BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25748_g1_i2 len=1791 path=[2146:0-177 2324:178-203 2350:204-231
2378:232-241 2388:242-293 2440:294-318 2465:319-399 5170:400-420
2567:421-555 7398:556-570 5950:571-580 5960:581-585 2732:586-655
7819:656-664 7828:665-923 4910:924-934 3081:935-967 4500:968-979
3126:980-996 3143:997-1139 5325:1140-1161 3308:1162-1299
3446:1300-1356 7631:1357-1364 6736:1365-1374 3521:1375-1480
5315:1481-1488 @3635@!:1489-1790]

Length=1791
                                                                      Score     E

ref|XP_004234328.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    885   0.0      
ref|XP_006351539.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    884   0.0      
ref|XP_009792294.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    864   0.0      
gb|EYU33550.1|  hypothetical protein MIMGU_mgv1a003763mg                856   0.0      
ref|XP_006372859.1|  asparaginyl-tRNA synthetase family protein         851   0.0      
ref|XP_003635124.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    850   0.0      
ref|XP_011081398.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    850   0.0      
ref|XP_011037109.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    847   0.0      
ref|XP_011026436.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    844   0.0      
gb|KDP39873.1|  hypothetical protein JCGZ_03404                         843   0.0      
ref|XP_002309798.2|  hypothetical protein POPTR_0007s01840g             843   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007039833.1|  Class II aminoacyl-tRNA and biotin synthetas...    835   0.0      
ref|XP_009348576.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    835   0.0      
ref|XP_004288480.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    832   0.0      
ref|XP_006440310.1|  hypothetical protein CICLE_v10019519mg             830   0.0      
ref|XP_006477189.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    828   0.0      
ref|XP_010689220.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    827   0.0      
ref|XP_010533903.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    823   0.0      
ref|XP_010053478.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    819   0.0      
ref|XP_004147209.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    818   0.0      
gb|KDO61441.1|  hypothetical protein CISIN_1g011197mg                   815   0.0      
gb|KCW77787.1|  hypothetical protein EUGRSUZ_D02080                     818   0.0      
ref|XP_010258932.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    814   0.0      
ref|XP_007210255.1|  hypothetical protein PRUPE_ppa003379mg             814   0.0      
emb|CDY42978.1|  BnaA01g17760D                                          812   0.0      
gb|KHG03082.1|  Asparagine--tRNA ligase                                 811   0.0      
ref|XP_009108309.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    810   0.0      
ref|XP_008448845.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    810   0.0      
ref|XP_002870111.1|  hypothetical protein ARALYDRAFT_914989             810   0.0      
emb|CDY58174.1|  BnaA08g30290D                                          809   0.0      
gb|KFK32185.1|  hypothetical protein AALP_AA6G208600                    808   0.0      
gb|KDO61440.1|  hypothetical protein CISIN_1g011197mg                   804   0.0      
ref|NP_193462.1|  asparaginyl-tRNA synthetase                           805   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA10904.1|  asparaginyl-tRNA synthetase                            805   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110832.1|  Asparagine--tRNA ligase                            801   0.0      
emb|CDY50134.1|  BnaCnng18830D                                          802   0.0      
ref|XP_009144600.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    801   0.0      
ref|XP_008238532.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    801   0.0      
ref|XP_006414245.1|  hypothetical protein EUTSA_v10024799mg             799   0.0      
ref|XP_006826798.1|  hypothetical protein AMTR_s00010p00025770          800   0.0      
ref|XP_010449638.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    798   0.0      
