|XP_006598208.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    288   1e-91    
gb|KHN11000.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       287   1e-91    
ref|XP_003534014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    289   1e-91    
ref|XP_008391186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    288   1e-91    
gb|KHN22506.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        289   1e-91    
ref|XP_010457349.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    288   1e-91    
ref|XP_007099680.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    288   2e-91    
ref|XP_006586237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    288   2e-91    
ref|XP_007149300.1|  hypothetical protein PHAVU_005G058700g             287   3e-91    
gb|AET01267.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    287   3e-91    
ref|XP_006587350.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    287   3e-91    
ref|XP_006401979.1|  hypothetical protein EUTSA_v10013645mg             289   4e-91    
gb|KFK35329.1|  hypothetical protein AALP_AA5G270700                    294   4e-91    
ref|XP_006442709.1|  hypothetical protein CICLE_v10020558mg             287   4e-91    
ref|XP_006442712.1|  hypothetical protein CICLE_v10020558mg             287   5e-91    
ref|XP_006442711.1|  hypothetical protein CICLE_v10020558mg             286   5e-91    
ref|XP_007140619.1|  hypothetical protein PHAVU_008G127400g             286   7e-91    
ref|XP_010650060.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   7e-91    
ref|XP_010443715.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    286   7e-91    
ref|XP_008391200.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    284   8e-91    
ref|XP_006487729.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    286   9e-91    
ref|XP_006487731.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    286   1e-90    
ref|XP_006299172.1|  hypothetical protein CARUB_v10015316mg             286   1e-90    
ref|XP_002529306.1|  Desacetoxyvindoline 4-hydroxylase, putative        286   1e-90    
ref|XP_006279791.1|  hypothetical protein CARUB_v10027925mg             285   1e-90    
ref|XP_004495381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   2e-90    
ref|XP_007149301.1|  hypothetical protein PHAVU_005G058800g             285   2e-90    
ref|XP_008351317.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    281   2e-90    
ref|XP_003633274.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   3e-90    
gb|KHN27717.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        284   3e-90    
gb|KHN26834.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        283   3e-90    
ref|XP_010671066.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   3e-90    
emb|CBI23600.3|  unnamed protein product                                280   4e-90    
emb|CBI21960.3|  unnamed protein product                                293   4e-90    
emb|CDM86215.1|  unnamed protein product                                284   5e-90    
gb|ABV25958.1|  D4H-like protein                                        285   5e-90    
emb|CBI21961.3|  unnamed protein product                                281   5e-90    
ref|XP_003534012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   5e-90    
gb|KHN22504.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        284   6e-90    
ref|XP_007140620.1|  hypothetical protein PHAVU_008G127500g             284   6e-90    
ref|XP_006487728.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    284   7e-90    
ref|XP_006403237.1|  hypothetical protein EUTSA_v10003233mg             284   7e-90    
ref|XP_003590081.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    290   8e-90    
ref|XP_009347731.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    283   9e-90    
ref|XP_004247712.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    283   9e-90    
ref|XP_006587351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    283   1e-89    
ref|NP_001052180.1|  Os04g0182200                                       283   1e-89    
ref|XP_006403236.1|  hypothetical protein EUTSA_v10003233mg             283   1e-89    
emb|CAH66105.1|  OSIGBa0101K10.4                                        283   1e-89    
gb|AAF86540.1|AC002560_33  F21B7.3                                      294   1e-89    
ref|XP_007152330.1|  hypothetical protein PHAVU_004G120800g             283   2e-89    
gb|EPS65191.1|  hypothetical protein M569_09587                         281   2e-89    
ref|XP_006442708.1|  hypothetical protein CICLE_v10020561mg             283   2e-89    
ref|XP_007035075.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    283   2e-89    
ref|NP_199158.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    282   2e-89    
emb|CDY10213.1|  BnaC05g04560D                                          284   3e-89    



>ref|XP_009768587.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=362

 Score =   392 bits (1006),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/263 (72%), Positives = 229/263 (87%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+ RG+RGFHEQDTE+KK+WYTR  T+ V YNSNFDLY+AP+ NWRDT FC+MAPN
Sbjct  101  DVLEEMIRGVRGFHEQDTEIKKQWYTREFTKKVVYNSNFDLYSAPATNWRDTFFCIMAPN  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LPP+C DI+IKYS+EV+KLG  LFELL+EALGL+ N+L +++C+KGLS++ HYY
Sbjct  161  PPSPEELPPICRDIIIKYSQEVKKLGSSLFELLAEALGLNRNHLTDMDCDKGLSVVCHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLG SKHAD+ F T+LLQ D+IGGLQVLHQN W DV   PGALVVNI DLLQ
Sbjct  221  PACPEPELTLGASKHADDGFITLLLQ-DNIGGLQVLHQNHWVDVPPTPGALVVNIADLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS EHRVLAN  GPR+S+ACFF+T+ + SSR+YGPIKELLSE+NPPKYRETT+
Sbjct  280  LISNDKFKSVEHRVLANHIGPRISIACFFSTFFLASSRLYGPIKELLSEDNPPKYRETTI  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F AKGLDGTSAL HFRL
Sbjct  340  QEYAAYFTAKGLDGTSALHHFRL  362



>ref|XP_009600230.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=371

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/264 (72%), Positives = 227/264 (86%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             +VLEE+ RG+R FHEQDTE+KK+WYTR LT+ V YNSNFDLY+AP+ NWRDT FC+MAP
Sbjct  109  SDVLEEMIRGVRSFHEQDTEIKKQWYTRQLTKRVVYNSNFDLYSAPATNWRDTFFCIMAP  168

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P QLPP+C DI+IKYS+EV+KLG  LFELL+EALGL+ N+L+ ++C+KGLS++ HY
Sbjct  169  NPPSPEQLPPICRDIIIKYSEEVKKLGSYLFELLAEALGLNRNHLSEMDCDKGLSVVCHY  228

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP LTLG SKHAD+ F T+LLQ D+IGGLQVLHQN W DV    GALVVNI DLL
Sbjct  229  YPACPEPQLTLGASKHADDGFITLLLQ-DNIGGLQVLHQNHWVDVPLTLGALVVNIADLL  287

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND+FKS EHRVLAN  GPR+S+ACFF+T+++ SSR+YGPIKELLSE+NPPKYRETT
Sbjct  288  QLISNDKFKSVEHRVLANHIGPRISIACFFSTFSLESSRLYGPIKELLSEDNPPKYRETT  347

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  +F  KGLDGTSAL HFRL
Sbjct  348  IQEYAAYFTEKGLDGTSALHHFRL  371



>ref|XP_002529304.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33073.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   384 bits (985),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 225/264 (85%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             +VLEE++ G+  F EQDTE+KK +Y+R LT+ V YNSNFDLY+AP+ANWRDT+   M P
Sbjct  101  ASVLEEMKDGLLKFFEQDTELKKGFYSRDLTKKVGYNSNFDLYSAPAANWRDTIAFQMVP  160

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP P ++P     IL++YSKEV+KLG VLF+LLSEALGL PN+L +++C+KGL ILGHY
Sbjct  161  DPPKPEEMPAAFRHILVEYSKEVRKLGSVLFDLLSEALGLKPNHLKDMDCDKGLFILGHY  220

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LTLGTSKHADNDF T+LLQDD IGGLQVLHQNQW DV   PGALVVNIGDLL
Sbjct  221  YPACPEPELTLGTSKHADNDFLTVLLQDD-IGGLQVLHQNQWTDVPPTPGALVVNIGDLL  279

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND+F S+EHRVLAN  GPRVSVACFF+T   P SR+YGPIKELLSEENPPKYRETT
Sbjct  280  QLISNDKFISAEHRVLANYKGPRVSVACFFSTALFPVSRLYGPIKELLSEENPPKYRETT  339

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KE+  HF+AKGLDGTSALLHF+L
Sbjct  340  VKEFVSHFNAKGLDGTSALLHFKL  363



>ref|XP_004246496.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/263 (70%), Positives = 225/263 (86%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+EE+ RG+  FHEQDT++KK+WYTR LT+ V YNSNFDLY AP+ NWRDT FC+MAPN
Sbjct  109  DVMEEMIRGVCSFHEQDTDIKKQWYTRELTKRVVYNSNFDLYNAPATNWRDTFFCIMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LPP+C DI++KYS+EV+KLG  LFELL+EALGL+ NYLN ++C +GLS++ HYY
Sbjct  169  PPSPEELPPICRDIIVKYSEEVKKLGRSLFELLAEALGLNRNYLNEMDCGEGLSVVCHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLG SKHAD+ F T+LLQ D IGGLQVLH+N W DV   PGALVVNI DLLQ
Sbjct  229  PACPEPELTLGASKHADDGFLTLLLQ-DHIGGLQVLHRNHWVDVPPTPGALVVNIADLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS EHRVLAN+ GPR+S+ACFF+T+ + +SR+YGPIKELLSEENP KYRETT+
Sbjct  288  LISNDKFKSVEHRVLANRVGPRISIACFFSTFFLEASRLYGPIKELLSEENPSKYRETTI  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F AKGLDGTSAL HFRL
Sbjct  348  QEYAAYFTAKGLDGTSALQHFRL  370



>ref|XP_006341094.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=370

 Score =   374 bits (960),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 222/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+ E+ RG+  FHEQD ++KK+WYTR  T+ V YNSNFDLY+AP+ NWRDT  C+MAPN
Sbjct  109  DVMAEMIRGVCSFHEQDNDIKKQWYTREFTKRVVYNSNFDLYSAPATNWRDTFSCIMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P + PP+C DI++KYS+EV+KLG  LFELL+EALGL+ NYLN+++C+KGLS+  HYY
Sbjct  169  PPSPEEWPPICRDIIVKYSEEVKKLGRSLFELLAEALGLNRNYLNDMDCDKGLSVACHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLG SKHAD+ F T+LLQ D IGGLQVLH+N W DV   PGALVVNI DLLQ
Sbjct  229  PACPEPELTLGASKHADDGFLTLLLQ-DHIGGLQVLHRNHWVDVPPTPGALVVNIADLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS EHRVLAN+ GPR+S+ACFF+T+ + SSR+YGPIKELLSEENP KYRETT+
Sbjct  288  LISNDKFKSVEHRVLANRVGPRISIACFFSTFFLASSRLYGPIKELLSEENPSKYRETTI  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F AKGLDGTSAL HFRL
Sbjct  348  QEYAAYFTAKGLDGTSALQHFRL  370



>ref|XP_007223277.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
 gb|EMJ24476.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
Length=375

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 217/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKKE YTR   R V YNSNFDLY+AP+ NWRDT  C MAPN
Sbjct  114  DVLEEIKNGVRGFFEQDTEVKKEHYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPN  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YSK V KLG +LFELLSEALGL P++LN+++C+ GL ILGHYY
Sbjct  174  PPKPEDLPQVCRDILVEYSKHVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLGTSKHADNDF T+LLQ D IGGLQVLHQN W DV   PGALVVNIGDLLQ
Sbjct  234  PPCPQPELTLGTSKHADNDFITVLLQ-DHIGGLQVLHQNNWIDVLPVPGALVVNIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S +HRVLAN+  PRVSVA FF+T  +   R+YGPIKELLSE+N PKYRETTL
Sbjct  293  LISNDRFRSVQHRVLANRSDPRVSVASFFSTGFLALPRIYGPIKELLSEDNLPKYRETTL  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  HFH KGLDGTSAL HF+L
Sbjct  353  KDFNAHFHNKGLDGTSALTHFKL  375



>ref|XP_008222546.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Prunus mume]
Length=370

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 221/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGFHEQDT+VKK++YTR   + V YNSNFDL+ AP++NWRDT  C MAPN
Sbjct  109  DVLEEIKDGVRGFHEQDTQVKKQFYTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  +P V  DILI+YSK+V KLG +LFELLSEALGL P+++N+I+C+ GL ++GHYY
Sbjct  169  PTKPEDMPEVFRDILIEYSKQVMKLGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LTLGTSKHAD+DF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  229  PSCPQPELTLGTSKHADSDFITVLLQ-DHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN+RFKS +HRVLAN  GPRVSVA FF+T  +P  R+YGPIKELLSE+NPPKYRETT+
Sbjct  288  LISNERFKSVQHRVLANHVGPRVSVASFFSTGMLPLGRLYGPIKELLSEDNPPKYRETTI  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  HF+ KGLDGTSAL HF L
Sbjct  348  REYNAHFNDKGLDGTSALTHFEL  370



>gb|KDP40304.1| hypothetical protein JCGZ_02302 [Jatropha curcas]
Length=366

 Score =   371 bits (953),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/262 (71%), Positives = 219/262 (84%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE++ G+R FHEQDTE+KKE Y R L + V YNSNFDLY+APSANWRDT    MAP P
Sbjct  106  VLEEMKDGVRRFHEQDTELKKELYCRDLAKKVVYNSNFDLYSAPSANWRDTFAIQMAPEP  165

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P+P +LP    DI+++YS EVQKLG +LFELLSEAL L P+YL ++EC +GL +LGHYYP
Sbjct  166  PNPEELPVAFRDIVMEYSMEVQKLGILLFELLSEALCLKPSYLEDMECAQGLFVLGHYYP  225

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LT+GT+KHADNDF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQL
Sbjct  226  ACPQPELTMGTTKHADNDFLTVLLQ-DHIGGLQVLHQNKWIDVPPTPGALVVNIGDLLQL  284

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDRF S EHRVLAN+ GPRVSVACFF+T  +   R+YGPIKELLSEENPPKYRETT+K
Sbjct  285  ISNDRFISVEHRVLANRIGPRVSVACFFSTALMSKPRLYGPIKELLSEENPPKYRETTVK  344

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  +F+AKGLDGTSAL HF+L
Sbjct  345  EFVAYFNAKGLDGTSALQHFKL  366



>ref|XP_008222545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Prunus mume]
Length=370

 Score =   371 bits (952),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 219/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGFHEQDT+VKK++YTR   + V YNSNFDL+ AP++NWRDT  C MAPN
Sbjct  109  DVLEEIKDGVRGFHEQDTQVKKQFYTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  +P V  DILI+YSK+V KLG +LFELLSEALGL P+++N+I+C+ GL ++GHYY
Sbjct  169  PTKPEDMPEVFRDILIEYSKQVMKLGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LTLGTSKHAD+DF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  229  PSCPQPELTLGTSKHADSDFITVLLQ-DHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN+RFKS +HRVLAN  GPRVSVA FF T   P  R+YGPIKELLSE+NPPKYRETT+
Sbjct  288  LISNERFKSVQHRVLANHVGPRVSVASFFTTGMQPLGRLYGPIKELLSEDNPPKYRETTI  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  HF+ KGLDGTSAL HF L
Sbjct  348  REYNAHFNDKGLDGTSALTHFEL  370



>ref|XP_008222541.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
 ref|XP_008222544.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=411

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/263 (71%), Positives = 219/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKK++YTR   R V YNSNFDLY+AP+ NWRDT  C MAPN
Sbjct  150  DVLEEIKNGVRGFFEQDTEVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPN  209

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YSK+V KLG +LFELLSEALGL P++LN+++C+ GL ILGHYY
Sbjct  210  PPKPEDLPQVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLRILGHYY  269

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLG+SKHADNDF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  270  PPCPQPELTLGSSKHADNDFITVLLQ-DHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQ  328

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN+  PRVSVA FF+T  +   R+YGPIKELLSE+N PKYRETT 
Sbjct  329  LISNDRFRSVEHRVLANRACPRVSVASFFSTGFLALPRIYGPIKELLSEDNLPKYRETTE  388

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  HFH KGLDGTSAL HF+L
Sbjct  389  KDFNSHFHNKGLDGTSALTHFKL  411



>gb|AAD38147.1|AF139500_1 unknown [Prunus armeniaca]
Length=370

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/263 (71%), Positives = 218/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKK++YTR   R V YNSNFDLY+AP+ NWRDT  C MAPN
Sbjct  109  DVLEEIKNGVRGFFEQDTEVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YSK+V KLG +LFELLSEALGL P++LN+++C+ GL ILGHYY
Sbjct  169  PPKPEDLPQVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLGTSKHADNDF T+LLQ D IGGLQVLHQN W DV   PGALVVNIGDLLQ
Sbjct  229  PPCPQPELTLGTSKHADNDFITVLLQ-DHIGGLQVLHQNTWIDVLPVPGALVVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN+  PRVSVACFF+T  +   R+YGPIKELLSE+N PKYRETT+
Sbjct  288  LISNDRFRSVEHRVLANRACPRVSVACFFSTGFLALPRIYGPIKELLSEDNLPKYRETTV  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  H + KGLDGT AL HF+L
Sbjct  348  KDYNAHHYNKGLDGTCALTHFKL  370



>ref|XP_011030520.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=364

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 222/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+E++ G+R FHEQD E+KKE+++R  TR V YNSNFDL+++PSANWRDT  CVMAP 
Sbjct  103  DVLQEMKDGVRRFHEQDVELKKEYFSRDYTRKVGYNSNFDLFSSPSANWRDTFTCVMAPI  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P +LP    DILI+Y+KEV KLG +LF+LLSEALGL+PN+L +I+C+KG +ILGHYY
Sbjct  163  SPRPEELPATFRDILIEYTKEVMKLGNLLFDLLSEALGLNPNHLKDIDCSKGHTILGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT+KH+DNDF T+LLQ D IGGLQV+HQN W DV   PGAL++NIGDLLQ
Sbjct  223  PACPQPELTLGTTKHSDNDFLTVLLQ-DHIGGLQVMHQNHWVDVSPTPGALLINIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+F S EHRVLAN+ GPR+SVA FF+T   P+SR YGPIKELLSEE+PPKYRETT+
Sbjct  282  LISNDKFISVEHRVLANRIGPRISVASFFSTNLNPNSRTYGPIKELLSEESPPKYRETTV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +F  KGLDGTSALLHF+L
Sbjct  342  RDYVTYFIHKGLDGTSALLHFKL  364



>ref|XP_007226473.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
 gb|EMJ27672.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
Length=369

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 218/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF+EQDT+VKK++YTR   + V YNSNFDL+ AP+ NWRDT  C MAPN
Sbjct  108  DVLEEIKDGVRGFYEQDTQVKKQFYTRDHFKPVVYNSNFDLHRAPACNWRDTFMCYMAPN  167

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P     +P V  DILI+YSK+V KLG +LFELLSEALGL P++LN+I+C+ GL ++GHYY
Sbjct  168  PTKAEDMPEVFRDILIEYSKQVMKLGKLLFELLSEALGLKPSHLNDIDCSLGLVLVGHYY  227

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LTLGTSKHAD+DF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  228  PSCPQPELTLGTSKHADSDFITVLLQ-DHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQ  286

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN+RFKS EHRVLAN+ GPRVSVA FF T   P  R+YGPIKELLSE+NPPKYR+TT+
Sbjct  287  LISNERFKSVEHRVLANRVGPRVSVASFFTTGMQPLERLYGPIKELLSEDNPPKYRDTTI  346

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  HF+ KGLDGTSAL HF L
Sbjct  347  REYNAHFNEKGLDGTSALTHFEL  369



>ref|XP_008222547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/263 (71%), Positives = 218/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKKE YTR  +R V YNSNFDLY+A + NWRDT  C MAPN
Sbjct  114  DVLEEIKNGVRGFFEQDTEVKKELYTRDYSRPVIYNSNFDLYSALATNWRDTFLCNMAPN  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YSK+V KLG +LFELLSEALGL P++LN+++C+ GL ILGHYY
Sbjct  174  PPKPEDLPQVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLG SKH D+DF T++LQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  234  PPCPQPELTLGASKHTDDDFITVVLQ-DHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN+ GPRVSVACFFNT  +   R+ GPIKELLSE+N PKYRETT+
Sbjct  293  LISNDRFRSVEHRVLANRAGPRVSVACFFNTGFLALPRICGPIKELLSEDNLPKYRETTV  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  HF+ KGLDGTSAL HF+L
Sbjct  353  KDYNAHFYNKGLDGTSALTHFKL  375



>ref|XP_007223369.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
 gb|EMJ24568.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
Length=366

 Score =   369 bits (946),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 215/262 (82%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE++  +RGF EQDT VKK++Y R   + V YNSNFDLY AP+ NWRDT  C MAPNP
Sbjct  106  VLEEMKDSVRGFFEQDTHVKKQFYNRDPLKPVGYNSNFDLYRAPATNWRDTFRCYMAPNP  165

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P  +P V  DILI+YSK+V KLG +LFELLSEALGL P+YLN+I+C+ GL + GHYYP
Sbjct  166  AKPEDMPEVFRDILIEYSKQVMKLGKLLFELLSEALGLKPSYLNDIDCSLGLLLGGHYYP  225

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            +CP+P+LT+G SKHADNDF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ+
Sbjct  226  SCPQPELTMGASKHADNDFLTVLLQ-DHIGGLQVLHQNKWIDVPPMPGALVVNIGDLLQV  284

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDRFKS+EHRVLAN+ GPRVSV CFF T  +P  R+YGPIKELLSE+NPPKYRETT++
Sbjct  285  LSNDRFKSAEHRVLANRVGPRVSVPCFFTTGMLPLERLYGPIKELLSEDNPPKYRETTIR  344

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  HF+ KGLDGTSAL HF+L
Sbjct  345  EYTAHFNDKGLDGTSALTHFKL  366



>emb|CAN66433.1| hypothetical protein VITISV_027452 [Vitis vinifera]
Length=365

 Score =   368 bits (945),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/264 (68%), Positives = 224/264 (85%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE+  G+  F+EQDTEVKK++YTR  +R  + YNSNFDLYTAP+ANWRDT +C+MAP
Sbjct  103  SVLEEMMEGVLRFYEQDTEVKKQFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP+P +LP  C DIL++Y  ++ +LG  LFEL+SEALGL+PN+L +++C +GLSIL HY
Sbjct  163  HPPNPEELPAACRDILMEYKDQIMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CP+P+LT+GT+KHADNDF T+LLQD  IGGLQVLHQ QW DV   PGALV+N+GDLL
Sbjct  223  YPSCPQPELTMGTTKHADNDFLTVLLQDQ-IGGLQVLHQGQWIDVPPMPGALVINVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++NDRFKS EHRVLAN  GPRVSVACFF+T   PSS++YGPIKELLSEENPPKY+ETT
Sbjct  282  QLITNDRFKSVEHRVLANHIGPRVSVACFFSTSIQPSSKLYGPIKELLSEENPPKYKETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F++KGLDGTSAL HFRL
Sbjct  342  VGDYVAYFNSKGLDGTSALPHFRL  365



>ref|XP_008338503.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=371

 Score =   368 bits (945),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/264 (70%), Positives = 219/264 (83%), Gaps = 2/264 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
              VLEEI+ G+RGF+EQDT VKKE YTR   R V Y+SNFDLYTAP+ NWRD+  C MAP
Sbjct  110  AGVLEEIKDGVRGFYEQDTRVKKELYTRNHFRPVIYHSNFDLYTAPATNWRDSFMCYMAP  169

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P  LP VC DIL++YSK+V KLG +LFELLSEALGL P++L +I+C++GL ++GHY
Sbjct  170  NPPKPEDLPEVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLLDIDCSEGLQVIGHY  229

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACP+P+LTLGTSKHAD+DF TILLQ D IGGLQV H N+W DV   PGALVVNIGDLL
Sbjct  230  YPACPQPELTLGTSKHADSDFLTILLQ-DHIGGLQV-HHNRWIDVPPVPGALVVNIGDLL  287

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SNDRF+S EHRVLAN+ GPR+SVA FF T  +PS+R+YGPIKELLSEENPPKYRE T
Sbjct  288  QLISNDRFRSVEHRVLANRAGPRISVASFFITGLLPSARLYGPIKELLSEENPPKYREIT  347

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KEY  HF+ KGLDGTSAL +F +
Sbjct  348  VKEYYSHFNKKGLDGTSALTYFNI  371



>ref|XP_002315712.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
 gb|EEF01883.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
Length=364

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/263 (69%), Positives = 222/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G+R F+EQD E+KKE+++R  TR V YNSNFDL+++PSANWRDT  CVMAP 
Sbjct  103  DVLEEMKDGVRRFYEQDVELKKEYFSRDHTRKVGYNSNFDLFSSPSANWRDTFTCVMAPI  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P +LP    DILI+Y+KEV KLG  LFELLSEALGL+PN+L +I+C+KGL+ILGHYY
Sbjct  163  SPRPEELPAAFRDILIEYTKEVMKLGNSLFELLSEALGLNPNHLKDIDCSKGLTILGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT+KH+DNDF T+LLQ D IGGLQV++QN W DV   PGAL++NIGDLLQ
Sbjct  223  PACPQPELTLGTTKHSDNDFLTVLLQ-DHIGGLQVMYQNHWVDVPPTPGALLINIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+F S EHRVLAN+ GPRVSVA FF+T   P+SR YGPIKELLSEE+PPKYRETT+
Sbjct  282  LISNDKFISVEHRVLANRIGPRVSVASFFSTNLNPNSRPYGPIKELLSEESPPKYRETTV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +F  KGLDGTSALLHF+L
Sbjct  342  RDYVAYFIHKGLDGTSALLHFKL  364



>ref|XP_009379006.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=368

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 221/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDT+VKKE YTR   + + YNSNFDLY+AP+ NWRDT  C +APN
Sbjct  107  DVLEEIKDGVRGFFEQDTQVKKELYTRDPLKPLVYNSNFDLYSAPATNWRDTFLCYVAPN  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  LP VC DIL++YSK V KLG +LFELLSEALGL P++LN+++CN+GL ILGHYY
Sbjct  167  PTKPEDLPQVCRDILVEYSKHVMKLGKLLFELLSEALGLKPSHLNDMDCNEGLLILGHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LT+GTSKHADNDF T+LLQ D IGGLQVLHQ +W DV   PGALVVNIGDLLQ
Sbjct  227  PSCPQPELTMGTSKHADNDFITVLLQ-DHIGGLQVLHQRKWVDVPPVPGALVVNIGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS +HRVLAN  GPR+SVA FF T  +PS+++YGPIKEL+S++NPPKY+ETT+
Sbjct  286  LISNDRFKSIQHRVLANCVGPRISVASFFCTGMLPSTKLYGPIKELVSKDNPPKYKETTV  345

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +F+ KGLDGTSAL HF+L
Sbjct  346  RDYVAYFNNKGLDGTSALSHFKL  368



>ref|XP_010650056.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=365

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/264 (68%), Positives = 221/264 (84%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE+  G+R FHEQDTEVKK++YTR  +R  V YNSNFDLYTAP+ANWRDT +C+MAP
Sbjct  103  SVLEEMMEGVRRFHEQDTEVKKQFYTRDASRKKVMYNSNFDLYTAPAANWRDTFYCLMAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP+P +LP  C DIL++Y  +V +LG  LFEL+SEALGL+PN+L +++C +GLSIL HY
Sbjct  163  HPPNPEELPASCRDILMEYKDQVMRLGFKLFELISEALGLNPNHLKDMDCAEGLSILCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CP+P+LT+GT+KHADNDF T+LLQD  IGGLQVLHQ QW DV    GALV+N+GDLL
Sbjct  223  YPSCPQPELTMGTTKHADNDFLTVLLQDQ-IGGLQVLHQGQWIDVPPRLGALVINVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++NDRFKS +HRV AN  GPRVSVACFF T   PSS++YGPIKEL SEENPPKYRETT
Sbjct  282  QLITNDRFKSVKHRVPANHIGPRVSVACFFRTSIQPSSKLYGPIKELSSEENPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F++KGLDGTSAL HFRL
Sbjct  342  VGDYVAYFNSKGLDGTSALPHFRL  365



>ref|XP_008224381.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=370

 Score =   363 bits (933),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 218/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL EI+ G+RGF+EQDT+VKK++YTR   + V YNSNFDL+ AP+ NWRD+  C MAPN
Sbjct  109  DVLGEIKDGVRGFYEQDTQVKKQFYTRDHFKPVVYNSNFDLHRAPATNWRDSFMCYMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  +P V  DILI+YSK+V KLG +LFELLSEALGL P++LN+I+C+ GL  +GHYY
Sbjct  169  PTEPEDMPEVFRDILIEYSKQVMKLGKLLFELLSEALGLKPSHLNDIDCSLGLVHVGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LTLGTSKHADNDF T+LLQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  229  PSCPQPELTLGTSKHADNDFITVLLQ-DHIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN+RFKS EHRVLAN+ GPRVSVA FF+T  +P  R+YGPIKELLSE+NPPKYRETT+
Sbjct  288  LISNERFKSVEHRVLANRVGPRVSVASFFSTGMLPLGRLYGPIKELLSEDNPPKYRETTI  347

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F  KGLDGTSAL HF L
Sbjct  348  REYNAYFIDKGLDGTSALTHFEL  370



>emb|CBI23590.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/264 (68%), Positives = 221/264 (84%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE+  G+R FHEQDTEVKK++YTR  +R  V YNSNFDLYTAP+ANWRDT +C+MAP
Sbjct  103  SVLEEMMEGVRRFHEQDTEVKKQFYTRDASRKKVMYNSNFDLYTAPAANWRDTFYCLMAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP+P +LP  C DIL++Y  +V +LG  LFEL+SEALGL+PN+L +++C +GLSIL HY
Sbjct  163  HPPNPEELPASCRDILMEYKDQVMRLGFKLFELISEALGLNPNHLKDMDCAEGLSILCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CP+P+LT+GT+KHADNDF T+LLQD  IGGLQVLHQ QW DV    GALV+N+GDLL
Sbjct  223  YPSCPQPELTMGTTKHADNDFLTVLLQDQ-IGGLQVLHQGQWIDVPPRLGALVINVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++NDRFKS +HRV AN  GPRVSVACFF T   PSS++YGPIKEL SEENPPKYRETT
Sbjct  282  QLITNDRFKSVKHRVPANHIGPRVSVACFFRTSIQPSSKLYGPIKELSSEENPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F++KGLDGTSAL HFRL
Sbjct  342  VGDYVAYFNSKGLDGTSALPHFRL  365



>ref|XP_008365367.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=370

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/262 (69%), Positives = 216/262 (82%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEEI+ G+RGF E DT+VKKE YTR   + V YNSNFDLY+AP  NWRDT  C +APNP
Sbjct  110  VLEEIKDGVRGFFELDTQVKKELYTRDPFKPVIYNSNFDLYSAPVTNWRDTFMCYVAPNP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P  LP VC DIL++YS +V KLG +LFELLSEALGL P++LN+I+C++GL ILGHYYP
Sbjct  170  TKPEDLPQVCRDILVEYSMQVMKLGRLLFELLSEALGLKPSHLNDIDCSEGLVILGHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LT+GTS HADNDF TILLQ D IGGLQVLHQ +W D+   PGALVVNIGDLLQL
Sbjct  230  ACPQPELTMGTSNHADNDFLTILLQ-DHIGGLQVLHQGKWVDIPPVPGALVVNIGDLLQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS +HRVLAN  GPR+SVA FF T  +PS+++YGPIKELLSE+NPPKYRETT++
Sbjct  289  ISNDKFKSIQHRVLANYVGPRISVASFFCTGMLPSTKLYGPIKELLSEDNPPKYRETTVR  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            +Y  HF+ KGLDGTSAL  F+L
Sbjct  349  DYVAHFNDKGLDGTSALXDFKL  370



>emb|CBI23594.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/263 (68%), Positives = 220/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE++ G+R F+EQDTEVKK++Y+R L R V YNSNFDLY AP+ANWRDT + +MAP 
Sbjct  71   TVLEEMKDGVRRFYEQDTEVKKQYYSRDLERKVVYNSNFDLYKAPAANWRDTFYFLMAPQ  130

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LPP   DILI+Y  EV KLG  L EL+SEALGL  N+L +++C +GL++L HYY
Sbjct  131  PPDPQELPPAFRDILIEYKDEVMKLGFKLLELISEALGLKANHLKDMDCAEGLAMLCHYY  190

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+GT+KHADNDF T+LLQ D+IGGLQVLHQ+QW DV   PGALV+NIGDLLQ
Sbjct  191  PACPQPELTMGTTKHADNDFLTVLLQ-DEIGGLQVLHQDQWVDVPPMPGALVINIGDLLQ  249

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLA+  GPRVSVACFF+T  +PS ++YGPIKELLSEENPPKYRE T+
Sbjct  250  LITNDRFKSVEHRVLASHKGPRVSVACFFSTALLPSLKLYGPIKELLSEENPPKYREITV  309

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++  +F+AKGLDGTSAL HF+L
Sbjct  310  RDFVAYFNAKGLDGTSALEHFKL  332



>ref|XP_010650057.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
 emb|CAN62402.1| hypothetical protein VITISV_000986 [Vitis vinifera]
Length=367

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/263 (68%), Positives = 220/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE++ G+R F+EQDTEVKK++Y+R L R V YNSNFDLY AP+ANWRDT + +MAP 
Sbjct  106  TVLEEMKDGVRRFYEQDTEVKKQYYSRDLERKVVYNSNFDLYKAPAANWRDTFYFLMAPQ  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LPP   DILI+Y  EV KLG  L EL+SEALGL  N+L +++C +GL++L HYY
Sbjct  166  PPDPQELPPAFRDILIEYKDEVMKLGFKLLELISEALGLKANHLKDMDCAEGLAMLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+GT+KHADNDF T+LLQ D+IGGLQVLHQ+QW DV   PGALV+NIGDLLQ
Sbjct  226  PACPQPELTMGTTKHADNDFLTVLLQ-DEIGGLQVLHQDQWVDVPPMPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLA+  GPRVSVACFF+T  +PS ++YGPIKELLSEENPPKYRE T+
Sbjct  285  LITNDRFKSVEHRVLASHKGPRVSVACFFSTALLPSLKLYGPIKELLSEENPPKYREITV  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++  +F+AKGLDGTSAL HF+L
Sbjct  345  RDFVAYFNAKGLDGTSALEHFKL  367



>ref|XP_006420179.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
 gb|ESR33419.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
Length=372

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 220/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE++ G+R F EQD E+KKE+YTR +T+MV YNSNFDLY+AP+ANWRDT+   MAPN
Sbjct  111  SILEEVKEGVRRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P ++P  C DI+++Y+K V KLG +LFELLSEALGL+PNYL  ++C +GL +LGHYY
Sbjct  171  PPKPEEMPAACRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+G ++HAD+DF T+LLQ D IGGLQV +QN W DV   PGALV+NIGDLLQ
Sbjct  231  PACPQPELTMGATEHADDDFVTVLLQ-DHIGGLQVCYQNHWIDVPPSPGALVINIGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+F S+EHRVLAN+ GPR+SVA FF+    PSS++YGPIKELLSEENPPKYRETT+
Sbjct  290  LISNDKFISAEHRVLANRVGPRISVASFFSPKRQPSSKLYGPIKELLSEENPPKYRETTV  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++  H H KGLDGTSAL HF+L
Sbjct  350  RDFVLHLHKKGLDGTSALEHFKL  372



>gb|KDO44340.1| hypothetical protein CISIN_1g017376mg [Citrus sinensis]
Length=372

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 220/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE++ G+R F EQD E+KKE+YTR +T+MV YNSNFDLY+AP+ANWRDT+   MAPN
Sbjct  111  SILEELKEGVRRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P ++P  C DI+++Y+K V KLG +LFELLSEALGL+PNYL  ++C +GL +LGHYY
Sbjct  171  PPKPEEMPAACRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+G ++HAD+DF T+LLQ D IGGLQV +QN W DV   PGALV+NIGDLLQ
Sbjct  231  PACPQPELTMGATEHADDDFVTVLLQ-DHIGGLQVCYQNHWIDVPPSPGALVINIGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+F S+EHRVLAN+ GPR+SVA FF+    PSS++YGPIKELLSEENPPKYRETT+
Sbjct  290  LISNDKFISAEHRVLANRVGPRISVASFFSPKRQPSSKLYGPIKELLSEENPPKYRETTV  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++  H H KGLDGTSAL HF+L
Sbjct  350  RDFVLHLHKKGLDGTSALEHFKL  372



>ref|XP_006489565.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=360

 Score =   360 bits (924),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 218/261 (84%), Gaps = 1/261 (0%)
 Frame = -1

Query  885  LEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            LEE++ G+R F EQD E+KKE+YTR +T+MV YNSNFDLY+AP+ANWRDT+   MAPNPP
Sbjct  101  LEELKEGVRRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPP  160

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P ++P  C DI+++Y+K V KLG +LFELLSEALGL+PNYL  ++C +GL +LGHYYPA
Sbjct  161  KPEEMPAACRDIVMEYTKSVMKLGHLLFELLSEALGLNPNYLKGMDCAEGLMLLGHYYPA  220

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CP+P+LT+G ++HAD+DF T+LLQ D IGGLQV +QN W DV   PGALV+NIGDLLQL+
Sbjct  221  CPQPELTMGATEHADDDFVTVLLQ-DHIGGLQVRYQNHWIDVPPSPGALVINIGDLLQLI  279

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKE  166
            SND+F S+EHRVLAN+ GPR+SVA FF+    PSS++YGPIKELLSEENPPKYRETT+++
Sbjct  280  SNDKFISAEHRVLANRVGPRISVASFFSPKRQPSSKLYGPIKELLSEENPPKYRETTVRD  339

Query  165  YEDHFHAKGLDGTSALLHFRL  103
            +  H H KGLDGTSAL HF+L
Sbjct  340  FVLHLHKKGLDGTSALEHFKL  360



>ref|XP_004246497.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 213/262 (81%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LEE++ G+  F EQDTE KK+WYTR LT++ ++NSNFDL+ AP  NWRDT     AP P
Sbjct  110  LLEEMKDGVLSFFEQDTEEKKQWYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP VC D+L++Y+ +V KLG  LFE+L+EA+GL PN+L ++ C +GL  LGHYYP
Sbjct  170  PKPEELPSVCRDVLLEYTNQVMKLGDTLFEILAEAIGLEPNHLKDMGCAEGLMALGHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLGTSKHADNDF T+LLQ D++GGLQVLHQN W DV   PGALVVNIGD+LQL
Sbjct  230  ACPQPELTLGTSKHADNDFLTVLLQ-DNVGGLQVLHQNHWVDVPPTPGALVVNIGDILQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            ++ND+FKS +HRVLAN+ GPRVS+ACFF T  V + R+YGPIKEL+SE+NPP YRETT+K
Sbjct  289  ITNDKFKSVDHRVLANKVGPRVSLACFFMTNFVATQRLYGPIKELISEQNPPNYRETTIK  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  HF+ KGLDGTS LLHFRL
Sbjct  349  EFTTHFNNKGLDGTSTLLHFRL  370



>ref|XP_007223295.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
 gb|EMJ24494.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
Length=375

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/263 (69%), Positives = 215/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI  G+RGF EQDTEVKKE YTR   R V YNSNFDLY+AP+ NWRD+  C MAPN
Sbjct  114  DVLEEITNGVRGFFEQDTEVKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPN  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YSK+V KLG +LF+LLSEALGL P++LN+++C+ GL +L +YY
Sbjct  174  PPKPEDLPQVCRDILVEYSKQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLG SKHAD+DF T++LQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  234  PPCPQPELTLGASKHADDDFITVVLQ-DHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN+ GPRVSVA FF T  +   ++YGPIKELLSE+N PKYRETT+
Sbjct  293  LISNDRFRSVEHRVLANRAGPRVSVASFFTTGFLALPQIYGPIKELLSEDNLPKYRETTV  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY  +F  KGLDGTSAL HF+L
Sbjct  353  KEYNAYFFNKGLDGTSALTHFKL  375



>ref|XP_006341091.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=370

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE++ G+  F EQDTE KK+WYTR LT++ ++NSNFDL+ AP  NWRDT     AP P
Sbjct  110  VLEEMKDGVISFFEQDTEEKKQWYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP VC D+L++Y+ +V KLG  LF +LSEA+GL PN+L ++ C +GL  LGHYYP
Sbjct  170  PKPEELPSVCRDVLLEYTNQVIKLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CP+P+LTLGTSKHADNDF T+LLQD+ IGGLQVLHQN W DV   PGALVVNIGD+LQL
Sbjct  230  ECPQPELTLGTSKHADNDFLTVLLQDN-IGGLQVLHQNHWVDVPPTPGALVVNIGDILQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS +HRVLAN+ GPRVS+ACFF T  VP+ R+YGPIKEL+SE NPPKYRETT+K
Sbjct  289  ISNDKFKSVDHRVLANKVGPRVSLACFFMTNFVPTQRLYGPIKELISEHNPPKYRETTIK  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  +F+ KGLDGTS LLHFRL
Sbjct  349  EFTTYFNNKGLDGTSTLLHFRL  370



>ref|XP_006341092.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Solanum tuberosum]
Length=364

