BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25758_g6_i1 len=502 path=[44659:0-328 74340:329-371 5747:372-406
5782:407-430 66173:431-446 76786:447-448 76788:449-460 76800:461-476
47584:477-501]

Length=502
                                                                      Score     E

ref|XP_009626835.1|  PREDICTED: erlin-2-B                             94.0    9e-20   
ref|XP_009778129.1|  PREDICTED: erlin-2-B                             94.0    9e-20   
ref|XP_006348696.1|  PREDICTED: erlin-2-B-like                        90.9    1e-18   
ref|XP_006378572.1|  hypothetical protein POPTR_0010s16620g           90.1    2e-18   
ref|XP_011011936.1|  PREDICTED: erlin-1-like                          90.1    2e-18   
ref|XP_004239055.1|  PREDICTED: erlin-2-B                             89.4    3e-18   
ref|XP_004297242.1|  PREDICTED: erlin-2-like                          85.1    2e-16   
emb|CDP00430.1|  unnamed protein product                              84.3    3e-16   
gb|KDP41298.1|  hypothetical protein JCGZ_15705                       84.3    3e-16   
ref|XP_002316089.2|  band 7 family protein                            83.2    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003528559.1|  PREDICTED: erlin-2-like                          80.9    4e-15   
gb|KGN47646.1|  hypothetical protein Csa_6G366440                     79.7    9e-15   
ref|XP_004144261.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like   79.7    2e-14   
ref|XP_004171702.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like   79.7    2e-14   
ref|XP_010258063.1|  PREDICTED: erlin-2-B-like                        79.0    2e-14   
ref|XP_003556691.1|  PREDICTED: erlin-2-like isoform X1               79.0    2e-14   
ref|XP_011075603.1|  PREDICTED: erlin-1                               76.6    1e-13   
ref|XP_008368234.1|  PREDICTED: erlin-1-like                          76.6    1e-13   
ref|XP_007157834.1|  hypothetical protein PHAVU_002G102100g           76.3    2e-13   
ref|XP_009356401.1|  PREDICTED: erlin-1                               75.1    6e-13   
ref|XP_008243857.1|  PREDICTED: erlin-2-B                             75.1    6e-13   
ref|XP_008350891.1|  PREDICTED: erlin-2-B-like                        75.1    6e-13   
ref|XP_002512086.1|  SPFH domain-containing protein 2 precursor, ...  73.2    2e-12   Ricinus communis
ref|XP_007223328.1|  hypothetical protein PRUPE_ppa007348mg           73.2    2e-12   
ref|XP_003607805.1|  Erlin-2                                          73.2    3e-12   
ref|XP_008445457.1|  PREDICTED: erlin-2-B                             72.8    4e-12   
ref|XP_010259731.1|  PREDICTED: erlin-2-B-like                        72.4    4e-12   
ref|XP_010091570.1|  hypothetical protein L484_026416                 71.2    6e-12   
ref|XP_004505361.1|  PREDICTED: erlin-2-B-like                        70.1    3e-11   
ref|XP_010554285.1|  PREDICTED: erlin-1                               68.2    1e-10   
ref|XP_007045881.1|  SPFH/Band 7/PHB domain-containing membrane-a...  67.8    3e-10   
ref|XP_010680704.1|  PREDICTED: erlin-1                               66.2    7e-10   
gb|KDO70385.1|  hypothetical protein CISIN_1g018056mg                 65.9    9e-10   
emb|CDY65417.1|  BnaC02g47990D                                        65.9    1e-09   
ref|XP_006437938.1|  hypothetical protein CICLE_v10031905mg           65.5    1e-09   
ref|XP_006437939.1|  hypothetical protein CICLE_v10031905mg           65.5    1e-09   
gb|KHN20517.1|  Erlin-2                                               64.7    2e-09   
ref|XP_009114153.1|  PREDICTED: erlin-2-B                             64.3    3e-09   
emb|CDY04155.1|  BnaA09g19330D                                        64.3    3e-09   
gb|EPS71381.1|  hypothetical protein M569_03378                       63.9    4e-09   
emb|CDY45557.1|  BnaC09g21530D                                        63.5    6e-09   
ref|XP_010939164.1|  PREDICTED: erlin-2-B-like                        62.8    1e-08   
gb|KCW86497.1|  hypothetical protein EUGRSUZ_B03154                   62.0    2e-08   
ref|XP_010044417.1|  PREDICTED: erlin-2-B                             62.0    2e-08   
gb|KCW86495.1|  hypothetical protein EUGRSUZ_B03154                   61.6    3e-08   
ref|XP_010527959.1|  PREDICTED: erlin-1-like                          61.6    3e-08   
ref|XP_006395697.1|  hypothetical protein EUTSA_v10004477mg           61.2    4e-08   
ref|NP_001141011.1|  hypothetical protein                             61.2    4e-08   Zea mays [maize]
ref|XP_002267076.1|  PREDICTED: erlin-2-B                             60.8    4e-08   Vitis vinifera
ref|XP_008794156.1|  PREDICTED: erlin-2-B-like                        60.8    5e-08   
ref|XP_002465119.1|  hypothetical protein SORBIDRAFT_01g032340        60.5    6e-08   Sorghum bicolor [broomcorn]
ref|XP_001751456.1|  predicted protein                                60.5    6e-08   
dbj|BAE99370.1|  hypothetical protein                                 60.5    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26236.1|  hypothetical protein AALP_AA8G220700                  60.5    6e-08   
ref|NP_027545.1|  SPFH/Band 7/PHB domain-containing membrane-asso...  60.5    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291384.1|  hypothetical protein CARUB_v10017522mg           60.5    7e-08   
ref|XP_004984014.1|  PREDICTED: erlin-2-B-like                        60.5    7e-08   
gb|ACN40257.1|  unknown                                               60.5    7e-08   Picea sitchensis
ref|NP_001168508.1|  hypothetical protein                             60.1    9e-08   Zea mays [maize]
ref|XP_010514121.1|  PREDICTED: erlin-2-B-like                        59.3    1e-07   
gb|KHN42949.1|  Erlin-2-B                                             58.9    1e-07   
dbj|BAJ89191.1|  predicted protein                                    59.3    2e-07   
ref|XP_010936489.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like   59.3    2e-07   
ref|XP_010233452.1|  PREDICTED: erlin-2 isoform X2                    58.5    2e-07   
emb|CAE54276.1|  putative integral membrane protein that regulate...  57.4    2e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010502373.1|  PREDICTED: erlin-2-B-like                        58.2    4e-07   
ref|XP_003562386.1|  PREDICTED: erlin-2-B isoform X1                  58.2    4e-07   
ref|XP_010044412.1|  PREDICTED: erlin-2-B-like isoform X1             58.2    4e-07   
ref|XP_010044413.1|  PREDICTED: erlin-2-B-like isoform X2             58.2    4e-07   
ref|XP_002875209.1|  band 7 family protein                            58.2    4e-07   
gb|ABK23954.1|  unknown                                               54.7    4e-07   Picea sitchensis
ref|XP_002965145.1|  hypothetical protein SELMODRAFT_227516           57.8    4e-07   
gb|EYU28860.1|  hypothetical protein MIMGU_mgv1a010144mg              57.8    4e-07   
gb|EMS50295.1|  hypothetical protein TRIUR3_30715                     57.8    6e-07   
gb|KCW86499.1|  hypothetical protein EUGRSUZ_B03155                   56.6    6e-07   
gb|AAT85034.1|  putative SPFH domain / Band 7 family                  57.4    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651510.1|  PREDICTED: erlin-2-like                          57.0    8e-07   
ref|XP_006409592.1|  hypothetical protein EUTSA_v10022792mg           57.0    8e-07   
ref|XP_006409591.1|  hypothetical protein EUTSA_v10022792mg           56.6    9e-07   
gb|ADE77372.1|  unknown                                               57.0    9e-07   
ref|XP_006837139.1|  hypothetical protein AMTR_s00110p00140670        56.6    1e-06   
ref|XP_002962231.1|  hypothetical protein SELMODRAFT_76972            56.2    1e-06   
ref|XP_001759598.1|  predicted protein                                56.2    1e-06   
gb|KFK26235.1|  hypothetical protein AALP_AA8G220700                  56.2    2e-06   
ref|XP_010425147.1|  PREDICTED: erlin-2-B-like                        55.8    2e-06   
ref|XP_009352456.1|  PREDICTED: uncharacterized protein LOC103943820  52.8    3e-06   
ref|XP_009396430.1|  PREDICTED: erlin-2-B isoform X1                  54.7    6e-06   
ref|XP_009396432.1|  PREDICTED: erlin-2-B isoform X3                  54.3    6e-06   
ref|XP_009396431.1|  PREDICTED: erlin-2-B isoform X2                  54.7    7e-06   
gb|AAO64812.1|  At2g03510                                             53.9    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005646983.1|  hypothetical protein COCSUDRAFT_53813            52.8    2e-05   
ref|XP_002949148.1|  hypothetical protein VOLCADRAFT_59054            52.4    4e-05   
ref|XP_010383610.1|  PREDICTED: erlin-2 isoform X2                    50.1    4e-05   
ref|NP_001088269.1|  erlin-2-A precursor                              51.6    5e-05   Xenopus laevis [clawed frog]
ref|XP_010346998.1|  PREDICTED: erlin-2 isoform X3                    50.1    5e-05   
ref|XP_006878153.1|  PREDICTED: erlin-2-like                          48.1    7e-05   
ref|XP_007960361.1|  PREDICTED: erlin-2 isoform X1                    51.2    7e-05   