ref|XP_010434685.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    797   0.0      
ref|XP_004508904.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    795   0.0      
ref|XP_010440027.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    795   0.0      
gb|AES90907.2|  asparagine-tRNA ligase                                  794   0.0      
ref|XP_007155659.1|  hypothetical protein PHAVU_003G220700g             791   0.0      
ref|XP_010933671.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    793   0.0      
emb|CDY35583.1|  BnaC01g21050D                                          789   0.0      
ref|XP_009388048.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    789   0.0      
ref|XP_009348577.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    786   0.0      
ref|XP_003525844.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    785   0.0      
gb|EPS73970.1|  hypothetical protein M569_00785                         785   0.0      
ref|XP_003550908.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    784   0.0      
ref|XP_008373763.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    784   0.0      
ref|XP_003608710.1|  Asparaginyl-tRNA synthetase                        781   0.0      
gb|KHN09822.1|  Asparagine--tRNA ligase, chloroplastic/mitochondrial    773   0.0      
gb|KDO61438.1|  hypothetical protein CISIN_1g011197mg                   764   0.0      
ref|XP_004957710.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    760   0.0      
ref|XP_006658561.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    757   0.0      
gb|KDO61439.1|  hypothetical protein CISIN_1g011197mg                   754   0.0      
ref|XP_008796093.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    754   0.0      
ref|XP_002460704.1|  hypothetical protein SORBIDRAFT_02g033440          756   0.0      Sorghum bicolor [broomcorn]
ref|XP_008667385.1|  PREDICTED: hypothetical protein isoform X1         753   0.0      
ref|XP_003560202.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    750   0.0      
gb|KDO61442.1|  hypothetical protein CISIN_1g011197mg                   744   0.0      
ref|XP_010258931.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    744   0.0      
dbj|BAJ90664.1|  predicted protein                                      740   0.0      
dbj|BAC15528.1|  putative asparaginyl-tRNA synthetase, chloroplas...    739   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_001757621.1|  predicted protein                                  731   0.0      
gb|ABD65116.1|  asparaginyl-tRNA synthetase, putative                   721   0.0      Brassica oleracea
ref|XP_010258933.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    700   0.0      
ref|XP_008448847.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    690   0.0      
ref|XP_006283618.1|  hypothetical protein CARUB_v10004675mg             687   0.0      
ref|NP_001059657.2|  Os07g0485400                                       684   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008653090.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    671   0.0      
ref|XP_007039834.1|  Class II aminoacyl-tRNA and biotin synthetas...    658   0.0      
gb|EEC82046.1|  hypothetical protein OsI_26023                          623   0.0      Oryza sativa Indica Group [Indian rice]
gb|KEH31646.1|  asparagine-tRNA ligase                                  626   0.0      
emb|CDP09969.1|  unnamed protein product                                622   0.0      
ref|XP_009592734.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    606   0.0      
ref|XP_001421099.1|  predicted protein                                  600   0.0      Ostreococcus lucimarinus CCE9901
gb|EMT10339.1|  Asparaginyl-tRNA synthetase, chloroplastic/mitoch...    580   0.0      
ref|WP_032125010.1|  asparaginyl-tRNA synthetase                        576   0.0      
gb|KIA78175.1|  Asparagine--tRNA ligase                                 566   0.0      
ref|WP_013924786.1|  asparaginyl-tRNA synthetase                        566   0.0      
gb|EFB42308.1|  hypothetical protein pah_c012o020                       564   0.0      Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_011174896.1|  asparaginyl-tRNA synthetase                        560   0.0      