 Score =   358 bits (919),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 213/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+EE++ G+  F EQDTEVKK+WYTR   ++  YNSNFDL+ AP  NWRDT   ++AP 
Sbjct  103  HVMEEMKDGVIRFFEQDTEVKKQWYTRDFIKVFQYNSNFDLFGAPVTNWRDTFTAIIAPT  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP VC D+L++Y+ +V KLG  LF +LSEA+GL PN+L ++ C +GL  LGHYY
Sbjct  163  PPNPEILPSVCRDVLLEYTNQVIKLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLGTSKHADNDF T+LLQD+ IGGLQVLHQN W DV   PGALVVNIGD+LQ
Sbjct  223  PECPQPELTLGTSKHADNDFLTVLLQDN-IGGLQVLHQNHWVDVPPTPGALVVNIGDILQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS +HRVLAN+ GPRVS+ACFF T  VP+ R+YGPIKEL+SE NPPKYRETT+
Sbjct  282  LISNDKFKSVDHRVLANKVGPRVSLACFFMTNFVPTQRLYGPIKELISEHNPPKYRETTI  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KE+  +F+ KGLDGTS LLHFRL
Sbjct  342  KEFTTYFNNKGLDGTSTLLHFRL  364



>ref|XP_002529305.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33074.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   358 bits (919),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 220/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G++ FHEQD E+KKE+Y+R  T+ V YNSNFDLY++P ANWRD++F  M P+
Sbjct  102  SVLEEMKEGVKRFHEQDVELKKEFYSRDYTKKVLYNSNFDLYSSPFANWRDSIFFQMIPD  161

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP  C DIL++YSKEV+KLG +L EL SEALGL PN+L ++ECN+GL I+G+YY
Sbjct  162  PPKPEELPAACRDILMEYSKEVRKLGDLLLELFSEALGLSPNHLKDMECNEGLLIVGNYY  221

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PAC +P++TLG S HAD+DFFT+LLQ D IGGLQVLHQN+W +V + P ALVVNIGDL+Q
Sbjct  222  PACRQPEITLGASGHADSDFFTVLLQ-DHIGGLQVLHQNEWINVPSTPDALVVNIGDLIQ  280

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN  GPR+SVA FF T  + +SR+YGPIKELLSEENPPKYRETT+
Sbjct  281  LITNDKFISVEHRVLANCVGPRISVASFFTTTLISTSRLYGPIKELLSEENPPKYRETTV  340

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY DH+  KGLDGTSALLHF+L
Sbjct  341  REYSDHYKGKGLDGTSALLHFKL  363



>ref|XP_002284638.2| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Vitis vinifera]
Length=681

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/264 (68%), Positives = 224/264 (85%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE+  G+  F+EQDTEVKK++YTR  +R  + YNSNFDLYTAP+ANWRDT +C+MAP
Sbjct  419  SVLEEMMEGVLRFYEQDTEVKKQFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAP  478

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP+P +LP  C DIL++Y  ++ +LG  LFEL+SEALGL+PN+L +++C +GLSIL HY
Sbjct  479  HPPNPEELPAACRDILMEYKDQIMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHY  538

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CP+P+LT+GT+KHADNDF T+LLQD  IGGLQVLHQ QW DV   PGALV+N+GDLL
Sbjct  539  YPSCPQPELTMGTTKHADNDFLTVLLQDQ-IGGLQVLHQGQWIDVPPMPGALVINVGDLL  597

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++NDRFKS EHRVLAN  GPRVSVACFF+T   PSS++YGPIKELLSEENPPKY+ETT
Sbjct  598  QLITNDRFKSVEHRVLANHIGPRVSVACFFSTSIQPSSKLYGPIKELLSEENPPKYKETT  657

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F++KGLDGTSAL HFRL
Sbjct  658  VGDYVAYFNSKGLDGTSALPHFRL  681


 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/265 (67%), Positives = 224/265 (85%), Gaps = 1/265 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+  F+EQD EVKKE+YTR LTR V YNSNFDLY + +ANWRDT +C+MAP+
Sbjct  102  SVLEEMMDGVHRFYEQDNEVKKEFYTRDLTRKVIYNSNFDLYVSKAANWRDTFYCLMAPH  161

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P +P +LP  C DIL++Y ++V +LG  L EL+SEA+GL+PN+L +++C +GL+IL HYY
Sbjct  162  PLNPQELPATCRDILMEYKEQVMRLGLKLLELMSEAIGLNPNHLKDMDCAEGLAILCHYY  221

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+GT+KH+DNDF TILLQ D IGGLQVLHQ+QW DV   PGALV+N+GDLLQ
Sbjct  222  PACPQPELTMGTTKHSDNDFLTILLQ-DQIGGLQVLHQDQWVDVPPEPGALVINVGDLLQ  280

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLAN+ GPRVSVACFF+T  +PSS++YGPIKELLS+ENPPKYRETT+
Sbjct  281  LITNDRFKSVEHRVLANRRGPRVSVACFFSTSHLPSSKLYGPIKELLSKENPPKYRETTV  340

Query  171  KEYEDHFHAKGLDGTSALLHFRL*I  97
            ++Y  HF +KGLDGTSAL  F+L I
Sbjct  341  RDYVLHFRSKGLDGTSALPQFKLXI  365



>ref|XP_008224382.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 215/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKKE YTR   R V YNSNFDLY+AP+ NWRD+  C MAPN
Sbjct  114  DVLEEIKNGVRGFFEQDTEVKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPN  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++YS +V KLG +LF+LLSEALGL P++LN+++C+ GL +L +YY
Sbjct  174  PPKPEDLPQVCRDILVEYSNQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLG SKH D+DF T++LQ D IGGLQVLHQN+W DV   PGALVVNIGDLLQ
Sbjct  234  PPCPQPELTLGASKHTDDDFITVVLQ-DHIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN+ GPRVSVA FF T  +   ++YGPIKELLSE+N PKYRET++
Sbjct  293  LISNDRFRSVEHRVLANRAGPRVSVASFFTTGFLALPQIYGPIKELLSEDNLPKYRETSV  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY  HF+ KGLDGTSAL HF+L
Sbjct  353  KEYNAHFYNKGLDGTSALTHFKL  375



>ref|XP_004299419.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/264 (67%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTR-MVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE++ G+R F EQDTEVKK+ Y R   R  V YNSNFDLY+AP+ NWRDT  C MAP
Sbjct  107  DVLEEVKNGVRRFFEQDTEVKKQLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAP  166

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             P  P  LP VC DIL++YS +V KLG +LFELLSEALGL P YLN+I+C +G+  LGHY
Sbjct  167  TPTKPEDLPEVCRDILVEYSDQVMKLGKLLFELLSEALGLKPTYLNDIDCTEGILFLGHY  226

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CP+P+LTLG +KHADN F T+LLQD  IGGLQVLHQN+W DV   PGALVVNIGDLL
Sbjct  227  YPPCPQPELTLGATKHADNAFLTVLLQDH-IGGLQVLHQNKWIDVPPVPGALVVNIGDLL  285

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SNDRFKS EH+VLAN+ GPRVS+A FF T  +P  ++YGPIKELLSEENPPKYRETT
Sbjct  286  QLISNDRFKSVEHKVLANRRGPRVSIASFFCTGMLPLPKLYGPIKELLSEENPPKYRETT  345

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +F+ KGLDGTSAL HF++
Sbjct  346  VRDYVAYFNEKGLDGTSALSHFKV  369



>ref|XP_009347727.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=370

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/262 (68%), Positives = 217/262 (83%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEEI+ G+RGF E DT+VKKE YTR   + + YNSNFDLY+AP  NWRDT  C +APNP
Sbjct  110  VLEEIKDGVRGFFELDTQVKKELYTRDPFKPLIYNSNFDLYSAPVTNWRDTFMCYVAPNP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P  LP VC DIL++YS +V KLG +LFELLSEALGL P+++N+I+C++GL ILGHYYP
Sbjct  170  TKPEDLPQVCRDILVEYSMQVMKLGRLLFELLSEALGLKPSHMNDIDCSEGLVILGHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CP+P+LT+GTS HADNDF TILLQ D IGGLQVLHQ++W DV   PGALVVNIGDLLQL
Sbjct  230  PCPQPELTIGTSSHADNDFLTILLQ-DHIGGLQVLHQSKWVDVPLVPGALVVNIGDLLQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDRFKS +HRVLAN+ GPR+SVA FF T  +P +++YGPIKELLSE+NPPKY+ETT++
Sbjct  289  ISNDRFKSIQHRVLANRVGPRISVASFFCTGMLPLTKLYGPIKELLSEDNPPKYKETTVR  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            +Y  +F+ KGLDGTSAL +F+L
Sbjct  349  DYVAYFNNKGLDGTSALSNFKL  370



>ref|XP_008224380.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=366

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/262 (69%), Positives = 213/262 (81%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE++  +RGF EQDT+VKK++Y R   + V YNSNFDLY AP+ NWRDT  C MAPNP
Sbjct  106  VLEEMKDSVRGFFEQDTQVKKQFYNRDPLKPVGYNSNFDLYRAPATNWRDTFRCHMAPNP  165

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P  +P V  DI+I+YSK+V KLG +LFELLSEALGL P+YLN+I+C  GL + GHYYP
Sbjct  166  AKPEDMPEVFRDIVIEYSKQVMKLGKLLFELLSEALGLKPSYLNDIDCGLGLLLGGHYYP  225

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            +CP+P+LT+G SKHADN F T+LLQD  IGGLQVLHQN+W DV   PGALVVNIG+LLQL
Sbjct  226  SCPQPELTMGASKHADNVFLTVLLQDH-IGGLQVLHQNKWIDVPPMPGALVVNIGNLLQL  284

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDRFKS EHRVLAN+ GPRVSV CFF T  +P  R+YGPIKELLSEENPPKYRETT++
Sbjct  285  LSNDRFKSVEHRVLANRVGPRVSVPCFFTTGMLPLERLYGPIKELLSEENPPKYRETTVR  344

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  HF+ KGLDGTSAL HF+L
Sbjct  345  EYTAHFNDKGLDGTSALTHFKL  366



>ref|XP_007035061.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY05987.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=371

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G R F EQD EVKK+++TR  T+ V+YNSNFDLY +P+ANWRDT+  +MAP+
Sbjct  110  SVLEEMKDGARRFFEQDLEVKKQFHTRDYTKRVAYNSNFDLYNSPAANWRDTVSSLMAPD  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP V  DI+++YSK+V  LG +LFELLSEALGLHP++L +++C KGL +L HYY
Sbjct  170  PPMPEELPEVIRDIMMEYSKQVMHLGYLLFELLSEALGLHPDHLRDMDCAKGLVMLSHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PAC  P+LTLG +KHADNDF T+LLQ D IGGLQV H+NQW DV   PGALV+NIGDLL+
Sbjct  230  PACSRPELTLGATKHADNDFLTVLLQ-DHIGGLQVFHENQWVDVPPTPGALVINIGDLLK  288

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND F S EHRVLAN  G RVSVACFF+T+ +P  R YGPIKELLSE+NPPKYRETT+
Sbjct  289  LISNDAFVSVEHRVLANSVGARVSVACFFSTFRLPDLRPYGPIKELLSEDNPPKYRETTV  348

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY D+ HAKGLDGTSAL HF+L
Sbjct  349  REYVDYVHAKGLDGTSALPHFKL  371



>emb|CBI23588.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R F+EQDTE+K+E+YTR ++R + YNSNFDLYTA +A+WRDT +C+MAP+
Sbjct  35   TVLEEMMNGVRRFYEQDTELKQEFYTRDVSRKLVYNSNFDLYTAKAASWRDTFYCLMAPH  94

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP  C DIL++Y ++V KLG  L EL+SEALGL+PN+L  ++C +GL+++ HYY
Sbjct  95   PPNPQDLPAACRDILMEYKEQVMKLGFKLLELMSEALGLNPNHLKGMDCAEGLAMVCHYY  154

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT  H DNDF T+LLQ D IGGLQVLHQ+QW DV   PGALV+N+GDLLQ
Sbjct  155  PACPQPELTLGTGFHTDNDFLTVLLQ-DQIGGLQVLHQDQWVDVPPMPGALVINVGDLLQ  213

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLAN  GPRVS+ACFF+T   PSS++YGPIKELLSEENP +YRETT+
Sbjct  214  LITNDRFKSVEHRVLANHTGPRVSIACFFSTSVQPSSKLYGPIKELLSEENPARYRETTV  273

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  HF  KGL+G++AL  FRL
Sbjct  274  SDYVAHFQEKGLEGSTALQLFRL  296



>ref|XP_008438545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=386

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 216/261 (83%), Gaps = 0/261 (0%)
 Frame = -1

Query  885  LEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            L+EI+ G   F+EQDTEVKK +YTR  T+ + YNSNFDL+TAP+ANWRDT  C M PN P
Sbjct  118  LDEIKNGTLRFYEQDTEVKKLFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMGPNVP  177

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
            +P  LP VC DIL +YSKE++KLG +LF +LSEALGL+ NYL+ IEC++GL++L HYYPA
Sbjct  178  NPQDLPEVCRDILFEYSKEMKKLGRILFGVLSEALGLNTNYLSEIECDRGLAVLCHYYPA  237

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CP+P+LTLGT++HADNDF T+LLQDD IGGLQVLH+ +W D+   PGALV+NIGDLLQL+
Sbjct  238  CPQPELTLGTTEHADNDFLTVLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQLI  297

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKE  166
            SNDRFKS EHRV+AN++GPRVSVA FF     P+S+VYGPIKELLSE+NP KYRETTLK+
Sbjct  298  SNDRFKSVEHRVVANREGPRVSVASFFGIGVYPTSQVYGPIKELLSEKNPAKYRETTLKD  357

Query  165  YEDHFHAKGLDGTSALLHFRL  103
            +  + + +GL+G SAL HFR+
Sbjct  358  FYFYHNMRGLNGISALQHFRI  378



>ref|XP_002284582.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=364

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R F+EQDTE+K+E+YTR ++R + YNSNFDLYTA +A+WRDT +C+MAP+
Sbjct  103  TVLEEMMNGVRRFYEQDTELKQEFYTRDVSRKLVYNSNFDLYTAKAASWRDTFYCLMAPH  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP  C DIL++Y ++V KLG  L EL+SEALGL+PN+L  ++C +GL+++ HYY
Sbjct  163  PPNPQDLPAACRDILMEYKEQVMKLGFKLLELMSEALGLNPNHLKGMDCAEGLAMVCHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT  H DNDF T+LLQ D IGGLQVLHQ+QW DV   PGALV+N+GDLLQ
Sbjct  223  PACPQPELTLGTGFHTDNDFLTVLLQ-DQIGGLQVLHQDQWVDVPPMPGALVINVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLAN  GPRVS+ACFF+T   PSS++YGPIKELLSEENP +YRETT+
Sbjct  282  LITNDRFKSVEHRVLANHTGPRVSIACFFSTSVQPSSKLYGPIKELLSEENPARYRETTV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  HF  KGL+G++AL  FRL
Sbjct  342  SDYVAHFQEKGLEGSTALQLFRL  364



>ref|XP_009784072.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=361

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 215/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+E+  G+R F+EQDTEVKK WYTR  ++ V YNSNFDL+ A SANWRDT +C MAP+
Sbjct  100  SVLQEMLNGVRRFYEQDTEVKKRWYTRDTSKRVVYNSNFDLFGAASANWRDTTYCSMAPD  159

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP  C DILI+YS+ ++KLG  LFELLSEALGL P+YLN+I C++GL++L HYY
Sbjct  160  PPTADELPEACRDILIEYSEHIKKLGCSLFELLSEALGLKPSYLNDIGCSEGLAVLYHYY  219

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTSKH+D+DFFT+LLQD+  GGLQVLH N W DVH   GALVVN G+LLQ
Sbjct  220  PACPEPELTLGTSKHSDSDFFTVLLQDNS-GGLQVLHDNYWVDVHPLSGALVVNFGELLQ  278

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS  HRVLA++ GPRVSVACFF T    SSRVYGPIKELLSE+NP +YRETT+
Sbjct  279  LISNDKFKSIAHRVLASRVGPRVSVACFFTTGHSLSSRVYGPIKELLSEDNPARYRETTV  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  H++A GL G SALL FR+
Sbjct  339  KDFSVHYNATGLGGKSALLGFRI  361



>ref|XP_003521041.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Glycine max]
Length=378

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 219/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G+  F+EQD+EVK+E YTR   R + YNSNFDL+T+P+ANWRDT +C MAP+
Sbjct  114  SVLEEMKSGVNRFYEQDSEVKRELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPH  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y+KEV+KLG VLFELLSEAL L+PNYLN+I CN+GL+++ H Y
Sbjct  174  PPKPEDLPSVCRDILLEYAKEVKKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLG +KH DNDF T+LLQ D IGGLQVLH+N+W DV   PGALV+NIGDLLQ
Sbjct  234  PACPEPELTLGATKHTDNDFITVLLQ-DHIGGLQVLHENRWVDVSPVPGALVINIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRV+AN+ GPRVSVA FF+T   PS+++YGPIK+L+SE+NPPKYRETT+
Sbjct  293  LITNDKFKSVEHRVVANRVGPRVSVASFFSTSLQPSTKLYGPIKDLVSEDNPPKYRETTV  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            + Y  +   +GLDGTS L HFR+
Sbjct  353  QGYVSYSLGRGLDGTSPLPHFRI  375



>ref|XP_010104048.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB98149.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=392

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 219/279 (78%), Gaps = 17/279 (6%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE++  G+R FHEQ+TE KK ++TR LTR V YNSNFDLY+  S NWRD+  C MAPN
Sbjct  115  SVLEDMIDGVRRFHEQETEAKKTFFTRDLTRAVIYNSNFDLYSGISTNWRDSFVCTMAPN  174

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+  ++P +C DILI+YSK+V K+G ++FELL+EALGL+PNYLN I C +GL ILGHYY
Sbjct  175  APNLEEMPIICRDILIEYSKQVMKVGTLVFELLTEALGLNPNYLNAIGCAEGLMILGHYY  234

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT+KHADNDF T+LLQ D IGGLQVLH N W DV   PGALVVNIGDLLQ
Sbjct  235  PACPQPELTLGTTKHADNDFVTVLLQ-DHIGGLQVLHDNDWIDVPPQPGALVVNIGDLLQ  293

Query  351  ----------------LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIK  220
                            L+SND+FKS EHRVLA++ GPR+SVA FF+T  +P++++YGPIK
Sbjct  294  ASVFDLLYSFVFTNFKLISNDKFKSIEHRVLASRVGPRISVASFFSTNLLPTTKLYGPIK  353

Query  219  ELLSEENPPKYRETTLKEYEDHFHAKGLDGTSALLHFRL  103
            ELLSE+NPPKYRETT+++Y  +F+ KGLD TSAL HFRL
Sbjct  354  ELLSEDNPPKYRETTMRDYVAYFNKKGLDETSALDHFRL  392



>ref|XP_004167607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
Length=375

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 218/263 (83%), Gaps = 0/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+EI+     F+EQDTE+KK +YTR  T+ + YNSNFDL+TAP+ANWRDT  C MAPN
Sbjct  105  SVLDEIKNRTLRFYEQDTELKKLFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMAPN  164

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP VC DIL +YSKE++KLG VLF +LSEALGL+ NYL++IEC++GL++L HYY
Sbjct  165  VPNPQDLPEVCRDILFEYSKEMKKLGRVLFGMLSEALGLNTNYLSDIECDRGLAVLCHYY  224

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT++HADNDF T+LLQDD IGGLQVLH+ +W D+   PGALV+NIGDLLQ
Sbjct  225  PACPQPELTLGTTEHADNDFLTLLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRV+AN++GPRVSVA FF     P+S+VYGPIKELLSE+N  KYRETTL
Sbjct  285  LISNDRFKSVEHRVVANREGPRVSVASFFGIGVYPTSQVYGPIKELLSEKNRAKYRETTL  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  + + +GL+G SAL HFRL
Sbjct  345  KDFYFYHNMRGLNGISALQHFRL  367



>ref|XP_008367169.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Malus domestica]
Length=375

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 216/263 (82%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLE I+ G+RGF+EQDT VKKE+YTR  ++ + YNSNFDLY++ + NWRDT  C MAP P
Sbjct  112  VLEXIKDGVRGFYEQDTRVKKEFYTRDHSKPLFYNSNFDLYSSXATNWRDTFKCYMAPXP  171

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP VC D+LI+YSK V +LG +LFELLSEALGL P++LN I+C+KGL +LGHYYP
Sbjct  172  PKPEDLPEVCRDVLIEYSKRVMELGKLLFELLSEALGLKPSHLNXIDCSKGLQVLGHYYP  231

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQ-VLHQNQWFDVHAYPGALVVNIGDLLQ  352
            ACP+P+LTLGTSKHAD+ F T+LLQ D IGGLQ V  Q +W DV   PGAL VNIGDLLQ
Sbjct  232  ACPQPELTLGTSKHADDSFLTVLLQ-DHIGGLQXVXRQXKWIDVPPVPGALXVNIGDLLQ  290

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRV AN++GPR+S+A FF+T  +P + +YGPIKEL+SE+NPPKYRETT+
Sbjct  291  LISNDRFKSVEHRVXANREGPRISIASFFSTGLLPFTNLYGPIKELVSEDNPPKYRETTV  350

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y+ HF+ KGLDGTSAL HF++
Sbjct  351  RDYDTHFYDKGLDGTSALSHFKI  373



>gb|KHN10894.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=378

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 218/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G+  F+EQD+EVK+E YTR   R + YNSNFDL+T+P+ANWRDT +C MAP+
Sbjct  114  SVLEEMKSGVNRFYEQDSEVKRELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPH  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y+KEV+KLG VLFELLSEAL L+PNYLN+I CN+GL+++ H Y
Sbjct  174  PPKPEDLPSVCRDILLEYAKEVKKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLG +KH DNDF T+LLQ D IGGLQVLH+N+W DV   PGALV+NIGDLLQ
Sbjct  234  PACPEPELTLGATKHTDNDFITVLLQ-DHIGGLQVLHENRWVDVSPVPGALVINIGDLLQ  292

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRV+AN+ GPRVSVA F +T   PS+++YGPIK+L+SE+NPPKYRETT+
Sbjct  293  LITNDKFKSVEHRVVANRVGPRVSVASFVSTSLQPSTKLYGPIKDLVSEDNPPKYRETTV  352

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            + Y  +   +GLDGTS L HFR+
Sbjct  353  QGYVSYSLGRGLDGTSPLPHFRI  375



>ref|XP_010672757.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=359

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 214/262 (82%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+  G++ F+EQD EVKK +YTR + + V YNSN+DLYT P+ANWRDT +C MAP P
Sbjct  99   VLEEMLEGVKRFYEQDVEVKKGYYTRDVAKKVVYNSNYDLYTGPAANWRDTFYCFMAPQP  158

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP  C +IL++Y+KEV KLG VL ELLSEALGL  N+LN+I+C++GL ++GHYYP
Sbjct  159  PSPQDLPNTCREILMEYTKEVMKLGRVLMELLSEALGLSANHLNDIDCSEGLVVVGHYYP  218

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLGTSKHAD+ F T+LLQ D IGGLQ+LH+++WFDV   PGALVVNIGDLLQL
Sbjct  219  ACPQPELTLGTSKHADDGFLTLLLQ-DQIGGLQILHEDKWFDVPPVPGALVVNIGDLLQL  277

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND FKS EHRVLAN+ GPRVSVA FF T    +S++YGPIK+L+SE+NPP+YRE T+ 
Sbjct  278  ISNDTFKSVEHRVLANRIGPRVSVASFFTTSFQGTSKIYGPIKDLVSEDNPPRYREVTVS  337

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  +  AKGLDG S+LL+FRL
Sbjct  338  EYVTYALAKGLDGVSSLLNFRL  359



>ref|XP_004296613.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=362

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTR-MVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE++ G+  F EQDTEVKK+ Y R   R  V YNSNFDLY+AP+ NWRDT  C MAP
Sbjct  100  DVLEEVKHGVHRFFEQDTEVKKQLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAP  159

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             P  P  LP VC +IL++YS +V KLG +LFELLSEALGL P YLN+I+C++GL +L HY
Sbjct  160  TPTKPEDLPEVCRNILVEYSDQVMKLGKLLFELLSEALGLKPTYLNDIDCSEGLVLLSHY  219

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CP+P+LTLGT+KHADN F T+LLQD  IGGLQVLHQN+W DV   PGALVVNIGDLL
Sbjct  220  YPPCPQPELTLGTTKHADNSFLTVLLQDH-IGGLQVLHQNKWIDVPPVPGALVVNIGDLL  278

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SNDRFKS EH+VLAN  GPRVS A FF T  +P  ++YGPIKELLSEENPPKYRETT
Sbjct  279  QLISNDRFKSVEHKVLANCRGPRVSNASFFCTGMLPLPKLYGPIKELLSEENPPKYRETT  338

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +F+ KGLDGTSAL HF++
Sbjct  339  VRDYAAYFNEKGLDGTSALSHFKV  362



>ref|XP_011073514.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/264 (67%), Positives = 216/264 (82%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+E+  G+R F+EQDTEVKK+WYTR  +  V YNSNFDLY A SANWRDT +C MAP 
Sbjct  110  SVLDEMLEGVRRFYEQDTEVKKKWYTRDGSETVVYNSNFDLYRAASANWRDTTYCNMAPR  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P +LP  C DI+++YSK + +LG  LFELLSEALGL+P++LNN+ C++GL++L HYY
Sbjct  170  LPCPEELPEACRDIMLEYSKHITRLGRFLFELLSEALGLNPDHLNNLGCSEGLAVLYHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+ TLG SKHAD DF T+LLQ D+IGGLQVL QN W D+    GALVVN+GDLLQ
Sbjct  230  PACPEPEKTLGASKHADYDFLTVLLQ-DNIGGLQVLFQNLWVDIPPLSGALVVNVGDLLQ  288

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEE-NPPKYRETT  175
            L+SND+FKSS+HRVLAN+ GPRVSVACFF T  +PS+++YGPI+ELLSEE NPPKYRETT
Sbjct  289  LISNDKFKSSQHRVLANRGGPRVSVACFFTTGLMPSTKLYGPIQELLSEEDNPPKYRETT  348

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  H++AKGL GTSAL  F L
Sbjct  349  VREYSLHYNAKGLGGTSALSDFML  372



>ref|XP_004134415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 gb|KGN56874.1| hypothetical protein Csa_3G135710 [Cucumis sativus]
Length=386

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 218/263 (83%), Gaps = 0/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+EI+     F+EQDTE+KK +YTR  T+ + YNSNFDL+TAP+ANWRDT  C MAPN
Sbjct  116  SVLDEIKNRTLRFYEQDTELKKLFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMAPN  175

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP VC DIL +YSKE++KLG VLF +LSEALGL+ NYL++IEC++GL++L HYY
Sbjct  176  VPNPQDLPEVCRDILFEYSKEMKKLGRVLFGMLSEALGLNTNYLSDIECDRGLAVLCHYY  235

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT++HADNDF T+LLQDD IGGLQVLH+ +W D+   PGALV+NIGDLLQ
Sbjct  236  PACPQPELTLGTTEHADNDFLTLLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQ  295

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRV+AN++GPRVSVA FF     P+S+VYGPIKELLSE+N  KYRETTL
Sbjct  296  LISNDRFKSVEHRVVANREGPRVSVASFFGIGVYPTSQVYGPIKELLSEKNRAKYRETTL  355

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  + + +GL+G SAL HFRL
Sbjct  356  KDFYFYHNMRGLNGISALQHFRL  378



>ref|XP_006341093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=367

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 211/262 (81%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            V+E ++ G+  F EQDTEVKK+WYTR LT+  ++NSNFDL+ AP  NWRDT    +AP P
Sbjct  107  VMEAMKDGVTRFFEQDTEVKKQWYTRDLTKEFTFNSNFDLFRAPVTNWRDTFRATIAPIP  166

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P QLP VC DIL++Y+ +V  LG  LFEL+SEA+GL PN+L ++ C +GL  +G YYP
Sbjct  167  PKPEQLPSVCKDILLEYTNQVMTLGDTLFELVSEAIGLEPNHLKDMGCAEGLLAIGQYYP  226

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLGTSKHADNDF T+LLQ D+IGGLQVLHQN W DV   PGALVVNIGDLLQL
Sbjct  227  ACPQPELTLGTSKHADNDFLTVLLQ-DNIGGLQVLHQNHWVDVPPTPGALVVNIGDLLQL  285

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            ++ND+FKS +HRVLAN+ G RVS+ACFF T  V + R+YGPIKEL+SE+NPPKYRETT+K
Sbjct  286  ITNDKFKSVDHRVLANKVGTRVSMACFFMTNCVTTHRLYGPIKELISEQNPPKYRETTIK  345

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  +F+ KGLDGTS LLHFRL
Sbjct  346  EFTTYFNNKGLDGTSTLLHFRL  367



>ref|XP_009591157.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=365

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+R F+EQDTEVKK+WYTR  ++ V YNSNFDL+ A SANWRDT +C M+PN
Sbjct  104  SVLEEMLNGVRRFYEQDTEVKKQWYTRDNSKRVVYNSNFDLFGAASANWRDTTYCSMSPN  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP  C DILI+YS+ ++KLG  LFELLSEALGL+P+YLN+I C++GL++L HYY
Sbjct  164  PPTADELPEACRDILIEYSEHIKKLGCSLFELLSEALGLNPSYLNDIGCSEGLAVLYHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTSKH+D+DFFT+LLQD+  GGLQVLH N W DVH   GALVVN G+LLQ
Sbjct  224  PACPEPELTLGTSKHSDSDFFTVLLQDNS-GGLQVLHDNYWVDVHPLSGALVVNFGELLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS  HRVLA++ GPRVSVACFF T    SSRVYGPIKELLSE+NP +YRETT+
Sbjct  283  LISNDKFKSIAHRVLASRVGPRVSVACFFTTGHSLSSRVYGPIKELLSEDNPARYRETTV  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  H++A GL G S+LL F +
Sbjct  343  KDFSVHYNATGLGGKSSLLDFMI  365



>ref|XP_004246493.2| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=367

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 212/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V++ ++ G+  F EQDTEVKK+WYTR L +  ++NSNFDL+ AP  NWRDT    +AP 
Sbjct  106  HVMDAMKDGVTRFFEQDTEVKKQWYTRDLNKEFTFNSNFDLFRAPVTNWRDTFRATIAPI  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P QLP VC DIL++Y+ +V KLG  LFEL+SEA+GL PN+L ++ C +GL  LG YY
Sbjct  166  PLKPEQLPSVCRDILLEYTNQVMKLGETLFELVSEAVGLEPNHLKDMGCAEGLLALGQYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGTSKHADNDF T+LLQ D+IGGLQVLHQ+ W DV   PGALVVNIGDLLQ
Sbjct  226  PACPQPELTLGTSKHADNDFLTVLLQ-DNIGGLQVLHQSHWVDVPPTPGALVVNIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS +HRVLAN+ GPRVS+ACFF T  + + R+YGPIKEL+SE+NPPKYRETT+
Sbjct  285  LITNDKFKSVDHRVLANKVGPRVSLACFFMTNCMTTHRMYGPIKELISEQNPPKYRETTI  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KE+  +F+ KGLDGTS LLHFRL
Sbjct  345  KEFTTYFNNKGLDGTSTLLHFRL  367



>emb|CDO99200.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/260 (67%), Positives = 209/260 (80%), Gaps = 6/260 (2%)
 Frame = -1

Query  867  GIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpphphqlp  688
            G+R F++QDTEVKK WYTR  ++ V YNSNFDL++APSANWRDT +  MAP  P   +LP
Sbjct  4    GVRRFYDQDTEVKKRWYTRDGSKTVVYNSNFDLFSAPSANWRDTSYVNMAPKVPRADELP  63

Query  687  PVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPEPDL  508
              CSDILIKYS  ++KLG  LFELLSEALGL PN+LN+I C++GL++L H YPACPEP+L
Sbjct  64   EACSDILIKYSGYIKKLGRSLFELLSEALGLKPNHLNDIGCSEGLAVLYHCYPACPEPEL  123

Query  507  TLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ-----LVS  343
            TLG +KHAD DF T+LLQ D  GGLQ+L++NQW DV   PGALVVN+GDLLQ     L+S
Sbjct  124  TLGATKHADYDFMTVLLQ-DHTGGLQILYENQWVDVPPVPGALVVNVGDLLQARYQSLIS  182

Query  342  NDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKEY  163
            ND+F SS+HRVLAN+ GPRVSVACFF T   PSS+ YGPIKELLSE+NPP+YRETT+K+Y
Sbjct  183  NDKFNSSQHRVLANRAGPRVSVACFFTTGLAPSSKRYGPIKELLSEDNPPRYRETTVKDY  242

Query  162  EDHFHAKGLDGTSALLHFRL  103
              H++AKGL  TSALL FR+
Sbjct  243  SLHYNAKGLGTTSALLDFRI  262



>ref|XP_004297996.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Fragaria vesca subsp. vesca]
Length=637

 Score =   359 bits (922),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 221/264 (84%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE+++G+ GFHEQDTEVKK++YTR  +   V YNSNFDLY+AP+ NWRD+  C MAP
Sbjct  375  DVLEEMKKGVLGFHEQDTEVKKQFYTRDHSSSPVIYNSNFDLYSAPATNWRDSFLCYMAP  434

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             PP    LP VC +IL++YSK+V KLG +LFELLSEALGL P++LN+I+C++GL +LGHY
Sbjct  435  IPPKIEDLPEVCREILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDIDCSEGLLVLGHY  494

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CP+P+LT+GTSKHADN+F ++LLQDD IGGLQV HQN+W DV   PGALVVNIGDL+
Sbjct  495  YPPCPQPELTMGTSKHADNNFMSVLLQDD-IGGLQVFHQNKWIDVPHVPGALVVNIGDLI  553

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND FKS EHRV+AN+ GPRVSVA FF+T   PS++++GPIKELLSE+NPPKYRETT
Sbjct  554  QLISNDIFKSVEHRVMANRRGPRVSVASFFSTGVRPSTKLFGPIKELLSEDNPPKYRETT  613

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            L+++  ++  KGL+G SAL HF+L
Sbjct  614  LRDFNVYYREKGLNGKSALSHFKL  637


 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  672  ILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPEPDLTLGTS  493
            IL++YS +V KLG +LF+LLSE+LGL  ++LN+I+C++GL ++GHYYPACP+P+LTLGTS
Sbjct  66   ILVEYSNQVIKLGKLLFKLLSESLGLKRSHLNDIDCSEGLLVIGHYYPACPQPELTLGTS  125

Query  492  KHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLVSNDRFKSSEHR  313
            KHADN F TILLQD+ IGGLQVLH N+W DV   PG+LVVNIGD LQL+SND+FKS EHR
Sbjct  126  KHADNTFITILLQDN-IGGLQVLHHNKWIDVPPVPGSLVVNIGDFLQLISNDKFKSVEHR  184

Query  312  VLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKEYEDHFHAKGLD  133
            VLAN  GPR+SVA FF+T  +  +++YGPIKELLSEENPPKYRETT+++Y  ++  KGLD
Sbjct  185  VLANCRGPRISVAGFFSTGLLQLAKLYGPIKELLSEENPPKYRETTVRDYNAYYRGKGLD  244

Query  132  G  130
            G
Sbjct  245  G  245



>ref|XP_010274816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=411

 Score =   352 bits (903),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 214/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL E+  GIR FHEQD EVKKE+Y R  TR V +NSNFDLY + +ANWRDTL CVMAP+
Sbjct  150  SVLHEMIEGIRRFHEQDIEVKKEFYIRDPTRKVRFNSNFDLYRSRAANWRDTLLCVMAPH  209

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP VC D +++YSK+V  LG  LFELLSEALGL+ NYL +I C +G  ++ HYY
Sbjct  210  PPSLEELPLVCRDAVMEYSKQVASLGLTLFELLSEALGLNKNYLRDIGCAEGHVLINHYY  269

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLTLG SKH+D+DFFT+LLQ D IGGLQV H++QW DV   PGALV+N+GDLLQ
Sbjct  270  PACPEPDLTLGISKHSDSDFFTLLLQ-DSIGGLQVRHEDQWVDVLPIPGALVINMGDLLQ  328

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRV+A + GPR+SVACFF T+  PS+R+YGPIKELLSEENPP YRETT+
Sbjct  329  LISNDRFKSVEHRVVAKRVGPRISVACFFGTHLQPSTRIYGPIKELLSEENPPVYRETTV  388

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y +++++KGL G +AL HF+L
Sbjct  389  QDYVEYYNSKGLGGGTALSHFKL  411



>ref|XP_010680231.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=351

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/263 (68%), Positives = 212/263 (81%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            VLE+I +G+RGF+EQ+ EVKK +Y+R  + R ++YNSNFDLYT P+ANWRDT   +MAP+
Sbjct  90   VLEDILKGVRGFYEQNDEVKKSYYSRDYSNRKLTYNSNFDLYTGPAANWRDTFGVMMAPD  149

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLPP C +ILI YS  + ++G +LFELLSEALGL  NYLN I C +GL++ GHYY
Sbjct  150  PPLPEQLPPPCREILINYSSHMMRVGRLLFELLSEALGLEANYLNKIGCTEGLNVTGHYY  209

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGTSKHADN F T+LLQD  IGGLQVLHQN W D+   PGALVVNIGDLLQ
Sbjct  210  PACPQPELTLGTSKHADNVFLTLLLQDQ-IGGLQVLHQNHWVDIPPTPGALVVNIGDLLQ  268

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND FKS+EHRVLAN  GPR+SVA FF T  + +SR YGPIKELLS  NPPKYRETT+
Sbjct  269  LISNDIFKSAEHRVLANIRGPRISVASFFTTLFLDTSRRYGPIKELLSPSNPPKYRETTV  328

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY  +F  KGLDGTSAL HF++
Sbjct  329  KEYTTYFLNKGLDGTSALPHFKI  351



>ref|XP_008354408.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Malus domestica]
Length=375

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 212/263 (81%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLE I+ G+RGF  QDT VK E+YTR  ++ + YN NFDLY++ + NWRDT  C MAP P
Sbjct  112  VLEAIKXGVRGFXXQDTRVKXEFYTRDHSKPLXYNXNFDLYSSXAXNWRDTXXCYMAPXP  171

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP VC D+LI YSK V +LG +LFELLSEALGL P++LN I C+KGL +LGHYYP
Sbjct  172  PKPEDLPEVCRDVLIXYSKRVMELGKLLFELLSEALGLKPSHLNXIXCSKGLQVLGHYYP  231

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVL-HQNQWFDVHAYPGALVVNIGDLLQ  352
            ACP+P+LTLGTSKHAD+ F T+ LQ D IGGLQV+  QN+W DV   PGALVVNIGDLLQ
Sbjct  232  ACPQPELTLGTSKHADDSFLTVXLQ-DHIGGLQVVXRQNKWIDVPPVPGALVVNIGDLLQ  290

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRVLAN++GPR+S A FF+T  +P + +YGPIKEL+SE+NPPKYRETT+
Sbjct  291  LISNDRFKSXEHRVLANREGPRISXASFFSTGLLPFTNLYGPIKELVSEDNPPKYRETTV  350

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y+ HF+ KGLDGTSAL HF++
Sbjct  351  RDYDTHFYDKGLDGTSALSHFKI  373



>ref|XP_006283978.1| hypothetical protein CARUB_v10005101mg [Capsella rubella]
 gb|EOA16876.1| hypothetical protein CARUB_v10005101mg [Capsella rubella]
Length=365

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/265 (65%), Positives = 215/265 (81%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMAp  715
            ++LE+++ G+R FHEQ  EVKKE Y+R +TR    Y+SNFDLYT+P+ANWRDT+ C MAP
Sbjct  102  DLLEKMKDGVREFHEQSPEVKKELYSRDITRQKFHYSSNFDLYTSPAANWRDTVTCFMAP  161

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP+P  LP +  D++I+YSK+V  LG  LF LLSEALGL+PN+LN+++C KGL +LGHY
Sbjct  162  DPPNPQDLPEMLRDVMIEYSKQVMSLGKFLFTLLSEALGLNPNHLNDMDCAKGLIMLGHY  221

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEPDLTLGTS+HAD  F T+LLQ D IGGLQVL +  WFDV   PGAL++NIGDLL
Sbjct  222  YPTCPEPDLTLGTSQHADTSFLTVLLQ-DQIGGLQVLQEGYWFDVPHVPGALIINIGDLL  280

Query  354  QLVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            QL+SND F SSEHRVLAN+    R+SVACFF T   P+  +YGPI+E++SEENPPKYRET
Sbjct  281  QLISNDNFVSSEHRVLANRASKARISVACFFFTAMTPNPTLYGPIREIVSEENPPKYRET  340

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY  HF+AKGLDGTSALLHF++
Sbjct  341  TIKEYTAHFNAKGLDGTSALLHFKI  365



>ref|XP_011040547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=368

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+  FHEQ++EVKKEWY+R  TR V YNSNFDLY AP+ANWRDTL CVMAP 
Sbjct  105  SVLEEMISGVARFHEQESEVKKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPR  164