ref|XP_010602982.1|  PREDICTED: erlin-2 isoform X2                    51.2    7e-05   
ref|XP_005563111.1|  PREDICTED: erlin-2                               51.2    7e-05   
ref|XP_007516752.1|  PREDICTED: erlin-2                               50.8    1e-04   
ref|XP_008144404.1|  PREDICTED: erlin-2 isoform X2                    49.3    1e-04   
ref|XP_004884322.1|  PREDICTED: erlin-2                               50.8    1e-04   
ref|NP_001244470.1|  erlin-2 precursor                                50.8    1e-04   
ref|XP_010602975.1|  PREDICTED: erlin-2 isoform X1                    50.8    1e-04   
ref|XP_002720834.1|  PREDICTED: erlin-2                               50.8    1e-04   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006625610.1|  PREDICTED: erlin-2-like                          50.4    1e-04   
ref|NP_001086246.1|  erlin-2-B precursor                              50.4    1e-04   Xenopus laevis [clawed frog]
ref|XP_008586172.1|  PREDICTED: erlin-2 isoform X2                    48.9    1e-04   
ref|XP_001493841.1|  PREDICTED: erlin-2 isoform X1                    50.4    1e-04   Equus caballus [domestic horse]
ref|XP_006896709.1|  PREDICTED: erlin-2                               50.4    1e-04   
ref|XP_010602989.1|  PREDICTED: erlin-2 isoform X3                    50.4    2e-04   
ref|XP_004598559.1|  PREDICTED: erlin-2                               50.4    2e-04   
ref|NP_001003791.1|  erlin-2 isoform 2                                48.5    2e-04   Homo sapiens [man]
ref|XP_002756994.1|  PREDICTED: erlin-2                               50.1    2e-04   Callithrix jacchus [common marmoset]
ref|XP_848949.1|  PREDICTED: erlin-2 isoformX4                        50.1    2e-04   Canis lupus familiaris [dogs]
ref|XP_005629927.1|  PREDICTED: erlin-2 isoform X5                    50.1    2e-04   
ref|XP_004758310.1|  PREDICTED: erlin-2 isoform X1                    50.1    2e-04   
ref|XP_002917270.1|  PREDICTED: erlin-2-like                          50.1    2e-04   
ref|XP_003938158.1|  PREDICTED: erlin-2 isoform X2                    50.1    2e-04   
ref|NP_502339.1|  Protein ERL-1                                       50.1    2e-04   Caenorhabditis elegans [roundworm]
ref|XP_008684810.1|  PREDICTED: erlin-2 isoform X1                    50.1    2e-04   
ref|XP_003311715.2|  PREDICTED: erlin-2 isoform X4                    48.9    2e-04   
ref|XP_004394468.1|  PREDICTED: erlin-2                               50.1    2e-04   
ref|XP_008684811.1|  PREDICTED: erlin-2 isoform X2                    50.1    2e-04   
ref|XP_010346995.1|  PREDICTED: erlin-2 isoform X1                    50.1    2e-04   
ref|XP_006916377.1|  PREDICTED: erlin-2 isoform X2                    48.1    2e-04   
ref|XP_007933159.1|  PREDICTED: erlin-2                               49.7    2e-04   
ref|XP_004637321.1|  PREDICTED: erlin-2                               49.7    2e-04   
gb|ERE89622.1|  zinc finger protein                                   50.1    3e-04   
ref|XP_005398467.1|  PREDICTED: erlin-2 isoform X1                    49.7    3e-04   
ref|XP_005398468.1|  PREDICTED: erlin-2 isoform X2                    49.3    3e-04   
ref|XP_003498266.1|  PREDICTED: erlin-2                               49.3    3e-04   
emb|CDQ75314.1|  unnamed protein product                              49.3    3e-04   
gb|EPQ01538.1|  Erlin-2                                               49.3    3e-04   
ref|XP_004606925.1|  PREDICTED: erlin-2                               49.3    3e-04   
ref|XP_006765654.1|  PREDICTED: erlin-2                               49.3    4e-04   
ref|XP_001169738.2|  PREDICTED: erlin-2 isoform X1                    49.3    4e-04   Pan troglodytes
ref|XP_008845823.1|  PREDICTED: erlin-2                               49.3    4e-04   
ref|XP_008144402.1|  PREDICTED: erlin-2 isoform X1                    49.3    4e-04   
ref|XP_005856473.1|  PREDICTED: erlin-2 isoform X1                    49.3    4e-04   
ref|XP_004671559.1|  PREDICTED: erlin-2                               49.3    4e-04   
gb|ERE89623.1|  erlin-2-like protein                                  49.3    4e-04   
ref|NP_001121887.1|  erlin-2 precursor                                48.9    4e-04   Danio rerio [leopard danio]
ref|XP_007113337.1|  PREDICTED: erlin-2 isoform X1                    48.9    4e-04   
ref|XP_004383453.1|  PREDICTED: erlin-2                               48.9    4e-04   
ref|XP_006170719.1|  PREDICTED: erlin-2                               48.9    4e-04   
ref|XP_006509177.1|  PREDICTED: erlin-2 isoform X1                    48.9    4e-04   
ref|XP_007448372.1|  PREDICTED: erlin-2 isoform X2                    48.9    4e-04   
ref|XP_005273448.1|  PREDICTED: erlin-2 isoform X1                    48.9    5e-04   
ref|XP_004318395.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_004284919.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|NP_705820.1|  erlin-2                                             48.9    5e-04   Mus musculus [mouse]
ref|NP_001167060.1|  Erlin-2 precursor                                48.9    5e-04   Salmo salar
ref|NP_001099558.1|  erlin-2                                          48.9    5e-04   Rattus norvegicus [brown rat]
dbj|BAC27019.1|  unnamed protein product                              48.9    5e-04   Mus musculus [mouse]
ref|XP_005273450.1|  PREDICTED: erlin-2 isoform X3                    48.9    5e-04   
emb|CAH90754.1|  hypothetical protein                                 48.9    5e-04   Pongo abelii [orang utan]
ref|XP_001512901.1|  PREDICTED: erlin-2                               48.9    5e-04   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003269711.2|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_007448371.1|  PREDICTED: erlin-2 isoform X1                    48.9    5e-04   
ref|XP_004682291.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_003984836.1|  PREDICTED: erlin-2 isoform X1                    48.9    5e-04   
emb|CDQ73083.1|  unnamed protein product                              48.9    5e-04   
ref|XP_008070569.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_008586169.1|  PREDICTED: erlin-2 isoform X1                    48.9    5e-04   
ref|XP_006982987.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_006741505.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_005066638.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_005981675.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|NP_009106.1|  erlin-2 isoform 1                                   48.9    5e-04   Homo sapiens [man]
ref|XP_005338432.1|  PREDICTED: erlin-2                               48.9    5e-04   
ref|XP_007170161.1|  PREDICTED: erlin-2 isoform X2                    48.9    5e-04   
ref|NP_001016719.1|  erlin-2 precursor                                48.9    5e-04   Xenopus tropicalis [western clawed frog]
gb|AAH05950.1|  ERLIN2 protein                                        48.9    5e-04   Homo sapiens [man]
ref|XP_003462936.1|  PREDICTED: erlin-2 isoform X1                    48.5    5e-04   
ref|XP_003796348.1|  PREDICTED: erlin-2                               48.5    6e-04   
gb|AAH50611.1|  ERLIN2 protein                                        48.1    6e-04   Homo sapiens [man]
gb|ELK08766.1|  Erlin-2                                               48.5    6e-04   
ref|XP_006183419.1|  PREDICTED: erlin-2                               48.5    6e-04   
ref|XP_004428907.1|  PREDICTED: erlin-2 isoform 3                     47.0    6e-04   
ref|XP_006916376.1|  PREDICTED: erlin-2 isoform X1                    48.5    7e-04   
ref|XP_006201197.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|XP_004021822.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|XP_007170160.1|  PREDICTED: erlin-2 isoform X1                    48.5    7e-04   
ref|XP_004469435.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|XP_003412458.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|NP_001040041.1|  erlin-2 precursor                                48.5    7e-04   Bos taurus [bovine]
ref|XP_005226182.1|  PREDICTED: erlin-2 isoform X3                    48.5    7e-04   
ref|NP_001137178.1|  erlin-2 precursor                                48.5    7e-04   Sus scrofa [pigs]
ref|XP_005362531.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|XP_005671838.1|  PREDICTED: erlin-2 isoform X2                    48.5    7e-04   
ref|XP_006051017.1|  PREDICTED: erlin-2                               48.1    7e-04   
ref|XP_010979431.1|  PREDICTED: erlin-2                               48.5    7e-04   
ref|XP_010837091.1|  PREDICTED: erlin-2 isoform X4                    48.5    8e-04   
gb|AAH67765.1|  ERLIN2 protein                                        47.8    8e-04   Homo sapiens [man]
ref|XP_005671837.1|  PREDICTED: erlin-2 isoform X1                    48.1    8e-04   
ref|XP_010837087.1|  PREDICTED: erlin-2 isoform X1                    48.1    0.001   
ref|XP_005226181.1|  PREDICTED: erlin-2 isoform X2                    48.1    0.001   
ref|XP_005286570.1|  PREDICTED: erlin-2                               47.8    0.001   