ref|WP_039356604.1|  asparaginyl-tRNA synthetase                        560   0.0      
gb|KIC73525.1|  Asparagine--tRNA ligase                                 560   0.0      
emb|CDZ80908.1|  Asparagine--tRNA ligase                                555   0.0      
ref|XP_001422855.1|  predicted protein                                  551   0.0      Ostreococcus lucimarinus CCE9901
emb|CDR32992.1|  Asparaginyl-tRNA synthetase                            541   0.0      
ref|WP_015191718.1|  asparaginyl-tRNA synthetase                        540   0.0      
ref|XP_005713545.1|  asparagine--tRNA ligase, chloroplast precursor     542   0.0      
ref|WP_036478667.1|  asparaginyl-tRNA synthetase                        538   0.0      
gb|KIC76212.1|  Asparagine--tRNA ligase                                 537   0.0      
ref|WP_013182621.1|  asparaginyl-tRNA synthetase                        536   0.0      
ref|WP_006507577.1|  asparaginyl-tRNA synthetase                        536   0.0      
ref|WP_017652700.1|  asparaginyl-tRNA synthetase                        536   0.0      
ref|WP_015139158.1|  asparaginyl-tRNA synthetase                        535   0.0      
ref|WP_039383095.1|  asparaginyl-tRNA synthetase                        534   0.0      
ref|WP_009344629.1|  asparaginyl-tRNA synthetase                        533   0.0      
ref|WP_028973342.1|  asparaginyl-tRNA synthetase                        533   0.0      
ref|WP_021360737.1|  asparagine--tRNA ligase                            531   1e-180   
ref|WP_006277672.1|  asparaginyl-tRNA synthetase                        531   1e-180   
ref|WP_036530798.1|  asparaginyl-tRNA synthetase                        531   2e-180   
ref|WP_021359414.1|  asparagine--tRNA ligase                            531   2e-180   
ref|WP_016951423.1|  asparaginyl-tRNA synthetase                        530   2e-180   
ref|WP_021375697.1|  asparagine--tRNA ligase                            530   2e-180   
ref|WP_039753709.1|  asparaginyl-tRNA synthetase                        530   2e-180   
ref|WP_003430444.1|  asparaginyl-tRNA synthetase                        530   3e-180   
ref|WP_003423318.1|  asparaginyl-tRNA synthetase                        530   3e-180   
ref|WP_011320339.1|  asparaginyl-tRNA synthetase                        530   4e-180   
ref|WP_038811786.1|  asparaginyl-tRNA synthetase                        530   5e-180   
ref|WP_006194614.1|  asparaginyl-tRNA synthetase                        529   5e-180   
ref|WP_010997802.1|  asparaginyl-tRNA synthetase                        529   6e-180   
ref|WP_012407633.1|  asparaginyl-tRNA synthetase                        529   8e-180   
ref|WP_021385136.1|  asparagine--tRNA ligase                            529   9e-180   
ref|WP_028088638.1|  asparaginyl-tRNA synthetase                        528   1e-179   
ref|WP_026733548.1|  asparaginyl-tRNA synthetase                        528   1e-179   
ref|WP_026295068.1|  asparaginyl-tRNA synthetase                        528   2e-179   
ref|WP_039204519.1|  asparaginyl-tRNA synthetase                        528   2e-179   
gb|KIE11165.1|  asparaginyl-tRNA synthetase                             528   2e-179   
ref|WP_019505273.1|  asparaginyl-tRNA synthetase                        527   3e-179   
ref|WP_007287700.1|  asparaginyl-tRNA synthetase                        527   3e-179   
ref|WP_017289279.1|  asparaginyl-tRNA synthetase                        527   4e-179   
ref|WP_028082726.1|  asparaginyl-tRNA synthetase                        527   4e-179   
ref|WP_021418214.1|  asparagine--tRNA ligase                            527   4e-179   
ref|WP_015083044.1|  asparaginyl-tRNA synthetase                        527   5e-179   
ref|WP_006101797.1|  asparaginyl-tRNA synthetase                        527   5e-179   
ref|WP_006439109.1|  asparaginyl-tRNA synthetase [                      528   6e-179   
ref|WP_027403107.1|  asparaginyl-tRNA synthetase                        526   7e-179   
ref|WP_022072260.1|  MULTISPECIES: asparagine--tRNA ligase              526   1e-178   
ref|WP_009787459.1|  asparaginyl-tRNA synthetase                        526   1e-178   