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP  C DI+I YS +V  L   LFELLSEALGL PNYL +I C +GL  LGHYY
Sbjct  165  QPNPQDLPHACRDIMIDYSNKVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYY  224

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT GTS H+D+ F T+LLQ D IGGLQVLH+NQW DV+  PGALV+N+GD+ Q
Sbjct  225  PACPEPDLTFGTSSHSDSSFLTVLLQ-DQIGGLQVLHENQWVDVNPIPGALVINLGDMFQ  283

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRET  178
            L+SNDRF S +HRVLA   GPR+SVACF   +  P  +SR+YGPIKELLSEE+P  YRET
Sbjct  284  LISNDRFISVQHRVLAKTVGPRISVACFIRQHLPPENASRLYGPIKELLSEESPAIYRET  343

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+   H++AKGLDG SAL HF+L
Sbjct  344  TVKDLVTHYYAKGLDGISALEHFKL  368



>ref|XP_011091187.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Sesamum indicum]
Length=365

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/264 (65%), Positives = 216/264 (82%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            G+VLEE+  G+R F+EQD E +K+WYTR   R V YNSNFDLY+AP+ANWRDT FC MAP
Sbjct  103  GSVLEEMLDGVRKFYEQDPEERKKWYTRDRKRSVVYNSNFDLYSAPAANWRDTFFCKMAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP P +LP VC DI+ +Y+K+V KLG  LF+LLSEALGL  N+L +++C  GL++L HY
Sbjct  163  HPPSPEELPAVCRDIMFEYTKQVLKLGTSLFKLLSEALGLDANHLGDMKCADGLALLCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CP+P+LT+G S+HAD+DF T+LL +D++ GLQVL+QNQWFDV + PG+LVVN+GDLL
Sbjct  223  YPFCPQPELTMGASQHADSDFLTVLL-NDNVTGLQVLYQNQWFDVPSVPGSLVVNVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SNDR  SSEHRVLAN    RVSVACFF +    S  +YGPI+ELLSE+NPPKYR TT
Sbjct  282  QLISNDRLISSEHRVLANNVRSRVSVACFFRSDIDKSDELYGPIQELLSEDNPPKYRATT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KEY ++++AKGLDGTSALLHFR+
Sbjct  342  MKEYVNYYNAKGLDGTSALLHFRV  365



>ref|XP_010262283.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262284.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262285.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262286.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=374

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVL+E+ +G+RGF+EQD EVKK++YTR L R + YNSN  LY +P+ANWRD+ +C MAP 
Sbjct  112  NVLDEMLQGVRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPE  171

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DI+++YSK+V+KLG  LFELLSEAL L   +L +I C +G ++L HYY
Sbjct  172  PPQPEDLPAVCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYY  231

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CPEP+LT+GTSKHADNDF T+LLQ D+IGGLQVL + QW DV   PGAL+VN+GDLLQ
Sbjct  232  PSCPEPELTMGTSKHADNDFLTVLLQ-DNIGGLQVLREKQWVDVLPMPGALIVNVGDLLQ  290

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYA-VPSSRVYGPIKELLSEENPPKYRETT  175
            L+SNDRFKS EHRVLAN+ GPRVSVACFF T     S ++YGPIKELLSEENPP YRETT
Sbjct  291  LISNDRFKSVEHRVLANRIGPRVSVACFFTTPVNQASGKLYGPIKELLSEENPPIYRETT  350

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  HF AKGLDG SAL  F+L
Sbjct  351  VQEYTKHFVAKGLDGNSALTRFKL  374



>ref|XP_006354512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=375

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 217/265 (82%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +V+E + +G R F EQD ++KK++YTR  T+ V + SNFDLY+   P+ NWRD++FC+MA
Sbjct  110  SVMEVMLQGTRRFFEQDVDIKKQYYTRDNTKKVVHVSNFDLYSPSVPATNWRDSIFCLMA  169

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            PN P P +LP  C +IL+++S  V  LG  LFELLSE LGL P++LNNI+C++GL +LGH
Sbjct  170  PNHPSPEELPIACREILMEFSNHVMTLGKSLFELLSEGLGLDPSHLNNIDCSEGLRVLGH  229

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+LT+GT+KH+DNDF T+LLQD  IGGLQVLH+ QW DV   PGALVVNIGDL
Sbjct  230  YYPACPQPELTIGTNKHSDNDFITVLLQDQ-IGGLQVLHKTQWIDVPPTPGALVVNIGDL  288

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++ S EHRVL+N+ GPR+SVACFF T ++PSS++YGPI ELLSE+NPPKYR T
Sbjct  289  LQLISNDKYLSVEHRVLSNKVGPRISVACFFYTGSMPSSKLYGPITELLSEDNPPKYRAT  348

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+Y D+F  KGLDGTSALLH+++
Sbjct  349  TVKDYADYFREKGLDGTSALLHYKI  373



>ref|XP_002317688.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
 gb|EEE98300.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
Length=368

 Score =   346 bits (887),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/265 (66%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+  FHEQD+EVKKEWY+R  TR V YNSNFDLY AP+ANWRDTL CVMAP 
Sbjct  105  SVLEEMIGGVARFHEQDSEVKKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPR  164

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+PH LP VC DI+  YS +V  L   LFELLSEALGL PNYL +I C +GL  LGHYY
Sbjct  165  QPNPHDLPDVCRDIMNDYSNKVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYY  224

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT GTS H+D+ F T+L+Q D IGGLQVLH+NQW D++  PGALV+N+GD+LQ
Sbjct  225  PACPEPDLTFGTSSHSDSSFLTVLVQ-DQIGGLQVLHENQWVDLNPIPGALVINLGDMLQ  283

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRET  178
            L+SNDRF S +HRVLA   GPR+SVACF   +  P  +SR+YGPIKELLSEE+P  YRET
Sbjct  284  LISNDRFISVQHRVLARTVGPRISVACFIRQHLPPENASRLYGPIKELLSEESPAIYRET  343

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+   H++AKGLDG SAL HF+L
Sbjct  344  TVKDLVTHYYAKGLDGISALEHFKL  368



>ref|XP_011073515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   345 bits (885),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 215/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE+  G+R F+EQ+TE+KK++Y+R  T+ V++N NFDL+++P+ANWRDT++CV++PN
Sbjct  111  SMLEEMLDGVRRFNEQETEIKKQFYSRDSTKKVTFNCNFDLFSSPAANWRDTIYCVISPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P +LP VC DI+I+YSK+V +LG  LF+L+SE+LGL P++L  +EC + L+++GHYY
Sbjct  171  PAQPEELPTVCRDIIIEYSKQVIRLGRCLFKLMSESLGLSPDHLIEMECAESLALIGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT G SKH+DN+F T+LLQ D++GGLQV HQNQW DV   PGALVVNIGDL Q
Sbjct  231  PPCPEPDLTFGISKHSDNNFITVLLQ-DNLGGLQVRHQNQWVDVPPLPGALVVNIGDLFQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LVSND+ KS EHRVLA+  GPR+SVA FF   + PSS+VY P+KELLSE++PPKYR TT 
Sbjct  290  LVSNDKLKSVEHRVLASNAGPRISVASFFGRDSGPSSKVYAPMKELLSEDDPPKYRPTTA  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY + F AKGL GTSALLHFRL
Sbjct  350  NEYTEFFRAKGLGGTSALLHFRL  372



>gb|KHG16548.1| hypothetical protein F383_20832 [Gossypium arboreum]
Length=370

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 210/263 (80%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+    RGFHE  +EVKK +YTR  T+ V Y SNFDLY +  ANWRDTLFCVM P 
Sbjct  107  SVLEEMLAAARGFHELPSEVKKSYYTREKTKKVIYGSNFDLYESRFANWRDTLFCVMGPE  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P HP QLP VC DI ++YSK++ KLG  LF+LLS+A+GL P++L  ++C+KG  +L HYY
Sbjct  167  PLHPQQLPLVCRDITMEYSKQIHKLGTTLFKLLSKAIGLTPDHLIGLDCSKGHCLLSHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGT+KH+D DF TILLQ D IGGLQV HQNQWFDV   PGALVVNIGDLLQ
Sbjct  227  PACPEPELTLGTAKHSDPDFLTILLQ-DHIGGLQVFHQNQWFDVPFLPGALVVNIGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+ KS EH+VLAN+ GPRVSVACFF  +  PS+R+YGPIKELLS+ENPP YRETT+
Sbjct  286  LISNDKLKSVEHQVLANEKGPRVSVACFFTPHLYPSTRIYGPIKELLSKENPPLYRETTV  345

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++  ++ +KGLD  SAL HF+L
Sbjct  346  EDFISYYDSKGLDEKSALAHFKL  368



>ref|XP_007035060.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05986.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 209/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+EE+  G+R F EQD E KK+ ++R  T+ V YNSNFDLY+AP+A WRDT+FC MAPN
Sbjct  113  SVMEEMMDGVRRFFEQDVEAKKQLFSRDYTKRVVYNSNFDLYSAPAAKWRDTVFCSMAPN  172

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP V  DI ++YSK++ KLG +LFELLSEALGL+P+YL +I+C KGL +L HYY
Sbjct  173  PPKPEELPTVFRDITLEYSKQIMKLGYLLFELLSEALGLNPDYLRDIDCAKGLVMLCHYY  232

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLG+SKHADN F T+LLQ D +GGLQVLH+N W DV   PGALV+NIGDLLQ
Sbjct  233  PICPQPELTLGSSKHADNGFLTVLLQ-DHVGGLQVLHENHWIDVPPAPGALVINIGDLLQ  291

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND   S  HRVL N  GPRVSVA FF T  +P +R+YGPIKELLSEENP KYRETT+
Sbjct  292  LISNDSCTSVAHRVLTNSVGPRVSVASFFTTALLPDARLYGPIKELLSEENPSKYRETTV  351

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  +F+AKGL GTS L HFRL
Sbjct  352  KDYITYFNAKGLSGTSPLPHFRL  374



>gb|AET01263.2| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=400

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 213/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+E++ G+  F EQD+EVK+E YTR   + + YNSNFDLY++P+A WRDT +C MAPN
Sbjct  136  SVLDEMKNGVVRFFEQDSEVKRELYTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPN  195

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP VC DI+++Y+K+V KLG +LFELLSEALGL PNYLN + CN+GL+++ HYY
Sbjct  196  SPNPEDLPSVCRDIMLEYTKQVMKLGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYY  255

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CPEP+LTLG +KH DNDF T+LLQ D IGGLQVL +N W DV   PGALV+NIGDLLQ
Sbjct  256  PSCPEPELTLGITKHTDNDFITVLLQ-DHIGGLQVLRENSWVDVSPVPGALVINIGDLLQ  314

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRV+AN  GPRVSVA F++T   PS+++YGPIKEL+SE+NPPKYRETT+
Sbjct  315  LITNDKFKSVEHRVVANHVGPRVSVASFYSTSFQPSTKLYGPIKELVSEDNPPKYRETTV  374

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y     A+GLDGTS L +F++
Sbjct  375  HDYVSFSMARGLDGTSPLPYFKI  397



>ref|XP_010026850.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60392.1| hypothetical protein EUGRSUZ_H03108 [Eucalyptus grandis]
Length=371

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 205/265 (77%), Gaps = 4/265 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R FHEQ  E KK +Y+R  T  V+Y+SNF+LY   +ANWRDTLFCVMAPN
Sbjct  109  TVLEEMLDGVRRFHEQGAEEKKRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                  LP VC DI++++SK V  LG  LFELLSEALGL PN+L ++EC KGL +L  YY
Sbjct  169  ALEAEDLPAVCGDIMLEFSKRVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LT+GTS+H D+DF T+LLQ D +GGLQVL+QNQW DV   PGAL+VNIGDLLQ
Sbjct  229  PKCPQPELTMGTSRHTDSDFLTVLLQ-DHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND FKSSEHRV+AN  GPRVSVACFF T   PS ++YGPIKEL+SE +PPKYRETT+
Sbjct  288  LISNDIFKSSEHRVVANNMGPRVSVACFFYTATPPSPKLYGPIKELISEGDPPKYRETTI  347

Query  171  KEYEDHF--HAKGLDGTSALLHFRL  103
             EY  HF  +AKG DGTSAL  F+L
Sbjct  348  MEYVSHFSANAKG-DGTSALQQFKL  371



>ref|XP_003626787.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 213/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+E++ G+  F EQD+EVK+E YTR   + + YNSNFDLY++P+A WRDT +C MAPN
Sbjct  100  SVLDEMKNGVVRFFEQDSEVKRELYTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPN  159

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP VC DI+++Y+K+V KLG +LFELLSEALGL PNYLN + CN+GL+++ HYY
Sbjct  160  SPNPEDLPSVCRDIMLEYTKQVMKLGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYY  219

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CPEP+LTLG +KH DNDF T+LLQ D IGGLQVL +N W DV   PGALV+NIGDLLQ
Sbjct  220  PSCPEPELTLGITKHTDNDFITVLLQ-DHIGGLQVLRENSWVDVSPVPGALVINIGDLLQ  278

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRV+AN  GPRVSVA F++T   PS+++YGPIKEL+SE+NPPKYRETT+
Sbjct  279  LITNDKFKSVEHRVVANHVGPRVSVASFYSTSFQPSTKLYGPIKELVSEDNPPKYRETTV  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y     A+GLDGTS L +F++
Sbjct  339  HDYVSFSMARGLDGTSPLPYFKI  361



>ref|XP_010556890.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=361

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 208/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G+R FHE+D E KK +++R  T  + YNSNFDLY++PSANWRDTL C +AP+
Sbjct  100  SVLEEMKDGVRRFHEEDLEAKKRYFSRDYTNRLGYNSNFDLYSSPSANWRDTLSCYIAPD  159

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  +P  C D++++YSK V  LG +LFELLSEALGL+P  L +++C KGL +L HYY
Sbjct  160  PPKPEDMPDSCRDVMMEYSKHVMNLGNLLFELLSEALGLNPETLKDMDCAKGLFVLSHYY  219

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLGTSKH D+ F T+LLQ D IGGLQV HQ+ W DV   PGALVVN GD LQ
Sbjct  220  PPCPQPDLTLGTSKHTDSSFITVLLQ-DHIGGLQVSHQDCWVDVPPVPGALVVNFGDFLQ  278

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S+EHRVLAN+ GPR+SVACFF+T  +P+ RVYGPIKELLSEENPPKYR+ T+
Sbjct  279  LLTNDKFISAEHRVLANRAGPRISVACFFSTGVLPNPRVYGPIKELLSEENPPKYRDMTI  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KGLDGTS L HFR+
Sbjct  339  TEYTSKYISKGLDGTSQLRHFRI  361



>ref|XP_002315713.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
 gb|EEF01884.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
Length=379

 Score =   343 bits (881),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 212/269 (79%), Gaps = 8/269 (3%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+  G+R F EQD EVKK++YTR +T+   YNSNFDL+TAP ANWRDT F  MAP P
Sbjct  112  VLEEMDAGVRRFFEQDVEVKKKFYTRDVTKRFVYNSNFDLHTAPVANWRDTFFSYMAPYP  171

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C DI++++SK+V  LG  LF LLSEALGL  ++L  ++C +GL+++ HYYP
Sbjct  172  PKPEELPGACRDIMMEFSKQVTSLGISLFGLLSEALGLKTDHLEKMDCAEGLALISHYYP  231

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ-  352
            ACPEP+LTLGTSKH+DNDF T+LLQ D IGGLQ+LHQ+QW D+   PGALV+NIGDL+Q 
Sbjct  232  ACPEPELTLGTSKHSDNDFLTVLLQ-DQIGGLQMLHQDQWVDIPPVPGALVINIGDLMQA  290

Query  351  ------LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPK  190
                  L+SND+FKS EHRVLAN+ GPR+SVACFF+T   PSS++YGPIKELLSE NPP 
Sbjct  291  SFSFISLISNDKFKSVEHRVLANRVGPRISVACFFSTSFQPSSKLYGPIKELLSEYNPPI  350

Query  189  YRETTLKEYEDHFHAKGLDGTSALLHFRL  103
            YRETT+ EY  +F+  GLDGTS L+HF+L
Sbjct  351  YRETTVNEYLSYFYDHGLDGTSPLIHFKL  379



>ref|XP_010023989.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60402.1| hypothetical protein EUGRSUZ_H03120 [Eucalyptus grandis]
Length=371

 Score =   343 bits (879),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 205/265 (77%), Gaps = 4/265 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R FHEQ  E K+ +Y+R  T  V+Y+SNF+LY   +ANWRDTLFCVMAPN
Sbjct  109  TVLEEMLDGVRRFHEQGAEEKRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                  LP VC DI++++SK V  LG  LFELLSEALGL PN+L ++EC KGL +L  YY
Sbjct  169  ALEAEDLPAVCGDIMLEFSKRVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LT+GTS+H D+DF T+LLQ D +GGLQVL+QNQW DV   PGAL+VNIGDLLQ
Sbjct  229  PKCPQPELTMGTSRHTDSDFLTVLLQ-DHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND FKSSEHRV+AN  GPRVSVACFF T   PS ++YGPIKEL+SE +PPKYRETT+
Sbjct  288  LISNDIFKSSEHRVVANNMGPRVSVACFFYTATPPSPKLYGPIKELISEGDPPKYRETTI  347

Query  171  KEYEDHF--HAKGLDGTSALLHFRL  103
             EY  HF  +AKG DGTSAL  F+L
Sbjct  348  MEYVSHFSANAKG-DGTSALQQFKL  371



>ref|XP_007149297.1| hypothetical protein PHAVU_005G058400g [Phaseolus vulgaris]
 gb|ESW21291.1| hypothetical protein PHAVU_005G058400g [Phaseolus vulgaris]
Length=367

 Score =   342 bits (878),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 211/263 (80%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLE+++ G+  F+EQDTEVKK+ YTR   +   YNSNFD+Y++P+ NWRDT FC +APN
Sbjct  106  TVLEDLKDGVCRFYEQDTEVKKDLYTRDQMKPFLYNSNFDIYSSPALNWRDTFFCYLAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y   V KLG  LFELLSE+LGLHPN+L +++C KGL  L HYY
Sbjct  166  PPKPQDLPVVCRDILLEYGTCVMKLGIALFELLSESLGLHPNHLKDMDCAKGLISLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGT+KH+DN F T+LLQ D IGGLQVL+QN W D+   PGALVVNIGDLLQ
Sbjct  226  PACPEPELTLGTTKHSDNCFLTVLLQ-DHIGGLQVLYQNTWIDIAPEPGALVVNIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRF+S EHRV+AN  GPR+SVACFF+     S ++YGPIKELLSE+NPPKYRETT+
Sbjct  285  LITNDRFRSVEHRVVANVTGPRISVACFFSEGLKSSGKLYGPIKELLSEDNPPKYRETTV  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F+ KGLDGTSAL HFR+
Sbjct  345  EEYVRYFNEKGLDGTSALHHFRI  367



>ref|XP_011091183.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Sesamum indicum]
Length=401

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 210/262 (80%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+ RG+R F+EQD  VKK++YTR ++R   +NSNFDLY +P+ANWRDT FC MAP P
Sbjct  141  VLEEMLRGVRRFNEQDVGVKKQFYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTP  200

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C DI I+YS+ V  LG  LF LLSEALGL  + L N++C  GL+ +GHYYP
Sbjct  201  PQPQELPASCRDIQIEYSRHVMTLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYP  260

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            +CP+P+LTLG SKH D+ F T++LQD  IGGLQ+  +NQW DV   PGALV+NIGDLLQL
Sbjct  261  SCPQPELTLGASKHTDDGFLTVVLQDH-IGGLQIFAENQWIDVPPVPGALVINIGDLLQL  319

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRVLAN++GPRVSVACFF+T  +PSS++YGPI++LLSE+NP KYRETT++
Sbjct  320  ISNDKFKSVEHRVLANREGPRVSVACFFSTALMPSSKLYGPIQDLLSEDNPAKYRETTVE  379

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  + +AKGLDG S LLHF++
Sbjct  380  EFFSYSYAKGLDGVSPLLHFKI  401



>ref|XP_011091184.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Sesamum indicum]
Length=373

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 210/262 (80%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+ RG+R F+EQD  VKK++YTR ++R   +NSNFDLY +P+ANWRDT FC MAP P
Sbjct  113  VLEEMLRGVRRFNEQDVGVKKQFYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTP  172

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C DI I+YS+ V  LG  LF LLSEALGL  + L N++C  GL+ +GHYYP
Sbjct  173  PQPQELPASCRDIQIEYSRHVMTLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYP  232

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            +CP+P+LTLG SKH D+ F T++LQD  IGGLQ+  +NQW DV   PGALV+NIGDLLQL
Sbjct  233  SCPQPELTLGASKHTDDGFLTVVLQDH-IGGLQIFAENQWIDVPPVPGALVINIGDLLQL  291

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRVLAN++GPRVSVACFF+T  +PSS++YGPI++LLSE+NP KYRETT++
Sbjct  292  ISNDKFKSVEHRVLANREGPRVSVACFFSTALMPSSKLYGPIQDLLSEDNPAKYRETTVE  351

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            E+  + +AKGLDG S LLHF++
Sbjct  352  EFFSYSYAKGLDGVSPLLHFKI  373



>ref|XP_003626788.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01264.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 212/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G++ FHE +T+ KKE+YTR L     Y SNFDLY++P+ NWRDT  C +AP+
Sbjct  103  SVLEEMKDGVKRFHEMETDAKKEFYTRDLHGSFIYKSNFDLYSSPALNWRDTCTCSLAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P   P VC DIL++Y K+V  LG +LFELLS+ALGL+PN+L ++ C +GL  L HYY
Sbjct  163  TPKPEDFPVVCRDILLEYGKQVMNLGTLLFELLSQALGLNPNHLKDMGCAEGLIALCHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GT+KH DNDF T+LLQ D IGGLQVL++++W D+   PGALVVN+GDLLQ
Sbjct  223  PPCPEPELTVGTTKHCDNDFLTVLLQ-DHIGGLQVLYEDKWIDITPVPGALVVNVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRV+ANQ GPR+SVACFF+T   PSS++YGP+KELLSE NPPKYRETT+
Sbjct  282  LITNDRFKSVEHRVVANQVGPRISVACFFSTGLRPSSKLYGPMKELLSENNPPKYRETTV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             ++  +F+AKGLDGTSAL H+++
Sbjct  342  ADFAAYFNAKGLDGTSALTHYKI  364



>ref|XP_007035057.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05983.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 208/262 (79%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLE+++  +R F EQD EV+K++YTR   + V YN NFDL+TAP+ANWRD++FC MAP+P
Sbjct  111  VLEDMKHSVRRFFEQDVEVRKQFYTRDNMKTVVYNCNFDLHTAPAANWRDSVFCTMAPDP  170

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P   +LP    DI+++YS  +  LG +LFEL+SEALGL+P++L  I+C KGL +L HYYP
Sbjct  171  PKLEELPESFRDIMVEYSNRLMSLGYLLFELISEALGLNPDHLVKIDCAKGLGVLCHYYP  230

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLG SKHAD+DF T+LLQD  +G LQVLH NQW DV   PGALVVNIGDLLQL
Sbjct  231  ACPQPELTLGASKHADSDFLTVLLQDH-VGALQVLHGNQWIDVPPTPGALVVNIGDLLQL  289

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDR  S EHRVLAN  GPRVSVA FF T   P+ R+YGPIKELL+E+NPPKYRETT+ 
Sbjct  290  ISNDRLLSVEHRVLANSVGPRVSVAGFFVTGFRPNPRLYGPIKELLTEDNPPKYRETTVI  349

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            +Y  HF+ KGLDGTSALLHFRL
Sbjct  350  DYLKHFNGKGLDGTSALLHFRL  371



>ref|XP_008224379.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=368

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/263 (69%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+RGF EQDTEVKK+ YTR   R V YNSNFDLY AP+ NWRDT  C MAP 
Sbjct  107  SVLEEIKDGVRGFFEQDTEVKKKVYTRDYFRPVIYNSNFDLYKAPATNWRDTFICYMAPY  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
               P  LP VC DILI+YSK++ +LG +L ELLSEALGL P++LN+I+C++GL +L HYY
Sbjct  167  AKKPEDLPEVCRDILIEYSKQIMRLGKLLLELLSEALGLTPSHLNDIDCSEGLVLLCHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGTSKHAD+DF T+LLQ D IGGLQVLH+N+W DV   PGALVVN+GDLLQ
Sbjct  227  PACPQPELTLGTSKHADSDFLTVLLQ-DHIGGLQVLHKNKWIDVPPMPGALVVNVGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN+RFKS EHRVLAN+ GPRVSVA FF T  +P  ++YGPIKELLSE+NPPKYRETT+
Sbjct  286  LISNERFKSVEHRVLANRVGPRVSVASFFTTGMLPLKKLYGPIKELLSEDNPPKYRETTV  345

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  H + KGLDGTSAL HF+L
Sbjct  346  KDYNAHVNIKGLDGTSALNHFKL  368



>gb|AES66420.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=372

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 202/263 (77%), Gaps = 0/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLE+++ G++ F EQDTEVKKE YTR  TR + YNSNFDLY +P+ NWRDT  C  A N
Sbjct  110  NVLEDMKDGVKRFFEQDTEVKKEMYTRDRTRPLVYNSNFDLYRSPALNWRDTFICDFAVN  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                  LP VC DIL++Y   + KLG VLFELLSEALGLHPN+L +++C +G  I+GHYY
Sbjct  170  ASKLEDLPVVCRDILMEYGTCLMKLGRVLFELLSEALGLHPNHLKDLDCCEGNMIIGHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT+GT+KH+D  F T+LLQD  IGGLQVLHQ++W DV   PGALVVNIGDLLQ
Sbjct  230  PACPEPDLTMGTTKHSDVSFLTVLLQDRIIGGLQVLHQDKWIDVPPVPGALVVNIGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN  GPR+SVACFF        ++YGPI ELLSE NPP+Y+ETT+
Sbjct  290  LITNDKFKSVEHRVLANGIGPRISVACFFKAGLRAHKKLYGPITELLSENNPPRYKETTV  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             ++  + +AKGLDGTS L  F+L
Sbjct  350  ADFIAYVYAKGLDGTSVLQDFKL  372



>ref|XP_007035064.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOY05990.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=369

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/264 (65%), Positives = 209/264 (79%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             ++LEE++ G++ F EQD EVKKE+Y R   R   Y SNFDLYT+P ANWRDT FCVMAP
Sbjct  107  SSILEEMKDGVQRFFEQDIEVKKEFYARDRVRRYRYTSNFDLYTSPFANWRDTCFCVMAP  166

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP P +LP V  DI ++Y K+V +LG  LF+LLSEALGL P++L  + C +GLS L HY
Sbjct  167  DPPKPEELPAVLRDIQLEYRKQVIRLGSSLFKLLSEALGLKPSHLEEMGCAEGLSALCHY  226

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LTLGTSKH+DNDF T+LLQ D IGGLQVLHQ+QW DV   PGALVVNIGDLL
Sbjct  227  YPPCPEPELTLGTSKHSDNDFLTVLLQ-DQIGGLQVLHQDQWVDVPPVPGALVVNIGDLL  285

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++ND+FKS EHRVLAN++GPR+SVACFF T  +PSSR+YGPI+ELL E NPP YRETT
Sbjct  286  QLITNDKFKSVEHRVLANREGPRISVACFFTTGLLPSSRLYGPIEELLLENNPPIYRETT  345

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++++  + +  GLDGTS L  FRL
Sbjct  346  VRDFVSYIYEHGLDGTSPLHLFRL  369



>ref|XP_007035072.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY05998.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=369

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL+E+    RGFHE   EVK+ +YTR     V Y SNFDLY +  ANWRDTLFCVM P P
Sbjct  107  VLDEMLAAARGFHELPREVKEGYYTRETMTKVKYGSNFDLYQSSYANWRDTLFCVMGPEP  166

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC DI ++YSK++ KLG  L+ELLSEALGL P++L  ++C KG  +L HYYP
Sbjct  167  LDPQELPLVCRDITMEYSKQIHKLGTTLYELLSEALGLKPDHLLGLDCPKGHCLLSHYYP  226

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACPEP+LT+GT+KH+D DF TILLQD  IGGLQV HQNQW DV + PGALVVNIGDLLQL
Sbjct  227  ACPEPELTMGTTKHSDPDFLTILLQDH-IGGLQVFHQNQWIDVPSVPGALVVNIGDLLQL  285

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SN++FKS EHRVLAN  GPRVSVACFF  +  PS+R+YGPIKELLSEENPP YRETT++
Sbjct  286  ISNEKFKSVEHRVLANHIGPRVSVACFFTPHLYPSTRIYGPIKELLSEENPPVYRETTVQ  345

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++ +++ +KGLD  SAL HF+L
Sbjct  346  DFINYYDSKGLDENSALTHFKL  367



>ref|XP_002284663.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R   + V +NSNFDLY A  ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDFQKKVRFNSNFDLYQARMANWRDSLACVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS++V KLG  LFELLSEALGL+PN+L ++EC +GL +LGHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D+DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDSDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFF-NTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+SVA FF  ++   +SR+YGPIKELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHRENNSRLYGPIKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ +KGLDG S+L HF+L
Sbjct  350  VDEFLTYYFSKGLDGNSSLPHFKL  373



>ref|XP_010457801.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
 ref|XP_010457804.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
 ref|XP_010457805.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=368

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EVKK +Y+R  +R   Y SNFDL+++P+ANWRDT  C MAPN
Sbjct  106  DLLEKMKDGVRDFHEQSPEVKKNFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP +C D+L++YS++V  LG  LFELLSEALGL+PN+L +++C+KGL +L HYY
Sbjct  166  PPEPHDLPEICRDVLMEYSQQVMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D I GLQVL +  WFDV   PGA+V+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHADNSFLTVLLP-DQIEGLQVLREGYWFDVPHVPGAIVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVL N+    RVSVACFF T  +P  RVYGPI+EL+SEENPPKYRETT
Sbjct  285  LITNDKFISLEHRVLGNKATRARVSVACFFTTGVLPDPRVYGPIRELVSEENPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  HF+ KGLDGTSALLHF++
Sbjct  345  IREYATHFNTKGLDGTSALLHFKI  368



>gb|KEH18776.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 213/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G++ F+EQDTEVKK+ YTR   +   YNSNFD+Y++P+ NWRDT  C +AP+
Sbjct  103  SVLEELKDGVKRFYEQDTEVKKDLYTRDRHKSFIYNSNFDIYSSPALNWRDTFTCYLAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  +P VC DIL++Y K ++ LG +LFEL SEALGL+PN+L +I+C +GL  LGHYY
Sbjct  163  TPKPEDIPVVCRDILLEYGKHMRNLGTLLFELCSEALGLNPNHLKDIDCAEGLLALGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GT+KH+DNDF T+LLQ D IGGLQVL+Q++W D+   PGAL+VN+GDLLQ
Sbjct  223  PPCPEPELTVGTTKHSDNDFLTVLLQ-DHIGGLQVLYQDKWIDITPVPGALIVNVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN  GPR+SVACFF T    SS++YGPIKELLSE+NPP YRET++
Sbjct  282  LITNDKFKSVEHRVLANNVGPRISVACFFCTGHRSSSKLYGPIKELLSEDNPPIYRETSV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F AKGLDGTSAL H+++
Sbjct  342  ADYVAYFEAKGLDGTSALTHYKI  364



>ref|XP_010093410.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB54016.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=377

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 214/265 (81%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ GIR FHEQ+TEVKKE+YTR  T+ V Y+SNFDLY+  S NWRDT  C MAPN
Sbjct  114  SVLEEMKVGIRRFHEQETEVKKEYYTRDPTKPVFYHSNFDLYSWISTNWRDTFICRMAPN  173

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C DILI+YSK+V ++G +LFEL+SEALGL+PN LN I+C +GL++L HYY
Sbjct  174  PPKPEDLPIACRDILIEYSKQVMEVGILLFELISEALGLNPNQLNEIDCAEGLTVLCHYY  233

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P LT+GT+KH DN F T+LLQ D+IGGLQVLH N+W DV   PG LVVNIGDLLQ
Sbjct  234  PACPQPKLTMGTTKHTDNGFLTVLLQ-DNIGGLQVLHDNKWIDVSPQPGTLVVNIGDLLQ  292

Query  351  --LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
              L+SN+RF S  H+VLAN+ GPRVSVA FF+T ++P+S++YGPIKELLSE NPPKYRET
Sbjct  293  ASLISNERFTSVRHKVLANRVGPRVSVASFFSTGSIPTSKLYGPIKELLSEGNPPKYRET  352

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+++Y  HF +KGL  TSAL  F+L
Sbjct  353  TVRDYVLHFDSKGLGRTSALDDFKL  377



>ref|XP_004510134.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Cicer arietinum]
Length=362

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 210/263 (80%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G++ F+EQ+T+VKK+ YTR   +   YNSNFD+Y++P+ NWRDT  C +AP+
Sbjct  101  SVLEEIKDGVKRFYEQNTQVKKDLYTRDRNKSFIYNSNFDIYSSPALNWRDTFMCYLAPH  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P     P VC DIL++Y K +  LG +LFELLSEALGL PN+L  ++C +GL  L HYY
Sbjct  161  TPKLEDFPIVCRDILLEYGKHMMNLGTLLFELLSEALGLKPNHLKEMDCVEGLIALCHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GT+KH+DNDF T+LLQ D IGGLQVLH+++W D+    GAL+VN+GDLLQ
Sbjct  221  PPCPEPELTVGTTKHSDNDFLTVLLQ-DHIGGLQVLHEDKWIDITPVTGALIVNVGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRV+AN+ GPR+SVACFF+T    SS++YGPIKELLSEENPPKYRETT+
Sbjct  280  LITNDKFKSVEHRVVANEVGPRISVACFFSTAYRSSSKLYGPIKELLSEENPPKYRETTV  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F AKGLDGT+AL H+++
Sbjct  340  ADYVAYFEAKGLDGTTALTHYKI  362



>ref|XP_010023981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60389.1| hypothetical protein EUGRSUZ_H03105 [Eucalyptus grandis]
Length=371

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 205/265 (77%), Gaps = 4/265 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R FHEQ  E K+ +Y+R  T  V+Y+SNF+LY   +ANWRDTLFCVMAPN
Sbjct  109  TVLEEMLDGVRRFHEQGAEEKRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP VC DI++++SK V  LG  LFELLSEALGL PN+L ++EC KGL +L  YY
Sbjct  169  APEAEDLPAVCRDIMLEFSKRVMNLGITLFELLSEALGLKPNHLKDMECAKGLVLLNQYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LT+GTS+H D+DF T+LLQ D +GGLQVL+QNQW DV   PGAL+VNIGDLLQ
Sbjct  229  PKCPQPELTMGTSRHTDSDFLTVLLQ-DHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND FKSSEHRV+AN  GPR SVACFF T   PS ++YGPIKEL+SE +PPKYRETT+
Sbjct  288  LISNDIFKSSEHRVVANNMGPRASVACFFYTATPPSPKLYGPIKELISEGDPPKYRETTI  347

Query  171  KEYEDHF--HAKGLDGTSALLHFRL  103
             EY  HF  +AKG DGTSAL  F+L
Sbjct  348  MEYVSHFSANAKG-DGTSALQQFKL  371



>ref|XP_004247920.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X2 [Solanum lycopersicum]
Length=375

 Score =   340 bits (873),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 218/265 (82%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +V+EE+ +G R F EQ  ++KK++YTR  T+ + + SNFDLY+   P+ NWRD++FC+MA
Sbjct  110  SVMEEMLQGTRRFFEQHVDIKKQYYTRDNTKKIVHVSNFDLYSPSVPATNWRDSIFCLMA  169

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            PN P P +LP  C +IL+++S  V  LG  LFELLSE LGL+P++LN+I+C +GL +LGH
Sbjct  170  PNHPSPEELPTACREILMEFSNHVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLRVLGH  229

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+LT+GT+KH+DNDF T+LLQD  IGGLQVLH+ QW DV   PGALVVNIGDL
Sbjct  230  YYPACPQPELTIGTNKHSDNDFITVLLQDQ-IGGLQVLHETQWIDVPPTPGALVVNIGDL  288

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++ S EHRVL+N+ GPR+SVACFF T ++P++++YGPIKELLS+++PPKYR T
Sbjct  289  LQLISNDKYLSVEHRVLSNKVGPRISVACFFYTGSLPTTKLYGPIKELLSDDSPPKYRAT  348

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+Y D+F  KGLDGTSALLH+++
Sbjct  349  TVKDYADYFREKGLDGTSALLHYKI  373



>ref|XP_010457800.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=368

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EVKK +Y+R  +R   Y SNFDL+++P+ANWRDT  C MAPN
Sbjct  106  DLLEKMKDGVRDFHEQSPEVKKGFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP +C D+L++YS++V  LG  LFELLSEALGL+PN+L +++C+KGL +L HYY
Sbjct  166  PPEPHDLPEICRDVLMEYSQQVMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D I GLQVL +  WFDV   PGA+V+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHADNSFLTVLLP-DQIEGLQVLREGYWFDVPHVPGAIVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVL N+    RVSVACFF T  +P  RVYGPI+EL+SEENPPKYRETT
Sbjct  285  LITNDKFISLEHRVLGNKATRARVSVACFFTTGVLPDPRVYGPIRELVSEENPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  HF+ KGLDGTSALLHF++
Sbjct  345  IREYATHFNTKGLDGTSALLHFKI  368



>ref|NP_172150.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q8H1S4.1|ACCH3_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
3 [Arabidopsis thaliana]
 gb|AAN13044.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE28019.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=369

 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 210/263 (80%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LE++++G+R FHEQ  EV+KE+Y+R  +R   Y SNFDL+++P+ANWRDT  C MAP+ 
Sbjct  108  LLEKMKKGVRDFHEQSQEVRKEFYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDT  167

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP +C DI+++YSK+V  LG  LFELLSEALGL PN+LN+++C+KGL +L HYYP
Sbjct  168  PKPQDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYP  227

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLTLGTS+H+DN F T+LL  D I GLQV  +  WFDV    GAL++NIGDLLQL
Sbjct  228  PCPEPDLTLGTSQHSDNSFLTVLLP-DQIEGLQVRREGHWFDVPHVSGALIINIGDLLQL  286

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SEENPPKYRETT+
Sbjct  287  ITNDKFISLEHRVLANRATRARVSVACFFTTGVRPNPRMYGPIRELVSEENPPKYRETTI  346

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  +F+AKGLDGTSALLHF++
Sbjct  347  KDYATYFNAKGLDGTSALLHFKI  369



>emb|CAN66006.1| hypothetical protein VITISV_042886 [Vitis vinifera]
Length=373

 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R   + V +NSNFDLY A  ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDSQKKVRFNSNFDLYQARMANWRDSLACVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS++V KLG  LFELLSEALGL+PN+L ++EC +GL +LGHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D+DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDSDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFF-NTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+SVA FF  ++   +SR+YGPIKELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHRENNSRLYGPIKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ +KGLDG S+L HF+L
Sbjct  350  VDEFLTYYFSKGLDGNSSLPHFKL  373



>gb|AAK44137.1|AF370322_1 putative oxidoreductase [Arabidopsis thaliana]
Length=369

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 210/263 (80%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LE++++G+R FHEQ  EV+KE+Y+R  +R   Y SNFDL+++P+ANWRDT  C MAP+ 
Sbjct  108  LLEKMKKGVRDFHEQSQEVRKEFYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDT  167

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP +C DI+++YSK+V  LG  LFELLSEALGL PN+LN+++C+KGL +L HYYP
Sbjct  168  PKPQDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYP  227

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLTLGTS+H+DN F T+LL  D I GLQV  +  WFDV    GAL++NIGDLLQL
Sbjct  228  PCPEPDLTLGTSQHSDNSFLTVLLP-DQIEGLQVRREGHWFDVPHVSGALIINIGDLLQL  286

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SEENPPKYRETT+
Sbjct  287  ITNDKFISLEHRVLANRATRARVSVACFFTTGVRPNPRMYGPIRELVSEENPPKYRETTI  346

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y  +F+AKGLDGTSALLHF++
Sbjct  347  KDYATYFNAKGLDGTSALLHFKI  369



>ref|XP_010668102.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=355

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 210/263 (80%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGL-TRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            VLE+I +G++GF EQD EVKK +Y+R    R ++YNSN DL+T P+ANWRDT   +M PN
Sbjct  94   VLEDILKGVKGFFEQDDEVKKGYYSRDYENRRLTYNSNVDLFTGPAANWRDTFGVMMTPN  153

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH+LPP C +ILI+YS++V K+G  LFELLS+ALGL  NYLN I C++ L++ GHYY
Sbjct  154  PPLPHELPPPCREILIEYSRQVMKVGNTLFELLSKALGLEANYLNEIGCSEELNVTGHYY  213

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGTSKHADN F T+LLQD  IGGLQVLH N W DV   PGALVVNIGDLLQ
Sbjct  214  PACPQPELTLGTSKHADNVFLTLLLQDQ-IGGLQVLHNNHWVDVSPTPGALVVNIGDLLQ  272