>ref|XP_009626835.1| PREDICTED: erlin-2-B [Nicotiana tomentosiformis]
Length=362

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DFTPIL V +SFIAIFV++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT+P F
Sbjct  28   DFTPILTVLVSFIAIFVLIVAPSMSTLNNSLSILHQVPEGHVGVYWRGGALLNTITDPGF  87



>ref|XP_009778129.1| PREDICTED: erlin-2-B [Nicotiana sylvestris]
Length=362

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DFTPIL V +SFIAIFV++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT+P F
Sbjct  28   DFTPILTVLVSFIAIFVLIVAPSMSTLNNSLSILHQVPEGHVGVYWRGGALLNTITDPGF  87



>ref|XP_006348696.1| PREDICTED: erlin-2-B-like [Solanum tuberosum]
Length=358

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DFTPIL V ++FIAIF ++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT+P F
Sbjct  24   DFTPILTVLVAFIAIFALIVAPSISTLNNSVSILHQVPEGHVGVYWRGGALLNTITDPGF  83



>ref|XP_006378572.1| hypothetical protein POPTR_0010s16620g [Populus trichocarpa]
 gb|ERP56369.1| hypothetical protein POPTR_0010s16620g [Populus trichocarpa]
Length=362

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+PIL VFLSFIAIF ++V P  S   NS S LHQVPEGHVGVYWRGGALL T+T+P F
Sbjct  21   DFSPILTVFLSFIAIFALIVIPSSSNIKNSLSILHQVPEGHVGVYWRGGALLQTVTDPGF  80



>ref|XP_011011936.1| PREDICTED: erlin-1-like [Populus euphratica]
 ref|XP_011011945.1| PREDICTED: erlin-1-like [Populus euphratica]
Length=362

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+PIL VFLSFIAIF ++V P  S   NS S LHQVPEGHVGVYWRGGALL T+T+P F
Sbjct  21   DFSPILTVFLSFIAIFALIVIPSSSNIKNSLSILHQVPEGHVGVYWRGGALLQTVTDPGF  80



>ref|XP_004239055.1| PREDICTED: erlin-2-B [Solanum lycopersicum]
Length=361

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DFTPIL V ++FI+IF ++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT+P F
Sbjct  27   DFTPILTVLVAFISIFALIVAPSISTLNNSVSILHQVPEGHVGVYWRGGALLNTITDPGF  86



>ref|XP_004297242.1| PREDICTED: erlin-2-like [Fragaria vesca subsp. vesca]
Length=386

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  173  TPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + ILFV + F+AIF M+V P +ST  NSFS LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  30   SSILFVLVGFLAIFSMLVLPSVSTISNSFSILHQVPEGHVGVYWRGGALLKTITDPGF  87



>emb|CDP00430.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLL---STN---SFSTLHQVPEGHVGVYWRGGALLSTIT  328
            DFTPIL VF +FIAIF++  + +L   S+N   S +TLHQVPEGHVGVYWRGGALL TIT
Sbjct  24   DFTPILTVFFAFIAIFLVATSQVLVPSSSNLLDSLATLHQVPEGHVGVYWRGGALLKTIT  83

Query  329  NPEF  340
            +P F
Sbjct  84   DPGF  87



>gb|KDP41298.1| hypothetical protein JCGZ_15705 [Jatropha curcas]
Length=367

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST---NSFSTLHQVPEGHVGVYWRGGALLSTITNPE  337
            DF+PIL VFL FIA+  ++V P  S+   NS S LHQVPEGHVGVYWRGGALL TIT+P 
Sbjct  21   DFSPILTVFLLFIAVISVIVLPSASSSFKNSLSILHQVPEGHVGVYWRGGALLKTITDPG  80

Query  338  F  340
            F
Sbjct  81   F  81



>ref|XP_002316089.2| band 7 family protein [Populus trichocarpa]
 gb|EEF02260.2| band 7 family protein [Populus trichocarpa]
Length=357

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 7/60 (12%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVV--TPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+PIL VFLSFIAIF +VV  +P+LS      LHQVPEGHVGVYWRGGALL T+T+P F
Sbjct  21   DFSPILTVFLSFIAIFALVVALSPVLSI-----LHQVPEGHVGVYWRGGALLQTVTDPGF  75



>ref|XP_003528559.1| PREDICTED: erlin-2-like [Glycine max]
Length=364

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPE  337
            D T ILF FLSF AI  +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT P 
Sbjct  23   DSTSILFTFLSFFAIVALVLLPSASPSFQNSLSILHQVPEGHVGVYWRGGALLKTITEPG  82

Query  338  F  340
            F
Sbjct  83   F  83



>gb|KGN47646.1| hypothetical protein Csa_6G366440 [Cucumis sativus]
Length=348

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  173  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGF  81



>ref|XP_004144261.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like [Cucumis sativus]
Length=399

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  173  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGF  81



>ref|XP_004171702.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like, partial [Cucumis 
sativus]
Length=398

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  173  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGF  81



>ref|XP_010258063.1| PREDICTED: erlin-2-B-like [Nelumbo nucifera]
Length=357

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPL---LSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPE  337
            DF+ I+ V + F++   +VV P     ++NSFS LHQVPEGHVGVYWRGGALL+TITNP 
Sbjct  21   DFSAIISVLMVFVSFAALVVVPSSFSTASNSFSILHQVPEGHVGVYWRGGALLNTITNPG  80

Query  338  F  340
            F
Sbjct  81   F  81



>ref|XP_003556691.1| PREDICTED: erlin-2-like isoform X1 [Glycine max]
Length=361

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPE  337
            D T ILF  LSF AI  +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT P 
Sbjct  20   DSTAILFTLLSFFAIVALVLLPSASPFFQNSLSILHQVPEGHVGVYWRGGALLKTITEPG  79

Query  338  F  340
            F
Sbjct  80   F  80



>ref|XP_011075603.1| PREDICTED: erlin-1 [Sesamum indicum]
Length=361

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+ I  V  +F+AI  M++ P  S    S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  25   DFSAIFTVLFTFVAIAAMIIVPSSSNLKQSLSILHQVPEGHVGVYWRGGALLKTITDPGF  84



>ref|XP_008368234.1| PREDICTED: erlin-1-like [Malus domestica]
Length=360

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I FVF +F+AIF + V P  ++ + S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  24   DSSAIFFVFFAFLAIFAVTVLP--TSTTLSILHQVPEGHVGVYWRGGALLKTITDPGF  79



>ref|XP_007157834.1| hypothetical protein PHAVU_002G102100g [Phaseolus vulgaris]
 gb|ESW29828.1| hypothetical protein PHAVU_002G102100g [Phaseolus vulgaris]
Length=359

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPE  337
            D   ILF FLSF A+  +V  P  S    N+ S LHQVPEGHVGVYWRGGALL TIT P 
Sbjct  18   DSIAILFTFLSFFAVVALVFVPAASPSFQNTLSILHQVPEGHVGVYWRGGALLKTITEPG  77

Query  338  F  340
            F
Sbjct  78   F  78



>ref|XP_009356401.1| PREDICTED: erlin-1 [Pyrus x bretschneideri]
Length=377

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + ILFV  +F+AIF   VT L ++++ S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  27   DSSAILFVLFAFLAIF-FAVTVLPTSSTISILHQVPEGHVGVYWRGGALLKTITDPGF  83



>ref|XP_008243857.1| PREDICTED: erlin-2-B [Prunus mume]
Length=371

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + +LFV   F+AIF + + P   + S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  25   DSSAVLFVLFGFLAIFALTMLP---STSLSILHQVPEGHVGVYWRGGALLKTITDPGF  79



>ref|XP_008350891.1| PREDICTED: erlin-2-B-like [Malus domestica]
Length=375

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + ILFV  +F+AIF   VT L ++++ S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  25   DSSAILFVLFAFLAIF-FAVTVLPTSSTISILHQVPEGHVGVYWRGGALLKTITDPGF  81



>ref|XP_002512086.1| SPFH domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF50755.1| SPFH domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=365

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+PIL VFL+FI I  ++V P  +   NS S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  25   DFSPILTVFLAFIGIISIIVIPSSANIKNSLSILHQVPEGHVGVYWRGGALLDTITSPGF  84



>ref|XP_007223328.1| hypothetical protein PRUPE_ppa007348mg [Prunus persica]
 gb|EMJ24527.1| hypothetical protein PRUPE_ppa007348mg [Prunus persica]
Length=371

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + +LFV   F+AI  + + P   + S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  25   DSSAVLFVLFGFLAILALTMLP---STSLSILHQVPEGHVGVYWRGGALLKTITDPGF  79