ref|WP_013254826.1|  asparaginyl-tRNA synthetase                        526   2e-178   
ref|WP_015148521.1|  asparaginyl-tRNA synthetase                        525   2e-178   
ref|WP_029638590.1|  asparaginyl-tRNA synthetase [                      525   2e-178   
ref|WP_016869073.1|  asparaginyl-tRNA synthetase                        525   2e-178   
ref|WP_012629290.1|  asparaginyl-tRNA synthetase                        525   3e-178   
ref|WP_015217480.1|  asparaginyl-tRNA synthetase                        525   3e-178   
ref|WP_013192229.1|  asparaginyl-tRNA synthetase                        525   4e-178   
ref|WP_015162505.1|  asparaginyl-tRNA synthetase                        524   6e-178   
ref|WP_026722401.1|  asparaginyl-tRNA synthetase                        524   7e-178   
ref|WP_021128388.1|  asparagine--tRNA ligase [                          524   9e-178   
emb|CEK35366.1|  asparaginyl-tRNA ligase,Asparagine--tRNA ligase,...    524   9e-178   
ref|WP_015113755.1|  asparaginyl-tRNA synthetase                        523   1e-177   
emb|CEJ73281.1|  Asparaginyl-tRNA synthetase (Asparagine--tRNA li...    523   1e-177   
ref|WP_008182157.1|  asparaginyl-tRNA synthetase                        523   1e-177   
ref|WP_015205859.1|  asparaginyl-tRNA synthetase                        523   1e-177   
ref|WP_021432526.1|  asparagine--tRNA ligase [                          523   2e-177   
ref|WP_025162005.1|  MULTISPECIES: asparaginyl-tRNA synthetase          523   2e-177   
ref|WP_039725923.1|  asparaginyl-tRNA synthetase                        523   2e-177   
ref|WP_023064824.1|  asparagine--tRNA ligase                            523   2e-177   
ref|WP_013944267.1|  asparaginyl-tRNA synthetase                        522   3e-177   
ref|WP_012596410.1|  MULTISPECIES: asparaginyl-tRNA synthetase          522   4e-177   
ref|WP_015954668.1|  asparaginyl-tRNA synthetase                        522   5e-177   
ref|WP_015223170.1|  asparaginyl-tRNA synthetase                        522   5e-177   
ref|WP_027984655.1|  asparaginyl-tRNA synthetase                        522   5e-177   
gb|EKE07889.1|  hypothetical protein ACD_17C00475G0001                  521   6e-177   
ref|WP_021428921.1|  asparagine--tRNA ligase [                          521   7e-177   
ref|WP_006622580.1|  MULTISPECIES: asparaginyl-tRNA synthetase          521   7e-177   
ref|WP_017661521.1|  asparaginyl-tRNA synthetase                        521   8e-177   
ref|WP_011611843.1|  asparaginyl-tRNA synthetase                        521   1e-176   
ref|WP_016878532.1|  asparaginyl-tRNA synthetase                        520   1e-176   
ref|WP_024268691.1|  Asparaginyl-tRNA synthetase                        521   1e-176   
ref|WP_006517726.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_010474487.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_026901716.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_024614173.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_017713084.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_002599003.1|  asparaginyl-tRNA synthetase                        520   2e-176   
ref|WP_006456769.1|  asparaginyl-tRNA synthetase                        520   3e-176   
ref|WP_006616883.1|  asparaginyl-tRNA synthetase                        520   3e-176   
ref|WP_015202795.1|  asparaginyl-tRNA synthetase                        520   4e-176   
ref|WP_017747073.1|  asparaginyl-tRNA synthetase                        520   4e-176   
ref|WP_015130970.1|  asparaginyl-tRNA synthetase                        520   4e-176   
ref|WP_014274085.1|  asparaginyl-tRNA synthetase                        519   4e-176   
emb|CDM69707.1|  Asparagine-tRNA ligase                                 519   5e-176   
ref|WP_017315943.1|  asparaginyl-tRNA synthetase                        519   6e-176   
ref|WP_039678290.1|  asparaginyl-tRNA synthetase                        518   1e-175   
ref|WP_017715250.1|  asparaginyl-tRNA synthetase                        518   1e-175   
ref|WP_015175718.1|  asparaginyl-tRNA synthetase                        518   1e-175   
ref|WP_015358646.1|  MULTISPECIES: asparagine--tRNA ligase AsnS         518   1e-175   
ref|WP_018664257.1|  Asparaginyl-tRNA synthetase                        518   1e-175   