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN +GPR+SV  FF T+ + +SR Y PIKELLS+ NPPKYRETT+
Sbjct  273  LITNDKFKSVEHRVLANNNGPRISVVSFFTTFFLETSRRYEPIKELLSQSNPPKYRETTV  332

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY  +   KGLDGTSAL HF+L
Sbjct  333  KEYSAYSTTKGLDGTSALPHFKL  355



>ref|XP_010026859.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60400.1| hypothetical protein EUGRSUZ_H03118 [Eucalyptus grandis]
Length=371

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 204/265 (77%), Gaps = 4/265 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE+  G+R FHEQ  E K+ +Y+R  T  V+Y+SNF+LY   +ANWRDTLFCVMAPN
Sbjct  109  TVLEEMLDGVRRFHEQGAEEKRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPN  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                 +LP VC DI++++SK V  LG  LFELLSEALGL PN+L ++EC KGL +L  YY
Sbjct  169  ALEAEELPAVCGDIMLEFSKRVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
              CP+P+LTLGTS+H D+DF T+LLQ D +GGLQVL+QNQW DV   PGAL+VNIGDLLQ
Sbjct  229  SKCPQPELTLGTSRHTDSDFLTVLLQ-DHVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND FKSSEHRV+AN  GPR SVACFF T   PS ++YGPIKEL+SE +PPKYRETT+
Sbjct  288  LISNDIFKSSEHRVVANNMGPRASVACFFYTATPPSPKLYGPIKELISEGDPPKYRETTI  347

Query  171  KEYEDHF--HAKGLDGTSALLHFRL  103
             EY  HF  +AKG DGTSAL  F+L
Sbjct  348  MEYVSHFSANAKG-DGTSALQQFKL  371



>ref|XP_006304979.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
 gb|EOA37877.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
Length=365

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 208/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE+++ G+R FHEQDTEVKK +Y+R     + Y+SNFDL+++ +ANWRDTL C  AP+
Sbjct  104  DVLEKMKEGVREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSQAANWRDTLGCYTAPD  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP    LP  C +++I+YSKEV KLG +LFELLSEALGL+ N+  +I+C   L +LGHYY
Sbjct  164  PPRQEDLPAACGEMMIEYSKEVMKLGELLFELLSEALGLNTNHFKDIDCTNSLLLLGHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH+DN F T+LLQ D IGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  224  PPCPQPDLTLGLTKHSDNSFLTLLLQ-DHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN+DGPR+SVACFF++Y + + RVYGPIKELLSE+NPPKYR+TT+
Sbjct  283  LITNDKFISVEHRVLANEDGPRISVACFFSSYLMANPRVYGPIKELLSEQNPPKYRDTTI  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  343  TEYAKFYRSKGFDGTSGLLYLKI  365



>ref|XP_002889612.1| hypothetical protein ARALYDRAFT_470684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65871.1| hypothetical protein ARALYDRAFT_470684 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 210/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EV+KE+Y+R  +R   Y+SNFDL+++P+ANWRDT  C MAP+
Sbjct  107  DLLEKMKDGVRDFHEQSPEVRKEFYSRDFSRRFLYSSNFDLFSSPAANWRDTFSCTMAPD  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP +C D++++YSK+V  LG  LFELLSEALGL PN+LNNI+C+KGL +L HYY
Sbjct  167  TPKPQDLPEICRDVMMEYSKQVMILGKFLFELLSEALGLEPNHLNNIDCSKGLLMLSHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS+H+DN F T+LL  D I GLQV  +  WFDV   PGAL++NIGDLLQ
Sbjct  227  PPCPEPDLTFGTSQHSDNSFLTVLLP-DQIEGLQVRREGYWFDVPHVPGALIINIGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P+ RVYGPI+EL+SEEN PKYRETT
Sbjct  286  LITNDKFISLEHRVLANRATRARVSVACFFTTGVRPNPRVYGPIRELVSEENLPKYRETT  345

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  +++AKGLDGTSALLHF++
Sbjct  346  IREYATYYNAKGLDGTSALLHFKI  369



>ref|XP_006420182.1| hypothetical protein CICLE_v10006571mg [Citrus clementina]
 gb|ESR33422.1| hypothetical protein CICLE_v10006571mg [Citrus clementina]
Length=367

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 203/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL  +    RGFHE   EVK+E+Y+R + R V Y SNFDLY + SANWRDTLFCVM P P
Sbjct  105  VLVGMLEAARGFHELPVEVKEEYYSREVNRKVKYGSNFDLYESSSANWRDTLFCVMGPEP  164

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC DI ++YS++V KLG +LFEL+SEALGL P+YL N+EC KG  +L +YYP
Sbjct  165  LDPQELPFVCRDITLEYSRQVHKLGTLLFELISEALGLKPDYLLNMECAKGHCLLSNYYP  224

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LT+GT+KH+D DF TILLQ D +GGLQV HQNQW DV    GA VVNIGDLLQL
Sbjct  225  ACPQPELTMGTTKHSDPDFLTILLQ-DHMGGLQVFHQNQWIDVPPLSGAFVVNIGDLLQL  283

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+ KS EHRVLAN  GPRVSVACFF  +  PS + YGPIKELLSEENPP YRET+++
Sbjct  284  ISNDKLKSVEHRVLANHIGPRVSVACFFTPHLYPSMKTYGPIKELLSEENPPLYRETSVQ  343

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF+L
Sbjct  344  DFIAYYESKGLDGNSALTHFKL  365



>ref|XP_004296614.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 208/263 (79%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRG-LTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            VLEE++ G+  F+EQD+EVKK++Y R   ++   YNSNFDLY+APS NWRDT  C MAP 
Sbjct  108  VLEEMKNGVLRFYEQDSEVKKQFYCRDDFSKPWQYNSNFDLYSAPSTNWRDTFMCYMAPT  167

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  +P VC D + +YSKEV KLG +LFELLSEALGL P++LN+I+C +GL +LGHYY
Sbjct  168  PTKPEDMPEVCRDEMAEYSKEVMKLGKILFELLSEALGLEPSHLNDIDCGEGLLVLGHYY  227

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PAC +P+LT+GTSKHAD  F T+LLQD  IGGLQVLHQN+W  V    GALVVNIGDLLQ
Sbjct  228  PACSQPELTMGTSKHADGGFLTVLLQDH-IGGLQVLHQNKWIHVPPVTGALVVNIGDLLQ  286

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRF+S EHRVLAN  GPR+SVA FF T  +PS+++YGPIK+LLSE+NPPKYRETT+
Sbjct  287  LISNDRFRSVEHRVLANHRGPRISVASFFCTGMLPSTKLYGPIKDLLSEDNPPKYRETTV  346

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +   KGLDG S+L H +L
Sbjct  347  RDYVAYHSQKGLDGKSSLSHVKL  369



>gb|KDO44344.1| hypothetical protein CISIN_1g017697mg [Citrus sinensis]
 gb|KDO44345.1| hypothetical protein CISIN_1g017697mg [Citrus sinensis]
 gb|KDO44346.1| hypothetical protein CISIN_1g017697mg [Citrus sinensis]
Length=367

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 203/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL  +    RGFHE   EVK+E+Y+R + R V Y SNFDLY + SANWRDTLFCVM P P
Sbjct  105  VLVGMLEAARGFHELPVEVKEEYYSREVNRKVKYGSNFDLYESSSANWRDTLFCVMGPEP  164

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC DI ++YS++V KLG +LFEL+SEALGL P+YL N+EC KG  +L +YYP
Sbjct  165  LDPQELPFVCRDITLEYSRQVHKLGTLLFELISEALGLKPDYLLNMECAKGHCLLSNYYP  224

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LT+GT+KH+D DF TILLQ D +GGLQV HQNQW DV    GA VVNIGDLLQL
Sbjct  225  ACPQPELTMGTTKHSDPDFLTILLQ-DHMGGLQVFHQNQWIDVPPLSGAFVVNIGDLLQL  283

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+ KS EHRVLAN  GPRVSVACFF  +  PS + YGPIKELLSEENPP YRET+++
Sbjct  284  ISNDKLKSVEHRVLANHIGPRVSVACFFTPHLYPSMKTYGPIKELLSEENPPLYRETSVQ  343

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF+L
Sbjct  344  DFIAYYESKGLDGNSALTHFKL  365



>emb|CBI23601.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R   + V +NSNFDLY A  ANWRD+L CVMAPN
Sbjct  84   SVLNDMIDGIRRFHEQDAETKKEYYSRDFQKKVRFNSNFDLYQARMANWRDSLACVMAPN  143

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS++V KLG  LFELLSEALGL+PN+L ++EC +GL +LGHYY
Sbjct  144  PPLPEQLPAVCRDIVMEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYY  203

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D+DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  204  PACPEPELTLGTSSHTDSDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  262

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFF-NTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+SVA FF  ++   +SR+YGPIKELLSEENPP YRETT
Sbjct  263  LVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHRENNSRLYGPIKELLSEENPPIYRETT  322

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ +KGLDG S+L HF+L
Sbjct  323  VDEFLTYYFSKGLDGNSSLPHFKL  346



>gb|KDP40305.1| hypothetical protein JCGZ_02303 [Jatropha curcas]
Length=372

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +++E ++ GIR F+EQD ++KKE+++R LTR V YNSN  LY +PS NWRD+    MAP+
Sbjct  103  SLMEHMKDGIRRFYEQDIDLKKEFFSRDLTRKVVYNSNLHLYASPSVNWRDSTLFRMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P +LP VC DIL+++S EV KLG +L EL+SEALGL P++L ++ CN+G  I+GHYY
Sbjct  163  TPIPEELPAVCRDILMEFSMEVMKLGNLLLELMSEALGLDPSHLKDMNCNEGFVIMGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LT+G SKHAD+ FFT+LLQ D +GGLQVLHQNQW DV   PGALVVNIGD LQ
Sbjct  223  PACPQPELTMGASKHADSGFFTVLLQ-DHVGGLQVLHQNQWTDVPPVPGALVVNIGDFLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN+ GPR+S ACFF    +   RVYGPIKELLS ENP  YRE T 
Sbjct  282  LITNDKFVSVEHRVLANRVGPRISAACFFTPTIMQKPRVYGPIKELLSAENPANYREATW  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY D+F+AKGLDGTS LL F++
Sbjct  342  KEYADYFNAKGLDGTSVLLPFKI  364



>ref|XP_010435699.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=365

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQ  +V+KE Y+R LTR   Y+SNFDLYT+ +ANWRDT+ C MAP+
Sbjct  103  DLLEKMKDGVRGFHEQSPQVRKELYSRDLTRKFHYSSNFDLYTSRAANWRDTVTCNMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP +  D++I+YS++V  LG  LF LLSEALGL+PN+LN+++C+KGL ++GHYY
Sbjct  163  PPNPQDLPEILRDVMIEYSEQVTNLGDFLFTLLSEALGLNPNHLNDMDCSKGLVMVGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D IGGLQVL +  WFDV   PGAL++N+GDLLQ
Sbjct  223  PPCPEPDLTLGTSQHADNSFLTVLLP-DQIGGLQVLREGYWFDVPHVPGALIINVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND F S EHRVLAN+    RVSVACFF T   P+  VYGPI+ELLSEENPPKYRETT
Sbjct  282  LITNDNFISLEHRVLANRVTRARVSVACFFTTALKPNPTVYGPIRELLSEENPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y   F AKGLDGTSALLHF++
Sbjct  342  ITDYTAFFVAKGLDGTSALLHFKI  365



>ref|XP_006354515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 211/265 (80%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +VLEE+ +G R F EQD EVK ++YTR +T+ V ++ NFDLY+   P+ANWRDTL C+MA
Sbjct  110  SVLEEMLQGTRRFFEQDIEVKNQYYTRDITKKVVHSCNFDLYSPSVPAANWRDTLSCLMA  169

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            PNPP P + P  C +ILI++S  + KLG  +FELLSE LGL+P++LN+I C +GL++LGH
Sbjct  170  PNPPSPEEFPAACREILIEFSDHIMKLGKSVFELLSEGLGLNPSHLNDIGCAEGLAVLGH  229

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+LT+GTSKH+DN F T+LLQD  IGGLQVLHQNQW DV   PGA+VVNIGDL
Sbjct  230  YYPACPQPELTMGTSKHSDNGFITVLLQDH-IGGLQVLHQNQWVDVPPTPGAIVVNIGDL  288

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++ S EHRVL N+   R+SVACFF T  +PSS  YGPI ELLSE+NPPKYR T
Sbjct  289  LQLISNDKYISVEHRVLTNKLSSRISVACFFGTGPLPSSNFYGPITELLSEDNPPKYRVT  348

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+ +Y  +F  KGLDGTSALLH+++
Sbjct  349  TVNDYTGYFSKKGLDGTSALLHYKI  373



>ref|XP_006598206.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=371

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/263 (65%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLE+++ G++ FHEQD E KKE YTR   + + YNSNFDLY++P+ NWRD+  C +APN
Sbjct  110  TVLEDLKDGVQRFHEQDIEEKKELYTRDHMKPLVYNSNFDLYSSPALNWRDSFMCYLAPN  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y   V KLG  LFELLSEALGLHP++L ++ C +GL  L HYY
Sbjct  170  PPKPEDLPVVCRDILLEYGTYVMKLGIALFELLSEALGLHPDHLKDLGCAEGLISLCHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLTLGT+KH+DN F T+LLQ D IGGLQVL+QN W D+   PGALVVNIGDLLQ
Sbjct  230  PACPEPDLTLGTTKHSDNCFLTVLLQ-DHIGGLQVLYQNMWIDITPEPGALVVNIGDLLQ  288

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRV AN  GPR+SVACFF+     S + YGPIKELL+E+NPPKYRETT+
Sbjct  289  LITNDRFKSVEHRVQANLIGPRISVACFFSEGLKSSPKPYGPIKELLTEDNPPKYRETTV  348

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  +F AKGLDGTSAL HF++
Sbjct  349  AEYVRYFEAKGLDGTSALQHFKI  371



>ref|XP_007035066.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05992.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 207/266 (78%), Gaps = 4/266 (2%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
               L+++  GIR FHEQD+EVK+E Y+R  TR V+YNSNFDLY A + NWRD+L CVMAP
Sbjct  108  ATTLDDMIEGIRRFHEQDSEVKREIYSRDYTREVNYNSNFDLYGAEATNWRDSLTCVMAP  167

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
              PHP +LP VC DILI+YSK+V K G  LFELLSEALGL  ++L +I C +GL +LGHY
Sbjct  168  RQPHPEELPTVCRDILIEYSKKVMKFGDTLFELLSEALGLSRSHLKDIGCGEGLFVLGHY  227

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEPDLTLGTS H D+ FFT+LLQ D IGGLQVLH+NQW DV    GALVVN+GD+L
Sbjct  228  YPPCPEPDLTLGTSSHTDSSFFTVLLQ-DQIGGLQVLHENQWVDVTPIHGALVVNLGDML  286

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRE  181
            QL++ND+FKS  HRVLA+  GPR+S+A FF T+  P  +SR YGPIKELLSEENPP YRE
Sbjct  287  QLITNDKFKSVHHRVLASTIGPRISIASFFRTHLPPENASRQYGPIKELLSEENPPIYRE  346

Query  180  TTLKEYEDHFHAKGLDGTSALLHFRL  103
            TT+K+Y  H+H+KGLD    L HFRL
Sbjct  347  TTVKDYVSHYHSKGLD-CRTLEHFRL  371



>gb|AFK38092.1| unknown [Lotus japonicus]
Length=373

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 205/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G+R F+EQD EVKKE Y+R   R V YNSN+DLY++P+ +WRDT  C +APN
Sbjct  112  SVLEEMKEGVRRFYEQDAEVKKELYSRDQKRPVVYNSNYDLYSSPALSWRDTFVCDLAPN  171

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C DIL++Y   V +LG VLFELLSEALGLHPN+L ++ C +GL  L HYY
Sbjct  172  PPKPEDLPVACRDILLEYGTNVMRLGIVLFELLSEALGLHPNHLKDMSCTEGLFSLCHYY  231

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT+GT+KH+D  F T+LLQ D IGGLQVL+Q+ W D+   PGALVVNIGDLLQ
Sbjct  232  PACPEPDLTMGTTKHSDGSFLTVLLQ-DHIGGLQVLYQDNWVDIPPVPGALVVNIGDLLQ  290

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDR KS EHRVLAN+ GPR+SVA FF +    S+++YGPIKEL SE NPPKYRETT 
Sbjct  291  LITNDRLKSVEHRVLANRIGPRISVAMFFRSGLQSSTKLYGPIKELSSENNPPKYRETTF  350

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F AKGLDG S LLHFRL
Sbjct  351  DDYMAYFDAKGLDGISKLLHFRL  373



>emb|CAN67227.1| hypothetical protein VITISV_000872 [Vitis vinifera]
Length=373

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/264 (66%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R     V ++SNFDLY A  ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDSQNKVRFSSNFDLYQARMANWRDSLSCVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS +V KLG  LFELLSEALGL+PN+L ++EC +GL +LGHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDPDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFF-NTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+SVA FF  ++A  +SR+YGP+KELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHAENNSRLYGPVKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            L E+  ++ +KGLDG S+L HF+L
Sbjct  350  LDEFLTYYFSKGLDGNSSLPHFKL  373



>ref|XP_010650061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R     V ++SNFDLY A +ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDSQNKVRFSSNFDLYQARTANWRDSLSCVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS +V KLG  LFELLSEALGL+PN+L ++EC +GL +LGHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D DFFTILLQ D +GGLQVLH++QW DV   PGAL++N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDPDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALLINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFF-NTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+SVA FF  ++A  +SR+YGP+KELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISVASFFRKSHAENNSRLYGPVKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            L E+  ++ +KGLDG S+L HF+L
Sbjct  350  LDEFLTYYFSKGLDGNSSLPHFKL  373



>ref|NP_172147.2| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q84MB3.1|ACCH1_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Arabidopsis thaliana]
 gb|AAP21238.1| At1g06620 [Arabidopsis thaliana]
 dbj|BAE99663.1| oxidoreductase like protein [Arabidopsis thaliana]
 gb|AEE28010.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=365

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE++  GIR FHEQDTEVKK +Y+R     + Y+SNFDL+++P+ANWRDTL C  AP+
Sbjct  104  DVLEKMIDGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPD  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C +++I+YSKEV KLG +LFELLSEALGL+ N+L +++C   L +LGHYY
Sbjct  164  PPRPEDLPATCGEMMIEYSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH+DN F TILLQ D IGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  224  PPCPQPDLTLGLTKHSDNSFLTILLQ-DHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN  GPR+SVACFF++Y + + RVYGPIKE+LSEENPP YR+TT+
Sbjct  283  LITNDKFISVEHRVLANVAGPRISVACFFSSYLMANPRVYGPIKEILSEENPPNYRDTTI  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  343  TEYAKFYRSKGFDGTSGLLYLKI  365



>ref|XP_003626790.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01266.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=365

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G++ F+EQDTEVKKE YTR   R   YNSNFD+Y++P+ NWRD+  C +AP 
Sbjct  103  SVLEELKDGVKRFYEQDTEVKKELYTRNSNRSFVYNSNFDIYSSPALNWRDSFMCYLAPP  162

Query  711  pphphql-pPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
                 Q  P VC DIL++Y K +  LG +LFELLSEALGL+PN+L +++C +GL  L HY
Sbjct  163  DTLKPQEFPVVCRDILLQYGKYMMNLGTLLFELLSEALGLNPNHLKDMDCAEGLIALCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LT+GT+KH+DNDF T+LLQD  +GGLQVL+ ++W D+   PGAL+V++GDLL
Sbjct  223  YPPCPEPELTVGTTKHSDNDFLTVLLQDH-VGGLQVLYDDKWIDITPVPGALIVDVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++NDRFKS EHRV+AN+ GPR+SVACFF T    SS++YGPIKELLSE+NPPKYRETT
Sbjct  282  QLITNDRFKSVEHRVVANEVGPRISVACFFCTGIRSSSKLYGPIKELLSEDNPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F  KGLDGTSAL H+++
Sbjct  342  VSDYVAYFEKKGLDGTSALTHYKI  365



>gb|EYU32538.1| hypothetical protein MIMGU_mgv1a008409mg [Erythranthe guttata]
Length=374

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 210/264 (80%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
              +LEE+  GIR F+EQ+T +KK++Y+R LT    +NSNFDL+++P+ANWRD++F  +AP
Sbjct  112  ARILEEMLDGIRRFNEQETAIKKQYYSRDLTAAFKFNSNFDLFSSPAANWRDSIFIPVAP  171

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P +LP VC +I+++YSK+V +LG  L +LLSE LGL PN L  +EC   L+++ HY
Sbjct  172  NPPKPEELPLVCREIMLEYSKQVMELGKTLLKLLSEGLGLSPNRLMEMECADSLALISHY  231

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEPD TLGT++H+DNDF ++LLQ D++GGLQV+H ++W DV   PGALV+NIGDLL
Sbjct  232  YPACPEPDKTLGTTRHSDNDFVSVLLQ-DNLGGLQVVHDDRWVDVVPIPGALVINIGDLL  290

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QLV+ND++KS EHRVLA+  GPR+SVA FF   + PS +V  PI+E+LSEENPPKYR TT
Sbjct  291  QLVTNDKYKSVEHRVLASNTGPRISVASFFGRDSGPSPKVLAPIEEMLSEENPPKYRPTT  350

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
             KEY D F AKGLDGTSALLHFRL
Sbjct  351  AKEYTDFFRAKGLDGTSALLHFRL  374



>gb|ABK96309.1| unknown [Populus trichocarpa x Populus deltoides]
Length=370

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+   +RGFHEQ  EVK+E+Y+R +TR V+Y SNFDLY A  ANWRDTLFCVM P+P
Sbjct  110  VLEEMLEAVRGFHEQPREVKEEYYSREMTRKVTYVSNFDLYKAKYANWRDTLFCVMGPDP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP V  DI+++YS +V KL  VLFELLSEALGL  ++L  ++C KG ++L HYYP
Sbjct  170  LDPQELPLVSRDIIMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACPEP+L +GT+KH+D DF TILLQ DDIGGLQ+ HQN W DV    GALVVNIGDLLQL
Sbjct  230  ACPEPELAMGTTKHSDPDFLTILLQ-DDIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRV+AN  GPRVSVA FF  +  PS+R+YGPIKELLSEENPP Y E T+K
Sbjct  289  ISNDKFKSVEHRVVANHIGPRVSVASFFTPHLYPSTRLYGPIKELLSEENPPIYCEITVK  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF+L
Sbjct  349  DFIAYYDSKGLDGNSALPHFKL  370



>ref|XP_010475402.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3 [Camelina sativa]
Length=368

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/264 (63%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EVKK +Y+R  +R   Y SNFDL+++P+ANWRDT  C MAPN
Sbjct  106  DLLEKMKDGVRDFHEQSPEVKKGFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP +C D+L++YS++V  LG  LFELLSEALGL+PN+L +++C+KGL +L HYY
Sbjct  166  PPEPHDLPEICRDVLMEYSQQVMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+H+DN F T+LL  D I GLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHSDNSFLTVLLP-DQIEGLQVRREGYWFDVPHVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVL N+    RVSVACFF T   P  RVYGPI+EL+SEENPPKYRETT
Sbjct  285  LITNDKFISLEHRVLGNRATRARVSVACFFTTGVRPDPRVYGPIRELVSEENPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  HF+ KGLDGTSALLHF++
Sbjct  345  IREYATHFNTKGLDGTSALLHFKI  368



>ref|XP_010440899.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=365

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 214/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++L +++ G+RGFHEQ  +V+KE Y R LTR   Y+SNFDLY++P+ANWRDT+ C MAP+
Sbjct  103  DLLTKMKDGVRGFHEQSPQVRKELYCRDLTRKFHYSSNFDLYSSPAANWRDTVTCNMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP +  D++I+YS+EV  LG  LF LLSEALGL+PN+LN+++C+KG+ +LGHYY
Sbjct  163  PPNPQDLPEILRDVMIEYSEEVMNLGEFLFTLLSEALGLNPNHLNDMDCSKGMVMLGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D IGGLQVL +  WFDV   PGAL++N+GDLLQ
Sbjct  223  PPCPEPDLTLGTSQHADNSFLTVLLP-DQIGGLQVLREGYWFDVPHVPGALIINVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND F S EHRVLAN+    R+SVACFF +   P+  +YGP++EL+SEENPPKYRETT
Sbjct  282  LITNDNFISLEHRVLANRATRARISVACFFTSSMGPNPTLYGPVRELVSEENPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +F+AKGLDGTSAL+HF++
Sbjct  342  IRDYNAYFNAKGLDGTSALVHFKI  365



>ref|XP_010326756.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X1 [Solanum lycopersicum]
Length=379

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/269 (61%), Positives = 219/269 (81%), Gaps = 7/269 (3%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +V+EE+ +G R F EQ  ++KK++YTR  T+ + + SNFDLY+   P+ NWRD++FC+MA
Sbjct  110  SVMEEMLQGTRRFFEQHVDIKKQYYTRDNTKKIVHVSNFDLYSPSVPATNWRDSIFCLMA  169

Query  717  pnpphphqlpPVCS----DILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLS  550
            PN P P +LP  CS    +IL+++S  V  LG  LFELLSE LGL+P++LN+I+C +GL 
Sbjct  170  PNHPSPEELPTACSNCCREILMEFSNHVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLR  229

Query  549  ILGHYYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVN  370
            +LGHYYPACP+P+LT+GT+KH+DNDF T+LLQD  IGGLQVLH+ QW DV   PGALVVN
Sbjct  230  VLGHYYPACPQPELTIGTNKHSDNDFITVLLQDQ-IGGLQVLHETQWIDVPPTPGALVVN  288

Query  369  IGDLLQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPK  190
            IGDLLQL+SND++ S EHRVL+N+ GPR+SVACFF T ++P++++YGPIKELLS+++PPK
Sbjct  289  IGDLLQLISNDKYLSVEHRVLSNKVGPRISVACFFYTGSLPTTKLYGPIKELLSDDSPPK  348

Query  189  YRETTLKEYEDHFHAKGLDGTSALLHFRL  103
            YR TT+K+Y D+F  KGLDGTSALLH+++
Sbjct  349  YRATTVKDYADYFREKGLDGTSALLHYKI  377



>ref|XP_010262281.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262282.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=382

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 209/264 (79%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVL+E+ +G+RGF+EQD EVKK++YTR L R + YNSN  LY +P+ANWRD+ +C MAP 
Sbjct  112  NVLDEMLQGVRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPE  171

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DI+++YSK+V+KLG  LFELLSEAL L   +L +I C +G ++L HYY
Sbjct  172  PPQPEDLPAVCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYY  231

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CPEP+LT+GTSKHADNDF T+LLQ D+IGGLQVL + QW DV   PGAL+VN+GDLLQ
Sbjct  232  PSCPEPELTMGTSKHADNDFLTVLLQ-DNIGGLQVLREKQWVDVLPMPGALIVNVGDLLQ  290

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYA-VPSSRVYGPIKELLSEENPPKYRETT  175
            L+SNDRFKS EHRVLAN+ GPRVSVACFF T     S ++YGPIKELLSEENPP YRE T
Sbjct  291  LISNDRFKSVEHRVLANRIGPRVSVACFFTTPVNQASGKLYGPIKELLSEENPPIYREIT  350

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  H  AKGLDG S L  F+L
Sbjct  351  VQEYIQHIIAKGLDGNS-LTRFKL  373



>emb|CAN80594.1| hypothetical protein VITISV_017626 [Vitis vinifera]
Length=373

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R   + V + SNFDLY A  ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS +V KLG  LFELLSEALGL+PN+L ++EC +GL + GHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D+DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDSDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNT-YAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+S+A FFNT +   +SR+YGPIKELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISLASFFNTSHPQNNSRLYGPIKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ +KGLDG S+L HF+L
Sbjct  350  VDEFLAYYFSKGLDGNSSLPHFKL  373



>ref|XP_010475400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   335 bits (858),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 208/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE++++GIR FHEQDTEVKK +Y+R     + Y+SNFDL+++ +ANWRDTL C  AP+
Sbjct  101  DVLEKMKKGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPD  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C + +I+YSKEV KLG +LFELLSEALGL+ N+L  ++C   L +LGHYY
Sbjct  161  PPRPEDLPATCGETMIEYSKEVMKLGELLFELLSEALGLNTNHLKGMDCTNSLLLLGHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH+DN F T+LLQ D IGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  221  PPCPQPDLTLGLTKHSDNSFLTLLLQ-DHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN+DGPR+SVACFF++Y + + R+YGPIKE LSE+NPPKYR+TT+
Sbjct  280  LITNDKFISVEHRVLANEDGPRISVACFFSSYMMANPRLYGPIKEHLSEQNPPKYRDTTI  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  340  TEYAKFYRSKGFDGTSGLLYLKI  362



>ref|XP_006294352.1| hypothetical protein CARUB_v10023369mg, partial [Capsella rubella]
 gb|EOA27250.1| hypothetical protein CARUB_v10023369mg, partial [Capsella rubella]
Length=396

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 211/264 (80%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE+++ GIRGFHEQD++V++++YTR +T+ V YNSNFDLY++PSANWRDTL C M+P+
Sbjct  135  DVLEKMKDGIRGFHEQDSDVRRKFYTRDVTKKVKYNSNFDLYSSPSANWRDTLSCFMSPD  194

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP +C +I+++YSK V +LG ++FELLSEALGL+PN+L  ++C KGL +L HYY
Sbjct  195  VPKTEDLPEICGEIMLEYSKRVMELGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYY  254

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS+H+D  F TILLQ D IGGLQVL    W DV   PGAL+VN+GDLLQ
Sbjct  255  PPCPEPDLTFGTSQHSDRSFLTILLQ-DHIGGLQVLQDGYWVDVPPVPGALLVNLGDLLQ  313

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+ + PR+SVA FF  + +PS RVYGPIKELLSE+N PKYR+TT
Sbjct  314  LITNDKFVSVEHRVLANKGEEPRISVASFF-VHPLPSLRVYGPIKELLSEQNLPKYRDTT  372

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY  H+ A+GLDG S LL F++
Sbjct  373  VTEYTSHYMARGLDGNSVLLDFKI  396



>ref|XP_002881136.1| hypothetical protein ARALYDRAFT_482001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57395.1| hypothetical protein ARALYDRAFT_482001 [Arabidopsis lyrata subsp. 
lyrata]
Length=362

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 211/264 (80%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+E+++ GIRGFHEQD++V+K++YTR +T+ V YNSNFDLY++PSANWRDTL C M+P+
Sbjct  101  DVMEKMKDGIRGFHEQDSDVRKKFYTRDITKKVKYNSNFDLYSSPSANWRDTLSCFMSPD  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP +C +I+++YSK V KLG ++FELLSEALGL+PN+L  ++C KGL +L HYY
Sbjct  161  VPKTEDLPDICGEIMLEYSKRVMKLGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS+H+D  F TILLQ D IG LQVL    W DV   PGAL+VN+GDLLQ
Sbjct  221  PPCPEPDLTFGTSQHSDRSFLTILLQ-DHIGELQVLQNGYWVDVPPVPGALLVNLGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+ + PR+SVA FF  + +PS RVYGPIKELLS++N PKYR+TT
Sbjct  280  LMTNDKFLSVEHRVLANRGEEPRISVASFF-VHPLPSLRVYGPIKELLSDQNLPKYRDTT  338

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY +H+ A+GLDG S LL F++
Sbjct  339  VSEYTNHYMARGLDGKSVLLDFKI  362



>ref|XP_003626795.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01271.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 210/263 (80%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G++ F+EQ TE KK  YTR + R   YNSNFD+Y++P+ NWRD+  C +AP+
Sbjct  103  SVLEELKDGVKRFYEQATEAKKSLYTRDMNRSFVYNSNFDIYSSPALNWRDSFACYLAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P   P VC D++++Y K+V  LG +LFEL+SEALGL+PN+L ++ C +GL  L HYY
Sbjct  163  TPKPEDFPAVCRDVILEYGKQVMNLGTLLFELMSEALGLNPNHLKDMGCAEGLIALCHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GT+KH+DNDF T+LLQ D IGGLQVL++++W D+    GAL+VN+GDLLQ
Sbjct  223  PPCPEPELTVGTTKHSDNDFLTVLLQ-DHIGGLQVLYEDKWIDITPVSGALIVNVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS  HRVLANQ GPR+SVACFF+T    SS++YGP+KELLSE+NPPKYRET++
Sbjct  282  LITNDKFKSVVHRVLANQVGPRISVACFFSTALKASSKLYGPMKELLSEDNPPKYRETSV  341

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F AKGLDGTSAL H+++
Sbjct  342  ADYVAYFRAKGLDGTSALTHYKI  364



>ref|XP_010650062.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=373

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 210/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL ++  GIR FHEQD E KKE+Y+R   + V + SNFDLY A  ANWRD+L CVMAPN
Sbjct  111  SVLNDMIDGIRRFHEQDAETKKEYYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DI+++YS +V KLG  LFELLSEALGL+PN+L ++EC +GL + GHYY
Sbjct  171  PPLPEQLPAVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D DFFTILLQ D +GGLQVLH++QW DV   PGALV+N+GDLLQ
Sbjct  231  PACPEPELTLGTSSHTDPDFFTILLQ-DQMGGLQVLHEDQWVDVPPIPGALVINMGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNT-YAVPSSRVYGPIKELLSEENPPKYRETT  175
            LVSNDRFKS  HRVLA   GPR+S+A FFNT +   +SR+YGPIKELLSEENPP YRETT
Sbjct  290  LVSNDRFKSIFHRVLAKNVGPRISLASFFNTSHPQNNSRLYGPIKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ +KGLDG S+L HF+L
Sbjct  350  VDEFLAYYFSKGLDGNSSLPHFKL  373



>ref|XP_002315711.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
 gb|EEF01882.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
Length=370

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+   +RGFHEQ  EVK+E+Y+R +TR V Y SNFDLY +  ANWRDTLFCVM P+P
Sbjct  110  VLEEMLEAVRGFHEQPREVKEEYYSREMTRKVKYVSNFDLYKSKYANWRDTLFCVMGPDP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP V  DI+++YS +V KL  VLFELLSEALGL  ++L  ++C KG ++L HYYP
Sbjct  170  LDPQELPLVSRDIMMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACPEP+L +GT+KH+D DF TILLQ DDIGGLQ+ HQN W DV    GALVVNIGDLLQL
Sbjct  230  ACPEPELAMGTTKHSDPDFLTILLQ-DDIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRV+AN  GPRVSVA FF  +  PS+R+YGPIKELLSEENPP Y E T+K
Sbjct  289  ISNDKFKSVEHRVVANHIGPRVSVASFFTPHLYPSTRLYGPIKELLSEENPPIYCEITVK  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF++
Sbjct  349  DFIAYYDSKGLDGNSALPHFKV  370



>ref|XP_003635549.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 211/262 (81%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+ +GIR F+EQDTEVKKE+YTR  ++ V++ SNFDL+ AP+A W+D+  C++APNP
Sbjct  108  VLEEMIKGIRRFNEQDTEVKKEFYTRDFSKKVTFVSNFDLFQAPAATWKDSFSCIIAPNP  167

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  +P VC DI+++YSK+V+ L   LFEL++EALGL+ N+L ++EC +GL ++ HYYP
Sbjct  168  PDPTDMPAVCRDIIMEYSKQVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYP  227

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACPEP+LT+GT  H D  F T+LLQ D +GGLQVLH+ QW +V+  PGALV+N GDLLQL
Sbjct  228  ACPEPELTMGTKTHTDPTFLTVLLQ-DQVGGLQVLHEKQWVNVNPVPGALVINTGDLLQL  286

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            VSND F+S++HRVLAN  GPRVSVA FF+ +++PSS++YGPIKELLSE+NPPKY+ETT +
Sbjct  287  VSNDMFRSAKHRVLANHKGPRVSVASFFSPFSLPSSKLYGPIKELLSEDNPPKYKETTAR  346

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            +Y     A+ LDGTSAL HF L
Sbjct  347  DYGTCHRAERLDGTSALQHFML  368



>gb|AFK35571.1| unknown [Lotus japonicus]
Length=366

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 209/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G++ F+EQDTEV KE+YTR   +   YNSNFD+Y++P+ NWRDT  C +AP+
Sbjct  105  SVLEEIKDGVQRFYEQDTEVTKEFYTRERYKSFIYNSNFDIYSSPALNWRDTFLCYLAPD  164

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y K +  LG +LFEL SEALGL+PN+L ++ C +GL  L HYY
Sbjct  165  PPKPEDLPQVCRDILLEYGKHIMNLGTLLFELFSEALGLNPNHLKDMGCLEGLYALCHYY  224

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGT+KH+DNDF T+LLQ D IGGLQV +Q++W DV   PGALVVN+GD LQ
Sbjct  225  PACPEPELTLGTTKHSDNDFLTVLLQ-DHIGGLQVRYQDKWIDVTPVPGALVVNVGDFLQ  283

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EH+VLAN  GPR+SVACFF+T     S++YGPIKELLS++NP KYRETT+
Sbjct  284  LITNDRFKSVEHQVLANHAGPRISVACFFSTAFRLPSKLYGPIKELLSKDNPAKYRETTI  343

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  ++  KGLDGTSAL H+R+
Sbjct  344  AEYVAYYVKKGLDGTSALSHYRI  366



>ref|XP_002889610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65869.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE+ + GIR FHEQDT+VKK +Y+R     V Y+SNFDL+++P+ANWRDTL C  AP+
Sbjct  101  DVLEKKKEGIREFHEQDTQVKKGFYSRDPASKVVYSSNFDLFSSPAANWRDTLGCYTAPD  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C +++I+YSKEV KLG +LFELLSEALGL+ ++L +++C   L +LGHYY
Sbjct  161  PPRPEDLPAACGEMMIEYSKEVMKLGKLLFELLSEALGLNTSHLKDMDCTNSLLLLGHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH DN F TILLQ D IGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  221  PPCPQPDLTLGLTKHFDNSFLTILLQ-DHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
             ++ND+FKS EHRVLAN  GPR+SVACFF++Y + + RVYGPIK++LSE+NPPKYR+TT+
Sbjct  280  HITNDKFKSVEHRVLANVAGPRISVACFFSSYLMANPRVYGPIKDILSEQNPPKYRDTTI  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  340  TEYAKFYRSKGFDGTSGLLYLKI  362



>ref|XP_006489571.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Citrus sinensis]
 ref|XP_006489572.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Citrus sinensis]
 ref|XP_006489573.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X3 [Citrus sinensis]
 ref|XP_006489574.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X4 [Citrus sinensis]
Length=367

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 201/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL  +    RGFHE   EVK+E+Y+R + R V Y SNFDLY + SANWRDTLFCVM P P
Sbjct  105  VLVGMLEAARGFHELPVEVKEEYYSREVNRKVKYGSNFDLYESSSANWRDTLFCVMGPEP  164

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC DI ++YS +V KLG +LFEL+SEALGL P+ L N+EC KG  +L +YYP
Sbjct  165  LDPQELPFVCRDITLEYSGQVHKLGTLLFELISEALGLKPDCLLNMECAKGHCLLSNYYP  224

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LT+GT+KH+D DF TILLQ D +GGLQV HQNQW DV    GA VVNIGDLLQL
Sbjct  225  ACPQPELTMGTTKHSDPDFLTILLQ-DHMGGLQVFHQNQWIDVPPLSGAFVVNIGDLLQL  283

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+ KS EHRVLAN  GPRVSVACFF  +  PS + YGPIKELLSEENPP YRET+++
Sbjct  284  ISNDKLKSVEHRVLANHIGPRVSVACFFTPHLYPSMKTYGPIKELLSEENPPVYRETSVQ  343

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF+L
Sbjct  344  DFIAYYESKGLDGNSALTHFKL  365



>ref|XP_010486415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 208/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE+++ GIR FHEQDTEVKK +Y+R     + Y+SNFDL+++ +ANWRDTL C  AP+
Sbjct  101  DVLEKMKEGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPD  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP    LP  C +++I+YSKEV KLG +LFELLSEALGL+ N+L +++C   L +LGHYY
Sbjct  161  PPRQEDLPATCGEMMIEYSKEVMKLGELLFELLSEALGLNTNHLKDMDCTNSLLLLGHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH+DN F T+LLQ D IGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  221  PPCPQPDLTLGLTKHSDNSFLTLLLQ-DHIGGLQVLHGQYWVDVPPVPGALVVNVGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN+DGPR+SVACFF++Y + + R+YGPIKELLSE+N PKYR+TT+
Sbjct  280  LITNDKFISVEHRVLANEDGPRISVACFFSSYLMANPRLYGPIKELLSEQNHPKYRDTTI  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  340  TEYAKFYRSKGFDGTSGLLYLKI  362