>ref|XP_003607805.1| Erlin-2 [Medicago truncatula]
 gb|AES90002.1| SPFH domain/band 7 family protein [Medicago truncatula]
Length=361

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 3/57 (5%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            IL  FLSFIAI V V+ P  S    N+ + +HQVPEGHVGVYWRGGALL TIT P F
Sbjct  23   ILVPFLSFIAIAVFVLVPSASPSFKNTMAIVHQVPEGHVGVYWRGGALLKTITEPGF  79



>ref|XP_008445457.1| PREDICTED: erlin-2-B [Cucumis melo]
 ref|XP_008445458.1| PREDICTED: erlin-2-B [Cucumis melo]
Length=366

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFST--LHQVPEGHVGVYWRGGALLSTITNPEF  340
            IL VF SF+AIF MVV P  S  S +   LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  26   ILIVFASFLAIFSMVVFPSQSNLSSNLSILHQVPEGHVGVYWRGGALLKTITDPGF  81



>ref|XP_010259731.1| PREDICTED: erlin-2-B-like [Nelumbo nucifera]
Length=357

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = +2

Query  170  FTPILFVFLSFIAIFVMVVTPLLSTNS--FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            F+ I+ V ++F++   +V+ P  ST S  FS LHQVPEG+VGVYWRGGALL TITNP F
Sbjct  22   FSAIVTVLIAFLSFAALVLVPAFSTASGNFSILHQVPEGYVGVYWRGGALLKTITNPGF  80



>ref|XP_010091570.1| hypothetical protein L484_026416 [Morus notabilis]
 gb|EXB44836.1| hypothetical protein L484_026416 [Morus notabilis]
Length=301

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +2

Query  182  LFVFLSFIAIFVMVV--TPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L VF+ FI +F ++   + L  +NS + LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  36   LAVFMLFIGVFAVIAMSSTLSGSNSLAILHQVPEGHVGVYWRGGALLKTITDPGF  90



>ref|XP_004505361.1| PREDICTED: erlin-2-B-like [Cicer arietinum]
Length=360

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +2

Query  173  TPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            T I   FLSFIAI  +V+ P  S    N+ S +HQVPEGHVGVYW GGALL TIT P F
Sbjct  20   TSIAIPFLSFIAIAALVLVPSASPSFKNTLSIIHQVPEGHVGVYWIGGALLKTITEPGF  78



>ref|XP_010554285.1| PREDICTED: erlin-1 [Tarenaya hassleriana]
Length=359

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            DF+ I+ VF  F+AI  +V++P       S LHQVPEGHVG YWRGGALL+TI  P F
Sbjct  22   DFSSIIAVFAIFLAIATVVMSPT------SILHQVPEGHVGAYWRGGALLNTINEPGF  73



>ref|XP_007045881.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Theobroma cacao]
 gb|EOY01713.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Theobroma cacao]
Length=409

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            PI+ +  +FI I    + P  S   N+ S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  29   PIIVIVFAFIVIASSAMIPPSSNIKNTLSILHQVPEGHVGVYWRGGALLKTITEPGF  85



>ref|XP_010680704.1| PREDICTED: erlin-1 [Beta vulgaris subsp. vulgaris]
Length=360

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTN--SFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            P+LF+F   +A F  +V    STN  S + LHQVPEGHVGVYWRGGALL  IT+P F
Sbjct  32   PLLFLF---VAAFTAIVLSSTSTNKISLTILHQVPEGHVGVYWRGGALLKIITDPGF  85



>gb|KDO70385.1| hypothetical protein CISIN_1g018056mg [Citrus sinensis]
Length=361

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNS--FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT+P F
Sbjct  21   DSSAILAVFLTFIAIVSLILIPSSSSVKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  80



>emb|CDY65417.1| BnaC02g47990D [Brassica napus]
Length=347

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + TPIL  F  FIAI  +V+ P       S++HQVPEGHVG YWRGGALL+ IT P F
Sbjct  19   NMTPILVAFGVFIAIAALVMFP------SSSVHQVPEGHVGAYWRGGALLNIITEPGF  70



>ref|XP_006437938.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
 ref|XP_006484199.1| PREDICTED: erlin-2-like [Citrus sinensis]
 gb|ESR51178.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
Length=363

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSF--STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT+P F
Sbjct  23   DSSAILAVFLTFIAIVSLILIPSSSSIKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  82



>ref|XP_006437939.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
 gb|ESR51179.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
Length=355

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSF--STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT+P F
Sbjct  23   DSSAILAVFLTFIAIVSLILIPSSSSIKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  82



>gb|KHN20517.1| Erlin-2 [Glycine soja]
Length=336

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  197  SFIA--IFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             FIA  +F +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  3    DFIAPSLFRVVLLPSASPFFQNSLSILHQVPEGHVGVYWRGGALLKTITEPGF  55



>ref|XP_009114153.1| PREDICTED: erlin-2-B [Brassica rapa]
Length=361

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  23   DLTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  74



>emb|CDY04155.1| BnaA09g19330D [Brassica napus]
Length=361

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  23   DLTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  74



>gb|EPS71381.1| hypothetical protein M569_03378, partial [Genlisea aurea]
Length=319

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  245  NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +SFS LHQVPEGHVG YWRGGALL T+TNP F
Sbjct  12   DSFSVLHQVPEGHVGAYWRGGALLKTLTNPGF  43



>emb|CDY45557.1| BnaC09g21530D [Brassica napus]
Length=358

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  22   DVTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  73



>ref|XP_010939164.1| PREDICTED: erlin-2-B-like [Elaeis guineensis]
Length=357

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +2

Query  188  VFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +F + I I +    P    +SFS LHQVPEGHVG YWRGGALL TIT+P F
Sbjct  31   IFFALIPIMLSFSIPT-PRSSFSILHQVPEGHVGAYWRGGALLKTITDPGF  80



>gb|KCW86497.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
 gb|KCW86498.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
Length=332

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGF  117



>ref|XP_010044417.1| PREDICTED: erlin-2-B [Eucalyptus grandis]
Length=402

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGF  117



>gb|KCW86495.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
Length=394

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+P F
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGF  117



>ref|XP_010527959.1| PREDICTED: erlin-1-like [Tarenaya hassleriana]
Length=352

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 7/52 (13%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNP  334
            +L VF++ IAI  +V++P       S LHQVPEGHVG YWRGGALL+TI+ P
Sbjct  29   VLAVFIA-IAILTVVISPT------SILHQVPEGHVGAYWRGGALLNTISEP  73



>ref|XP_006395697.1| hypothetical protein EUTSA_v10004477mg [Eutrema salsugineum]
 gb|ESQ32983.1| hypothetical protein EUTSA_v10004477mg [Eutrema salsugineum]
Length=358

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  22   DVTSIFVAFGVFIAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNMITEPGF  73



>ref|NP_001141011.1| hypothetical protein [Zea mays]
 gb|ACF85166.1| unknown [Zea mays]
 tpg|DAA45821.1| TPA: hypothetical protein ZEAMMB73_141028 [Zea mays]
Length=371

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            P  F  ++FI I  ++V+  LS  S S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  43   PFAFGIVAFIGICFVLVS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGF  94



>ref|XP_002267076.1| PREDICTED: erlin-2-B [Vitis vinifera]
 emb|CBI27284.3| unnamed protein product [Vitis vinifera]
Length=379

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  242  TNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            TN+ + LHQVPEGHVG+YWRGGALL TIT P F
Sbjct  68   TNNLTLLHQVPEGHVGMYWRGGALLKTITEPGF  100



>ref|XP_008794156.1| PREDICTED: erlin-2-B-like [Phoenix dactylifera]
Length=360

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQVPEGHVGVYWRGGALL TITNP F
Sbjct  57   LHQVPEGHVGVYWRGGALLKTITNPGF  83



>ref|XP_002465119.1| hypothetical protein SORBIDRAFT_01g032340 [Sorghum bicolor]
 gb|EER92117.1| hypothetical protein SORBIDRAFT_01g032340 [Sorghum bicolor]
Length=372

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            P  F  ++FI I  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  44   PFAFGVVAFIGICFVLIS--LSAPS-SVLHQVPEGHVGVYWRGGALLKTITPPGF  95



>ref|XP_001751456.1| predicted protein [Physcomitrella patens]
 gb|EDQ83773.1| predicted protein [Physcomitrella patens]
Length=352

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPL-LSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            PILF   +  AI + ++ PL ++  +   LHQ+PEGHVGVYWRGGALL+TI+ P F
Sbjct  25   PILF---AICAIGLAILVPLAVAGTNLVLLHQIPEGHVGVYWRGGALLNTISEPGF  77



>dbj|BAE99370.1| hypothetical protein [Arabidopsis thaliana]
Length=342

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  8    DISSILIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  59



>gb|KFK26236.1| hypothetical protein AALP_AA8G220700 [Arabis alpina]
Length=356

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  +V+ P       S +HQVPEGHVG YWRGGALL+ I+ P F
Sbjct  22   DVTSIFLAFGVFIAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNMISEPGF  73