ref|WP_016863384.1|  asparaginyl-tRNA synthetase                        518   2e-175   
ref|WP_009457499.1|  MULTISPECIES: asparaginyl-tRNA synthetase          518   2e-175   
ref|WP_017303432.1|  asparaginyl-tRNA synthetase                        518   2e-175   
ref|WP_007353368.1|  MULTISPECIES: asparaginyl-tRNA synthetase          518   2e-175   
ref|WP_012162530.1|  asparaginyl-tRNA synthetase                        518   2e-175   
ref|WP_026788669.1|  asparaginyl-tRNA synthetase                        518   2e-175   
ref|WP_004821328.1|  asparaginyl-tRNA synthetase                        517   2e-175   
ref|WP_008311987.1|  asparaginyl-tRNA synthetase                        517   3e-175   
ref|WP_009630358.1|  asparaginyl-tRNA synthetase                        517   3e-175   
ref|WP_021285529.1|  asparaginyl-tRNA synthetase                        517   3e-175   
ref|WP_026794100.1|  MULTISPECIES: asparaginyl-tRNA synthetase          517   3e-175   
ref|WP_019498293.1|  asparaginyl-tRNA synthetase                        517   4e-175   
ref|WP_013322851.1|  asparaginyl-tRNA synthetase                        517   5e-175   
ref|WP_011058304.1|  asparaginyl-tRNA synthetase                        516   5e-175   
ref|WP_017321492.1|  asparaginyl-tRNA synthetase                        516   5e-175   
ref|WP_035292809.1|  asparaginyl-tRNA synthetase                        516   8e-175   
ref|WP_009625861.1|  asparaginyl-tRNA synthetase                        516   1e-174   
ref|WP_009556169.1|  asparaginyl-tRNA synthetase                        515   1e-174   
ref|WP_027248929.1|  asparaginyl-tRNA synthetase                        515   1e-174   
ref|WP_006631174.1|  asparaginyl-tRNA synthetase                        515   2e-174   
ref|WP_011377750.1|  asparaginyl-tRNA synthetase                        515   2e-174   
ref|WP_015144905.1|  asparaginyl-tRNA synthetase                        515   2e-174   
ref|WP_023074100.1|  asparaginyl-trna synthetase                        515   2e-174   
ref|WP_024621111.1|  asparaginyl-tRNA synthetase [                      515   3e-174   
ref|WP_035158922.1|  asparaginyl-tRNA synthetase                        514   3e-174   
ref|WP_017311912.1|  asparaginyl-tRNA synthetase                        514   3e-174   
gb|KEI68793.1|  AsnS                                                    514   3e-174   
ref|WP_027702320.1|  asparaginyl-tRNA synthetase [                      514   3e-174   
ref|WP_026797012.1|  asparaginyl-tRNA synthetase                        514   3e-174   
ref|WP_008681608.1|  asparaginyl-tRNA synthetase                        514   4e-174   
ref|WP_018589412.1|  asparaginyl-tRNA synthetase                        514   5e-174   
ref|WP_027098532.1|  asparaginyl-tRNA synthetase                        514   5e-174   
ref|WP_035161618.1|  asparaginyl-tRNA synthetase                        514   6e-174   
ref|WP_013388444.1|  asparaginyl-tRNA synthetase                        514   6e-174   
ref|WP_039312574.1|  asparaginyl-tRNA synthetase                        514   7e-174   
ref|WP_016206869.1|  asparaginyl-tRNA ligase                            514   7e-174   
ref|WP_034103977.1|  asparaginyl-tRNA synthetase                        514   7e-174   
ref|WP_024125488.1|  asparaginyl-tRNA synthetase AsnC                   513   8e-174   
ref|WP_015225265.1|  asparaginyl-tRNA synthetase                        513   8e-174   
ref|WP_022490246.1|  asparagine--tRNA ligase                            513   1e-173   
ref|WP_027843410.1|  asparaginyl-tRNA synthetase                        513   1e-173   
gb|AIE74372.1|  Asparaginyl-tRNA synthetase                             513   2e-173   
ref|WP_032116919.1|  asparaginyl-tRNA synthetase                        513   2e-173   
ref|WP_003430261.1|  asparagine--tRNA ligase                            513   2e-173   
ref|WP_014271840.1|  asparaginyl-tRNA synthetase                        512   2e-173   
ref|WP_003412169.1|  asparaginyl-tRNA synthetase                        512   2e-173   
ref|WP_015125670.1|  asparaginyl-tRNA synthetase                        512   3e-173   
ref|WP_027309089.1|  asparaginyl-tRNA synthetase                        512   3e-173   
ref|WP_017413274.1|  asparaginyl-tRNA synthetase                        512   3e-173   