>ref|XP_006417896.1| hypothetical protein EUTSA_v10009596mg [Eutrema salsugineum]
 gb|ESQ36249.1| hypothetical protein EUTSA_v10009596mg [Eutrema salsugineum]
Length=458

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQ  EVKK++Y R  TR   Y+SNFDLY++P+ANWRDT  C +AP+
Sbjct  196  DLLEKMKDGVRGFHEQSPEVKKQFYGRDFTREFLYSSNFDLYSSPAANWRDTFSCNIAPD  255

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++YS++V  LG  LFELLSEALGL+PN+LN+I+C+KGL +L HYY
Sbjct  256  PPKPQNLPEICRDVMLEYSQQVINLGEFLFELLSEALGLNPNHLNDIDCSKGLLMLSHYY  315

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LTLGTS H+DN F T+LL  D I GLQV  +  WFDV   PGALV+NIGD LQ
Sbjct  316  PPCPEPELTLGTSPHSDNSFLTVLLT-DQIEGLQVHREGYWFDVPPVPGALVINIGDFLQ  374

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF+T   P+ R+YGPIKEL+SEE+PPKYRETT
Sbjct  375  LITNDKFISLEHRVLANRATRARVSVACFFSTGVRPNPRMYGPIKELVSEEDPPKYRETT  434

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +K+Y  +F+AKGLDGTSALLHF++
Sbjct  435  IKDYSTYFNAKGLDGTSALLHFKI  458



>ref|XP_009119310.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
6-like [Brassica rapa]
Length=355

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPS--ANWRDTLFCVMA  718
            +V+EEI+ G+R FHEQD EVKK ++TR +T+ V YNSNFDLY   S   NWRD+  C MA
Sbjct  92   SVIEEIKGGVRRFHEQDLEVKKSYFTRDVTKSVVYNSNFDLYNPSSLCVNWRDSFVCCMA  151

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP+P ++P  C D +I+YSK V  LGG LFELLSE+LGLH   L +++C KGL+++GH
Sbjct  152  PDPPNPDEIPLACRDAMIEYSKHVMTLGGFLFELLSESLGLHSEMLKSMDCMKGLNMIGH  211

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLT GTS+H+D+ F TILLQD  IGGLQ+LH++ W DV   PGALV+NIGD 
Sbjct  212  YYPPCPQPDLTFGTSQHSDSSFITILLQDQ-IGGLQILHKDSWVDVSPLPGALVINIGDF  270

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQ+++ND+FKS EHRVLAN+ GPR+SVA FF+T  +P+S VYGPIKELLSEENPPKY++ 
Sbjct  271  LQIITNDKFKSVEHRVLANRAGPRISVAGFFSTNMLPNSTVYGPIKELLSEENPPKYKDF  330

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            TL+EY   +  KGLDGTS L  F++
Sbjct  331  TLEEYTKGYIEKGLDGTSHLSRFKI  355



>ref|XP_007149298.1| hypothetical protein PHAVU_005G058500g [Phaseolus vulgaris]
 gb|ESW21292.1| hypothetical protein PHAVU_005G058500g [Phaseolus vulgaris]
Length=367

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 205/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLE+++ G+  F+EQDTEVKK+ YTR   +   YNSNFD+Y++P+ +WRDT FC +APN
Sbjct  106  TVLEDLKDGVCRFYEQDTEVKKDLYTRDHKKPFVYNSNFDIYSSPALSWRDTFFCYLAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC DIL++Y   V KLG  LFELLSE+LGLHPN+L +++C KG+  L HYY
Sbjct  166  PPKPQDLPAVCRDILLEYGTWVMKLGIALFELLSESLGLHPNHLKDMDCAKGIISLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGT KH+DN F T+LLQ D IGGLQVL+QN W D+   PGALVVNIGD LQ
Sbjct  226  PACPEPELTLGTIKHSDNSFLTVLLQ-DHIGGLQVLYQNTWIDIAPEPGALVVNIGDFLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRV+AN  GPR+SVACFF+       ++YGPIKELLSEENPPKYRE T+
Sbjct  285  LITNDRFKSVEHRVVANVTGPRISVACFFSEGLRTPGKLYGPIKELLSEENPPKYREVTV  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  ++  KGLDGTSAL  FR+
Sbjct  345  EEYARNYFEKGLDGTSALHPFRI  367



>ref|XP_011091222.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=365

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 200/262 (76%), Gaps = 1/262 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            G+VLEE+  G+R F+EQD EVKK+WYTR   + V YNSN++LY A S +WRDT +  MAP
Sbjct  103  GSVLEEMLEGVRRFYEQDAEVKKQWYTRDGLKTVVYNSNYNLYAAESVDWRDTTYICMAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             PP P  LP  C DI+++YSK+V KLG  LFELLSEAL L+PN+L NI C  GL +L HY
Sbjct  163  TPPDPEDLPLECRDIIVEYSKQVTKLGRYLFELLSEALNLNPNHLKNIGCADGLGVLYHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LTLG S H D DF T+LLQ D IGGLQVL+ NQWFD+   PGALVVNIGDLL
Sbjct  223  YPPCPEPELTLGASAHTDIDFLTVLLQ-DHIGGLQVLYNNQWFDIPPVPGALVVNIGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QLVSND FKS  HRVLA+  GPR+SVACFF T  +PS +VYGPIKELLS++NPPKYRETT
Sbjct  282  QLVSNDNFKSGLHRVLASPAGPRLSVACFFTTGLIPSPKVYGPIKELLSDDNPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHF  109
            ++EY  H++ K     SALL F
Sbjct  342  VREYSLHYNTKKDHEASALLDF  363



>ref|XP_003596174.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66425.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=371

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 199/263 (76%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLE+++ G+  F EQD EVKKE YTR  TR + YNSNFDLY++P+ NWRDT  C  A N
Sbjct  110  NVLEDMKDGVIRFFEQDIEVKKEMYTRDQTRPLVYNSNFDLYSSPALNWRDTFICDFALN  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP VC DIL++Y   + KLG +LFELLSEALGLH N+L +++C +G  +LGHYY
Sbjct  170  APKLEDLPVVCRDILMEYGTRLMKLGTILFELLSEALGLHSNHLKDLDCCEGNILLGHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT+GT+KH+D  F T+LLQ D IGGLQVL+Q +W DV   P ALVVNIGDLLQ
Sbjct  230  PACPEPDLTMGTTKHSDGSFLTVLLQ-DHIGGLQVLYQEKWIDVPPVPEALVVNIGDLLQ  288

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN  GPR+SVACFF        ++YGPI ELLSE+NPP+YRETT 
Sbjct  289  LITNDKFKSVEHRVLANDIGPRISVACFFKAGLRAHEKLYGPITELLSEDNPPRYRETTF  348

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +  AKGLDGTS L HF+L
Sbjct  349  ADYVAYLCAKGLDGTSVLQHFKL  371



>ref|XP_003596176.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66427.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=367

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLE+++ G+  F EQDTEVKKE YTR  TR + YNSNFDLY++P+ NWRDTL   MAPN
Sbjct  106  NVLEDMKDGVIRFFEQDTEVKKEMYTRDQTRPLVYNSNFDLYSSPALNWRDTLALKMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP VC DI ++Y + V KLG VLFELLSEALGLHPN+L +++C++G  +L HYY
Sbjct  166  APKPEDLPVVCRDIFLEYGEHVMKLGIVLFELLSEALGLHPNHLKDLDCSEGNLLLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP LT+GT+KH+D+ F T+LLQ D IGGLQVLH+ +W DV   P ALV+NIGD+LQ
Sbjct  226  PACPEPHLTMGTAKHSDSSFLTVLLQ-DHIGGLQVLHKGKWIDVPPIPEALVINIGDVLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EHRVLAN  GPRVSVA FF        ++YGPIKE+LSE+NPP+YRETT 
Sbjct  285  LITNDRFKSVEHRVLANTIGPRVSVASFFRAGPRAQEKLYGPIKEILSEDNPPRYRETTF  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             ++  +++AKGLDG SAL HF+L
Sbjct  345  TDFVAYYNAKGLDGISALEHFKL  367



>ref|XP_007221652.1| hypothetical protein PRUPE_ppb006192mg [Prunus persica]
 gb|EMJ22851.1| hypothetical protein PRUPE_ppb006192mg [Prunus persica]
Length=366

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 203/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VL+E+    RGFHE   EVK E+Y+R L R V + SNFDLY +  ANWRD+LFCVM+P 
Sbjct  103  RVLDEMLAAARGFHELPREVKSEYYSRELLRKVKFGSNFDLYQSRFANWRDSLFCVMSPE  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P +LP +C DI ++YS+ V K+G  LFELLSEALGL P++L  ++C KG  +L HYY
Sbjct  163  PLDPQELPLICRDITMEYSENVHKMGVTLFELLSEALGLKPDHLIGLDCAKGHLVLSHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GTSKH+D DF TILLQ D IGGLQVL++NQW DV   PGALVVNIGDLLQ
Sbjct  223  PPCPEPELTMGTSKHSDPDFLTILLQ-DQIGGLQVLYENQWIDVPPVPGALVVNIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LVSNDRFKS EH+VLAN  GPRVS+ACFF  +  PS+R+YGPIKELLSE+ PP Y+ET+L
Sbjct  282  LVSNDRFKSVEHQVLANHAGPRVSIACFFTLHLHPSTRLYGPIKELLSEDRPPVYKETSL  341

Query  171  KEYEDHFHAKGLDGTSALLHFR  106
            K++  ++  KGLDG SAL +F+
Sbjct  342  KDFIAYYDEKGLDGNSALTYFK  363



>gb|KFK42981.1| hypothetical protein AALP_AA1G064100 [Arabis alpina]
Length=369

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             +LE+++ G+R FHEQ  EV+K++Y R  TR   Y SNFDL+++P+ANWRDT    +AP+
Sbjct  107  QLLEKMKDGVRSFHEQAPEVRKQYYGRDFTRKFLYLSNFDLFSSPAANWRDTFSSYIAPD  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++I+YSKEV  LG  LFELLSEALGL PN+LN+++C+KGL +L HYY
Sbjct  167  PPKPQDLPAICRDVMIEYSKEVMVLGKSLFELLSEALGLSPNHLNDMDCSKGLLMLSHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT+GTS+H+DN F T+LL  D I GLQV  +  WFDV   PGAL++NIGDLLQ
Sbjct  227  PPCPEPDLTIGTSQHSDNSFLTVLLP-DQIEGLQVHREGNWFDVPHVPGALIINIGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EH+VLAN+    RVSVACFF T   P+ R+YGPI+EL+SEENPPKYRETT
Sbjct  286  LITNDKFVSLEHQVLANRATRARVSVACFFTTGVRPNPRMYGPIRELVSEENPPKYRETT  345

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +K+Y  +F+AKGLDGTSALLHF++
Sbjct  346  IKDYATYFNAKGLDGTSALLHFKI  369



>emb|CBI33261.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   327 bits (839),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 206/256 (80%), Gaps = 1/256 (0%)
 Frame = -1

Query  870  RGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpphphql  691
            +GIR F+EQDTEVKKE+YTR  ++ V++ SNFDL+ AP+A W+D+  C++APNPP P  +
Sbjct  3    KGIRRFNEQDTEVKKEFYTRDFSKKVTFVSNFDLFQAPAATWKDSFSCIIAPNPPDPTDM  62

Query  690  pPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPEPD  511
            P VC DI+++YSK+V+ L   LFEL++EALGL+ N+L ++EC +GL ++ HYYPACPEP+
Sbjct  63   PAVCRDIIMEYSKQVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYPACPEPE  122

Query  510  LTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLVSNDRF  331
            LT+GT  H D  F T+LLQD  +GGLQVLH+ QW +V+  PGALV+N GDLLQLVSND F
Sbjct  123  LTMGTKTHTDPTFLTVLLQDQ-VGGLQVLHEKQWVNVNPVPGALVINTGDLLQLVSNDMF  181

Query  330  KSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKEYEDHF  151
            +S++HRVLAN  GPRVSVA FF+ +++PSS++YGPIKELLSE+NPPKY+ETT ++Y    
Sbjct  182  RSAKHRVLANHKGPRVSVASFFSPFSLPSSKLYGPIKELLSEDNPPKYKETTARDYGTCH  241

Query  150  HAKGLDGTSALLHFRL  103
             A+ LDGTSAL HF L
Sbjct  242  RAERLDGTSALQHFML  257



>gb|AFK46776.1| unknown [Lotus japonicus]
Length=365

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 205/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G++ F EQD+EV K +YTR   +  +YNSNFD+Y++P+ NWRDT  C MAP+
Sbjct  104  SVLEEIKNGVKRFFEQDSEVTKGFYTRDKVKSFTYNSNFDIYSSPALNWRDTFTCYMAPD  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP VC DIL++Y K V  L  +LFELLSEALGL+P++L ++ C +GL  LGHYY
Sbjct  164  APKPEDLPVVCRDILLEYGKHVMNLATLLFELLSEALGLNPSHLKDMGCAEGLVALGHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP LT+GT+KH+D DF T+LLQ D IGGLQVLHQN+W +V    GALVVN+GD LQ
Sbjct  224  PACPEPQLTVGTTKHSDADFLTVLLQ-DHIGGLQVLHQNEWVNVIPESGALVVNVGDFLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            +++NDRFKS EHRVLAN  GPR+SVACFF+T    SS++YGPIKELLS++NPPKYR  T+
Sbjct  283  IITNDRFKSVEHRVLANHVGPRISVACFFSTGHRSSSKLYGPIKELLSKDNPPKYRGITV  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F  KG+DGT+AL H+ L
Sbjct  343  ADYSAYFEEKGMDGTTALTHYML  365



>ref|XP_011030519.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
2-like [Populus euphratica]
Length=370

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 204/262 (78%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+   +RGFHEQ  EVK+E+Y+R + R V Y SNFDLY +  ANWRDTLFCVM P+P
Sbjct  110  VLEEMLEAVRGFHEQPREVKEEYYSREMMRKVKYVSNFDLYKSKYANWRDTLFCVMGPDP  169

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP V  DI+++YS +V KL  VLFELLSEALGL  ++L  ++C KG ++L HYYP
Sbjct  170  LDPQELPLVARDIMMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYP  229

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACPEP+L +GT+KH+D DF TILLQ D+IGGLQ+ HQN W DV    GALVVNIGDLLQL
Sbjct  230  ACPEPELAMGTTKHSDPDFLTILLQ-DNIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQL  288

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRV+AN  GPRVSVA FF  +  PS+R+YGPIKELLSEENPP Y E T+K
Sbjct  289  ISNDKFKSVEHRVVANHIGPRVSVASFFTPHLYPSTRLYGPIKELLSEENPPIYCEITVK  348

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  ++ +KGLDG SAL HF+L
Sbjct  349  DFIAYYDSKGLDGNSALPHFKL  370



>ref|XP_009119308.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
7 [Brassica rapa]
Length=355

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+  FHE+D EVKK +++R   +   Y++NF+LY++ + NWRD+  C MAPN
Sbjct  94   SVLEEIKDGVVRFHEEDPEVKKTYFSRDFAKTFIYHNNFELYSSSAGNWRDSFACYMAPN  153

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P ++   C D +I YSK V  LGG++FELLSEALGL  + L +++C KGL +L HYY
Sbjct  154  PPNPEEIAMACRDAMIGYSKHVMSLGGLIFELLSEALGLRADKLKSLDCMKGLLMLCHYY  213

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLGTSKH+DN F T+LLQD  IGGLQVLHQ+ W DV   PGALV+NIGD LQ
Sbjct  214  PPCPQPDLTLGTSKHSDNTFITMLLQDQ-IGGLQVLHQDYWVDVSPIPGALVINIGDFLQ  272

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN+ GPR+SVACFF++  +P+S VYGPIKELLSEENPPKYRE T+
Sbjct  273  LMTNDKFKSVEHRVLANEAGPRISVACFFSSSVIPNSTVYGPIKELLSEENPPKYREFTV  332

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   +  KGLDGTS LL++++
Sbjct  333  PEYSKGYIEKGLDGTSHLLNYKI  355



>emb|CDX71101.1| BnaC03g11850D [Brassica napus]
Length=365

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLY-TAPSANWRDTLFCVMA  718
            NVLEEIQ G+R FHE+D EVKK +++R L  +   YNSNFDLY +APS NWRDT  C +A
Sbjct  102  NVLEEIQDGVRRFHEEDPEVKKRYFSRDLANKNFVYNSNFDLYGSAPSVNWRDTFACYIA  161

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D L +YSK V  LGG+LFELLSEALGL P+ L +  C K L ++ H
Sbjct  162  PDPPTPEELPVTCRDALFEYSKHVMSLGGLLFELLSEALGLEPDILKSKGCLKSLLMICH  221

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLGTSKH+DN F T+LLQD+ IGGLQ+LHQ+ W DV   PGAL++NIGD 
Sbjct  222  YYPPCPQPDLTLGTSKHSDNSFITVLLQDN-IGGLQILHQDSWVDVAPLPGALIINIGDF  280

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN+ GPR+SVA FF++    +S VYGP+KEL+SEENPPKYR+ 
Sbjct  281  LQLMTNDKFVSVEHRVLANRQGPRISVASFFSSSKRANSTVYGPMKELVSEENPPKYRDI  340

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY D ++ KGLDGTS LL+FR+
Sbjct  341  TIKEYTDGYNEKGLDGTSHLLNFRI  365



>ref|XP_010450550.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=365

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++L++++ G+RGFHEQ ++V+KE Y+R LTR   Y+SNFDLYT+ +ANWRDT+   MAP+
Sbjct  103  DLLKKMKDGVRGFHEQSSQVRKELYSRDLTRKFHYSSNFDLYTSRAANWRDTVTFNMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP +  D++I+YS++V  LG  LF LLSEALGL+PN+LN+++C+KGL ++GHYY
Sbjct  163  PPNPQDLPEILRDVMIEYSEQVMNLGDFLFTLLSEALGLNPNHLNDMDCSKGLVMVGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D IGGLQVL +  WFDV   PGAL++N+GDLLQ
Sbjct  223  PPCPEPDLTLGTSQHADNSFLTVLLA-DQIGGLQVLREGYWFDVPHVPGALIINVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND F S EHRVLAN+    RVSVACFF T   P+  VYGPI+EL+SEENPPKYRETT
Sbjct  282  LITNDNFISLEHRVLANRATRARVSVACFFTTALKPNPTVYGPIRELVSEENPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F  KGLDGTSALLHF++
Sbjct  342  ITDYTAYFIDKGLDGTSALLHFKI  365



>ref|XP_007227098.1| hypothetical protein PRUPE_ppa025648mg [Prunus persica]
 gb|EMJ28297.1| hypothetical protein PRUPE_ppa025648mg [Prunus persica]
Length=330

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 202/262 (77%), Gaps = 20/262 (8%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEEI+ G+RGF+EQDT+VKK++YTR   + V YNSNFDL+ AP+ NWRD+  C MAPNP
Sbjct  89   VLEEIKDGVRGFYEQDTQVKKQFYTRDHFKPVVYNSNFDLHRAPATNWRDSFMCYMAPNP  148

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P  +P V  DILI+YSK+                   P++LN+I+C+ GL  +GHYYP
Sbjct  149  TKPEDMPEVFRDILIEYSKQ-------------------PSHLNDIDCSLGLVHVGHYYP  189

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            +CP+P+LTLGTSKHADNDF T+LLQD  IGGLQVLHQN+W DV   PGALVVNIGDLLQL
Sbjct  190  SCPQPELTLGTSKHADNDFITVLLQDH-IGGLQVLHQNKWIDVPPVPGALVVNIGDLLQL  248

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SN+RFKS EHRVLAN+ GPRVSVA FF+T  +P  R+YGPIKELLSE+NPPKYRETT++
Sbjct  249  ISNERFKSVEHRVLANRVGPRVSVASFFSTGMLPLGRLYGPIKELLSEDNPPKYRETTIR  308

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  HF  KGLDGTSAL HF L
Sbjct  309  EYNAHFIDKGLDGTSALTHFEL  330



>ref|XP_010262287.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nelumbo nucifera]
Length=372

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+EI +G+R F+EQD +V+K +Y+R   + V YNSNF LY + +ANWRDTL+CVM+PN
Sbjct  111  SVLDEILQGVRRFNEQDVDVRKRFYSRDTKKKVVYNSNFVLYQSAAANWRDTLYCVMSPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P ++P VC DI+I+YS +V++L   L ELLSEAL L P++L ++ C +  +IL HYY
Sbjct  171  PPSPEEIPQVCRDIMIQYSGQVERLAVTLLELLSEALMLKPSHLVDMGCAESHAILCHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GTSKHADNDF TILLQ D IGGLQVLHQN W DV    GALVVNIGDLLQ
Sbjct  231  PACPEPELTMGTSKHADNDFMTILLQ-DQIGGLQVLHQNHWVDVPPLRGALVVNIGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDR +S EHRV+AN  GPRVSVACFF T    S + YGPIKELLSEENPP YRE T+
Sbjct  290  LISNDRLRSVEHRVVANNVGPRVSVACFFPTSVQESIKRYGPIKELLSEENPPIYREITI  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             E+  +F++KGLDG+  L HF+L
Sbjct  350  PEFSSYFYSKGLDGSPMLDHFKL  372



>emb|CBI23604.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/259 (65%), Positives = 202/259 (78%), Gaps = 6/259 (2%)
 Frame = -1

Query  867  GIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpphphqlp  688
            GIR FHEQD E KKEWYTR  +R V+Y+SNFDLY A S NWRDT  C +AP+PP P QLP
Sbjct  4    GIRRFHEQDGEAKKEWYTRDYSRKVTYSSNFDLYQASSTNWRDTFACTLAPDPPQPEQLP  63

Query  687  PVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPEPDL  508
             VC DIL++Y K V++LG  LFELLSEALGLHPN+L N+EC +G+ +LGHYYPACPEP+L
Sbjct  64   AVCRDILMEYLKHVRRLGFSLFELLSEALGLHPNHLKNMECAEGILLLGHYYPACPEPEL  123

Query  507  TLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLVSNDRFK  328
            TLGTS H D DF TIL+Q D +GGLQVLH++QW ++    GALV+N+GDLLQ VSN  FK
Sbjct  124  TLGTSSHTDADFITILIQ-DQMGGLQVLHEDQWVNIPPISGALVINVGDLLQFVSNGNFK  182

Query  327  SSEHRVLANQDGPRVSVACFFNTYAVP---SSRVYGPIKELLSEENPPKYRETTL-KEYE  160
            SSEHRVLA   GPR+SVACFF    +P   ++R+YGPIKELLSE+NPP YR+     EY 
Sbjct  183  SSEHRVLAKNVGPRISVACFFRK-IIPVENTTRLYGPIKELLSEDNPPIYRQENFPNEYL  241

Query  159  DHFHAKGLDGTSALLHFRL  103
             H+ +KGLDGTS+LL F+L
Sbjct  242  MHYDSKGLDGTSSLLRFKL  260



>gb|KCW60394.1| hypothetical protein EUGRSUZ_H03111 [Eucalyptus grandis]
Length=282

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 209/261 (80%), Gaps = 1/261 (0%)
 Frame = -1

Query  885  LEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            +EE++ G+R F+EQD E KK +YTR +TR V YNSNFDLYTA  ANWRDT FC MAP+PP
Sbjct  23   MEEMKEGVRRFYEQDDEAKKAFYTRDVTRKVVYNSNFDLYTAAVANWRDTFFCYMAPSPP  82

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P +LP VC DIL+ YSK+V  LGG+LFELLSE+LGL  + L  ++C +GL ++ HYYPA
Sbjct  83   SPEELPEVCRDILMDYSKQVMSLGGLLFELLSESLGLRLDRLREMDCAEGLVVICHYYPA  142

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CP P+LT+GTSKH+DNDF T+ L  D IGGLQVLH N+W DV   PGALVVN+GDLLQL+
Sbjct  143  CPRPELTMGTSKHSDNDFLTVFLH-DHIGGLQVLHDNRWVDVPPVPGALVVNVGDLLQLI  201

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLKE  166
            +ND+FKS EHRVLAN  GPR+SVACFF+T   PSS+++GPI+ELLSE+NPP YRETT+++
Sbjct  202  TNDKFKSVEHRVLANPVGPRISVACFFSTSFQPSSKLFGPIRELLSEDNPPIYRETTVRD  261

Query  165  YEDHFHAKGLDGTSALLHFRL  103
            Y  +F   GLDGTS L HF+L
Sbjct  262  YLAYFKEHGLDGTSPLRHFKL  282



>ref|XP_008224374.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=403

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 201/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VL+E+    RGFHE   EVK E+Y+R L R V + SNFDLY +  ANWRD+LFCVM P 
Sbjct  140  RVLDEMLAAARGFHELHREVKSEYYSRELLRKVKFGSNFDLYQSRFANWRDSLFCVMGPE  199

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P +LP +C DI ++YS+ V K+G  LFELLSEALGL P++L  ++C KG  IL HYY
Sbjct  200  PLDPQELPLICRDITMEYSENVHKMGVTLFELLSEALGLKPDHLIGLDCAKGHLILSHYY  259

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GTSKH+D DF TILLQ D IGGLQVL++NQW DV   PGALVVNIGDLLQ
Sbjct  260  PPCPEPELTMGTSKHSDPDFLTILLQ-DQIGGLQVLYENQWIDVPPVPGALVVNIGDLLQ  318

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LVSNDRFKS EH+VLAN  GPRVS+ACF   +  PS+R+YGPIKELLSE+ PP Y+ET+L
Sbjct  319  LVSNDRFKSVEHQVLANHAGPRVSIACFLTPHLHPSTRLYGPIKELLSEDRPPVYKETSL  378

Query  171  KEYEDHFHAKGLDGTSALLHFR  106
            K++  ++  KGLDG SAL HF+
Sbjct  379  KDFIAYYDKKGLDGNSALTHFK  400



>ref|XP_004247708.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum lycopersicum]
 ref|XP_010326754.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum lycopersicum]
Length=375

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 208/264 (79%), Gaps = 3/264 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMAp  715
            VLEE+ +G R F EQD E+KK +YTR  T+ V++ SNFDL++   P+A+WRD+L+C M P
Sbjct  111  VLEEMLQGARRFFEQDVEIKKRYYTRDTTKKVAHVSNFDLFSPSVPAASWRDSLYCFMCP  170

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P + P VC +ILI++SK++ KLG  LFELLSE LGL+P +L ++ C +GLSI  HY
Sbjct  171  NPPSPEEFPTVCREILIEFSKKMMKLGCSLFELLSEGLGLNPCHLKDMNCAEGLSIAQHY  230

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACP+P+LT+GT +H+D  F T+LLQDD IGGLQV HQNQW DV    GALVVNIGDLL
Sbjct  231  YPACPQPELTIGTRQHSDCVFITVLLQDD-IGGLQVRHQNQWIDVPPTRGALVVNIGDLL  289

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND++ S EHRVL+N+ GPR+SV CFF+T A PS R+YGPIKELLSE NPPKYR TT
Sbjct  290  QLISNDKYISVEHRVLSNKVGPRISVPCFFSTGAFPSPRIYGPIKELLSECNPPKYRATT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KEY D+F  KG DGTS LL +++
Sbjct  350  VKEYTDYFRKKGFDGTSTLLDYKI  373



>ref|XP_006354516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=382

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 208/264 (79%), Gaps = 3/264 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMAp  715
            VLEE+ +G R F EQD E+KK++YTR  T+ V++ SNFDL++   P+A+WRD+L+C M P
Sbjct  118  VLEEMLQGARRFFEQDVEIKKQYYTRDTTKKVAHVSNFDLFSPSVPAASWRDSLYCFMCP  177

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P + P  C +ILI++SK++ KLG  LFELLSE LGL+P +L ++ C +GLSI  HY
Sbjct  178  NPPSPEEFPTACREILIEFSKKMMKLGYSLFELLSEGLGLNPCHLKDMNCAEGLSIAQHY  237

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACP+P+LT+GT +H+D  F T+LLQDD IGGLQV HQNQW DV   PGALVVNIGDLL
Sbjct  238  YPACPQPELTIGTRQHSDCVFITVLLQDD-IGGLQVRHQNQWIDVPPTPGALVVNIGDLL  296

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND++ S EHRVL+N+ GPR+SV CFF+T A PS R+YGPIKEL SE NPPKYR TT
Sbjct  297  QLISNDKYISVEHRVLSNKVGPRISVPCFFSTGAFPSPRIYGPIKELSSECNPPKYRATT  356

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KEY D+F  KG DGTS LL +++
Sbjct  357  VKEYTDYFRKKGFDGTSTLLDYKI  380



>emb|CDO99213.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 204/264 (77%), Gaps = 1/264 (0%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
              VLEE+    R FHE   E K+ +YTR  ++ V Y SNFDLY + SANWRDTLFCVM P
Sbjct  95   ARVLEEMLSRARDFHELPHEEKRVYYTRQTSKKVQYTSNFDLYKSRSANWRDTLFCVMGP  154

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             P  P QLP VC DIL++Y+++++KLG  LFELLSEALGL  ++L  ++C +  ++L HY
Sbjct  155  EPLDPLQLPEVCRDILMEYTEQMRKLGTALFELLSEALGLKSDHLVGMDCAEAQAVLSHY  214

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GTSKH+D DF TILLQ D IGGLQVLHQN W +V    GALVVN+GDLL
Sbjct  215  YPACPEPELTMGTSKHSDPDFLTILLQ-DHIGGLQVLHQNHWVNVPPVAGALVVNVGDLL  273

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND+F S EHRV AN  GPRVS+ACFF  +  PS+R+YGP+KELLSE+NPP YRETT
Sbjct  274  QLISNDQFISVEHRVRANHVGPRVSIACFFKPHLYPSTRLYGPMKELLSEDNPPVYRETT  333

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++E+  ++++KGLDG  ALLHF+L
Sbjct  334  MQEFVAYYNSKGLDGVPALLHFKL  357



>gb|KFK31253.1| hypothetical protein AALP_AA6G088500 [Arabis alpina]
Length=363

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 209/264 (79%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQD+EV+K++Y+R  T+ V YNSNFDLY++PS NWRDTL C M P+
Sbjct  102  DLLEKMKDGVRGFHEQDSEVRKKFYSRDNTKTVRYNSNFDLYSSPSTNWRDTLSCFMFPD  161

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P   +LP +C +I+++YSK V KL  ++FELLSEALGL+PN+L  ++C KGL +L HYY
Sbjct  162  LPKAEELPEICGEIMLEYSKGVMKLAELIFELLSEALGLNPNHLKEMDCTKGLFMLSHYY  221

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPD T GTS+H+D  F TILLQ D IGGLQVLH + W DV    GAL+VN+GD+LQ
Sbjct  222  PPCPEPDRTFGTSQHSDRSFLTILLQ-DHIGGLQVLHDDYWVDVPPVSGALLVNLGDILQ  280

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L+SND+F S EHRVLAN+ + PR+SVA FF  + +PS RVYGPI+ELLSEENPPKYR+TT
Sbjct  281  LISNDKFVSVEHRVLANRGEKPRISVASFF-VHPLPSLRVYGPIEELLSEENPPKYRDTT  339

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY   + A+GLDG S LLH+++
Sbjct  340  ITEYTSQYMARGLDGNSVLLHYKI  363



>ref|XP_010557155.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=370

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+  FHEQD EVKK +YTR  T+ V YNSNFDLY++P+A WRDT  C ++P+
Sbjct  108  HVLEEMNDGVVRFHEQDPEVKKGFYTRDPTKKVVYNSNFDLYSSPAATWRDTFGCYLSPD  167

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP    +P  C DI++++ K V K+  +LFELLSEALGL PN+L +++C K L +L HYY
Sbjct  168  PPRLEDMPTTCRDIMMEFGKGVMKVAELLFELLSEALGLMPNHLKDMDCAKALLMLCHYY  227

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG SKH+DN F T++LQD++ GGLQVLH + W DV   PGALVVN+GDLLQ
Sbjct  228  PPCPQPDLTLGLSKHSDNSFLTVVLQDNN-GGLQVLHGDNWVDVPPVPGALVVNVGDLLQ  286

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S+EHRVLA + +GPR SVACFF+TY +P+SR+YGP+KEL+SE+NP KYR+TT
Sbjct  287  LITNDKFISAEHRVLAKRGNGPRTSVACFFSTYLMPNSRLYGPMKELVSEQNPAKYRDTT  346

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + E+  ++ AKG DGTSALLH R+
Sbjct  347  ITEFAAYYRAKGHDGTSALLHLRI  370



>ref|XP_009119045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Brassica rapa]
Length=363

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE ++ G+R FHE D EV+K +Y+R  +  + Y+SNFDLY++P+ANWRDTL C  AP+
Sbjct  102  DVLERMKEGVREFHELDPEVRKGFYSRDPSNKLVYSSNFDLYSSPAANWRDTLGCYTAPD  161

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP  C +++I+YSKEV K+G +LFELLSEALGL+ N+L +++C   L +LGHYY
Sbjct  162  PPRPEDLPAACGEVMIEYSKEVMKVGKMLFELLSEALGLNTNHLKDMDCTNSLLLLGHYY  221

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG +KH+DN F T+LLQ D++GGLQVLH   W DV   PGALV+N+GDLLQ
Sbjct  222  PPCPQPDLTLGLTKHSDNSFLTVLLQ-DNVGGLQVLHDQYWVDVPPVPGALVINVGDLLQ  280

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++N +F S EHRVLAN  GPR+SVACFF++Y + + RVYGPIKELLSEENPP YR+TT+
Sbjct  281  LITNGKFISVEHRVLANGAGPRISVACFFSSYLMANPRVYGPIKELLSEENPPIYRDTTI  340

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   + +KG DGTS LL+ ++
Sbjct  341  TEYSKFYRSKGFDGTSGLLYLKI  363



>ref|XP_003596185.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66436.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=358

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 201/263 (76%), Gaps = 0/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLE+++ G+  F EQD EVKKE Y+R   R  SYNSNF+LY++ + NWRDT  C +APN
Sbjct  96   NVLEDMRNGVIRFFEQDVEVKKELYSRDPMRPFSYNSNFNLYSSSALNWRDTFVCSLAPN  155

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP VC D L++Y + V KLG  LFELLSEALGLHPN+L ++ C KG+  L HYY
Sbjct  156  APKPQDLPLVCRDELLEYGEYVTKLGMTLFELLSEALGLHPNHLKDMGCAKGILSLSHYY  215

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT+KH+D+ F T+LLQDD IGGLQV HQN+W D+   P ALVVN+GDLLQ
Sbjct  216  PACPEPELTMGTTKHSDSCFLTLLLQDDHIGGLQVFHQNKWIDIPPIPDALVVNVGDLLQ  275

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LV+ND+FKS EH+VLAN  GPRVSVACFFN      S  YGPIKE LSE+NPPKY+E T+
Sbjct  276  LVTNDKFKSVEHKVLANIIGPRVSVACFFNADLNSFSNQYGPIKEFLSEDNPPKYKEITI  335

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  +++ KG+DG SAL HFR+
Sbjct  336  SEYVAYYNTKGIDGISALQHFRV  358



>ref|XP_010023986.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X1 [Eucalyptus grandis]
 gb|KCW60403.1| hypothetical protein EUGRSUZ_H03121 [Eucalyptus grandis]
Length=374

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 198/263 (75%), Gaps = 4/263 (2%)
 Frame = -1

Query  882  EEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            EE+  GIR FHEQD E K+EWY+R    R V YNSNFDLY AP+ANWRDTL CV+AP  P
Sbjct  113  EEMVEGIRRFHEQDLEAKREWYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSCVLAPRSP  172

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P +LP VC D++I+Y   + +L   +FELLSEALGL P+YL  I C +GL  +GHYYP 
Sbjct  173  DPQELPAVCRDVIIEYKDRILELADTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPP  232

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CPEPDLTLGT  H D+ F TILLQ D IGGLQV HQNQW DV   PGALV+N+GDL+QL+
Sbjct  233  CPEPDLTLGTGDHTDSGFLTILLQ-DQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLI  291

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRETTL  172
            SND+F S  HRVLA + GPR+SVAC    +  P  SSR+YGPI+ELLSEENPP YRETT+
Sbjct  292  SNDKFISVSHRVLAQKIGPRISVACLMRQHLPPENSSRLYGPIEELLSEENPPIYRETTV  351

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+   H++AKGL+G SAL HF+L
Sbjct  352  KDLVTHYYAKGLNGVSALEHFKL  374



>gb|AFK38415.1| unknown [Medicago truncatula]
Length=371

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 198/263 (75%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLE+++ G+  F EQD EVKKE YTR  TR + YNSNFDLY++P+ NWRDT  C  A N
Sbjct  110  NVLEDMKDGVIRFFEQDIEVKKEMYTRDQTRPLVYNSNFDLYSSPALNWRDTFICDFALN  169

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP VC DIL++Y   + KLG +LFELLSEALGL  N+L +++C +G  +LGHYY
Sbjct  170  APKLEDLPVVCRDILMEYGTRLMKLGTILFELLSEALGLRSNHLKDLDCCEGNILLGHYY  229

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEPDLT+GT+KH+D  F T+LLQ D IGGLQVL+Q +W DV   P ALVVNIGDLLQ
Sbjct  230  PACPEPDLTMGTTKHSDGSFLTVLLQ-DHIGGLQVLYQEKWIDVPPVPEALVVNIGDLLQ  288

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN  GPR+SVACFF        ++YGPI ELLSE+NPP+YRETT 
Sbjct  289  LITNDKFKSVEHRVLANDIGPRISVACFFKAGLRAHEKLYGPITELLSEDNPPRYRETTF  348

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +  AKGLDGTS L HF+L
Sbjct  349  ADYVAYLCAKGLDGTSVLQHFKL  371



>ref|XP_002529301.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33070.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=359

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 214/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLEE++ GIR F+EQD E+KKE+Y+R  T+ + YNSNFDL+TA +ANWRDT+F +MAP+
Sbjct  98   NVLEEMKDGIRRFYEQDIELKKEFYSRDYTKKIVYNSNFDLFTAQAANWRDTIFFLMAPD  157

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP VC +IL +Y KEV  LG +L ELLSEALGL P++L  ++C +GL++L HYY
Sbjct  158  PPKSEELPAVCRNILKEYCKEVTSLGNLLLELLSEALGLSPSHLKEMDCAEGLAVLCHYY  217

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTL TSKH DNDF T+LLQ D IGGLQV HQNQW DV   PGALVVNIGDLLQ
Sbjct  218  PACPQPELTLATSKHTDNDFLTVLLQ-DHIGGLQVQHQNQWIDVPPTPGALVVNIGDLLQ  276

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+F S EHRVLAN  GPR+S ACFF+T  +P SR+YGPI+ELLSEENPPKYRETT+
Sbjct  277  LISNDKFISVEHRVLANHIGPRISAACFFSTSVMPKSRLYGPIQELLSEENPPKYRETTV  336

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  + + KGLDGTS LLHF+L
Sbjct  337  TEYVLYSNGKGLDGTSPLLHFKL  359



>ref|XP_006350684.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=361

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 209/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G+R F+EQDTEVKK+WYTR  ++ V YNSNFDL+ + SA WRDT +C MAP 
Sbjct  100  SVLEEMLNGVRRFYEQDTEVKKQWYTRDTSKKVVYNSNFDLFKSASAYWRDTTYCNMAPL  159

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP  C DILI+Y+++V+KLG  LFELLSEALGL+P+YLN+I C++GL++L H Y
Sbjct  160  PPSADELPDACRDILIEYTEQVKKLGRSLFELLSEALGLNPSYLNDIGCSEGLAVLYHCY  219

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PA PEP+LTLG  KH+D+DF T+LLQ D +GGLQV+H+N W D+    GALVVN+G+LLQ
Sbjct  220  PASPEPELTLGAGKHSDSDFLTVLLQ-DHLGGLQVIHKNYWVDIPPVSGALVVNVGELLQ  278

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+ KS  HRVLA+  GPRVSVA FF T    SSRVYGPIKELLS++NP +YRET++
Sbjct  279  LISNDKLKSIAHRVLASGVGPRVSVASFFTTGHSLSSRVYGPIKELLSKDNPARYRETSV  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+Y DH++A G+ G SAL  FR+
Sbjct  339  KDYADHYNATGIGGKSALSDFRI  361



>emb|CBI23596.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 209/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+ +GIR F+EQDTEVKKE+YTR  ++ V + SNFDL+ AP+A W+D+  C++ PN
Sbjct  98   SVLEEMIKGIRRFNEQDTEVKKEFYTRDSSKKVKFVSNFDLFQAPAATWKDSFSCIINPN  157

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  +P VC DI+++YSK+V+ L   LFEL++EALGL+ N+L ++EC +GL ++ HYY
Sbjct  158  PPDPTDMPAVCRDIIMEYSKQVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYY  217

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT  H D  F T+LLQ D +GGLQVLH+ QW +V+  PGALV+N GDLLQ
Sbjct  218  PACPEPELTMGTKTHTDPTFLTVLLQ-DQVGGLQVLHEKQWVNVNPVPGALVINTGDLLQ  276