>ref|NP_027545.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
 gb|AAD17426.2| expressed protein [Arabidopsis thaliana]
 gb|AAM65678.1| unknown [Arabidopsis thaliana]
 gb|AEC05709.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
Length=356

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  22   DISSILIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  73



>ref|XP_006291384.1| hypothetical protein CARUB_v10017522mg [Capsella rubella]
 gb|EOA24282.1| hypothetical protein CARUB_v10017522mg [Capsella rubella]
Length=356

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  22   DVSSILLAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  73



>ref|XP_004984014.1| PREDICTED: erlin-2-B-like [Setaria italica]
Length=371

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            P  F  ++FI I  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  43   PFAFGIVAFIGICFVLIS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGF  94



>gb|ACN40257.1| unknown [Picea sitchensis]
Length=358

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +2

Query  203  IAIFVMVVTPLLST-NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +AI  M+  PL +  +S   +HQVPEGHVGVYWRGGALL T+T+P F
Sbjct  30   LAICFMLYIPLSADGHSLDIVHQVPEGHVGVYWRGGALLKTVTSPGF  76



>ref|NP_001168508.1| hypothetical protein [Zea mays]
 gb|ACN28470.1| unknown [Zea mays]
 gb|AFW88126.1| hypothetical protein ZEAMMB73_644677 [Zea mays]
Length=371

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = +2

Query  185  FVF--LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            FVF   +FIAI  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  44   FVFGVFAFIAICFVLIS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGF  94



>ref|XP_010514121.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I   F  F+AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  23   DVSSIFIAFGVFVAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  74



>gb|KHN42949.1| Erlin-2-B, partial [Glycine soja]
Length=310

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  1    SILHQVPEGHVGVYWRGGALLKTITEPGF  29



>dbj|BAJ89191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=366

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  203  IAIFVMVVTPLLSTNSFST-LHQVPEGHVGVYWRGGALLSTITNP  334
            + IF+ V   L+S ++ S+ LHQVPEGHVGVYWRGGALL TIT P
Sbjct  43   VVIFIAVCFLLVSISAPSSILHQVPEGHVGVYWRGGALLKTITTP  87



>ref|XP_010936489.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like [Elaeis guineensis]
Length=360

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  263  HQVPEGHVGVYWRGGALLSTITNPEF  340
            HQVPEGHVGVYWRGGALL TITNP F
Sbjct  58   HQVPEGHVGVYWRGGALLKTITNPGF  83



>ref|XP_010233452.1| PREDICTED: erlin-2 isoform X2 [Brachypodium distachyon]
Length=314

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNP  334
            P+    + FIA+  ++V+  +S  S S LHQVPEGHVGVYWRGGALL  IT+P
Sbjct  39   PLALGVIVFIAVCFLLVS--ISAPS-SILHQVPEGHVGVYWRGGALLKAITSP  88



>emb|CAE54276.1| putative integral membrane protein that regulates cation conductance 
[Triticum aestivum]
Length=215

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            S LHQVPEGHVGVYWRGGALL TIT P +
Sbjct  6    SILHQVPEGHVGVYWRGGALLKTITTPGY  34



>ref|XP_010502373.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I   F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  23   DVSSIFIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  74



>ref|XP_003562386.1| PREDICTED: erlin-2-B isoform X1 [Brachypodium distachyon]
Length=367

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +2

Query  176  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            P+    + FIA+  ++V+  +S  S S LHQVPEGHVGVYWRGGALL  IT+P +
Sbjct  39   PLALGVIVFIAVCFLLVS--ISAPS-SILHQVPEGHVGVYWRGGALLKAITSPGY  90



>ref|XP_010044412.1| PREDICTED: erlin-2-B-like isoform X1 [Eucalyptus grandis]
Length=391

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  170  FTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            F  ILF FL      +++++   + +S S LHQVPEGHVGVYWRGGALL TITNP F
Sbjct  102  FRSILF-FLVPTVCLILILSISSTKSSLSILHQVPEGHVGVYWRGGALLKTITNPGF  157



>ref|XP_010044413.1| PREDICTED: erlin-2-B-like isoform X2 [Eucalyptus grandis]
Length=382

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  170  FTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            F  ILF FL      +++++   + +S S LHQVPEGHVGVYWRGGALL TITNP F
Sbjct  102  FRSILF-FLVPTVCLILILSISSTKSSLSILHQVPEGHVGVYWRGGALLKTITNPGF  157



>ref|XP_002875209.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51468.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I   F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  22   DVSSIFIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  73



>gb|ABK23954.1| unknown [Picea sitchensis]
Length=81

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  203  IAIFVMVVTPLLST-NSFSTLHQVPEGHVGVYWRGGALLSTITN  331
            +AI  M+  PL +  +S   +HQVPEGHVGVYWRGGALL T+T+
Sbjct  30   LAICFMLYIPLSADGHSLDIVHQVPEGHVGVYWRGGALLKTVTS  73



>ref|XP_002965145.1| hypothetical protein SELMODRAFT_227516 [Selaginella moellendorffii]
 gb|EFJ33983.1| hypothetical protein SELMODRAFT_227516 [Selaginella moellendorffii]
Length=332

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  248  SFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +F  LHQ+PEGHVGVYWRGGALL TI+ P F
Sbjct  40   NFGVLHQIPEGHVGVYWRGGALLKTISEPGF  70



>gb|EYU28860.1| hypothetical protein MIMGU_mgv1a010144mg [Erythranthe guttata]
Length=321

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +2

Query  215  VMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + V+ P LS    + S LHQVPEGHVGVYWRGGALL+  T+P F
Sbjct  1    MQVILPTLSIFGQNMSILHQVPEGHVGVYWRGGALLNVNTDPGF  44



>gb|EMS50295.1| hypothetical protein TRIUR3_30715 [Triticum urartu]
Length=356

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNP  334
            S LHQVPEGHVGVYWRGGALL TIT P
Sbjct  31   SILHQVPEGHVGVYWRGGALLKTITTP  57



>gb|KCW86499.1| hypothetical protein EUGRSUZ_B03155, partial [Eucalyptus grandis]
Length=244

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  263  HQVPEGHVGVYWRGGALLSTITNPEF  340
            HQVPEGHVGVYWRGGALL+TIT+P F
Sbjct  17   HQVPEGHVGVYWRGGALLNTITDPGF  42



>gb|AAT85034.1| putative SPFH domain / Band 7 family [Oryza sativa Japonica Group]
 gb|ABF96672.1| SPFH domain protein 2 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95945.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75497.1| hypothetical protein OsI_12095 [Oryza sativa Indica Group]
 gb|EEE59277.1| hypothetical protein OsJ_11309 [Oryza sativa Japonica Group]
Length=374

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 13/54 (24%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            I FV +SF A               S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  57   ICFVLISFSA-------------PSSILHQVPEGHVGVYWRGGALLETITPPGF  97



>ref|XP_006651510.1| PREDICTED: erlin-2-like [Oryza brachyantha]
Length=362

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            S LHQVPEGHVGVYWRGGALL TIT P F
Sbjct  57   SILHQVPEGHVGVYWRGGALLETITPPGF  85



>ref|XP_006409592.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 ref|XP_006409595.1| hypothetical protein EUTSA_v10022979mg [Eutrema salsugineum]
 gb|ESQ51045.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 gb|ESQ51048.1| hypothetical protein EUTSA_v10022979mg [Eutrema salsugineum]
Length=302

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I   F  FIAI  +V+ P       S +HQVPEG+VG YWRGGALL+ IT P F
Sbjct  22   DVSSIFIAFGVFIAIAALVMFP------SSLVHQVPEGYVGAYWRGGALLNIITEPGF  73



>ref|XP_006409591.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 gb|ESQ51044.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
Length=282

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D + I   F  FIAI  +V+ P       S +HQVPEG+VG YWRGGALL+ IT P F
Sbjct  22   DVSSIFIAFGVFIAIAALVMFPS------SLVHQVPEGYVGAYWRGGALLNIITEPGF  73



>gb|ADE77372.1| unknown [Picea sitchensis]
Length=338

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            +   +LFV    IA+ V +  P +S+  F  LHQVPEGHVG YW GGAL   IT+P F
Sbjct  16   NLVQLLFVL---IAVLVAISIPAVSS-CFGILHQVPEGHVGAYWTGGALSKRITDPGF  69



>ref|XP_006837139.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda]
 gb|ERM99992.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda]
Length=336

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQVPEGHVG YWRGGALL TIT+P F
Sbjct  35   LHQVPEGHVGAYWRGGALLKTITSPGF  61



>ref|XP_002962231.1| hypothetical protein SELMODRAFT_76972, partial [Selaginella moellendorffii]
 gb|EFJ37491.1| hypothetical protein SELMODRAFT_76972, partial [Selaginella moellendorffii]
Length=307

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQ+PEGHVGVYWRGGALL TI+ P F
Sbjct  2    LHQIPEGHVGVYWRGGALLKTISEPGF  28



>ref|XP_001759598.1| predicted protein [Physcomitrella patens]
 gb|EDQ75510.1| predicted protein [Physcomitrella patens]
Length=312