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LVSND F+S++HRVLAN  GPRVSVA FF+  ++P S++YGPIKELLSEENPPKY+ETT 
Sbjct  277  LVSNDMFRSAKHRVLANHKGPRVSVASFFSPSSLPPSKLYGPIKELLSEENPPKYKETTA  336

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +  A+ L GTSAL HF+L
Sbjct  337  RDYGTYHRAERLGGTSALQHFKL  359



>ref|XP_006354513.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 216/265 (82%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +VLEE+ +G R F EQD E+KK+ Y+R  T+ V + SNFDLY+   P+ANWRDTLFC+MA
Sbjct  110  SVLEEMLQGTRQFFEQDVEIKKQHYSRDSTKRVIHTSNFDLYSPSVPAANWRDTLFCLMA  169

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C +IL++YSK+V KLG  L ELLSE LGL   +L +++C +GL ILGH
Sbjct  170  PDPPSPQELPTACGEILMEYSKDVMKLGFSLLELLSEGLGLDRCHLKDMDCAEGLGILGH  229

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+L +GT+KH+DNDF T+L+QD  IGGLQVLHQNQW DV   PGALVVNIGDL
Sbjct  230  YYPACPQPELAIGTNKHSDNDFITVLIQDH-IGGLQVLHQNQWVDVPPTPGALVVNIGDL  288

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++ S EHRVLAN+ GPR+SVACFF T ++PSS++YGPI ELLSE+NPPKYR T
Sbjct  289  LQLISNDKYISVEHRVLANKVGPRISVACFFYTGSMPSSKLYGPITELLSEDNPPKYRAT  348

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+Y D+F  KGLDGTS LLH+R+
Sbjct  349  TVKDYRDYFRKKGLDGTSTLLHYRI  373



>gb|AFK38250.1| unknown [Lotus japonicus]
Length=365

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 204/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G++ F EQD+EV K +YTR   +  +YNSNFD+Y++P+ NWRDT  C MAP+
Sbjct  104  SVLEEIKNGVKRFFEQDSEVTKGFYTRDKVKSFTYNSNFDIYSSPALNWRDTFTCYMAPD  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP VC DIL++Y K V  L  +LFELLSEALGL+P++L ++ C +GL  LGHYY
Sbjct  164  APKPEDLPVVCRDILLEYGKHVMNLATLLFELLSEALGLNPSHLKDMGCAEGLVALGHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP LT+GT+KH+D DF T+LLQ D IGGL VLHQN+W +V    GALVVN+GD LQ
Sbjct  224  PACPEPQLTVGTTKHSDADFLTVLLQ-DHIGGLLVLHQNEWVNVTPESGALVVNVGDFLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            +++NDRFKS EHRVLAN  GPR+SVACFF+T    SS++YGPIKELLS++NPPKYR  T+
Sbjct  283  IIANDRFKSVEHRVLANHVGPRISVACFFSTGHRSSSKLYGPIKELLSKDNPPKYRGITV  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  +F  KG+DGT+AL H+ L
Sbjct  343  ADYSAYFEEKGMDGTTALTHYML  365



>ref|XP_010904577.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Elaeis guineensis]
Length=359

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 201/262 (77%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL+E+  G+R FHE+  EVK+E+Y+R   + VS+ SNFDLY AP+ANWRD++FC MAP P
Sbjct  98   VLDEMLAGVRSFHEEKAEVKREYYSRDSRKKVSFYSNFDLYQAPAANWRDSVFCWMAPEP  157

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LPP C  I  +YS  V+ LG VL ELLSEALGL  +YL  +EC KG +++ +YYP
Sbjct  158  PEPEELPPACRQITFEYSDHVKSLGNVLLELLSEALGLPSDYLKEMECAKGHALVSNYYP  217

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEP LTLGTSKH+D DF TILLQ D +GGLQ+LHQ  W DV    GALVVNIGDLLQL
Sbjct  218  PCPEPHLTLGTSKHSDPDFLTILLQ-DHVGGLQILHQQHWVDVPPVAGALVVNIGDLLQL  276

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDR KS EHRVLAN  GPRVSVACFF  +  PSSR+YGPIKELLS+E+PP YRE  L+
Sbjct  277  ISNDRLKSVEHRVLANSVGPRVSVACFFTMHLYPSSRLYGPIKELLSDESPPLYREILLR  336

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            ++  H+ +KGLDG SAL +F+L
Sbjct  337  DFISHYDSKGLDGQSALSYFKL  358



>ref|XP_010023982.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Eucalyptus grandis]
 gb|KCW60393.1| hypothetical protein EUGRSUZ_H03109 [Eucalyptus grandis]
Length=374

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 198/263 (75%), Gaps = 4/263 (2%)
 Frame = -1

Query  882  EEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            EE+  GIR FHEQD E K+EWY+R    R V YNSNFDLY AP+ANWRDTL CV+AP  P
Sbjct  113  EEMVEGIRRFHEQDLEAKREWYSRDFGGRKVLYNSNFDLYQAPAANWRDTLSCVLAPRSP  172

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P +LP VC D++I+Y   + +L   +FELLSEALGL  +YL  I+C +GL  +GHYYP 
Sbjct  173  DPQELPAVCRDVIIEYKDRILELADTVFELLSEALGLESSYLKTIQCGEGLFFVGHYYPP  232

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CPEPDLTLGT  H D+ F TILLQ D IGGLQV HQNQW DV   PGALV+N+GDL+QL+
Sbjct  233  CPEPDLTLGTGDHTDSGFLTILLQ-DQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLI  291

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRETTL  172
            SND+F S  HRVLA + GPR+SVAC    +  P  SSR+YGPI+ELLSEENPP YRETT+
Sbjct  292  SNDKFISVSHRVLAQKIGPRISVACLMRQHLPPENSSRLYGPIEELLSEENPPIYRETTV  351

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+   H++AKGL+G SAL HF+L
Sbjct  352  KDLVTHYYAKGLNGVSALEHFKL  374



>ref|XP_010672098.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 207/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGL-TRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             VLEEI +G+R F E+D E+KK +Y+R    +   YNSN +LY   +ANWRD+   +MAP
Sbjct  90   TVLEEILKGVREFFEEDDEMKKSYYSRDYENKTFVYNSNINLYKGKTANWRDSFGVMMAP  149

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             PP PHQLP  C +ILI+YSK+V K+G VLFELLSEALGL   +LN I C++GL+++GHY
Sbjct  150  YPPLPHQLPTPCREILIEYSKQVMKVGKVLFELLSEALGLEAKHLNEIGCSEGLNVMGHY  209

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACP+P+LTLGTSKHADN F T+LLQD  IGGLQVLH N+W DV   PGALVVNIGDLL
Sbjct  210  YPACPQPELTLGTSKHADNVFLTLLLQDQ-IGGLQVLHHNRWVDVPPTPGALVVNIGDLL  268

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++ND++KS EHRVLAN+ GPR+SVA FF+T+ + +SR YGPIKELLSE NPPKYRETT
Sbjct  269  QLITNDKYKSVEHRVLANKRGPRISVASFFSTFLLETSRKYGPIKELLSESNPPKYRETT  328

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KE   +F   GL+G SA  HFRL
Sbjct  329  VKECSAYFINNGLNGGSAREHFRL  352



>ref|XP_002889611.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65870.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=368

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 205/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EV+KE Y+R   R   Y SNFDLY+AP+ANWRDT +C MAP+
Sbjct  106  DLLEKMKDGVRDFHEQPPEVRKELYSRDFNRKFMYLSNFDLYSAPAANWRDTFYCYMAPD  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++YSK+V  LG  LFELLSEALGL+PN+L +++C KGL +L HY+
Sbjct  166  PPKPEDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMDCLKGLRMLCHYF  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS H+D+ F TILL  D I GLQVL +  WFDV   PGAL++NIGDLLQ
Sbjct  226  PPCPEPDLTFGTSPHSDSSFLTILLP-DQIKGLQVLREGYWFDVPHVPGALIINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S  HRVLAN+    RVSVACFF T+  P+ RVYGPIKEL+SEENPPKYRETT
Sbjct  285  LITNDKFISLGHRVLANRATRARVSVACFFTTHVKPNPRVYGPIKELVSEENPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +  Y  +F+ KGL GTSALLHF++
Sbjct  345  ITNYATYFNGKGLGGTSALLHFKV  368



>ref|NP_180642.1| 2-oxoglutarate dependent oxygenase-like protein [Arabidopsis 
thaliana]
 gb|AAC20719.1| putative dioxygenase [Arabidopsis thaliana]
 gb|AEC08447.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein 
[Arabidopsis thaliana]
Length=362

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 207/264 (78%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+E+++ GIRGFHEQD++V+K++YTR +T+ V YNSNFDLY++PSANWRDTL C MAP+
Sbjct  101  DVMEKMKDGIRGFHEQDSDVRKKFYTRDVTKTVKYNSNFDLYSSPSANWRDTLSCFMAPD  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP +C +I+++Y+K V KLG ++FELLSEALGL+PN+L  ++C KGL +L HYY
Sbjct  161  VPETEDLPDICGEIMLEYAKRVMKLGELIFELLSEALGLNPNHLKEMDCTKGLLMLSHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP LT GTS H+D  F TILLQ D IGGLQV     W DV   PGAL+VN+GDLLQ
Sbjct  221  PPCPEPGLTFGTSPHSDRSFLTILLQ-DHIGGLQVRQNGYWVDVPPVPGALLVNLGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+ + PR+SVA FF  + +PS RVYGPIKELLSE+N PKYR+TT
Sbjct  280  LMTNDQFVSVEHRVLANKGEKPRISVASFF-VHPLPSLRVYGPIKELLSEQNLPKYRDTT  338

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY  H+ A+GL G S LL F++
Sbjct  339  VTEYTSHYMARGLYGNSVLLDFKI  362



>ref|XP_008779114.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Phoenix dactylifera]
Length=363

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 205/263 (78%), Gaps = 3/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL+E+  G+R F+E   EVK+E+YTR   + V +NSNFDLY AP+ANWRDT+FC MAP P
Sbjct  103  VLDEMLAGVRTFNEAAAEVKREYYTRDPAKKVQFNSNFDLYQAPAANWRDTMFCAMAPEP  162

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C +I ++Y+  +QK+G  LFELLSEALGL+ ++LN +EC KGL ++ HYYP
Sbjct  163  PRPDELPLACREITLQYANHIQKVGIFLFELLSEALGLNRDHLNEMECAKGLGVVAHYYP  222

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEP LTLG SKH+D DF TILLQ D IGGLQV+HQNQW DV   PGAL+VNIGDLLQL
Sbjct  223  PCPEPHLTLGISKHSDPDFLTILLQ-DQIGGLQVVHQNQWIDVPPLPGALIVNIGDLLQL  281

Query  348  VSNDRFKSSEHRVLANQD-GPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            +SNDR KS EHRVLAN+   PR+SVACFF+T+  PS+++YGPIKELLS E  P Y+E + 
Sbjct  282  ISNDRLKSVEHRVLANKSVDPRISVACFFSTHFYPSTKLYGPIKELLSNER-PMYKEVSA  340

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY  ++ +KGLDG SAL +F++
Sbjct  341  KEYVTYYKSKGLDGQSALNYFKI  363



>dbj|BAB68392.1| CmE8 [Cucumis melo]
Length=367

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 214/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V EEI   +R F EQD+EVKK++YTR  T+   YN NFDL+++P ANWRDT+  VMAPN
Sbjct  106  SVQEEIINRVRRFFEQDSEVKKQYYTRDYTKSFIYNCNFDLFSSPVANWRDTIVTVMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+PH LP VC DIL +YSK + KLG ++F LLSEALGL   +L +++CN+GL I+GHYY
Sbjct  166  PPNPHDLPQVCRDILFEYSKHIMKLGELIFGLLSEALGLKSTHLVDLDCNEGLRIIGHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+ P+P+L++GT++H+D+ F T+LLQD+ +GGLQV  QN+W DV   PGA V+N+G+LLQ
Sbjct  226  PSSPQPELSIGTTEHSDDTFITVLLQDN-MGGLQVRQQNKWVDVPPVPGAFVINVGNLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRF SSEH+VLAN++GPR+SVA FF+T  +P+S++YGPIKELLSE+NPPKY+E T+
Sbjct  285  LITNDRFVSSEHKVLANREGPRISVASFFSTGRLPTSKLYGPIKELLSEQNPPKYKEITV  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F  KGLDGTSAL HF++
Sbjct  345  REYNIYFAEKGLDGTSALPHFKI  367



>ref|XP_009119312.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
6-like [Brassica rapa]
Length=355

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPS--ANWRDTLFCVMA  718
            +V+EEI+ G+R FHEQD EVKK ++TR  T+ V YNSNFDLY   S   NWRDT  C MA
Sbjct  92   SVIEEIKGGVRRFHEQDLEVKKSYFTRDPTKSVVYNSNFDLYNPSSLCVNWRDTFVCCMA  151

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP+  ++P  C D +I+YSK V  LGG LFELLSEALGLH   L +++C K L++LGH
Sbjct  152  PDPPNLEEIPLACRDAMIEYSKHVMTLGGFLFELLSEALGLHSEILKSMDCMKALNVLGH  211

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTL TS+H+D+ F TILL D  IGGLQ+LH++ W DV   PGALV+NIGD 
Sbjct  212  YYPPCPQPDLTLCTSQHSDSSFITILLHDQ-IGGLQILHKDSWVDVTPLPGALVINIGDY  270

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN+ GPR+SVA FF+T  +P+S VYGPIKELLSEENPPKY++ 
Sbjct  271  LQLITNDKFISVEHRVLANRAGPRISVAGFFSTNMLPNSTVYGPIKELLSEENPPKYKDI  330

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            TL+EY   +  KGLDGTS L  F++
Sbjct  331  TLEEYNRGYFEKGLDGTSHLSRFKI  355



>emb|CDY18226.1| BnaC05g02490D [Brassica napus]
Length=355

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 205/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G+  FHE+D EVKK +++R   +   Y++NF+LY++ + NWRD+  C MAPN
Sbjct  94   SVLEEIKDGVVRFHEEDPEVKKTYFSRDFAKTFIYHNNFELYSSSAGNWRDSFACYMAPN  153

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  +P  C D +I YSK V  LGG+LFELLSEALGL  + L ++ C KGL +L HYY
Sbjct  154  PPNPEDIPVACRDAMIGYSKHVMSLGGLLFELLSEALGLSSDKLKSLGCMKGLLMLCHYY  213

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PD+TLGTSKH+DN F T+LLQD  IGGLQVLHQ+ W DV   PGALV+NIGD LQ
Sbjct  214  PPCPQPDITLGTSKHSDNTFITMLLQDQ-IGGLQVLHQDCWVDVSPIPGALVINIGDFLQ  272

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+FKS EHRVLAN+ GPR+SVACFF++  +P+S VYGPIKEL+SEENPPKYRE T+
Sbjct  273  LMTNDKFKSVEHRVLANKAGPRISVACFFSSSVIPNSTVYGPIKELVSEENPPKYREFTV  332

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   +  KGLDGTS LL++++
Sbjct  333  PEYSKGYIEKGLDGTSHLLNYKI  355



>ref|XP_008438542.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1-like [Cucumis melo]
Length=384

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 214/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V EEI   +R F EQD+EVKK++YTR  T+   YN NFDL+++P ANWRDT+  VMAPN
Sbjct  123  SVQEEIINRVRRFFEQDSEVKKQYYTRDYTKSFIYNCNFDLFSSPVANWRDTIVTVMAPN  182

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+PH LP VC DIL +YSK + KLG ++F LLSEALGL   +L +++CN+GL I+GHYY
Sbjct  183  PPNPHDLPQVCRDILFEYSKHIMKLGELIFGLLSEALGLKSTHLVDLDCNEGLRIIGHYY  242

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+ P+P+L++GT++H+D+ F T+LLQD+ +GGLQV  QN+W DV   PGA V+N+G+LLQ
Sbjct  243  PSSPQPELSIGTTEHSDDTFITVLLQDN-MGGLQVRQQNKWVDVPPVPGAFVINVGNLLQ  301

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRF SSEH+VLAN++GPR+SVA FF+T  +P+S++YGPIKELLSE+NPPKY+E T+
Sbjct  302  LITNDRFVSSEHKVLANREGPRISVASFFSTGRLPTSKLYGPIKELLSEQNPPKYKEITV  361

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F  KGLDGTSAL HF++
Sbjct  362  REYNIYFAEKGLDGTSALPHFKI  384



>gb|EYU42211.1| hypothetical protein MIMGU_mgv1a008992mg [Erythranthe guttata]
Length=356

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 200/262 (76%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+  GIR F+E D   KK +YTR +TR   YNSNFDLY+AP+ANWRDT F  MAPNP
Sbjct  96   VLEEMLCGIRRFNELDAGAKKLYYTRDVTRKFVYNSNFDLYSAPAANWRDTFFSYMAPNP  155

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C DI I+YS+ V  LG  LF LLSEALGL  + L  + C  GL+ LGHYYP
Sbjct  156  PKPEELPASCRDIQIEYSRHVMSLGFRLFGLLSEALGLESSRLFEMGCTDGLTFLGHYYP  215

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLG SKH D+ F T+LLQD  IGGLQV   N W D+    GALV+NIGDLLQL
Sbjct  216  ACPQPELTLGASKHTDDGFLTVLLQDQ-IGGLQVFLNNMWIDIPPVHGALVINIGDLLQL  274

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRVLAN+ GPR+SVACFF+T  +PSS++YGPIKELLS++NPPKYRETT++
Sbjct  275  ISNDKFKSVEHRVLANRKGPRMSVACFFSTSMMPSSKIYGPIKELLSKDNPPKYRETTVE  334

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  +   KGLDG S LLHF++
Sbjct  335  EYVTYSFTKGLDGVSPLLHFKI  356



>ref|XP_010414213.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 201/264 (76%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+E+++ GIRGFHEQD+EVKK +Y+R +T+ V YN+NFDLY++ + NWRDTL  VMAP+
Sbjct  98   DVMEKMKDGIRGFHEQDSEVKKTFYSRDMTKKVKYNTNFDLYSSQAVNWRDTLTTVMAPD  157

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                  LP VC +I+++YSK + KLG ++FELLSEALGL PN+L  ++C K LS+L HYY
Sbjct  158  GLQVEDLPAVCREIMLEYSKRMMKLGEIIFELLSEALGLKPNHLKELDCAKSLSLLSHYY  217

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPD T G S H D  F TILLQ D IGGLQVLH   W DV   P AL+VN+GDLLQ
Sbjct  218  PPCPEPDRTFGISSHTDISFITILLQ-DHIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQ  276

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+ + PR+S A FF  + +P+ +VYGPIKE LSE+NPPKYR+TT
Sbjct  277  LITNDKFVSVEHRVLANRGEEPRISSASFF-MHTIPNEQVYGPIKEFLSEQNPPKYRDTT  335

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              E   H+ AKGLDGTS LLHFR+
Sbjct  336  TSEMARHYLAKGLDGTSPLLHFRI  359



>ref|XP_007152331.1| hypothetical protein PHAVU_004G120900g [Phaseolus vulgaris]
 gb|ESW24325.1| hypothetical protein PHAVU_004G120900g [Phaseolus vulgaris]
Length=367

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 200/263 (76%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE     R FHE   EVK E+Y+R + + V Y SNFDLY +  ANWRDTLFCVM P 
Sbjct  104  KVLEETLVAAREFHELAQEVKGEYYSREVMKKVKYGSNFDLYQSKYANWRDTLFCVMGPE  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P  LPP+C D+ ++YSK+V  LG VLF LLSEALGL+P++L  ++C KG SIL HYY
Sbjct  164  PLDPQALPPICRDVTMEYSKQVHVLGKVLFGLLSEALGLNPDHLEGMDCAKGHSILFHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT++H+D DF TILLQ D IGGLQVL  N W DV   P ALVVNIGDLLQ
Sbjct  224  PACPEPELTMGTTRHSDPDFLTILLQ-DHIGGLQVLSHNGWVDVPPVPEALVVNIGDLLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SN RFKS EHRVLAN+ GPRVSVACFF  +  P++R+YGPIKELLSE+NPP YRET+L
Sbjct  283  LISNGRFKSVEHRVLANRIGPRVSVACFFTLHLYPTARMYGPIKELLSEDNPPVYRETSL  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  ++  KGLDG SAL HF +
Sbjct  343  KDFIAYYDGKGLDGNSALNHFMI  365



>ref|XP_008391709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=374

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  GIR FHEQD  VK+E Y+R   + V YN+NFDLY AP+ANWRDTL CVMAP 
Sbjct  111  HVLEEMIDGIRRFHEQDQVVKEEIYSRDYAKKVYYNTNFDLYQAPAANWRDTLSCVMAPR  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P   +LP VC D++I YS++V+  G  LFELLS+ALGL+PN+L  + C +GL + GHYY
Sbjct  171  APDLGELPSVCRDVVIDYSEKVKAXGXALFELLSQALGLNPNHLKELGCAEGLVLFGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GTS+H D+ F T+LLQ D IGGLQVLH+NQW DV    GALV+N+GD+ Q
Sbjct  231  PTCPEPELTMGTSQHTDSSFLTVLLQ-DQIGGLQVLHENQWVDVTPIHGALVINLGDMSQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRET  178
            L+SND+F S+ HRVLA   GPR+SVACFF  +  P  SSR+Y PIKELLSEENPP YRET
Sbjct  290  LISNDKFISANHRVLAKNVGPRISVACFFRQHLPPENSSRLYAPIKELLSEENPPVYRET  349

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K++  H+++KGL+G SAL + ++
Sbjct  350  TVKDFVAHYYSKGLNGISALEYLKI  374



>ref|XP_010457799.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X8 [Camelina sativa]
Length=368

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 206/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EVKK +Y+R  +R   Y SNF L+++PSA+WRDTL C MAPN
Sbjct  106  DLLEKVKDGVRDFHEQSPEVKKGFYSRDFSRRFLYLSNFHLFSSPSASWRDTLACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP  C D++++YS +V  LG  LFELLSEALGL+P +L +++C+KGL +L HYY
Sbjct  166  PPKPHDLPETCRDVMMEYSNQVMVLGEFLFELLSEALGLNPYHLKDMDCSKGLIMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+H+D  F T+LL  D I GLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHSDISFLTVLLP-DQIEGLQVRREGSWFDVPYVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVL N+    RVSVACFF T  +P  RVYGPI+EL+SEENPPKYRETT
Sbjct  285  LITNDKFISLEHRVLGNKATRARVSVACFFTTGVLPDPRVYGPIRELVSEENPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  HF+ KGLDGTSALLHF++
Sbjct  345  IREYATHFNTKGLDGTSALLHFKI  368



>ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33069.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=364

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 211/268 (79%), Gaps = 8/268 (3%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTR---GLTRMVSYNSNFDLYTAPSANWRDTLFCVMA  718
            +L++I  G+R FHEQDTEVKK +Y+R   G+ +   +N+NFD Y +P+ANWRD+++C+MA
Sbjct  99   ILDDIIDGVRKFHEQDTEVKKRFYSREQAGIAKF-KFNTNFDFYQSPAANWRDSMYCIMA  157

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP   +LP VC DILI YS +V  L  +LFELLSEALGL+ NYL +I C++GL  LGH
Sbjct  158  PDPPSSEELPDVCRDILIDYSNKVAALSNILFELLSEALGLNANYLKDIGCSEGLLFLGH  217

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLH-QNQWFDVHAYPGALVVNIGD  361
            YYP CPEP+LT+GTS H+DN F T+LLQD   GGLQVL  +NQW DV+  PGALV+N+GD
Sbjct  218  YYPVCPEPELTMGTSSHSDNSFLTVLLQDQS-GGLQVLSCKNQWVDVNPTPGALVINLGD  276

Query  360  LLQLVSNDRFKSSEHRVLANQDGPRVSVACFFN--TYAVPSSRVYGPIKELLSEENPPKY  187
            +LQL+SND+FKSSEHRVLA   GPR+SVACF    T++  +SR+YGPIKELLSEE PP Y
Sbjct  277  MLQLISNDKFKSSEHRVLAKSVGPRISVACFNIQLTHSKNASRLYGPIKELLSEETPPVY  336

Query  186  RETTLKEYEDHFHAKGLDGTSALLHFRL  103
             ETT+KEY  ++++KGL+G SAL HF+L
Sbjct  337  LETTIKEYLTYYYSKGLNGISALEHFKL  364



>gb|AFK45613.1| unknown [Lotus japonicus]
Length=356

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 204/263 (78%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEI+ G++ F EQ  EV KE+YTR   +   YNSNFDLY++P+ NWRD+  C +AP+
Sbjct  95   SVLEEIKNGVKRFFEQGAEVIKEFYTRDKFKSFIYNSNFDLYSSPALNWRDSFACYLAPD  154

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P P  LP VC DIL++Y K +  LG +L EL SEALGL P +L ++ C +GL  L HYY
Sbjct  155  APKPEHLPLVCRDILLEYGKHMMNLGTLLLELFSEALGLDPGHLKDMGCTEGLIALCHYY  214

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT+KH+DNDF T+LLQ D IGGLQVL+Q+QW DV   PGALVVN+GDLLQ
Sbjct  215  PACPEPELTVGTTKHSDNDFLTVLLQ-DRIGGLQVLYQDQWIDVTPVPGALVVNVGDLLQ  273

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRFKS EH+VLAN  GPR+SVACFF+T    SS  YGPIKELL+++NPPKYRETT+
Sbjct  274  LITNDRFKSVEHQVLANHVGPRISVACFFSTGNRLSSNPYGPIKELLTKDNPPKYRETTI  333

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             +Y  ++  KGLDGT+AL H+++
Sbjct  334  SDYSAYYEKKGLDGTTALTHYKI  356



>ref|XP_004511093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like [Cicer arietinum]
Length=377

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 206/265 (78%), Gaps = 2/265 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
              VL+++  G+  FHEQDTE KKE+Y+R +T+   +N+NFD Y  P+ NWRDTL CVMAP
Sbjct  114  STVLDDMLHGVLRFHEQDTETKKEFYSRDITKRAYFNTNFDFYVTPAVNWRDTLSCVMAP  173

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             P  P +LP +C DI I+YS+ V+K+G +LFELLSEALGL+ +YL +I+C +GL ++ HY
Sbjct  174  QPLDPQELPSICRDITIEYSEYVKKVGMLLFELLSEALGLNSSYLKDIDCAEGLFVISHY  233

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LT GTS H+D+ F T+LLQ D IGGLQV H++QW DV   PGALVVN+GD++
Sbjct  234  YPPCPEPELTFGTSAHSDSSFLTVLLQ-DQIGGLQVFHEDQWVDVTPIPGALVVNLGDMM  292

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP-SSRVYGPIKELLSEENPPKYRET  178
            QL++ND+F S +HRVLA + GPRVSVACFF  +  P +S++YGPI ELL+ ENPP Y+ET
Sbjct  293  QLITNDKFISVKHRVLAQKLGPRVSVACFFRQHLPPENSKLYGPISELLTPENPPVYKET  352

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            ++K+   H++ KGLDGTSAL HFRL
Sbjct  353  SVKDLVSHYYGKGLDGTSALEHFRL  377



>gb|KDP40307.1| hypothetical protein JCGZ_02305 [Jatropha curcas]
Length=374

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 6/267 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VL+E+  GIR FHEQD EVKKE Y+R    + + +NSNFDLY+AP+ANWRDTL CVMAP
Sbjct  110  SVLDEMIDGIRKFHEQDDEVKKELYSRDFANKKIYFNSNFDLYSAPAANWRDTLSCVMAP  169

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             PP P +LP VC +I++ YS +V  L   LFELLSEALGL+  YLN + C +GL  LGHY
Sbjct  170  CPPKPEELPHVCREIMMNYSNKVIALAHTLFELLSEALGLNRKYLNEMGCAEGLFFLGHY  229

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GTS H+D+ F T+LLQ D IGGLQVL ++QW DV   PGALV+N+GDLL
Sbjct  230  YPACPEPELTMGTSSHSDSSFLTVLLQ-DQIGGLQVLCEDQWVDVTPTPGALVINLGDLL  288

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSS---RVYGPIKELLSEENPPKYR  184
            QL+SND FKSS+HRV+A   GPR+SVACF   +  PS    RVYGPIKELLSEENPP ++
Sbjct  289  QLISNDTFKSSQHRVIAKTVGPRISVACFCRHHG-PSQNVPRVYGPIKELLSEENPPVFK  347

Query  183  ETTLKEYEDHFHAKGLDGTSALLHFRL  103
            ETTLK+Y   ++AKGLDG SAL HF+L
Sbjct  348  ETTLKDYLARYYAKGLDGISALEHFKL  374



>emb|CDY09965.1| BnaC08g44860D [Brassica napus]
Length=365

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 207/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE ++ G+RGFHEQ  EV+K++Y R  +R   Y+SNFDL+++PSANWRDT  C +AP+
Sbjct  103  DLLERMKDGVRGFHEQPPEVRKQYYGRDFSRTFRYSSNFDLFSSPSANWRDTFACNIAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++Y+K V  LG  LFE+LSEALGL PN+LN ++C+KGL +L HYY
Sbjct  163  PPKPEDLPQICRDVMLEYTKHVVNLGEFLFEMLSEALGLEPNHLNEMDCSKGLLMLNHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG ++H+DN F T+LL  D I GLQV  +  WFDV   PGAL++NIGDLLQ
Sbjct  223  PPCPQPDLTLGATQHSDNSFLTVLLP-DQIEGLQVNREGYWFDVPHVPGALIINIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SEENPP+YRE T
Sbjct  282  LITNDKFISLEHRVLANRATRARVSVACFFTTGVRPNPRLYGPIRELVSEENPPRYREIT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  H +AKGLDGTSALLHF++
Sbjct  342  IRDYAAHVNAKGLDGTSALLHFKI  365



>ref|XP_009626886.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=372

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +VL+E+ RG R FHEQ+ +VKK +Y+R + R V YN NFDL++  A +ANWRD+L+ VMA
Sbjct  109  SVLDEMLRGARRFHEQEIDVKKPYYSRDVARKVMYNCNFDLFSEKALAANWRDSLYSVMA  168

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P P  P +LP  C +I+I+YS  V KLG  L ELLSE +GL PN+L  ++C +GL IL +
Sbjct  169  PTPAKPEELPETCREIVIEYSDHVMKLGCNLLELLSEGVGLKPNHLKEMDCAEGLGILCN  228

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+L +GTS+HADNDFFT+LLQDD  GGLQV HQN W DV   PGALV+NIGD+
Sbjct  229  YYPACPQPELAIGTSRHADNDFFTVLLQDD-FGGLQVFHQNHWVDVPPTPGALVINIGDI  287

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++KS EHRVL N+ GPR+S+A FF T  + SSR+YGPI+ELLSE+NPPKYR T
Sbjct  288  LQLISNDKYKSIEHRVLTNKVGPRISIASFFGTGPLASSRIYGPIEELLSEDNPPKYRAT  347

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            TLK++ ++   KGLDG S L H+R+
Sbjct  348  TLKDFFEYSSQKGLDGNSNLSHYRI  372



>ref|XP_010469792.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 203/264 (77%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+E+++ GIRGFHEQD++VKK +Y+R +T+ V YN+NF LY++ +ANWRDTL  VMAP+
Sbjct  98   DVMEKMKDGIRGFHEQDSDVKKTFYSRDITKKVKYNTNFGLYSSQAANWRDTLTMVMAPD  157

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
                  LP VC +I+++YSK + KLG  +FELLSEALGL+PN+L  ++C+K LS+L HYY
Sbjct  158  VSQVEDLPAVCREIMLEYSKRMMKLGETIFELLSEALGLNPNHLKELDCDKSLSLLSHYY  217

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPD T G S H D  F TILLQ D IGGLQVLH   W DV   P AL+VN+GDLLQ
Sbjct  218  PPCPEPDRTFGISSHTDISFITILLQ-DHIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQ  276

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+ + PR+S A FF  + +P+ +VYGPIKELLSE+NPPKYR+TT
Sbjct  277  LITNDKFVSVEHRVLANRGEEPRISSASFF-MHTIPNEQVYGPIKELLSEQNPPKYRDTT  335

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              E   H+ AKGLDGTS LLHFR+
Sbjct  336  TSEMARHYLAKGLDGTSPLLHFRI  359



>emb|CDY06221.1| BnaA09g49820D [Brassica napus]
Length=368

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQ  +V+K++Y R  ++   Y SNFDL+++P+ANWRDT  C +AP+
Sbjct  106  DLLEKMKDGVRGFHEQSPDVRKQYYVRDFSKKFMYLSNFDLFSSPAANWRDTFSCTIAPD  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++Y+K V  LG  LFE+LSEALGL PN+LN ++C+KGL +L HYY
Sbjct  166  PPKPEDLPEICRDVMLEYTKHVMTLGEFLFEILSEALGLDPNHLNEMDCSKGLLMLNHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGT++H+D  F T+LL  D I GLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTTQHSDTSFLTVLLP-DQIEGLQVNREGYWFDVPHVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LV+ND+F S EHRVLAN+    RVS+ACFF T   P+ R+YGPI+EL+SEENPP+YRETT
Sbjct  285  LVTNDKFISLEHRVLANRATQARVSIACFFTTGVRPNPRMYGPIRELVSEENPPRYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +++AKGLDGTSALLHF++
Sbjct  345  IRDYAAYYNAKGLDGTSALLHFKI  368



>ref|XP_009118527.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Brassica rapa]
 ref|XP_009118528.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Brassica rapa]
Length=365

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 208/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE ++ G+RGFHEQ  EV+K++Y R  +R   Y+SNFDL+++P+ANWRDT  C +AP+
Sbjct  103  DLLERMKDGVRGFHEQPPEVRKQYYGRDFSRTFRYSSNFDLFSSPAANWRDTFSCTIAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++Y+K V  LG  LFE+LSEALGL PN+LN ++C+KGL +L HYY
Sbjct  163  PPKPEDLPEICRDVMLEYTKHVVNLGEFLFEMLSEALGLEPNHLNEMDCSKGLLMLNHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLG ++H+DN F T+LL  D+I GLQ+  +  W+DV   PGAL++NIGDLLQ
Sbjct  223  PPCPQPDLTLGATQHSDNSFLTVLLP-DEIEGLQINREGHWYDVPHVPGALIINIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDGP-RVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SEENPP+YRE T
Sbjct  282  LITNDKFISLEHRVLANRATRGRVSVACFFTTGVRPNPRLYGPIRELVSEENPPRYREIT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  H +AKGLDGTSALLHF++
Sbjct  342  IRDYSAHVNAKGLDGTSALLHFKI  365



>ref|XP_009761530.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=377

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 207/266 (78%), Gaps = 3/266 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             +V+E++  G+R FHEQD+EVKKE+Y+R +TR  +YN+NFDL+ A +ANWRDT +CVMAP
Sbjct  110  SSVMEKVLEGVRHFHEQDSEVKKEFYSRDVTRKFTYNTNFDLHKAKTANWRDTFYCVMAP  169

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P ++P VC D+++KY+  V KLG  L +LLSEALGL+PN+LN+IEC +GL ++GHY
Sbjct  170  NPPRPEEIPEVCRDVVVKYTDYVMKLGLTLCDLLSEALGLNPNHLNDIECAEGLLVVGHY  229

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEPD TLG + H D+ F TI+LQ D IGGLQV H+NQW DV   PGAL+VNIGDL+
Sbjct  230  YPACPEPDFTLGLTGHTDSGFLTIVLQ-DRIGGLQVFHKNQWVDVAFMPGALIVNIGDLM  288

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRE  181
            QL++ND+F+S  HRVLA   GPR+SVA  F  +      SR+YGPIKELL EENPP YRE
Sbjct  289  QLITNDKFRSVLHRVLAKNIGPRISVASLFRMHFQERSESRLYGPIKELLLEENPPIYRE  348

Query  180  TTLKEYEDHFHAKGLDGTSALLHFRL  103
            T+ KE+  + + KGLDGTS L HF+L
Sbjct  349  TSRKEFFTYLYNKGLDGTSLLSHFKL  374



>ref|XP_010435700.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=365

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 211/264 (80%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++  +RGFHEQ  +V+KE Y R LTR   Y+SNFDLYT+ +ANWRDT+ C MAP+
Sbjct  103  DLLEKMKDRVRGFHEQSPQVRKELYCRDLTRKFHYSSNFDLYTSRAANWRDTVTCNMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP +  D++I+YS++V  +G  LF LLSEALGL+PN+LN+++C+KGL ++GHYY
Sbjct  163  PPNPQDLPEILRDVMIEYSEQVTNVGDFLFTLLSEALGLNPNHLNDMDCSKGLVMVGHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F T+LL  D IGGLQVL +  WFDV   PGAL++N+GDLLQ
Sbjct  223  PPCPEPDLTLGTSQHADNSFLTVLLP-DQIGGLQVLREGYWFDVPHVPGALIINVGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND F S EHRVLAN+    R+SVACFF +   P+  +YGPI+EL+SEE PPKYRETT
Sbjct  282  LITNDNFTSLEHRVLANRATRARISVACFFTSSMGPNPTLYGPIRELVSEEYPPKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +F+AKGLDG SAL+HF++
Sbjct  342  IRDYNAYFNAKGLDGISALVHFKI  365



>ref|XP_003626775.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01251.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=365

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 207/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEW-YTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            +VLEE++ G++ FHE DT+ KKE+ YT+   +   Y SNFDLY++P+ NWRDT  C +AP
Sbjct  103  SVLEEMKDGVKRFHEMDTDAKKEYFYTKDRNKSFIYKSNFDLYSSPALNWRDTCACYLAP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            + P P   P VC DI ++Y K V  LG +LFE LSEALGL PN+L ++ C +GL  + HY
Sbjct  163  DTPKPQDFPVVCRDITLEYGKHVMNLGTMLFEFLSEALGLKPNHLKDMGCTEGLIAVCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CPEP+LT+GT+KH+D+ F T+LLQD  IGGLQVL++++W D+    GAL+VNIGDLL
Sbjct  223  YPSCPEPELTMGTTKHSDHSFLTVLLQDH-IGGLQVLYEDKWIDITPATGALIVNIGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++ND+FKS EHRV+ANQ GPR+SVACFF+T   PSS++YGP+KELLSE+NP KYRETT
Sbjct  282  QLITNDKFKSVEHRVVANQVGPRISVACFFSTGLRPSSKLYGPMKELLSEKNPSKYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + +Y  +F AKGLDGTSAL H+++
Sbjct  342  VADYAAYFKAKGLDGTSALTHYKI  365



>ref|XP_010475401.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 2-like [Camelina sativa]
Length=379

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 206/266 (77%), Gaps = 4/266 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE++ G+R FHEQ  E +KE YTR  ++   Y SNFDLY APSANWRD+ +C MAP 
Sbjct  115  HLLEEMKDGVRNFHEQPPEARKELYTRDYSKKFMYTSNFDLYRAPSANWRDSCYCYMAPY  174

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  +P +C D++++YSK+V  LG  LFELLSEALGL+ N+L +++C KGL +L HYY
Sbjct  175  PPKPQDIPEICRDVMLEYSKQVMILGEFLFELLSEALGLNHNHLKDMDCLKGLRMLCHYY  234

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS+H+D+ F T+LLQ D IGGLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  235  PPCPEPDLTFGTSQHSDSSFLTVLLQ-DQIGGLQVRREGYWFDVPHVPGALVINIGDLLQ  293

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRE  181
            L++ND+F S EHRVLAN+    RVSVACFF TY   +P+ R YGPIKEL+S+ENPPKYRE
Sbjct  294  LITNDKFISLEHRVLANRATRARVSVACFFTTYVQVLPNPRSYGPIKELVSDENPPKYRE  353

Query  180  TTLKEYEDHFHAKGLDGTSALLHFRL  103
            T +++Y  + +AKGLDGTSALLH ++
Sbjct  354  TIVRDYATYVNAKGLDGTSALLHLKI  379



>ref|XP_011029844.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=359

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 202/264 (77%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++ EE+  GI  FH QD EVKKE+Y+R  TR V YNSNFDLY  P+A+WRDTL CVMAP+
Sbjct  95   SIQEEVIDGIHRFHHQDVEVKKEFYSRDYTRKVLYNSNFDLYQVPAASWRDTLTCVMAPS  154

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P +LPPVC DILI YSK +  LG  LFE+LSEALGL PN+L +I C +GL +LGH Y
Sbjct  155  PPNPEELPPVCRDILIDYSKRIMTLGNSLFEMLSEALGLEPNHLKDIGCAEGLYVLGHCY  214

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT+KHAD+ F T+LLQ D IGGLQVLH+NQW +V   PGALVVN+GDL Q
Sbjct  215  PACPEPELTMGTTKHADSGFLTLLLQ-DQIGGLQVLHENQWINVSPMPGALVVNVGDLFQ  273

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSS-RVYGPIKELLSEENPPKYRETT  175
            L+SND+F S+ HRV+A   GPR SVAC F    +P + R+YGPIKELLSEENPP YRETT
Sbjct  274  LISNDKFVSATHRVVARNVGPRTSVACLFRQNLLPETLRLYGPIKELLSEENPPVYRETT  333

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +K++    H  G DG S L H ++
Sbjct  334  VKDFLALKHLNGNDGVSRLKHLKI  357



>ref|XP_006305137.1| hypothetical protein CARUB_v10009503mg [Capsella rubella]
 gb|EOA38035.1| hypothetical protein CARUB_v10009503mg [Capsella rubella]
Length=368

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EV+K++YTR  +R   Y SNFDL++AP+ANWRD+  C MAPN
Sbjct  106  DLLEKMKDGVRDFHEQSPEVRKDFYTRDFSRRFLYLSNFDLFSAPAANWRDSFSCTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP +C  ++++YSK+V  LG  L+ELLSEALGL+ ++L ++EC KGL +L HYY
Sbjct  166  PPEPHDLPEICRGVMMEYSKQVMDLGEFLYELLSEALGLNSSHLKDMECLKGLRMLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+HADN F TILL  D I GLQV  +  WFDV   PGAL++NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHADNSFLTILLP-DQIEGLQVRREGYWFDVPHVPGALIINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SE NPPKYRETT
Sbjct  285  LITNDKFISLEHRVLANRSPRARVSVACFFTTGVRPNPRLYGPIRELVSEANPPKYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  +F+AKGLDGTSALLH+++
Sbjct  345  VREYTTYFNAKGLDGTSALLHYKI  368



>ref|XP_006379886.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
 gb|ERP57683.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
Length=372

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+++  G+R FHEQDTEVKKE++TR   R V+YN+NFD Y AP+ANWRD+L+C++AP+
Sbjct  109  SVLDDMINGVRRFHEQDTEVKKEFHTRDEMRKVAYNTNFDFYQAPAANWRDSLYCLVAPH  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP VC DI+I Y+ +V  LG ++FELLSEALGL P++L ++ C +GL  +GHYY
Sbjct  169  PPRPEELPAVCRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+PDLTLG SKH D+ F  ++LQ D +GGLQVLH++QW DV   PGAL+VN+GD+ Q
Sbjct  229  PACPQPDLTLGLSKHTDSAFLAVVLQ-DHLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRET  178
            L++N +FKS  HRV+A   GPR+S ACFF T+     SSRVYGPIKELLSEENPP YR+T
Sbjct  288  LITNGKFKSVYHRVVAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENPPVYRQT  347

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+Y  + ++KGLDG   L HF+L
Sbjct  348  TIKDYVSYTYSKGLDGNPRLEHFKL  372



>ref|XP_004488811.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 207/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT-APSANWRDTLFCVMAp  715
            +VLE+++ G+  F+EQD EVKKE Y+R  TR + YNSNFDLY+ +P+ NWRDT  C +AP
Sbjct  111  SVLEDMKDGVLRFYEQDFEVKKELYSRDQTRSLIYNSNFDLYSNSPALNWRDTFACHLAP  170

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            N P P   P VC DIL++Y + + KLG  +FELLSEALGL  +++ N+ C++G+ +L HY
Sbjct  171  NTPKPEDFPVVCRDILLEYGEHIMKLGMTVFELLSEALGLDKDHVKNLGCSEGIMLLCHY  230

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GT+KH+DN F T+LLQD  IGGLQVLH+++WFD+   P ALVVNIGDLL
Sbjct  231  YPACPEPELTMGTTKHSDNSFLTLLLQDH-IGGLQVLHKDKWFDIPPIPEALVVNIGDLL  289

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QLV+ND+FKS EHRVLAN  GPR+SVACFF        ++YGPIKELLS++NPP+YRET 
Sbjct  290  QLVTNDKFKSVEHRVLANSIGPRISVACFFMADHRSKEKLYGPIKELLSQDNPPRYRETN  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              +Y D++ AKGLDGTS+L HF+L
Sbjct  350  FADYVDYYKAKGLDGTSSLQHFKL  373



>emb|CDX88705.1| BnaA03g09440D [Brassica napus]
Length=366

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTR-GLTRMVSYNSNFDLYTA-PSANWRDTLFCVMA  718
             VLEEIQ G+R FHE+D EVKKE++TR    +   YNSNFDLY++ PS NWRDT  C +A
Sbjct  103  KVLEEIQDGVRRFHEEDPEVKKEYFTRDNANKKFVYNSNFDLYSSSPSVNWRDTFTCYLA  162

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D + +YSK V  LGG+L EL SEALGL    L +  C KGLS+L H
Sbjct  163  PDPPSPEELPVTCRDAVFEYSKHVMSLGGLLCELFSEALGLESEILKSKGCLKGLSMLCH  222

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLG SKH+DN F T+LLQD+ IGGLQ+LHQ+ W DV   PGALV+N+GD 
Sbjct  223  YYPPCPQPDLTLGVSKHSDNSFLTVLLQDN-IGGLQILHQDSWVDVAPLPGALVINVGDF  281

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN+ GPR+S+ACFF++    +S VYGP+KEL+SEENPPKYR+ 
Sbjct  282  LQLITNDKFVSLEHRVLANRQGPRISIACFFSSSKHANSTVYGPMKELVSEENPPKYRDI  341

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY + +  KGLDGTS LL+FR+
Sbjct  342  TIKEYTEGYFKKGLDGTSHLLNFRI  366



>ref|XP_010510283.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 201/263 (76%), Gaps = 3/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            V ++++ GIRGFHEQD+EVKK +Y+R +T+ V YN+NFDLY++ +ANWRDTL  VM+P+ 
Sbjct  99   VTDKMKDGIRGFHEQDSEVKKTFYSRDMTKKVKYNTNFDLYSSQAANWRDTLTTVMSPDV  158

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P    LP VC +I+++YSK + KLG ++FELLSEALGL PN+L  ++C K LS+L HYYP
Sbjct  159  PQVEDLPAVCREIMLEYSKRMMKLGEIIFELLSEALGLKPNHLKELDCAKSLSLLSHYYP  218

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPD T G S H D  F TILLQ D IGGLQVLH   W DV   P AL+VN+GDLLQL
Sbjct  219  PCPEPDRTFGISSHTDISFITILLQ-DHIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQL  277

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+   PR+S A FF  + +P+ +VYGPIKELLSE+NPPKYR+TT 
Sbjct  278  ITNDKFVSVEHRVLANRCKEPRISSASFF-MHTIPNEQVYGPIKELLSEQNPPKYRDTTT  336

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             E   H+ AKGLDGTS LLHFR+
Sbjct  337  SEMARHYLAKGLDGTSPLLHFRI  359



>ref|XP_009131992.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Brassica rapa]
Length=366

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTR-GLTRMVSYNSNFDLYTA-PSANWRDTLFCVMA  718
             VLEEIQ G+R FHE+D EVKKE++TR    +   YNSNFDLY++ PS NWRDT  C +A
Sbjct  103  KVLEEIQDGVRRFHEEDPEVKKEYFTRDNANKKFVYNSNFDLYSSSPSVNWRDTFTCYLA  162

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P PP P +LP  C D + +YSK V  LGG+L EL SEALGL    L +  C KGLS+L H
Sbjct  163  PFPPSPEELPVTCRDAVFEYSKHVMSLGGLLCELFSEALGLESEILKSKGCLKGLSMLCH  222

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLG SKH+DN F T+LLQD+ IGGLQ+LHQ+ W DV   PGALV+N+GD 
Sbjct  223  YYPPCPQPDLTLGVSKHSDNSFLTVLLQDN-IGGLQILHQDSWVDVAPLPGALVINVGDF  281

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN+ GPR+S+ACFF++    +S VYGP+KEL+SEENPPKYR+ 
Sbjct  282  LQLITNDKFVSLEHRVLANRQGPRISIACFFSSSKHANSTVYGPMKELVSEENPPKYRDI  341

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY + +  KGLDGTS LL+FR+
Sbjct  342  TIKEYTEGYFKKGLDGTSHLLNFRI  366



>ref|XP_010557154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=362

 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 212/263 (81%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLE+++ G+RGFHEQD EVKK +YTR  ++ + Y SNFDLY++P+ANWRDT  C MAP 
Sbjct  101  DVLEKMKNGVRGFHEQDPEVKKGFYTRDFSKRLLYLSNFDLYSSPAANWRDTFSCYMAPQ  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP VC +++++YSK+V KLG +L ELLSEA+GL PN+L +++C+KGL +L HYY
Sbjct  161  PPRPEDLPLVCGEMMLEYSKQVMKLGELLLELLSEAVGLSPNHLKDMDCSKGLLMLCHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+P+LTLGTSKH+DN F ++LLQ DDIGGLQVLH   W DV   PGALVVN+GDLLQ
Sbjct  221  PPCPQPELTLGTSKHSDNSFVSVLLQ-DDIGGLQVLHDEYWVDVLPLPGALVVNVGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRV+AN+ GPRVSVACFF T    + RVY PIKELLSE +PP+YR TT+
Sbjct  280  LITNDKFVSLEHRVVANRAGPRVSVACFFTTGMTSNPRVYEPIKELLSERDPPRYRGTTI  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KEY   ++AKGLDGTSALLH ++
Sbjct  340  KEYATFYNAKGLDGTSALLHLKI  362



>ref|XP_011029845.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Populus euphratica]
Length=372

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 208/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL+++  G+R FHEQDTEVKKE+YTR   R V+YN+NFD Y AP+ANWRD+L+C++AP+
Sbjct  109  SVLDDMINGVRRFHEQDTEVKKEFYTRDEMRRVAYNTNFDFYQAPAANWRDSLYCLVAPH  168

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP V  DI+I Y+ +V  LG ++FELLSEALGL P++L ++ C +GL  +GHYY
Sbjct  169  PPRPEELPAVXRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYY  228

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+PDLTLG SKHAD+ F T++LQ D +GGLQVLH++QW DV   PGAL+VN+GD+ Q
Sbjct  229  PACPQPDLTLGLSKHADSAFLTVVLQ-DQLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQ  287

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRET  178
            L++N +FKS  HRV+A   GPR+S ACFF T+     SSRVYGPIKELLSEEN P YR+T
Sbjct  288  LITNGKFKSVYHRVMAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENQPIYRQT  347

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K+Y  + ++KGLDG   L HF+L
Sbjct  348  TIKDYVSYTYSKGLDGNPRLEHFKL  372



>ref|XP_009118490.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X1 [Brassica rapa]
Length=365

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQ  EV+K++Y R  ++   Y SNFDL+++P+ANWRDT  C +AP+
Sbjct  103  DLLEKMKDGVRGFHEQLPEVRKQYYGRDFSKKFMYLSNFDLFSSPAANWRDTFSCTIAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++Y+K V  LG  LFE+LSEALGL PNYLN ++C+KGL +L HYY
Sbjct  163  PPKPEDLPEICRDVMLEYTKHVMNLGQFLFEMLSEALGLDPNYLNEMDCSKGLHMLNHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGT++H+D+ F T+LL  D I GLQV  +  W+DV   PGAL++NIGDLLQ
Sbjct  223  PPCPEPDLTLGTTQHSDSSFLTVLLP-DQIEGLQVNREGHWYDVPHVPGALIINIGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVS+ACFF T   P+ R+YGPIKEL+SEENPP+YRETT
Sbjct  282  LITNDKFISLEHRVLANKARQARVSIACFFTTGLRPNPRLYGPIKELVSEENPPRYRETT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  + ++KGLDGTSALLHF++
Sbjct  342  IRDYSAYVNSKGLDGTSALLHFKI  365



>ref|XP_009118492.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Brassica rapa]
Length=368

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+RGFHEQ  +V+K++Y R  ++   Y SNFDL+++P+ANWRDT  C +AP+
Sbjct  106  DLLEKMKDGVRGFHEQSPDVRKQYYVRDFSKKFMYLSNFDLFSSPAANWRDTFSCNIAPD  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++Y+K V  LG  LFE+LSEALGL PN+LN ++C+KGL +L HYY
Sbjct  166  PPKPEDLPEICRDVMLEYTKHVMTLGEFLFEILSEALGLDPNHLNEMDCSKGLLMLNHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGT++H+D  F T+LL  D I GLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTTQHSDTSFLTVLLP-DQIEGLQVNREGYWFDVPHVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            LV+ND+F S EHRVLAN+    RVS+ACFF T   P+ R+YGPI+EL+SEENPP+YRETT
Sbjct  285  LVTNDKFISLEHRVLANRATQARVSIACFFTTGVRPNPRMYGPIRELVSEENPPRYRETT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +++Y  +++AKGLDGTSALLHF++
Sbjct  345  IRDYAAYYNAKGLDGTSALLHFKI  368



>gb|KCW60401.1| hypothetical protein EUGRSUZ_H03119 [Eucalyptus grandis]
Length=353

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 196/263 (75%), Gaps = 4/263 (2%)
 Frame = -1

Query  882  EEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            EE+  GIR FHEQD E K+EWY+R    R V YNSNFDLY AP+ANWRDTL  V+AP  P
Sbjct  92   EEMVEGIRRFHEQDLEAKREWYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSRVLAPRSP  151

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P +LP VC D++I+Y   + +L   +FELLSEALGL P+YL  I C +GL  +GHYYPA
Sbjct  152  DPQELPAVCRDVIIEYKDRILELSDTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPA  211

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CPEPDLTLGT  H D+ F TILLQ D IGGLQV HQNQW DV   PGALV+N+GDL+QL+
Sbjct  212  CPEPDLTLGTGDHTDSGFLTILLQ-DQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLI  270

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRETTL  172
            SND F S  HRVLA + GPR+SVAC    +  P  SSR+YGPI+E LSEENPP YRETT+
Sbjct  271  SNDEFISVSHRVLAQKIGPRISVACLMRQHLPPENSSRLYGPIEERLSEENPPIYRETTV  330

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+   H++AKGL+G SAL HF+L
Sbjct  331  KDLVTHYYAKGLNGVSALEHFKL  353



>ref|XP_003548216.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
Length=369

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 201/263 (76%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             VLEE    +  FHE   E+K E+Y+R   + V Y SNFDLY +  ANWRDTLFCVM P+
Sbjct  106  KVLEETMAAVHEFHELPQELKAEYYSREQMKKVKYGSNFDLYQSKYANWRDTLFCVMGPD  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P +LPP+C D+ ++YS++VQ LG VLF LLSEALGL P++L  ++C KG SIL HYY
Sbjct  166  PLDPQELPPICRDVAMEYSRQVQLLGRVLFGLLSEALGLDPDHLEGMDCAKGHSILFHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CPEP+LT+GT++H+D DF TILLQ D IGGLQVL    W DV   PGALVVNIGDLLQ
Sbjct  226  PSCPEPELTMGTTRHSDPDFLTILLQ-DHIGGLQVLGPYGWVDVPPVPGALVVNIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS EHRVLAN+ GPRVSVACFF  +  P++R+YGPIKELLSEE PP YRET+L
Sbjct  285  LISNDKFKSVEHRVLANRIGPRVSVACFFTLHLYPTTRIYGPIKELLSEEKPPVYRETSL  344

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K++  ++  KGLDG SAL HF +
Sbjct  345  KDFIAYYDNKGLDGNSALDHFMI  367



>ref|XP_007223357.1| hypothetical protein PRUPE_ppa007457mg [Prunus persica]
 gb|EMJ24556.1| hypothetical protein PRUPE_ppa007457mg [Prunus persica]
Length=367

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+    RGFHE  TEVK E+Y+R   R V + SNFDLY    A+WRD+LFCVM P P
Sbjct  103  VLEEMLAAARGFHELLTEVKAEYYSREQMRKVKFRSNFDLYQTKFASWRDSLFCVMGPEP  162

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC D  ++YS  V KLG  LFELLSEALGL  ++L  ++C KG  IL HYYP
Sbjct  163  LDPKELPDVCRDATMEYSDYVHKLGVTLFELLSEALGLKSDHLLGLDCAKGHVILSHYYP  222

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEP+LT+GT+KH+D  F TILLQD  IGGLQVL++NQW DV   PGALVVNIGDLLQL
Sbjct  223  PCPEPELTMGTTKHSDPSFLTILLQDQ-IGGLQVLYENQWVDVPPVPGALVVNIGDLLQL  281

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            VSNDRFKS EH+VLAN  GPRVSVACFF     PS+R+YGPIKELLSE++PP YRET+L+
Sbjct  282  VSNDRFKSVEHQVLANHAGPRVSVACFFTLNFYPSTRLYGPIKELLSEDHPPLYRETSLQ  341

Query  168  EYEDHFHAKGLDGTSALLHFR  106
             +  H+  KGLDG SAL  F+
Sbjct  342  NFSAHYDGKGLDGNSALTRFK  362



>ref|XP_008372316.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=376

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 198/261 (76%), Gaps = 1/261 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VL+E+    RGFHEQ  EVK E+Y+R L R V + SNFDLY +  ANWRD+LFCVM P P
Sbjct  114  VLDEMLEAARGFHEQPREVKAEYYSRELMRKVKFGSNFDLYQSRFANWRDSLFCVMGPEP  173

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
              P +LP VC DI ++YS  V KLG  LFE LSEALGL  ++  +++C  G  IL HYYP
Sbjct  174  LDPQELPVVCRDIXMEYSNHVHKLGVTLFEXLSEALGLKSDHXLSLDCANGHLILTHYYP  233

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEP+LT+GT+KH+D DF TILLQD  IGGLQVL QNQW DV   PGAL+VNIGD+LQL
Sbjct  234  PCPEPELTMGTTKHSDPDFLTILLQDH-IGGLQVLCQNQWIDVPFVPGALIVNIGDILQL  292

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SNDRFKS EH+VLAN  GPRVS+ACFF  +  PS+R+YGPIK LLSE++PP YRET+L+
Sbjct  293  ISNDRFKSVEHQVLANYGGPRVSIACFFTLHLYPSTRLYGPIKNLLSEDHPPVYRETSLQ  352

Query  168  EYEDHFHAKGLDGTSALLHFR  106
            ++  ++  KGLDG SAL HF+
Sbjct  353  DFISYYEGKGLDGNSALTHFK  373



>emb|CDX71103.1| BnaC03g11870D [Brassica napus]
Length=362

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 205/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLY-TAPSANWRDTLFCVMA  718
            NVL+EI+ G R FHE+D EVKK +++R L  +   YNSNFDLY ++PS NWRDT  C +A
Sbjct  99   NVLKEIEDGGRRFHEEDPEVKKRYFSRDLANKNFFYNSNFDLYGSSPSVNWRDTFACYIA  158

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D + +YSK V  LGG+LFELLSEALGL P+ L + EC K L +L H
Sbjct  159  PDPPTPEELPVTCRDAMFEYSKHVMSLGGLLFELLSEALGLEPDILKSKECLKSLLMLCH  218

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLGTSKH+DN F TILLQD+ IGGLQ+LHQ+ W DV   PGAL++NIGD 
Sbjct  219  YYPPCPQPDLTLGTSKHSDNSFLTILLQDN-IGGLQILHQDSWVDVAPLPGALIINIGDF  277

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++N +F S EHRVLAN+ GPR+SVA FF++    +S VYGP+KEL+SEENPPKYR+ 
Sbjct  278  LQLITNGKFISVEHRVLANRQGPRISVASFFSSSKRANSTVYGPMKELVSEENPPKYRDI  337

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY D +  KGLDGTS L++FR+
Sbjct  338  TIKEYTDGYTEKGLDGTSYLMNFRI  362



>gb|KFK42982.1| hypothetical protein AALP_AA1G064200 [Arabis alpina]
Length=368

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 206/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EV+K++Y R   R  +Y+SNFDLY++P+ANWRDT  C MAP+
Sbjct  106  DLLEKMKDGVRSFHEQSPEVRKQYYGRDFARKFTYSSNFDLYSSPAANWRDTFSCYMAPD  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LPP+  D++I+Y+KEV  LG  L ELLSEALGL+PN+L +++C KGL +L HYY
Sbjct  166  PPKPQDLPPIVRDVMIEYTKEVMSLGEFLLELLSEALGLNPNHLKDMDCLKGLLMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+H+DN F T+LL  D I GLQVL    WFDV   PGAL++NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHSDNSFLTVLLP-DLIEGLQVLRDGYWFDVPPVPGALIINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T    + R+YGP++EL+SEENPPKYRE T
Sbjct  285  LITNDKFISLEHRVLANRTTRARVSVACFFTTGLRHNPRMYGPMRELVSEENPPKYREIT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            LKEY  + +AKG+DGTSALL FR+
Sbjct  345  LKEYAAYIYAKGIDGTSALLPFRI  368



>ref|XP_009119044.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
2-like [Brassica rapa]
Length=368

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 204/264 (77%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE ++ G+R F+EQ  EVKK++Y+R   R   Y SNFDLYT+ +A+WRDT  C MAPN
Sbjct  106  DLLERMKDGVRRFNEQAPEVKKQYYSRDFRREFVYTSNFDLYTSSAASWRDTFSCYMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++YSK+   LG  LFELLSEALGL+PN+L  I+C+KGL +L HYY
Sbjct  166  PPKPQDLPAICRDVMLEYSKQALCLGEFLFELLSEALGLNPNHLKEIDCSKGLRMLCHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLG SKH+D+ F T+LL  D I GLQVL +  WFDV   PGAL++N+GDLLQ
Sbjct  226  PPCPEPDLTLGASKHSDSSFLTVLLP-DQIEGLQVLREGYWFDVPPVPGALIINVGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F SSEHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SE+NPPKYRE T
Sbjct  285  LITNDKFISSEHRVLANRATKARVSVACFFTTGIRPNPRIYGPIRELVSEDNPPKYREIT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +KE+  H  AKGLDGTS LLHF++
Sbjct  345  VKEFALHRSAKGLDGTSDLLHFKI  368



>ref|XP_003632020.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=680

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 207/267 (78%), Gaps = 6/267 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL E+  GIR FHEQD E KKEWYTR  +R V+Y+SNFDLY A S NWRDT  C +AP+
Sbjct  108  SVLSEMIDGIRRFHEQDGEAKKEWYTRDYSRKVTYSSNFDLYQASSTNWRDTFACTLAPD  167

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P QLP VC DIL++Y K V++LG  LFELLSEALGLHPN+L N+EC +G+ +LGHYY
Sbjct  168  PPQPEQLPAVCRDILMEYLKHVRRLGFSLFELLSEALGLHPNHLKNMECAEGILLLGHYY  227

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LTLGTS H D DF TIL+Q D +GGLQVLH++QW ++    GALV+N+GDLLQ
Sbjct  228  PACPEPELTLGTSSHTDADFITILIQ-DQMGGLQVLHEDQWVNIPPISGALVINVGDLLQ  286

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP---SSRVYGPIKELLSEENPPKYRE  181
             VSN  FKSSEHRVLA   GPR+SVACFF    +P   ++R+YGPIKELLSE+NPP YR+
Sbjct  287  FVSNGNFKSSEHRVLAKNVGPRISVACFFRK-IIPVENTTRLYGPIKELLSEDNPPIYRQ  345

Query  180  TTL-KEYEDHFHAKGLDGTSALLHFRL  103
                 EY  H+ +KGLDGTS+LL F+L
Sbjct  346  ENFPNEYLMHYDSKGLDGTSSLLRFKL  372


 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 187/264 (71%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            NVLEE+  GIR F+EQD EVKKE+Y+R + R V +NSN+DL+ + +ANWRDTL   +  +
Sbjct  418  NVLEEMVNGIRVFNEQDPEVKKEYYSRDMMRKVKFNSNYDLFHSRAANWRDTLTISLTSD  477

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLS-ILGHY  535
               P +LP +C +   +Y K V KLG VLFELLSEALGL P++L  +   +G S ++ HY
Sbjct  478  GLDPQELPAICREATTEYIKHVMKLGDVLFELLSEALGLKPDHLRAMGYTEGSSTMVCHY  537

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GTSKH D    TILLQD  IGGLQV H+NQW +VH   G+LV+NIGD L
Sbjct  538  YPACPEPELTMGTSKHTDPATLTILLQDQ-IGGLQVFHENQWAEVHPIAGSLVINIGDFL  596

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            Q++SN + KS  HRV+AN  GPR+S A FF+      +++ GP+KEL+SEENPP YR+  
Sbjct  597  QVMSNGKLKSVYHRVVANHVGPRISTAYFFSGARTEPAKLCGPLKELISEENPPVYRDFL  656

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY   F +KGLD  S L +F+L
Sbjct  657  VAEYIGKFMSKGLDDDSGLDYFKL  680



>ref|NP_172149.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q9C5K7.1|ACCH2_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
2 [Arabidopsis thaliana]
 gb|AAK25895.1|AF360185_1 putative oxidoreductase [Arabidopsis thaliana]
 gb|AAK64077.1| putative oxidoreductase [Arabidopsis thaliana]
 dbj|BAE98542.1| putative Iron/Ascorbate oxidoreductase family protein [Arabidopsis 
thaliana]
 gb|AEE28015.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=369

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 206/263 (78%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LE+++ G+R FHEQ  EV+K+ Y+R   R   Y SNFDLYTA +ANWRDT +C MAP+P
Sbjct  108  LLEKMKDGVRDFHEQPPEVRKDLYSRDFGRKFIYLSNFDLYTAAAANWRDTFYCYMAPDP  167

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P  LP +C D++++YSK+V  LG  LFELLSEALGL+PN+L ++EC KGL +L HY+P
Sbjct  168  PEPQDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFP  227

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLT GTSKH+D  F T+LL  D+I GLQV  +  WFDV   PGAL++NIGDLLQL
Sbjct  228  PCPEPDLTFGTSKHSDGSFLTVLLP-DNIEGLQVCREGYWFDVPHVPGALIINIGDLLQL  286

Query  348  VSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S +HRVLAN+    RVSVACFF+T+  P+ RVYGPIKEL+SEENPPKYRETT+
Sbjct  287  ITNDKFISLKHRVLANRATRARVSVACFFHTHVKPNPRVYGPIKELVSEENPPKYRETTI  346

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +F+ KGL GTSALL F++
Sbjct  347  RDYATYFNGKGLGGTSALLDFKV  369



>ref|XP_002892212.1| hypothetical protein ARALYDRAFT_470414 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68471.1| hypothetical protein ARALYDRAFT_470414 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 202/263 (77%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEIQ G+  FHE+D EVKK +++   T+   Y++NF+LY++ + NWRD+  C MAP+
Sbjct  85   SVLEEIQNGVVRFHEEDPEVKKSYFSLDFTKTFIYHNNFELYSSSAGNWRDSFACYMAPD  144

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP  C D +I YSK V  LGG+LFELLSEALGL    L ++ C KGL ++ HYY
Sbjct  145  PPNPEDLPVACRDAMIGYSKHVMNLGGLLFELLSEALGLSSEALKSMGCMKGLHMICHYY  204

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PDLTLGTSKH+DN F TILLQ D+IGGLQ+LHQ+ W DV   PGALV+NIGD LQ
Sbjct  205  PPCPQPDLTLGTSKHSDNTFITILLQ-DNIGGLQILHQDCWVDVSPLPGALVINIGDFLQ  263

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S EHRVLAN+ GPR+S+ACFF++   P+S VYGPIKELLSEENPPKYR+ T+
Sbjct  264  LMTNDKFISVEHRVLANKVGPRISIACFFSSSMNPNSTVYGPIKELLSEENPPKYRDFTV  323

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   +  KGLDGTS L H+R+
Sbjct  324  PEYSKGYIEKGLDGTSHLSHYRI  346



>emb|CDX71105.1| BnaC03g11890D [Brassica napus]
Length=366

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTR-GLTRMVSYNSNFDLYTA-PSANWRDTLFCVMA  718
            NVLEEIQ G+R FHE+D EVKK+++TR    +   YNSNFDLY++ PS NWRDT  C +A
Sbjct  103  NVLEEIQDGVRRFHEEDPEVKKQYFTRDNANKKFVYNSNFDLYSSSPSVNWRDTFTCYLA  162

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D + +YSK V  LGG+L EL SEALGL    L +  C KGLS+L H
Sbjct  163  PDPPSPEELPVTCRDAVFEYSKHVMSLGGLLCELFSEALGLESEILKSKGCLKGLSMLCH  222

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLG SKH+DN F T+LLQD+ IGGLQ+LHQ+ W DV   PGALV+NIGD 
Sbjct  223  YYPPCPQPDLTLGVSKHSDNSFLTVLLQDN-IGGLQILHQDSWVDVAPLPGALVINIGDF  281

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN+ GPR+SVA FF++    +S VYGP+KEL+SEENPPKYR+ 
Sbjct  282  LQLITNDKFVSLEHRVLANRQGPRISVASFFSSSKHANSTVYGPMKELVSEENPPKYRDI  341

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY + +  KGLDGTS LL+FR+
Sbjct  342  TIKEYTEGYFKKGLDGTSHLLNFRI  366



>ref|XP_009379005.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=374

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VL E+  GIR FHEQD  VK++ Y+R   + V YNSNFDLY AP+ANWRDTL CVMAP 
Sbjct  111  HVLGEMIDGIRRFHEQDQVVKEQIYSRDYAKKVYYNSNFDLYQAPAANWRDTLSCVMAPR  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P   +LP VC D++I YS++V+ LG  LFELLS+ALGL+PN+L  + C +GL + GHYY
Sbjct  171  APDLGELPSVCRDVVIDYSEKVKALGVALFELLSQALGLNPNHLKEVGCAEGLVLFGHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+LT+GTS+H D+ F T+LLQ D IGGLQVLH+NQW DV    GALV+N+GD+LQ
Sbjct  231  PTCPEPELTMGTSQHTDSSFLTVLLQ-DQIGGLQVLHENQWVDVTPIHGALVMNLGDMLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRET  178
            L+SND+F S+ HRVLA   GPR+SVACFF  +  P  SSR+Y PIKELLSEENPP YRET
Sbjct  290  LISNDKFMSANHRVLAKNVGPRISVACFFRQHFPPENSSRLYAPIKELLSEENPPLYRET  349

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+K++  H++ KGL+G  +L + ++
Sbjct  350  TVKDFVAHYYRKGLNGIPSLEYLKI  374



>ref|XP_010023987.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X2 [Eucalyptus grandis]
Length=374

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 196/263 (75%), Gaps = 4/263 (2%)
 Frame = -1

Query  882  EEIQRGIRGFHEQDTEVKKEWYTRGLT-RMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            EE+  GIR FHEQD E K+EWY+R    R V YNSNFDLY AP+ANWRDTL  V+AP  P
Sbjct  113  EEMVEGIRRFHEQDLEAKREWYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSRVLAPRSP  172

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P +LP VC D++I+Y   + +L   +FELLSEALGL P+YL  I C +GL  +GHYYPA
Sbjct  173  DPQELPAVCRDVIIEYKDRILELSDTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPA  232

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CPEPDLTLGT  H D+ F TILLQ D IGGLQV HQNQW DV   PGALV+N+GDL+QL+
Sbjct  233  CPEPDLTLGTGDHTDSGFLTILLQ-DQIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLI  291

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYRETTL  172
            SND F S  HRVLA + GPR+SVAC    +  P  SSR+YGPI+E LSEENPP YRETT+
Sbjct  292  SNDEFISVSHRVLAQKIGPRISVACLMRQHLPPENSSRLYGPIEERLSEENPPIYRETTV  351

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            K+   H++AKGL+G SAL HF+L
Sbjct  352  KDLVTHYYAKGLNGVSALEHFKL  374



>ref|XP_010650059.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 200/264 (76%), Gaps = 5/264 (2%)
 Frame = -1

Query  885  LEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpp  706
            LEE+  G+R FHEQD EVKKE+YTR L + V + SNFDL+ AP+A WRDTL  VM P  P
Sbjct  107  LEEMLAGVRRFHEQDAEVKKEFYTRDLRKKVLFLSNFDLFQAPTATWRDTLALVMYPILP  166

Query  705  hphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPA  526
             P  LP VC DI + YSK+VQ+LG  LFELLS  LGL+PN+L ++EC + LS LGHYYPA
Sbjct  167  EPESLPTVCRDIALAYSKQVQRLGITLFELLSVGLGLNPNHLKDMECAERLSFLGHYYPA  226

Query  525  CPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLV  346
            CPEP+LTLGTS H+D DF TILLQ D +GGLQV H+NQW DV   PGAL+VN+GD LQL+
Sbjct  227  CPEPELTLGTSIHSDADFMTILLQ-DQLGGLQVFHENQWVDVPPIPGALIVNVGDFLQLL  285

Query  345  SNDRFKSSEHRVLANQDGPRVSVACFFNT-YAVPSS--RVYGPIKELLSEENPPKYRETT  175
            +ND+ KS  HRV+A Q GPR+SVACFF T +  P    R YGPI+ELLSEENPP Y+ETT
Sbjct  286  TNDKLKSVHHRVIAKQKGPRISVACFFRTEFFEPGDNLRSYGPIQELLSEENPPVYKETT  345

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              +Y  H+++KG  GTS+LLH +L
Sbjct  346  ANDYLKHYYSKG-SGTSSLLHLKL  368



>emb|CDO99201.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   318 bits (816),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/259 (62%), Positives = 204/259 (79%), Gaps = 10/259 (4%)
 Frame = -1

Query  876  IQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpphph  697
            ++ G+  F +QD E++ +WYTR + + V YN NFDL++AP+ANWRD+++CVMAPNPP P 
Sbjct  1    MKAGVHRFFDQDFEIRSQWYTRDVKQRVVYNCNFDLFSAPTANWRDSIYCVMAPNPPDPQ  60

Query  696  qlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPE  517
            +LP  C DILI++ KEV KLG  LFE+LSE+LGL PN+LN+I C +GL+ L +YYPACP+
Sbjct  61   ELPLACRDILIEFCKEVMKLGSTLFEILSESLGLDPNHLNSIGCGEGLASLCNYYPACPQ  120

Query  516  PDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLVSND  337
            P+LTLGTSKHAD+DF T+LLQ D I GLQVLHQNQW +V   PGALV        L+SND
Sbjct  121  PELTLGTSKHADSDFLTVLLQ-DHIRGLQVLHQNQWVEVPPIPGALV--------LISND  171

Query  336  RFKSSEHRVLANQDGPRVSVACFFNTYAV-PSSRVYGPIKELLSEENPPKYRETTLKEYE  160
            +F S EHRVLAN  G RVSVACFF  + + PS+++Y PI+ELL+EENPPKYR TT+K+Y 
Sbjct  172  KFISVEHRVLANNVGARVSVACFFRHFDMSPSAKLYAPIEELLTEENPPKYRATTVKDYV  231

Query  159  DHFHAKGLDGTSALLHFRL  103
             HF+ KGLDGTSALLHF+L
Sbjct  232  SHFNNKGLDGTSALLHFKL  250



>ref|NP_001154315.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein 
[Arabidopsis thaliana]
 gb|AEE28017.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=366

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 206/263 (78%), Gaps = 5/263 (2%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LE+++ G+RGFHEQ  EV+K++Y+R LTR   Y+SNFDLY++P+ANWRDT+ C M P+P
Sbjct  108  LLEKMKDGVRGFHEQSPEVRKDFYSRDLTRKFQYSSNFDLYSSPAANWRDTVACTMDPDP  167

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
               +       D+ I+YS++V  LG  LF LLSEALGL+PN+LN+++C+KGL +L HYYP
Sbjct  168  STRYSRDL---DVTIEYSEQVMNLGEFLFTLLSEALGLNPNHLNDMDCSKGLIMLCHYYP  224

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLTLGTS+HADN F T+LL  D I GLQVL +  WF+V   PGAL++NIGDLLQL
Sbjct  225  PCPEPDLTLGTSQHADNTFLTVLLP-DQIEGLQVLREGYWFNVPHVPGALIINIGDLLQL  283

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+    RVSVA FF T   P+  +YGPI+EL+S+ENPPKYRETT+
Sbjct  284  ITNDKFVSLEHRVLANRATRARVSVAGFFTTAMRPNPTMYGPIRELVSKENPPKYRETTI  343

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +F AKGLDGTSALLHF++
Sbjct  344  RDYTAYFSAKGLDGTSALLHFKI  366



>emb|CBI23597.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+ +GIR F+EQDTEVKKE+YTR  ++ V + SN DL+ AP+A W+D+  C++ PN
Sbjct  111  SVLEEMIKGIRRFNEQDTEVKKEFYTRDSSKKVKFVSNSDLFQAPAATWKDSFSCIITPN  170

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  +P VC DI+++YSK+V+ L   LFEL++EALGL+ N+L ++EC +GL ++ HYY
Sbjct  171  PPDPTDMPAVCRDIIMEYSKQVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYY  230

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACPEP+LT+GT  H D  F T+LLQ D +GGLQVLH+ QW +V+  PGALV+N GDLLQ
Sbjct  231  PACPEPELTMGTKTHTDPTFLTVLLQ-DQVGGLQVLHEKQWVNVNPVPGALVINTGDLLQ  289

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            LVSND F+S++HRVLAN  GPRVSV  FF+ +++P S++YGPIKELLSEENPPKY+ETT 
Sbjct  290  LVSNDMFRSAKHRVLANHKGPRVSVGSFFSPFSLPPSKLYGPIKELLSEENPPKYKETTA  349

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y     A+  DGTSAL HF+L
Sbjct  350  RDYGTCHRAERHDGTSALHHFKL  372



>ref|NP_180641.1| 2-oxoglutarate dependent oxygenase-like protein [Arabidopsis 
thaliana]
 gb|AAC20718.1| putative dioxygenase [Arabidopsis thaliana]
 gb|AEC08446.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein 
[Arabidopsis thaliana]
Length=358

 Score =   322 bits (825),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 200/263 (76%), Gaps = 3/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            V+E ++ GIRGFHEQD+EVKK +Y+R +T+ V YN+NFDLY++ +ANWRDTL  VMAP+ 
Sbjct  98   VMESMKDGIRGFHEQDSEVKKTFYSRDITKKVKYNTNFDLYSSQAANWRDTLTMVMAPDV  157

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P    LP +C +I+++YSK + KLG ++FELLSEALGL PN+L  + C K LS+L HYYP
Sbjct  158  PQAGDLPVICREIMLEYSKRMMKLGELIFELLSEALGLKPNHLKELNCAKSLSLLSHYYP  217

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPD T G S H D  F TILLQ D IGGLQVLH   W DV   P AL+VN+GDLLQL
Sbjct  218  PCPEPDRTFGISSHTDISFITILLQ-DHIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQL  276

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+ + PR+S A FF  + +P+ +VYGP+KELLS++NPPKYR TT 
Sbjct  277  ITNDKFVSVEHRVLANRGEEPRISSASFF-MHTIPNEQVYGPMKELLSKQNPPKYRNTTT  335

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             E   H+ A+GLDGTS LLHFR+
Sbjct  336  TEMARHYLARGLDGTSPLLHFRI  358



>ref|XP_010483594.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like isoform X2 [Camelina sativa]
Length=366

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTR-MVSYNSNFDLYTA-PSANWRDTLFCVMA  718
            NV+EEI+  +R FHE D EVKK +Y+R  T+   +Y+SNFDLY++ PS  WRD++ C MA
Sbjct  103  NVIEEIKDAVRRFHEDDPEVKKSYYSRDFTKNKFAYSSNFDLYSSSPSLTWRDSISCYMA  162

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D +IKY+K V  LG +LFELLSEALGL    L +++C K L ++ H
Sbjct  163  PDPPTPEELPETCRDAVIKYTKHVLSLGDLLFELLSEALGLKSEILKSMDCLKSLLMICH  222

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLG SKH+DN F T+LLQDD IGGLQ+LHQ+ W DV   PGALVVNIGD 
Sbjct  223  YYPPCPQPDLTLGISKHSDNSFLTVLLQDD-IGGLQILHQDSWIDVSPLPGALVVNIGDF  281

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++ND+F S EHRVLAN  GPR+SVA FF++    +S VYGP+KELLSEENPPKYR+T
Sbjct  282  LQLITNDKFISVEHRVLANTRGPRISVASFFSSSIRENSTVYGPMKELLSEENPPKYRDT  341

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            TL++Y + +  KGLDGTS LL+FR+
Sbjct  342  TLRDYSEGYFKKGLDGTSHLLNFRI  366



>emb|CBI23598.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 196/258 (76%), Gaps = 5/258 (2%)
 Frame = -1

Query  867  GIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnpphphqlp  688
            G+R FHEQD EVKKE+YTR L + V + SNFDL+ AP+A WRDTL  VM P  P P  LP
Sbjct  4    GVRRFHEQDAEVKKEFYTRDLRKKVLFLSNFDLFQAPTATWRDTLALVMYPILPEPESLP  63

Query  687  PVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYPACPEPDL  508
             VC DI + YSK+VQ+LG  LFELLS  LGL+PN+L ++EC + LS LGHYYPACPEP+L
Sbjct  64   TVCRDIALAYSKQVQRLGITLFELLSVGLGLNPNHLKDMECAERLSFLGHYYPACPEPEL  123