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  248  SFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            + + LHQ+PEGHVGVYWRGGALL+TI+ P F
Sbjct  7    NLAILHQIPEGHVGVYWRGGALLNTISGPGF  37



>gb|KFK26235.1| hypothetical protein AALP_AA8G220700 [Arabis alpina]
Length=357

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 35/59 (59%), Gaps = 7/59 (12%)
 Frame = +2

Query  167  DFTPILFVFLSFIAIFVMVVT-PLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            D T I   F  FIAI  + V  P       S +HQVPEGHVG YWRGGALL+ I+ P F
Sbjct  22   DVTSIFLAFGVFIAIAALQVMFP------SSLVHQVPEGHVGAYWRGGALLNMISEPGF  74



>ref|XP_010425147.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 7/54 (13%)
 Frame = +2

Query  182  LFVFLS-FIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            LF+ L  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  27   LFIALGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGF  74



>ref|XP_009352456.1| PREDICTED: uncharacterized protein LOC103943820 [Pyrus x bretschneideri]
Length=123

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  233  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L S+++ S +HQVPEGHVGV WRG  LL TIT+P F
Sbjct  3    LPSSSTISIMHQVPEGHVGVCWRGCTLLKTITDPGF  38



>ref|XP_009396430.1| PREDICTED: erlin-2-B isoform X1 [Musa acuminata subsp. malaccensis]
Length=394

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQVPEGHVGVYWRGGALL   T+P F
Sbjct  91   LHQVPEGHVGVYWRGGALLEATTDPGF  117



>ref|XP_009396432.1| PREDICTED: erlin-2-B isoform X3 [Musa acuminata subsp. malaccensis]
Length=345

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQVPEGHVGVYWRGGALL   T+P F
Sbjct  91   LHQVPEGHVGVYWRGGALLEATTDPGF  117



>ref|XP_009396431.1| PREDICTED: erlin-2-B isoform X2 [Musa acuminata subsp. malaccensis]
Length=392

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  260  LHQVPEGHVGVYWRGGALLSTITNPEF  340
            LHQVPEGHVGVYWRGGALL   T+P F
Sbjct  89   LHQVPEGHVGVYWRGGALLEATTDPGF  115



>gb|AAO64812.1| At2g03510 [Arabidopsis thaliana]
Length=316

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNPEF  340
            S +HQVPEGHVG YWRGGALL+ IT P F
Sbjct  5    SLVHQVPEGHVGAYWRGGALLNIITEPGF  33



>ref|XP_005646983.1| hypothetical protein COCSUDRAFT_53813 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22439.1| hypothetical protein COCSUDRAFT_53813 [Coccomyxa subellipsoidea 
C-169]
Length=346

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = +2

Query  179  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNP  334
            +L   L++I I  +++   L    FS LH VPEGHVGVYWRGG+LLS +T P
Sbjct  25   VLLSTLNYIVIGSLLLAVFLK---FS-LHSVPEGHVGVYWRGGSLLSRVTEP  72



>ref|XP_002949148.1| hypothetical protein VOLCADRAFT_59054 [Volvox carteri f. nagariensis]
 gb|EFJ49641.1| hypothetical protein VOLCADRAFT_59054 [Volvox carteri f. nagariensis]
Length=378

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 16/82 (20%)
 Frame = +2

Query  188  VFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNP----EFPPSDT  355
            +++S IAI V +          + +HQ+PEGHVGVYWRGG LL   T+P      P  DT
Sbjct  37   IYISIIAIAVALFIK-------TAVHQIPEGHVGVYWRGGVLLHRTTSPGIRVRLPLLDT  89

Query  356  -----TNPLTEL*APLLGGTPG  406
                 T   T+    +L GT G
Sbjct  90   FEAIQTTMQTDRLTDILCGTKG  111



>ref|XP_010383610.1| PREDICTED: erlin-2 isoform X2 [Rhinopithecus roxellana]
 ref|XP_010383611.1| PREDICTED: erlin-2 isoform X2 [Rhinopithecus roxellana]
Length=152

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001088269.1| erlin-2-A precursor [Xenopus laevis]
 sp|Q5XH03.1|ERL2A_XENLA RecName: Full=Erlin-2-A; AltName: Full=Endoplasmic reticulum 
lipid raft-associated protein 2-A; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2-A; Short=SPFH 
domain-containing protein 2-A [Xenopus laevis]
 gb|AAH84273.1| LOC495100 protein [Xenopus laevis]
Length=335

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  233  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L++   FS +H++ EGHVGVY+RGGALLST + P F
Sbjct  14   LIAAALFSAIHKIEEGHVGVYYRGGALLSTTSGPGF  49



>ref|XP_010346998.1| PREDICTED: erlin-2 isoform X3 [Saimiri boliviensis boliviensis]
 ref|XP_010346999.1| PREDICTED: erlin-2 isoform X3 [Saimiri boliviensis boliviensis]
Length=152

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V VV+     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006878153.1| PREDICTED: erlin-2-like, partial [Chrysochloris asiatica]
Length=78

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_007960361.1| PREDICTED: erlin-2 isoform X1 [Chlorocebus sabaeus]
Length=380

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  41   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  90



>ref|XP_010602982.1| PREDICTED: erlin-2 isoform X2 [Fukomys damarensis]
 gb|KFO37062.1| Erlin-2 [Fukomys damarensis]
Length=369

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  30   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  79



>ref|XP_005563111.1| PREDICTED: erlin-2 [Macaca fascicularis]
Length=380

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  41   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  90



>ref|XP_007516752.1| PREDICTED: erlin-2 [Erinaceus europaeus]
Length=339

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V    L  + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFLCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_008144404.1| PREDICTED: erlin-2 isoform X2 [Eptesicus fuscus]
Length=152

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004884322.1| PREDICTED: erlin-2 [Heterocephalus glaber]
 ref|XP_004855445.1| PREDICTED: erlin-2 [Heterocephalus glaber]
 gb|EHB02707.1| Erlin-2 [Heterocephalus glaber]
Length=339

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001244470.1| erlin-2 precursor [Macaca mulatta]
 ref|XP_007960362.1| PREDICTED: erlin-2 isoform X2 [Chlorocebus sabaeus]
 ref|XP_003902691.2| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211141.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211142.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211143.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_010383609.1| PREDICTED: erlin-2 isoform X1 [Rhinopithecus roxellana]
 gb|EHH28411.1| Endoplasmic reticulum lipid raft-associated protein 2 [Macaca 
mulatta]
 gb|EHH64102.1| Endoplasmic reticulum lipid raft-associated protein 2 [Macaca 
fascicularis]
Length=339

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_010602975.1| PREDICTED: erlin-2 isoform X1 [Fukomys damarensis]
Length=390

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  30   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  79



>ref|XP_002720834.1| PREDICTED: erlin-2 [Oryctolagus cuniculus]
 ref|XP_008272221.1| PREDICTED: erlin-2 [Oryctolagus cuniculus]
Length=339

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006625610.1| PREDICTED: erlin-2-like [Lepisosteus oculatus]
Length=330

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L  IA  VM +T   +   FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  4    LGAIASVVMAIT---AAALFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001086246.1| erlin-2-B precursor [Xenopus laevis]
 sp|Q6DKC0.1|ERL2B_XENLA RecName: Full=Erlin-2-B; AltName: Full=Endoplasmic reticulum 
lipid raft-associated protein 2-B; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2-B; Short=SPFH 
domain-containing protein 2-B [Xenopus laevis]
 gb|AAH74372.1| MGC84282 protein [Xenopus laevis]
Length=330

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  233  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L++   FS +H++ EGHVGVY+RGGALL+T + P F
Sbjct  14   LIAAALFSAIHKIEEGHVGVYYRGGALLTTTSGPGF  49



>ref|XP_008586172.1| PREDICTED: erlin-2 isoform X2 [Galeopterus variegatus]
Length=152

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_001493841.1| PREDICTED: erlin-2 isoform X1 [Equus caballus]
 ref|XP_005606388.1| PREDICTED: erlin-2 isoform X2 [Equus caballus]
 ref|XP_008521772.1| PREDICTED: erlin-2 [Equus przewalskii]
 ref|XP_008521773.1| PREDICTED: erlin-2 [Equus przewalskii]
Length=339

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006896709.1| PREDICTED: erlin-2 [Elephantulus edwardii]
Length=339

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_010602989.1| PREDICTED: erlin-2 isoform X3 [Fukomys damarensis]
Length=360

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004598559.1| PREDICTED: erlin-2 [Ochotona princeps]
Length=339

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001003791.1| erlin-2 isoform 2 [Homo sapiens]
 ref|NP_001003790.1| erlin-2 isoform 2 [Homo sapiens]
 ref|XP_003311714.1| PREDICTED: erlin-2 isoform X5 [Pan troglodytes]
 ref|XP_004046936.1| PREDICTED: erlin-2-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004046937.1| PREDICTED: erlin-2-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_008954407.1| PREDICTED: erlin-2 isoform X3 [Pan paniscus]
 ref|XP_009241973.1| PREDICTED: erlin-2 isoform X2 [Pongo abelii]
 ref|XP_009241974.1| PREDICTED: erlin-2 isoform X2 [Pongo abelii]
 gb|AAH48308.1| ER lipid raft associated 2 [Homo sapiens]
 gb|AAQ89210.1| C8orf2 [Homo sapiens]
 gb|AIC50826.1| ERLIN2, partial [synthetic construct]
Length=152