Query  507  TLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQLVSNDRFK  328
            TLGTS H+D DF TILLQ D +GGLQV H+NQW DV   PGAL+VN+GD LQL++ND+ K
Sbjct  124  TLGTSIHSDADFMTILLQ-DQLGGLQVFHENQWVDVPPIPGALIVNVGDFLQLLTNDKLK  182

Query  327  SSEHRVLANQDGPRVSVACFFNT-YAVPSS--RVYGPIKELLSEENPPKYRETTLKEYED  157
            S  HRV+A Q GPR+SVACFF T +  P    R YGPI+ELLSEENPP Y+ETT  +Y  
Sbjct  183  SVHHRVIAKQKGPRISVACFFRTEFFEPGDNLRSYGPIQELLSEENPPVYKETTANDYLK  242

Query  156  HFHAKGLDGTSALLHFRL  103
            H+++KG  GTS+LLH +L
Sbjct  243  HYYSKG-SGTSSLLHLKL  259



>ref|XP_009599435.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=384

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMA  718
            +VL+E+ RG R F EQD EVKK++Y R  T+ V YNSNFDLY+  A + NW D+L+  M 
Sbjct  121  SVLDEMLRGSRRFFEQDIEVKKQYYHRDYTQRVVYNSNFDLYSPKAIAVNWSDSLYSTMG  180

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P P  P +LP  C +I+++YS  V K+G  L ELLSE LGL P++L  + C++GLSIL +
Sbjct  181  PAPLDPEELPEACREIIMEYSHHVMKMGCTLLELLSECLGLKPSHLKEMGCSEGLSILCN  240

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYPACP+P+L +G SKH DNDFFT+LLQDD +GGLQVLHQNQW DV   PGALV+NIGD+
Sbjct  241  YYPACPQPELAVGLSKHTDNDFFTVLLQDD-LGGLQVLHQNQWVDVPPTPGALVINIGDV  299

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL+SND++KS EHR L+ + GPR+S+A FF++  +PSS++YGPI+ELLSE+NPPKYR T
Sbjct  300  LQLISNDKYKSVEHRALSKKVGPRISIASFFSSGPLPSSKLYGPIEELLSEDNPPKYRAT  359

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            TLK++ D+F  KGLDGTS L H R+
Sbjct  360  TLKDFYDYFSKKGLDGTSNLSHLRI  384



>ref|XP_004134074.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Cucumis sativus]
 ref|XP_004167602.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Cucumis sativus]
 gb|KGN56873.1| hypothetical protein Csa_3G135700 [Cucumis sativus]
Length=368

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 210/263 (80%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V E I  G+R F EQD+EVKK++YTR  T+   YN NFDL+TAP ANWRDT+   MAPN
Sbjct  107  SVQEAIIDGVRRFFEQDSEVKKQYYTRDYTKPFIYNCNFDLFTAPVANWRDTIVTFMAPN  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP+P  LP VC DIL +YSK++ KLG ++F LLSE LGL   +L +++CN+GL ++ HYY
Sbjct  167  PPNPQDLPQVCRDILPEYSKQIMKLGELIFGLLSEGLGLKSTHLLDLDCNEGLRVICHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+ P+P+L +GT++H+D+ F T+LLQD+ +GGLQV  QN+W DV   PGA V+N+G+LLQ
Sbjct  227  PSSPQPELCIGTTEHSDDSFITVLLQDN-MGGLQVRQQNKWVDVTPVPGAFVINVGNLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++NDRF SSEH+VLAN++GPRVSVA FF+T  +P+S++YGPIKELLSE+NPPKY+E T+
Sbjct  286  LITNDRFVSSEHKVLANREGPRVSVASFFSTGRLPTSKLYGPIKELLSEQNPPKYKEITV  345

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +EY  +F+ KGLDGT AL HF++
Sbjct  346  REYNIYFNEKGLDGTPALPHFKI  368



>ref|XP_004247709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=376

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 205/266 (77%), Gaps = 3/266 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             ++ E++  G+R FHEQD+EVKKE+Y+R +TR V+YNSNFDL  +P+ANWRDTL+CVM P
Sbjct  110  SSIKEKVLEGVRHFHEQDSEVKKEFYSRDVTRKVTYNSNFDLLKSPTANWRDTLYCVMDP  169

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P ++P VC ++LI+Y+K + KLG  LFELLSEAL L  ++L ++EC +GL I GHY
Sbjct  170  NPPDPEEIPNVCREVLIEYTKYIMKLGLTLFELLSEALQLKSDHLKDMECAEGLFITGHY  229

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LTLG S H D+ F TI+LQ D IGGLQV H++QW DV   PGAL+VNIGDL+
Sbjct  230  YPACPEPELTLGLSGHTDSGFLTIVLQ-DQIGGLQVFHKDQWVDVPFLPGALIVNIGDLM  288

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRE  181
            QL++ND+FKS  HRVLA   GPR+SVA FF  +      SR+YGPIKELLSEENPP YRE
Sbjct  289  QLITNDKFKSVLHRVLAKNVGPRISVASFFRMHFQEGSESRLYGPIKELLSEENPPIYRE  348

Query  180  TTLKEYEDHFHAKGLDGTSALLHFRL  103
            T+ KEY    + KGLDGTS L  F+L
Sbjct  349  TSRKEYVMRLYNKGLDGTSLLSPFKL  374



>ref|XP_009141108.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Brassica 
rapa]
Length=361

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 205/263 (78%), Gaps = 3/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            V+++++  + GFHEQD++V+K+ YTR  T+ V+YNSNFDLY++PSANWRDTL C M+P+ 
Sbjct  101  VMDKMKDRVCGFHEQDSDVRKKLYTRDNTKKVTYNSNFDLYSSPSANWRDTLSCFMSPDV  160

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P    LP +C +I+++YSK V +LG ++FELLSEALGL PN+L  ++C KGL +L HYYP
Sbjct  161  PRREDLPEICGEIMLEYSKRVMELGELIFELLSEALGLDPNHLKEMDCTKGLLMLSHYYP  220

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLT GTS+H+D  F TILLQ D IGGLQVL    W DV   PGAL++N+GD LQL
Sbjct  221  PCPEPDLTFGTSQHSDRSFLTILLQ-DHIGGLQVLQDGCWVDVPPVPGALLINLGDFLQL  279

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++N++F S EHRVLAN+ D PRVSVA FF  + +PS RVYGP+KELLSE+NPPKYR+TT+
Sbjct  280  ITNNKFLSVEHRVLANRGDEPRVSVASFF-VHPLPSFRVYGPMKELLSEQNPPKYRDTTV  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  H+ A+GLDG S L  F++
Sbjct  339  TEYTRHYMARGLDGNSVLHQFKI  361



>ref|XP_010026853.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like [Eucalyptus grandis]
Length=610

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 209/262 (80%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
             +EE++ G+R F+EQD E KK +YTR +TR V YNSNFDLYTA  ANWRDT FC MAP+P
Sbjct  350  AMEEMKEGVRRFYEQDDEAKKAFYTRDVTRKVVYNSNFDLYTAAVANWRDTFFCYMAPSP  409

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP VC DIL+ YSK+V  LGG+LFELLSE+LGL  + L  ++C +GL ++ HYYP
Sbjct  410  PSPEELPEVCRDILMDYSKQVMSLGGLLFELLSESLGLRLDRLREMDCAEGLVVICHYYP  469

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP P+LT+GTSKH+DNDF T+ L  D IGGLQVLH N+W DV   PGALVVN+GDLLQL
Sbjct  470  ACPRPELTMGTSKHSDNDFLTVFLH-DHIGGLQVLHDNRWVDVPPVPGALVVNVGDLLQL  528

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            ++ND+FKS EHRVLAN  GPR+SVACFF+T   PSS+++GPI+ELLSE+NPP YRETT++
Sbjct  529  ITNDKFKSVEHRVLANPVGPRISVACFFSTSFQPSSKLFGPIRELLSEDNPPIYRETTVR  588

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            +Y  +F   GLDGTS L HF+L
Sbjct  589  DYLAYFKEHGLDGTSPLRHFKL  610


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+ +D+FKS +HRV+AN+ G RVSVACFF     PSSR+YGPIKEL S +N P Y+ETT
Sbjct  161  QLIMSDQFKSVKHRVVANKRGLRVSVACFFGHTPQPSSRLYGPIKELTSADNAPIYKETT  220

Query  174  LKEYEDHFHAKGL  136
            L  Y  H+ +KGL
Sbjct  221  LPNYTAHYISKGL  233



>ref|XP_010475404.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
 ref|XP_010475405.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=368

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 205/264 (78%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EV+K +Y+R  +R   Y SNF L+++PSA+WRDTL C MAPN
Sbjct  106  DLLEKVKDGVRDFHEQSPEVRKGFYSRDFSRRFLYLSNFHLFSSPSASWRDTLACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  LP +C D++++YS++V  LG  LFELLSEALGL+PN+L +++C+KGL +L HYY
Sbjct  166  PPKPQDLPEICGDVMMEYSEQVMVLGEFLFELLSEALGLNPNHLKDMDCSKGLIMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+H+D  F T+LL  D I GLQVL +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHSDISFLTVLLP-DQIEGLQVLREGYWFDVPHVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P  RVYGPI EL+SEENPPKYR  T
Sbjct  285  LITNDKFISLEHRVLANRATRARVSVACFFTTGVRPDPRVYGPITELVSEENPPKYRGIT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  + +AKGLDGTSALLH ++
Sbjct  345  IREYTTYSNAKGLDGTSALLHLKI  368



>emb|CDX97789.1| BnaC04g41500D [Brassica napus]
Length=361

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 205/263 (78%), Gaps = 3/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            V+++++  + GFHEQD++V+K+ YTR  T+ V+YNSNFDLY++PSANWRDTL C M+P+ 
Sbjct  101  VMDKMKDRVCGFHEQDSDVRKKLYTRDNTKKVTYNSNFDLYSSPSANWRDTLSCFMSPDV  160

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P    LP +C +I+++YSK+V +LG ++FELLSEALG+ PN+L  ++C KGL +L HYYP
Sbjct  161  PRTEDLPEICGEIMLEYSKQVMELGELIFELLSEALGMDPNHLKEMDCTKGLLMLSHYYP  220

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLT GTS+H+D  F TILLQ D IGGLQVL    W DV   P AL++N+GD LQL
Sbjct  221  PCPEPDLTFGTSQHSDRSFLTILLQ-DHIGGLQVLQDGCWVDVPPVPRALLINLGDFLQL  279

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+ D PRVSVA FF  + +PS RVYGP+KELLSE+NPPKYR+TT+
Sbjct  280  ITNDKFLSVEHRVLANRGDEPRVSVASFF-VHLLPSFRVYGPMKELLSEQNPPKYRDTTV  338

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY  H+ A+GLDG S L  F++
Sbjct  339  TEYTRHYMARGLDGNSVLHQFKI  361



>gb|EYU32968.1| hypothetical protein MIMGU_mgv1a008832mg [Erythranthe guttata]
Length=361

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 198/262 (76%), Gaps = 1/262 (0%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            VLEE+  G+R F+E D E KK +YTR +TR   YNSN DLY+ P+ NWRDT    MAPNP
Sbjct  101  VLEEMLCGVRRFNEMDAEAKKVYYTRDVTRKFVYNSNSDLYSVPTVNWRDTFLSFMAPNP  160

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P P +LP  C DI I+YS+ V  LG  LF LLSEALGL  + L  + C  GL+ +GHYYP
Sbjct  161  PKPEELPASCRDIQIEYSRHVMNLGFRLFGLLSEALGLESSRLAEMGCTDGLTFVGHYYP  220

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
            ACP+P+LTLG + H D+ F T+LLQD  IGGLQV   N W D+    GALV+NIGDLLQL
Sbjct  221  ACPQPELTLGATNHTDDAFLTVLLQDQ-IGGLQVFLDNMWIDIPPVHGALVINIGDLLQL  279

Query  348  VSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTLK  169
            +SND+FKS EHRVLAN++GPR+SVACFF+T  +PSS++YGPIKELLSE+NPPKYRETT++
Sbjct  280  ISNDKFKSVEHRVLANREGPRMSVACFFSTSLMPSSKIYGPIKELLSEDNPPKYRETTVE  339

Query  168  EYEDHFHAKGLDGTSALLHFRL  103
            EY  +   KGLDG SALLHF++
Sbjct  340  EYVTYSFNKGLDGISALLHFKI  361



>ref|XP_009347725.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=362

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G RGF EQDT+VKKE YTR  +R + YNSNFDLY+AP+ +WRD+  C MAPN
Sbjct  101  DVLEEMKNGARGFFEQDTQVKKELYTRDHSRPLVYNSNFDLYSAPATSWRDSFGCYMAPN  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP VC DIL++YSK+V KLG +L ELLSEALGL P++LN+I+C++GL +L HYY
Sbjct  161  PPKPEELPEVCRDILVEYSKQVMKLGTLLLELLSEALGLKPSHLNDIDCSEGLVLLSHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT+KH D  F TILLQ D IGGLQVL QN+W +V   PGALVVNIGDLLQ
Sbjct  221  PACPQPELTLGTTKHGDFSFLTILLQ-DHIGGLQVLPQNKWINVPPVPGALVVNIGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS +HRVLAN+ GPRVS+A  F T  +PS+++YGPIKELLSE+NPPKYRETT+
Sbjct  280  LISNDRFKSVQHRVLANRVGPRVSIASLFYTGMLPSTKLYGPIKELLSEDNPPKYRETTV  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  +   KGLDG+SAL  F+L
Sbjct  340  RDYVLYVRNKGLDGSSALSQFKL  362



>ref|XP_008380113.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
 ref|XP_008380114.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=363

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 217/263 (83%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE++ G RGF EQDT+VKKE YTR  +R + YNSNFDLY+AP+ +WRD+  C MAPN
Sbjct  102  DVLEEMKNGARGFFEQDTQVKKELYTREHSRPLVYNSNFDLYSAPATSWRDSFGCYMAPN  161

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P +LP VC DIL++YSK+V KLG +L +LLSEALGL P++LN+I+C++GL +L HYY
Sbjct  162  PPKPEELPEVCRDILVEYSKQVMKLGKLLLZLLSEALGLKPSHLNDIDCSEGLVLLSHYY  221

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP+P+LTLGT+KH D  F TILLQ D IGGLQVL QN+W +V   PGALVVNIGDLLQ
Sbjct  222  PACPQPELTLGTTKHGDFSFLTILLQ-DHIGGLQVLPQNKWINVPPVPGALVVNIGDLLQ  280

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS +HRVLAN+ GPRVS+A  F T  +PS+++YGPIKELLSE+NPPKYRETT+
Sbjct  281  LISNDRFKSVQHRVLANRVGPRVSIASLFYTGMLPSTKLYGPIKELLSEDNPPKYRETTV  340

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  + H KGLDG+SAL  F+L
Sbjct  341  RDYVLYVHNKGLDGSSALSQFKL  363



>gb|KFK27480.1| hypothetical protein AALP_AA8G389000 [Arabis alpina]
Length=364

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTR-GLTRMVSYNSNFDLYTAP-SANWRDTLFCVMA  718
            NVLEEI+ G+R FHE D EVKK +++R    +   YNSNFDLY++  S NWRDT+ C M 
Sbjct  101  NVLEEIKDGVRRFHEDDPEVKKLYFSRDSAKKKFVYNSNFDLYSSSKSVNWRDTITCYMT  160

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP  C D + +YSK V  LGG+LFELLSEALGL  + L +++C K L ++ H
Sbjct  161  PDPPTPEELPVTCRDAIYEYSKHVMSLGGLLFELLSEALGLESDILKSMDCLKTLLMISH  220

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CP+PDLTLG SKH+DN F T+LLQD+ IGGLQ+LHQ+ W DV    GAL++NIGD+
Sbjct  221  YYPPCPQPDLTLGISKHSDNSFLTVLLQDN-IGGLQILHQDSWVDVSPLHGALIINIGDI  279

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRET  178
            LQL++NDRF S EHRVLAN+ GPR+SVA FF++   P+S +YGP+KEL+SEENPPKYR+ 
Sbjct  280  LQLITNDRFVSVEHRVLANRQGPRISVASFFSSSIRPNSTIYGPMKELVSEENPPKYRDI  339

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY D +  KGLDGTS LL+FR+
Sbjct  340  TIKEYTDGYFVKGLDGTSHLLNFRI  364



>ref|XP_009619591.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=362

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 203/263 (77%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V++E+ +G++ F+EQ  E K E+Y+R   + V +NSNFDLY + +ANWRDTL CVMAPN
Sbjct  101  HVMDEMIKGVQRFNEQPNEQKMEFYSRDNLKKVKFNSNFDLYQSKAANWRDTLACVMAPN  160

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP   +LP  C   L++YS+ V+KLG  +FELL+EALGL PN+L  +EC KG  IL HYY
Sbjct  161  PPRSDELPVTCRKELLEYSEHVRKLGHTIFELLAEALGLKPNHLLEMECAKGHFILSHYY  220

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEP+ TLG +KH D DFFTILLQD  IGGLQ+ HQN W D+H   GALV+N+GDLLQ
Sbjct  221  PPCPEPNKTLGITKHTDPDFFTILLQDH-IGGLQINHQNHWIDIHPVTGALVINLGDLLQ  279

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SND+FKS+EHRVL+ Q GPR+SVACFF T   P  R+YGPIKELLS+ENPPKY+ETT+
Sbjct  280  LLSNDKFKSAEHRVLSKQIGPRISVACFFTTQFQPFDRLYGPIKELLSDENPPKYKETTV  339

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  ++++KGL    +LLH RL
Sbjct  340  RDYVSYYNSKGLGARPSLLHLRL  362



>ref|XP_007152332.1| hypothetical protein PHAVU_004G121000g [Phaseolus vulgaris]
 gb|AGV54269.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein 1 [Phaseolus 
vulgaris]
 gb|ESW24326.1| hypothetical protein PHAVU_004G121000g [Phaseolus vulgaris]
Length=367

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 199/263 (76%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
             +LE++    R FHE   EVK E+YTR  T+ V Y +NFDLY +  ANWRDTL C MAP 
Sbjct  104  KLLEDMLAAAREFHELPQEVKGEYYTREKTKKVKYWTNFDLYQSKYANWRDTLNCTMAPE  163

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P  P +LPPVC D+++++SK+ Q LG +LFELLSEALGL PN+L +++C KG  IL HYY
Sbjct  164  PLDPQELPPVCRDVIMEFSKQGQVLGSLLFELLSEALGLMPNHLEDMDCAKGHLILSHYY  223

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P+CP+P+LT+G S H D DF T+LLQD  IGGLQVL QNQW DV   PGALVVNIGDLLQ
Sbjct  224  PSCPQPELTMGLSSHTDPDFLTVLLQDH-IGGLQVLVQNQWIDVPPIPGALVVNIGDLLQ  282

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L+SNDRFKS EHRV+ NQ   RVS+A FF     PS+R+YGPIK+LLSE+NPP YRETTL
Sbjct  283  LLSNDRFKSVEHRVMVNQGQARVSIAFFFTHDHCPSTRMYGPIKQLLSEDNPPLYRETTL  342

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            +++ DHF+ KGL G  AL HF+L
Sbjct  343  QDFNDHFYKKGLHGIPALSHFKL  365



>ref|XP_010457797.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X6 [Camelina sativa]
 ref|XP_010457798.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X7 [Camelina sativa]
Length=368

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 204/264 (77%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LE+++ G+R FHEQ  EVKK +Y+R  +R   Y SNF L+++PSA+WRDTL C MAPN
Sbjct  106  DLLEKVKDGVRDFHEQSPEVKKGFYSRDFSRRFLYLSNFHLFSSPSASWRDTLACTMAPN  165

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP PH LP  C D++++YS +V  LG  LFELLSEALGL+PN+L +++C+KGL +L HYY
Sbjct  166  PPKPHDLPETCRDVMMEYSNQVMVLGEFLFELLSEALGLNPNHLKDMDCSKGLIMLSHYY  225

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLTLGTS+H+D  F T+LL  D I GLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  226  PPCPEPDLTLGTSQHSDISFLTVLLP-DQIEGLQVRREGSWFDVPYVPGALVINIGDLLQ  284

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S EHRVLAN+    RVSVACFF T   P  RVYGP+ EL+SEENPPKYRE T
Sbjct  285  LITNDKFISLEHRVLANRATRARVSVACFFTTGVKPDPRVYGPMTELVSEENPPKYREIT  344

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            ++EY  + +AKGLDGTSALLH ++
Sbjct  345  IREYTTYSNAKGLDGTSALLHLKI  368



>ref|XP_010093411.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
 gb|EXB54017.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
Length=350

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 206/263 (78%), Gaps = 19/263 (7%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE++  +R FHEQDTEVKK++YTR   + + YNSNFDLY+AP+ NWRD+  C MAP 
Sbjct  107  SLLEEMKDRVRRFHEQDTEVKKKYYTRDPMKPLIYNSNFDLYSAPTTNWRDSFLCRMAPK  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P+P  LP VC D+L++YSK+V K+G +LFELLSEALGL PNYLN+++C++G++ILGHYY
Sbjct  167  VPNPEDLPAVCRDVLMEYSKQVMKVGILLFELLSEALGLKPNYLNDMDCSEGVAILGHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            PACP P+LT+GT++HADNDF T+LLQ D IGGLQ+L+ N+W DV  +PGALVVN+GDL+Q
Sbjct  227  PACPHPELTVGTTEHADNDFLTVLLQ-DHIGGLQILYDNKWTDVPPHPGALVVNLGDLMQ  285

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
                                PRVS+A FF T+ +PS+++YGPIKELLSE NPPKYRETT+
Sbjct  286  A------------------SPRVSIASFFCTHLLPSTKLYGPIKELLSETNPPKYRETTV  327

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            ++Y  ++ +KGLDGTSAL HF+L
Sbjct  328  RDYTAYYISKGLDGTSALDHFKL  350



>ref|XP_003626796.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01272.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=366

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEE+  G++ F+EQDTE KK +YTR + R   YNSN D+Y++P+ NW+D+  C +AP 
Sbjct  103  SVLEELNDGVKRFYEQDTEAKKSFYTRDMQRSFIYNSNVDIYSSPALNWKDSFGCNLAPP  162

Query  711  pphphql-pPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
                 +  P VC DIL++Y K +  LG +LFELLSEALGL+PN+L +++C +GL  L HY
Sbjct  163  DTLKPEEFPVVCRDILLRYGKHMMNLGTLLFELLSEALGLNPNHLKDMDCAEGLIALCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LT+GT+KH+DNDF T+LLQD  IGGLQVL+ ++W D+    GAL+VN+GDLL
Sbjct  223  YPPCPEPELTVGTTKHSDNDFLTVLLQDH-IGGLQVLYDDKWIDITPVSGALIVNVGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++ND+FKS  HRVLAN  GPR+SVACFF+T    SS++YGP+KELLSE+NPPKY+ETT
Sbjct  282  QLITNDKFKSVVHRVLANTVGPRISVACFFSTGLKASSKLYGPMKELLSEDNPPKYKETT  341

Query  174  LKEYED-HFHAKGLDGTSALLHFRL  103
            + +Y   +F AKG+DGTSAL H+++
Sbjct  342  VADYVAYYFRAKGVDGTSALEHYKI  366



>ref|XP_003529012.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Glycine max]
Length=365

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 203/264 (77%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLY-TAPSANWRDTLFCVMAp  715
            +VLEE++ G++ FHE DTE KKE+Y+R  ++   YNSNFDLY + P+ NWRD+  C++ P
Sbjct  103  SVLEEMKNGVKRFHEMDTEAKKEFYSRDRSKSFLYNSNFDLYGSQPAINWRDSCRCLLYP  162

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            + P P +LP VC DIL++Y K + +LG +L EL SEAL L PNYL ++ C  GL  L HY
Sbjct  163  DTPKPEELPVVCRDILLEYRKHIMRLGILLLELFSEALSLSPNYLKDMGCADGLLALCHY  222

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP+CPEPDLT+G + H+DNDFFT+LLQD  IGGLQV ++++W D+   PGA V+NIGDLL
Sbjct  223  YPSCPEPDLTMGITMHSDNDFFTVLLQDH-IGGLQVRYEDKWIDISPVPGAFVINIGDLL  281

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            Q ++NDRFKS+EHRVLAN  GPR+SVACFF+  A  S ++ GPIKELLSEENPPK+R+ T
Sbjct  282  QFITNDRFKSAEHRVLANDVGPRISVACFFSPSAKTSLKLCGPIKELLSEENPPKFRDIT  341

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              +YE ++ AKGLDGTSAL  +R+
Sbjct  342  FGDYEAYYLAKGLDGTSALTRYRI  365



>ref|XP_003628028.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET02504.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 201/265 (76%), Gaps = 2/265 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
              VL+E+  G+  FHEQDTE+KK++Y+R +T+   +N+NFDLY  P+ NWRD+L CVM P
Sbjct  111  STVLDEMIDGVVRFHEQDTEMKKKFYSRDITKRAYFNTNFDLYVTPAVNWRDSLSCVMGP  170

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             P  P  LP VC DI +KYS  V K+G +L ELLSEALGL+ NYL +I+C +GL ++ HY
Sbjct  171  QPLDPQDLPTVCRDITVKYSDYVNKVGMILLELLSEALGLNSNYLKDIDCAEGLFLISHY  230

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CPEP+LT GTS H+D+ FFT+LLQ D +GGLQV H NQW DV   PGALV+N+GD++
Sbjct  231  YPPCPEPELTFGTSAHSDSSFFTVLLQ-DQLGGLQVFHGNQWVDVTPIPGALVINLGDMM  289

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP-SSRVYGPIKELLSEENPPKYRET  178
            QL++ND+F S +HRVLA + GPR+SVACFF  +  P +S++YGPI ELL+ ENPP Y+ET
Sbjct  290  QLITNDKFLSVKHRVLAPKIGPRISVACFFRQHLPPENSKLYGPITELLTPENPPVYKET  349

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            ++K    H++ KGLDG SAL HFR+
Sbjct  350  SVKGLVSHYYGKGLDGNSALDHFRI  374



>ref|XP_010274803.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Nelumbo nucifera]
Length=380

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 199/254 (78%), Gaps = 2/254 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
             ++L+E+  G+R F+EQD EVKK +YTR ++R V YNSNFDLY +P+ANWRDT +C MAP
Sbjct  112  ASLLDEMLEGVRRFYEQDNEVKKRFYTRDISRRVVYNSNFDLYQSPAANWRDTFYCKMAP  171

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP+P +LP  C DI+++YS++V +L   L +L+SEAL L P  L ++ C +  +IL HY
Sbjct  172  NPPNPEELPEACRDIMMEYSRQVARLAATLLQLVSEALTLEPKRLIDMGCAESEAILCHY  231

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GTSKHADND  TILLQ D IGGLQVLH+N W DV   PGALVVN+GDLL
Sbjct  232  YPACPEPELTMGTSKHADNDVVTILLQ-DHIGGLQVLHKNHWVDVPPMPGALVVNVGDLL  290

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SNDRFKS +HRVLA + GPRVSVA FF +    S+ +YGPIKELLSEENPP YRETT
Sbjct  291  QLISNDRFKSVDHRVLAKRIGPRVSVASFFPSRE-DSTHIYGPIKELLSEENPPIYRETT  349

Query  174  LKEYEDHFHAKGLD  133
             +EY + F +KGLD
Sbjct  350  AQEYSNFFRSKGLD  363



>ref|XP_010486403.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
2-like [Camelina sativa]
Length=371

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 204/266 (77%), Gaps = 4/266 (2%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            ++LEE++ G+R FHEQ  E +KE YTR  ++   Y SNFDLY APSANW D+ +C MAP 
Sbjct  107  HLLEEMKDGVRNFHEQPPEARKELYTRDYSKKFMYTSNFDLYRAPSANWIDSCYCYMAPY  166

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            PP P  +P +C D++++YSK+V  LG  LFELLSEALGL+ N+L +++C KGL +L HYY
Sbjct  167  PPKPQDIPEICRDVMMEYSKQVVILGEFLFELLSEALGLNHNHLKDMDCLKGLRMLCHYY  226

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPDLT GTS+H+D+ F  +LL  D IGGLQV  +  WFDV   PGALV+NIGDLLQ
Sbjct  227  PPCPEPDLTFGTSRHSDSSFLNVLLP-DQIGGLQVRREGHWFDVRHVPGALVINIGDLLQ  285

Query  351  LVSNDRFKSSEHRVLANQDG-PRVSVACFFNTY--AVPSSRVYGPIKELLSEENPPKYRE  181
            L++ND+F S EHRVLAN+    RVSVACFF T+   +P+ R+YGPIKEL+SEENPPKYRE
Sbjct  286  LITNDKFISLEHRVLANRATRARVSVACFFTTHVQVLPNPRLYGPIKELVSEENPPKYRE  345

Query  180  TTLKEYEDHFHAKGLDGTSALLHFRL  103
            T +++Y  + +AKGLDGTSALLH ++
Sbjct  346  TIVRDYATYVNAKGLDGTSALLHLKI  371



>ref|XP_006493816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=372

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 205/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGL-TRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            ++L+E+  G+ GFHEQDTEVKK++YTR    RMV YN+NFD Y AP ANWRDTL CVMAP
Sbjct  109  SILDEMIDGVIGFHEQDTEVKKKFYTRDYQKRMVLYNTNFDFYVAPEANWRDTLSCVMAP  168

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            NPP P +LP VC DI++ ++K+  +L   LFEL+SEALGL+ N L +++C +GL +LGHY
Sbjct  169  NPPDPEELPEVCRDIIVDHAKKTTELALTLFELISEALGLNANRLKDMDCAEGLFLLGHY  228

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACPEP+LT+GT  HAD  F T+LLQ D +GGLQVLH+N+W +V    GALVVN+GD++
Sbjct  229  YPACPEPELTMGTDSHADTSFLTVLLQ-DRLGGLQVLHENEWVNVTPIHGALVVNLGDMM  287

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNT-YAVPSSRVYGPIKELLSEENPPKYRET  178
            QL+SN +FKS  HRVLA   GPRVSVACFF + +    +R+YGPI ELLSEENPP Y+E 
Sbjct  288  QLISNGKFKSVNHRVLAKDVGPRVSVACFFRSHFQSEKARLYGPINELLSEENPPIYKEI  347

Query  177  TLKEYEDHFHAKGLDGTSALLHFRL  103
            T+KEY  H ++ GLDGTS L HF+L
Sbjct  348  TVKEYLSHSYSIGLDGTSPLDHFKL  372



>ref|XP_007035062.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05988.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 205/267 (77%), Gaps = 4/267 (1%)
 Frame = -1

Query  894  GNVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRM-VSYNSNFDLYTAPSANWRDTLFCVMA  718
            G+VL+E+  GIR FHEQDTEVKKE+YTR  TR  V Y SN DLY + +ANWRDTL C+MA
Sbjct  109  GSVLDEMIDGIRRFHEQDTEVKKEFYTRDTTRRKVLYLSNVDLYRSKAANWRDTLGCLMA  168

Query  717  pnpphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGH  538
            P+PP P +LP VC+DI++ YS  V   G  LFELLSEALGL+P+YL +++C +GL ++GH
Sbjct  169  PDPPDPTELPEVCTDIVMDYSNRVVTFGFTLFELLSEALGLNPSYLKDMDCTEGLLLMGH  228

Query  537  YYPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDL  358
            YYP CPEP+LT+GT+ H D+   TILLQ D +GGLQVLH+NQW DV   PGAL+VN+GD 
Sbjct  229  YYPKCPEPELTMGTTNHRDSSIITILLQ-DQMGGLQVLHENQWVDVPCIPGALIVNVGDF  287

Query  357  LQLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVP--SSRVYGPIKELLSEENPPKYR  184
            LQL+SND+FKS  HRVLA   GPR+SVACF    A    +SR+ GPIKE+LSEENPP YR
Sbjct  288  LQLLSNDKFKSVNHRVLAKHVGPRISVACFLRMQANTGNASRLCGPIKEMLSEENPPIYR  347

Query  183  ETTLKEYEDHFHAKGLDGTSALLHFRL  103
            E  +++Y   +++KGLDGT +L HF+L
Sbjct  348  EILVQDYLSLYYSKGLDGTPSLSHFKL  374



>emb|CDY10161.1| BnaC05g04040D [Brassica napus]
Length=349

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 202/264 (77%), Gaps = 2/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTR-GLTRMVSYNSNFDLYTAPSANWRDTLFCVMAp  715
            NV++ ++ G+R FHE D EV+K +Y+R   +  + Y SNFDLY +P+ANWRDTL C  AP
Sbjct  87   NVMDRMKEGVREFHELDPEVRKGFYSRDSSSSNMLYMSNFDLYNSPAANWRDTLVCFTAP  146

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
            +PP P  LP  C +++I+YS EV K+G +LFELLSEALGL+ N+L +++C   L +LGHY
Sbjct  147  DPPRPEDLPAACGEVMIEYSNEVMKVGKMLFELLSEALGLNTNHLKDMDCANSLLLLGHY  206

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YP CP+P+LTLG +KH+DN F T+LLQD  +GGLQVLH   W DV   PGALVVN+GDLL
Sbjct  207  YPPCPQPNLTLGLTKHSDNSFLTVLLQDH-VGGLQVLHDQYWVDVPPVPGALVVNVGDLL  265

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL++N +F S EHRVLAN  GPR+SVACFF++Y + + RVYGPIKELLSEENPP YR+TT
Sbjct  266  QLITNGKFISVEHRVLANGAGPRISVACFFSSYWMENPRVYGPIKELLSEENPPIYRDTT  325

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            + EY   + +KG DGTS LL+ ++
Sbjct  326  ITEYSKFYRSKGFDGTSGLLYLKI  349



>gb|KFK42979.1| hypothetical protein AALP_AA1G063900 [Arabis alpina]
Length=368

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 206/263 (78%), Gaps = 2/263 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApnp  709
            +LE+++ G+RGF+EQ  EV+K++YTR  ++   Y SNFDLYT+ +A+WRDT  C MAPNP
Sbjct  107  LLEKMKNGVRGFNEQSPEVRKQFYTRDFSKEFVYTSNFDLYTSQAASWRDTFMCYMAPNP  166

Query  708  phphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYYP  529
            P PH LPP+C D++I+YSKEV  LG  LF+ LSEALGL+ N+LN+I+C+ GL +L HYYP
Sbjct  167  PKPHDLPPICRDVMIEYSKEVMNLGEFLFQFLSEALGLNTNHLNDIDCSMGLRMLCHYYP  226

Query  528  ACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQL  349
             CPEPDLT+GTS+H+D+ F T+LL  D I GLQV     WFDV   PGAL++NIGDLLQL
Sbjct  227  PCPEPDLTIGTSQHSDSSFLTVLLP-DLIEGLQVRRDGYWFDVPPVPGALIINIGDLLQL  285

Query  348  VSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            ++ND+F S EHRVLAN+    RVSVACFF T   P+ R+YGPI+EL+SE+NPPKYRETT+
Sbjct  286  ITNDKFVSLEHRVLANRATRARVSVACFFTTGVRPNPRMYGPIRELVSEDNPPKYRETTV  345

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
            KE+     A+GLDGTS LLHF++
Sbjct  346  KEFAAQRSARGLDGTSDLLHFKI  368



>gb|KFK31257.1| hypothetical protein AALP_AA6G088800 [Arabis alpina]
Length=364

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 203/264 (77%), Gaps = 3/264 (1%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +V+E+++ GIR FHEQD+EVKK +Y+R +T+ V YN+NFDLY++ +ANWRDTL  VMAP+
Sbjct  103  DVMEKMKDGIREFHEQDSEVKKTFYSRDITKKVKYNTNFDLYSSQAANWRDTLTTVMAPD  162

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
             P    LP +C +I+++Y+K + KLG ++FELLSEALGL  N+L  ++C K LS+L HYY
Sbjct  163  VPKADDLPNICGEIMLEYTKRMMKLGELIFELLSEALGLKSNHLKEMDCAKSLSLLSHYY  222

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CPEPD T G S H D  F TILLQ D IGGLQ+LH   W DV   P AL++N+GDLLQ
Sbjct  223  PPCPEPDRTFGISSHTDISFITILLQ-DHIGGLQILHDGYWIDVPPNPEALILNLGDLLQ  281

Query  351  LVSNDRFKSSEHRVLANQ-DGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            L++ND+F S +HRVLAN+ + PR+S+A FF  + +P+ +VYGPIKELLSEENPPKYR+TT
Sbjct  282  LITNDQFVSVDHRVLANRGEEPRISIASFF-MHTIPNEQVYGPIKELLSEENPPKYRDTT  340

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
              E   H+ A+GLDGTS LLHF++
Sbjct  341  TTEMATHYLARGLDGTSPLLHFKI  364



>ref|XP_009802072.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana sylvestris]
 ref|XP_009802073.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana sylvestris]
Length=373

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/264 (66%), Positives = 210/264 (80%), Gaps = 3/264 (1%)
 Frame = -1

Query  888  VLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYT--APSANWRDTLFCVMAp  715
            VLEE+ +G R F EQD EVKK++YTR  T+ V + SNFDLY+   P+ANWRD+LFC+MAP
Sbjct  111  VLEEMLQGTRRFFEQDIEVKKQYYTRDSTKKVIHTSNFDLYSPSVPAANWRDSLFCLMAP  170

Query  714  npphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHY  535
             PP P +LP    +IL  YSK V KLG  L ELLSE LGL   +L +++C +GL ILGHY
Sbjct  171  TPPSPEELPTANREILQDYSKHVMKLGCSLLELLSEGLGLDRCHLKDMDCAEGLGILGHY  230

Query  534  YPACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLL  355
            YPACP+P+LT+GT+KH+DNDF T+LLQD  IGGLQVLHQNQW +V   PGALVVNIGDLL
Sbjct  231  YPACPQPELTIGTNKHSDNDFITVLLQDH-IGGLQVLHQNQWVNVPPTPGALVVNIGDLL  289

Query  354  QLVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETT  175
            QL+SND++ S EHRVLAN+ GPR+SVACFF T   PSSR+YGPI ELLSE+N PKYR TT
Sbjct  290  QLISNDKYISVEHRVLANKVGPRISVACFFYTGPRPSSRLYGPIPELLSEDNLPKYRATT  349

Query  174  LKEYEDHFHAKGLDGTSALLHFRL  103
            +K+Y D+F  KGLDGTSALLH+++
Sbjct  350  VKDYTDYFRQKGLDGTSALLHYKI  373



>ref|NP_171933.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein 7 [Arabidopsis 
thaliana]
 sp|P93821.1|ACCH7_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
7 [Arabidopsis thaliana]
 gb|AAB70438.1| Strong similarity to Arabidopsis 2A6 (gb|X83096) [Arabidopsis 
thaliana]
 gb|AEE27690.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein 7 [Arabidopsis 
thaliana]
Length=345

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/263 (59%), Positives = 201/263 (76%), Gaps = 1/263 (0%)
 Frame = -1

Query  891  NVLEEIQRGIRGFHEQDTEVKKEWYTRGLTRMVSYNSNFDLYTAPSANWRDTLFCVMApn  712
            +VLEEIQ G+  FHE+D EVKK +++  LT+   Y++NF+LY++ + NWRD+  C M P+
Sbjct  84   SVLEEIQNGVVRFHEEDPEVKKSYFSLDLTKTFIYHNNFELYSSSAGNWRDSFVCYMDPD  143

Query  711  pphphqlpPVCSDILIKYSKEVQKLGGVLFELLSEALGLHPNYLNNIECNKGLSILGHYY  532
            P +P  LP  C D +I YSK V  LGG+LFELLSEALGL+ + L ++ C KGL ++ HYY
Sbjct  144  PSNPEDLPVACRDAMIGYSKHVMSLGGLLFELLSEALGLNSDTLKSMGCMKGLHMICHYY  203

Query  531  PACPEPDLTLGTSKHADNDFFTILLQDDDIGGLQVLHQNQWFDVHAYPGALVVNIGDLLQ  352
            P CP+PD TLGTSKH+DN F TILLQ D+IGGLQ+LHQ+ W DV   PGAL++NIGD LQ
Sbjct  204  PPCPQPDQTLGTSKHSDNTFITILLQ-DNIGGLQILHQDCWVDVSPLPGALIINIGDFLQ  262

Query  351  LVSNDRFKSSEHRVLANQDGPRVSVACFFNTYAVPSSRVYGPIKELLSEENPPKYRETTL  172
            L++ND+F S +HRVL N+ GPR+S+ACFF++   P+S VYGPIKELLSEENPPKYR+ T+
Sbjct  263  LMTNDKFISVDHRVLTNRVGPRISIACFFSSSMNPNSTVYGPIKELLSEENPPKYRDFTI  322

Query  171  KEYEDHFHAKGLDGTSALLHFRL  103
             EY   +  KGLDGTS L H+R+
Sbjct  323  PEYSKGYIEKGLDGTSHLSHYRI  345



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1869813998100