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_002756994.1| PREDICTED: erlin-2 [Callithrix jacchus]
 ref|XP_008977566.1| PREDICTED: erlin-2 [Callithrix jacchus]
 ref|XP_008977568.1| PREDICTED: erlin-2 [Callithrix jacchus]
Length=339

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_848949.1| PREDICTED: erlin-2 isoformX4 [Canis lupus familiaris]
 ref|XP_005629928.1| PREDICTED: erlin-2 isoform X6 [Canis lupus familiaris]
 ref|XP_005629929.1| PREDICTED: erlin-2 isoform X7 [Canis lupus familiaris]
 ref|XP_005629930.1| PREDICTED: erlin-2 isoform X8 [Canis lupus familiaris]
 ref|XP_005629931.1| PREDICTED: erlin-2 isoform X9 [Canis lupus familiaris]
Length=337

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005629927.1| PREDICTED: erlin-2 isoform X5 [Canis lupus familiaris]
Length=353

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  16   LMAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  65



>ref|XP_004758310.1| PREDICTED: erlin-2 isoform X1 [Mustela putorius furo]
 ref|XP_004758311.1| PREDICTED: erlin-2 isoform X2 [Mustela putorius furo]
 ref|XP_004758312.1| PREDICTED: erlin-2 isoform X3 [Mustela putorius furo]
 ref|XP_004758313.1| PREDICTED: erlin-2 isoform X4 [Mustela putorius furo]
 ref|XP_004758314.1| PREDICTED: erlin-2 isoform X5 [Mustela putorius furo]
 ref|XP_004806140.1| PREDICTED: erlin-2 isoform X1 [Mustela putorius furo]
 ref|XP_004806141.1| PREDICTED: erlin-2 isoform X2 [Mustela putorius furo]
 ref|XP_004806142.1| PREDICTED: erlin-2 isoform X3 [Mustela putorius furo]
 ref|XP_004806143.1| PREDICTED: erlin-2 isoform X4 [Mustela putorius furo]
 ref|XP_004806144.1| PREDICTED: erlin-2 isoform X5 [Mustela putorius furo]
Length=337

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_002917270.1| PREDICTED: erlin-2-like [Ailuropoda melanoleuca]
 gb|EFB22472.1| hypothetical protein PANDA_005478 [Ailuropoda melanoleuca]
Length=337

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003938158.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
 ref|XP_010346996.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
 ref|XP_010346997.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
Length=339

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V VV+     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_502339.1| Protein ERL-1 [Caenorhabditis elegans]
 emb|CAM36358.1| Protein ERL-1 [Caenorhabditis elegans]
Length=312

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  254  STLHQVPEGHVGVYWRGGALLSTITNP  334
              LH++ EGHVGVY+RGGALL  +TNP
Sbjct  19   QALHKIEEGHVGVYYRGGALLKAVTNP  45



>ref|XP_008684810.1| PREDICTED: erlin-2 isoform X1 [Ursus maritimus]
Length=366

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  29   LMAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>ref|XP_003311715.2| PREDICTED: erlin-2 isoform X4 [Pan troglodytes]
Length=193

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  41   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  90



>ref|XP_004394468.1| PREDICTED: erlin-2 [Odobenus rosmarus divergens]
Length=337

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_008684811.1| PREDICTED: erlin-2 isoform X2 [Ursus maritimus]
Length=337

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_010346995.1| PREDICTED: erlin-2 isoform X1 [Saimiri boliviensis boliviensis]
Length=372

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  33   LMAQLGAAVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  82



>ref|XP_006916377.1| PREDICTED: erlin-2 isoform X2 [Pteropus alecto]
Length=152

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  8    VAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_007933159.1| PREDICTED: erlin-2 [Orycteropus afer afer]
Length=339

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V VV      + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVVASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004637321.1| PREDICTED: erlin-2 [Octodon degus]
Length=339

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +  L    FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFLCACLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>gb|ERE89622.1| zinc finger protein [Cricetulus griseus]
Length=983

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  215  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            V V +     + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  626  VAVASSFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  667



>ref|XP_005398467.1| PREDICTED: erlin-2 isoform X1 [Chinchilla lanigera]
Length=348

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005398468.1| PREDICTED: erlin-2 isoform X2 [Chinchilla lanigera]
Length=339

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003498266.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007622680.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007622686.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610932.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610933.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610934.1| PREDICTED: erlin-2 [Cricetulus griseus]
 gb|EGV94642.1| Erlin-2 [Cricetulus griseus]
 gb|ERE89621.1| erlin-2-like protein [Cricetulus griseus]
Length=339

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>emb|CDQ75314.1| unnamed protein product [Oncorhynchus mykiss]
Length=341

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            F+++H++ EGH GVY+RGGALL+T +NP F
Sbjct  20   FASVHKIEEGHTGVYYRGGALLTTTSNPGF  49



>gb|EPQ01538.1| Erlin-2 [Myotis brandtii]
Length=365

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  26   LMAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  75



>ref|XP_004606925.1| PREDICTED: erlin-2, partial [Sorex araneus]
Length=344

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVAVSFCCASIFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006765654.1| PREDICTED: erlin-2 [Myotis davidii]
Length=339

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_001169738.2| PREDICTED: erlin-2 isoform X1 [Pan troglodytes]
Length=380

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  41   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  90



>ref|XP_008845823.1| PREDICTED: erlin-2 [Nannospalax galili]
 ref|XP_008845824.1| PREDICTED: erlin-2 [Nannospalax galili]
Length=339

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_008144402.1| PREDICTED: erlin-2 isoform X1 [Eptesicus fuscus]
Length=339

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005856473.1| PREDICTED: erlin-2 isoform X1 [Myotis brandtii]
 ref|XP_005856474.1| PREDICTED: erlin-2 isoform X2 [Myotis brandtii]
 ref|XP_006086286.1| PREDICTED: erlin-2 isoform X1 [Myotis lucifugus]
 ref|XP_006086287.1| PREDICTED: erlin-2 isoform X2 [Myotis lucifugus]
Length=339

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004671559.1| PREDICTED: erlin-2 [Jaculus jaculus]
Length=339

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>gb|ERE89623.1| erlin-2-like protein [Cricetulus griseus]
Length=365

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001121887.1| erlin-2 precursor [Danio rerio]
 sp|A3QK16.1|ERLN2_DANRE RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2 [Danio rerio]
Length=331

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            FS LH++ EGHVGVY+RGGALL+  + P F
Sbjct  19   FSALHKIEEGHVGVYYRGGALLTATSGPGF  48



>ref|XP_007113337.1| PREDICTED: erlin-2 isoform X1 [Physeter catodon]
Length=355

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  16   LMAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  65



>ref|XP_004383453.1| PREDICTED: erlin-2 [Trichechus manatus latirostris]
Length=340

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006170719.1| PREDICTED: erlin-2 [Tupaia chinensis]
 gb|ELV09838.1| Erlin-2 [Tupaia chinensis]
Length=341

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006509177.1| PREDICTED: erlin-2 isoform X1 [Mus musculus]
 ref|XP_006509178.1| PREDICTED: erlin-2 isoform X2 [Mus musculus]
Length=364

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  24   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  73



>ref|XP_007448372.1| PREDICTED: erlin-2 isoform X2 [Lipotes vexillifer]
Length=339

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005273448.1| PREDICTED: erlin-2 isoform X1 [Homo sapiens]
Length=451

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  112  LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  161



>ref|XP_004318395.1| PREDICTED: erlin-2 [Tursiops truncatus]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004284919.1| PREDICTED: erlin-2 [Orcinus orca]
 ref|XP_007113338.1| PREDICTED: erlin-2 isoform X2 [Physeter catodon]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_705820.1| erlin-2 [Mus musculus]
 ref|XP_006509179.1| PREDICTED: erlin-2 isoform X3 [Mus musculus]
 ref|XP_006509180.1| PREDICTED: erlin-2 isoform X4 [Mus musculus]
 sp|Q8BFZ9.1|ERLN2_MOUSE RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Mus musculus]
 gb|AAH36333.1| ER lipid raft associated 2 [Mus musculus]
 gb|AAH38374.1| ER lipid raft associated 2 [Mus musculus]
 gb|EDL32800.1| SPFH domain family, member 2 [Mus musculus]
Length=340

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001167060.1| Erlin-2 precursor [Salmo salar]
 gb|ACN10713.1| Erlin-2 precursor [Salmo salar]
Length=330

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            FS++H++ EGH GVY+RGGALL+T ++P F
Sbjct  20   FSSVHKIEEGHTGVYYRGGALLTTTSSPGF  49



>ref|NP_001099558.1| erlin-2 [Rattus norvegicus]
 ref|XP_008769545.1| PREDICTED: erlin-2 isoform X1 [Rattus norvegicus]
 ref|XP_008769546.1| PREDICTED: erlin-2 isoform X1 [Rattus norvegicus]
 sp|B5DEH2.1|ERLN2_RAT RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Rattus norvegicus]
 gb|EDM09088.1| SPFH domain family, member 2 (predicted) [Rattus norvegicus]
 gb|AAI68668.1| ER lipid raft associated 2 [Rattus norvegicus]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>dbj|BAC27019.1| unnamed protein product [Mus musculus]
Length=340

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005273450.1| PREDICTED: erlin-2 isoform X3 [Homo sapiens]
Length=264

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  112  LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  161



>emb|CAH90754.1| hypothetical protein [Pongo abelii]
Length=338

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_001512901.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
 ref|XP_007668052.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
 ref|XP_007668053.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
Length=338

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003269711.2| PREDICTED: erlin-2 [Nomascus leucogenys]
Length=305

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_007448371.1| PREDICTED: erlin-2 isoform X1 [Lipotes vexillifer]
Length=368

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  29   LMAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>ref|XP_004682291.1| PREDICTED: erlin-2 [Condylura cristata]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003984836.1| PREDICTED: erlin-2 isoform X1 [Felis catus]
 ref|XP_006930788.1| PREDICTED: erlin-2 isoform X2 [Felis catus]
 ref|XP_007097149.1| PREDICTED: erlin-2 isoform X1 [Panthera tigris altaica]
 ref|XP_007097150.1| PREDICTED: erlin-2 isoform X2 [Panthera tigris altaica]
Length=337

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>emb|CDQ73083.1| unnamed protein product [Oncorhynchus mykiss]
Length=330

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            FS++H++ EGH GVY+RGGALL+T ++P F
Sbjct  20   FSSVHKIEEGHTGVYYRGGALLTTTSSPGF  49



>ref|XP_008070569.1| PREDICTED: erlin-2 [Tarsius syrichta]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_008586169.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
 ref|XP_008586170.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
 ref|XP_008586171.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006982987.1| PREDICTED: erlin-2 [Peromyscus maniculatus bairdii]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006741505.1| PREDICTED: erlin-2 [Leptonychotes weddellii]
Length=316

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005066638.1| PREDICTED: erlin-2 [Mesocricetus auratus]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005981675.1| PREDICTED: erlin-2 [Pantholops hodgsonii]
Length=338

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_009106.1| erlin-2 isoform 1 [Homo sapiens]
 ref|NP_001126372.1| erlin-2 [Pongo abelii]
 ref|XP_003830787.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_005273449.1| PREDICTED: erlin-2 isoform X2 [Homo sapiens]
 ref|XP_008954404.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_008954405.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_009241970.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009241971.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009241972.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009453464.1| PREDICTED: erlin-2 isoform X3 [Pan troglodytes]
 sp|O94905.1|ERLN2_HUMAN RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Homo sapiens]
 sp|Q5R7C5.1|ERLN2_PONAB RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Pongo abelii]
 dbj|BAA36845.1| unnamed protein product [Homo sapiens]
 emb|CAC09443.1| hypothetical protein [Homo sapiens]
 gb|AAQ88475.1| C8orf2 [Homo sapiens]
 emb|CAH92335.1| hypothetical protein [Pongo abelii]
 emb|CAL37919.1| hypothetical protein [synthetic construct]
 emb|CAL37946.1| hypothetical protein [synthetic construct]
 gb|EAW63365.1| SPFH domain family, member 2, isoform CRA_a [Homo sapiens]
 gb|EAW63366.1| SPFH domain family, member 2, isoform CRA_a [Homo sapiens]
 dbj|BAF84083.1| unnamed protein product [Homo sapiens]
 dbj|BAG72542.1| ER lipid raft associated 2 [synthetic construct]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005338432.1| PREDICTED: erlin-2 [Ictidomys tridecemlineatus]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_007170161.1| PREDICTED: erlin-2 isoform X2 [Balaenoptera acutorostrata scammoni]
Length=339

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001016719.1| erlin-2 precursor [Xenopus (Silurana) tropicalis]
 sp|Q28J34.1|ERLN2_XENTR RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ82623.1| SPFH domain family, member 2 [Xenopus (Silurana) tropicalis]
 gb|AAI58954.1| hypothetical protein LOC549473 [Xenopus (Silurana) tropicalis]
Length=335

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  233  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L++   FS +H++ EGHVGVY+RGGALL++ + P F
Sbjct  14   LIAAALFSAIHKIEEGHVGVYYRGGALLTSTSGPGF  49



>gb|AAH05950.1| ERLIN2 protein, partial [Homo sapiens]
Length=347

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003462936.1| PREDICTED: erlin-2 isoform X1 [Cavia porcellus]
 ref|XP_005000481.1| PREDICTED: erlin-2 isoform X2 [Cavia porcellus]
Length=339

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V + +  L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVALASGFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003796348.1| PREDICTED: erlin-2 [Otolemur garnettii]
Length=339

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V + +  L    FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAIVALTSSFLCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>gb|AAH50611.1| ERLIN2 protein, partial [Homo sapiens]
Length=229

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  23   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  72



>gb|ELK08766.1| Erlin-2 [Pteropus alecto]
Length=370

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  31   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  80



>ref|XP_006183419.1| PREDICTED: erlin-2 [Camelus ferus]
 ref|XP_010947448.1| PREDICTED: erlin-2 [Camelus bactrianus]
Length=339

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004428907.1| PREDICTED: erlin-2 isoform 3 [Ceratotherium simum simum]
Length=152

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  251  FSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  20   FSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006916376.1| PREDICTED: erlin-2 isoform X1 [Pteropus alecto]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006201197.1| PREDICTED: erlin-2 [Vicugna pacos]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_004021822.1| PREDICTED: erlin-2 [Ovis aries]
 ref|XP_005698880.1| PREDICTED: erlin-2 isoform X1 [Capra hircus]
 ref|XP_005698881.1| PREDICTED: erlin-2 isoform X2 [Capra hircus]
Length=338

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_007170160.1| PREDICTED: erlin-2 isoform X1 [Balaenoptera acutorostrata scammoni]
Length=368

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  30   MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>ref|XP_004469435.1| PREDICTED: erlin-2 [Dasypus novemcinctus]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_003412458.1| PREDICTED: erlin-2 [Loxodonta africana]
 ref|XP_010590761.1| PREDICTED: erlin-2 [Loxodonta africana]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|NP_001040041.1| erlin-2 precursor [Bos taurus]
 ref|XP_005226183.1| PREDICTED: erlin-2 isoform X1 [Bos taurus]
 ref|XP_005906170.1| PREDICTED: erlin-2 [Bos mutus]
 ref|XP_010837089.1| PREDICTED: erlin-2 isoform X3 [Bison bison bison]
 sp|Q1RMU4.1|ERLN2_BOVIN RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Bos taurus]
 gb|AAI14708.1| ER lipid raft associated 2 [Bos taurus]
 tpg|DAA14454.1| TPA: erlin-2 [Bos taurus]
 gb|ELR48820.1| Erlin-2 [Bos mutus]
Length=338

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005226182.1| PREDICTED: erlin-2 isoform X3 [Bos taurus]
 ref|XP_010837088.1| PREDICTED: erlin-2 isoform X2 [Bison bison bison]
Length=352

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  15   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  63



>ref|NP_001137178.1| erlin-2 precursor [Sus scrofa]
 gb|ACK36978.1| ER lipid raft-associated 2 isoform 2 [Sus scrofa]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005362531.1| PREDICTED: erlin-2 [Microtus ochrogaster]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVACSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005671838.1| PREDICTED: erlin-2 isoform X2 [Sus scrofa]
 ref|XP_005671839.1| PREDICTED: erlin-2 isoform X3 [Sus scrofa]
Length=339

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_006051017.1| PREDICTED: erlin-2 [Bubalus bubalis]
Length=338

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_010979431.1| PREDICTED: erlin-2 [Camelus dromedarius]
Length=368

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  29   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>ref|XP_010837091.1| PREDICTED: erlin-2 isoform X4 [Bison bison bison]
Length=367

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  30   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>gb|AAH67765.1| ERLIN2 protein [Homo sapiens]
 dbj|BAG59750.1| unnamed protein product [Homo sapiens]
 gb|AIC59736.1| ERLIN2, partial [synthetic construct]
Length=206

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



>ref|XP_005671837.1| PREDICTED: erlin-2 isoform X1 [Sus scrofa]
Length=368

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  191  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  29   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  78



>ref|XP_010837087.1| PREDICTED: erlin-2 isoform X1 [Bison bison bison]
Length=418

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  81   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  129



>ref|XP_005226181.1| PREDICTED: erlin-2 isoform X2 [Bos taurus]
Length=418

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  194  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  81   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  129



>ref|XP_005286570.1| PREDICTED: erlin-2 [Chrysemys picta bellii]
 ref|XP_005286571.1| PREDICTED: erlin-2 [Chrysemys picta bellii]
Length=333

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  236  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITNPEF  340
            L+   FS +H++ EGH+GVY+RGGALL++ + P F
Sbjct  15   LAATLFSAVHKIEEGHIGVYYRGGALLTSTSGPGF  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520067850276