ref|WP_022211377.1|  asparagine--tRNA ligase                            512   3e-173   
ref|WP_002583001.1|  asparaginyl-tRNA synthetase                        512   3e-173   
ref|WP_010874068.1|  asparaginyl-tRNA synthetase                        512   4e-173   
ref|WP_021657518.1|  asparagine--tRNA ligase                            512   4e-173   
ref|WP_015116753.1|  asparaginyl-tRNA synthetase                        511   4e-173   
ref|WP_008794728.1|  asparaginyl-tRNA synthetase                        511   5e-173   
ref|WP_015152391.1|  asparaginyl-tRNA synthetase                        511   5e-173   
ref|WP_039221439.1|  MULTISPECIES: asparaginyl-tRNA synthetase          511   6e-173   
ref|WP_039714962.1|  asparaginyl-tRNA synthetase                        511   6e-173   
ref|WP_035468026.1|  asparaginyl-tRNA synthetase                        511   6e-173   
ref|WP_006001136.1|  asparaginyl-tRNA synthetase                        511   8e-173   
ref|WP_011098467.1|  asparaginyl-tRNA synthetase                        511   9e-173   
ref|WP_015173755.1|  asparaginyl-tRNA synthetase                        511   9e-173   
ref|WP_003375192.1|  MULTISPECIES: asparaginyl-tRNA synthetase          511   1e-172   
ref|WP_039260465.1|  asparaginyl-tRNA synthetase                        511   1e-172   
ref|WP_023436956.1|  asparaginyl-tRNA synthetase                        511   1e-172   
ref|WP_021659081.1|  asparagine--tRNA ligase                            511   1e-172   
ref|WP_022195458.1|  asparagine--tRNA ligase                            510   1e-172   
ref|WP_036007231.1|  asparaginyl-tRNA synthetase                        510   1e-172   
ref|WP_005910393.1|  asparaginyl-tRNA synthetase                        510   2e-172   
ref|WP_008702581.1|  asparaginyl-tRNA synthetase                        510   2e-172   
ref|WP_029599129.1|  asparaginyl-tRNA synthetase                        510   2e-172   
ref|WP_005904540.1|  asparaginyl-tRNA synthetase                        510   2e-172   
ref|WP_022168984.1|  asparagine--tRNA ligase                            510   2e-172   
ref|WP_010293167.1|  asparaginyl-tRNA synthetase                        510   2e-172   
ref|WP_008796242.1|  asparaginyl-tRNA synthetase                        509   3e-172   
ref|WP_005900877.1|  asparaginyl-tRNA synthetase                        509   3e-172   
gb|KHD15165.1|  asparaginyl-tRNA synthetase                             509   5e-172   
ref|WP_032847975.1|  asparaginyl-tRNA synthetase                        509   5e-172   
ref|WP_015390164.1|  asparaginyl-tRNA synthetase                        511   5e-172   
ref|WP_027632545.1|  asparaginyl-tRNA synthetase                        509   6e-172   
ref|WP_023038625.1|  asparaginyl-tRNA synthetase                        509   6e-172   
ref|WP_035306710.1|  asparaginyl-tRNA synthetase                        509   6e-172   
ref|WP_005917454.1|  asparaginyl-tRNA synthetase                        508   7e-172   
ref|WP_018047948.1|  hypothetical protein                               509   7e-172   
ref|WP_005956834.1|  asparaginyl-tRNA synthetase                        508   8e-172   
ref|WP_013969080.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_036728945.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_008694905.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_022743472.1|  asparagine--tRNA ligase AsnS                       508   9e-172   
ref|WP_015187664.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_015196243.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_016340124.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_008908006.1|  asparaginyl-tRNA synthetase                        508   9e-172   
ref|WP_024969948.1|  asparaginyl-tRNA synthetase                        508   1e-171   
ref|WP_002771538.1|  asparaginyl-tRNA synthetase                        508   1e-171   
ref|WP_015135362.1|  asparaginyl-tRNA synthetase                        508   1e-171   
ref|WP_005895263.1|  MULTISPECIES: asparaginyl-tRNA synthetase          508   1e-171   
ref|WP_039259042.1|  asparaginyl-tRNA synthetase                        508   1e-171   
ref|WP_009222126.1|  asparaginyl-tRNA synthetase                        509   1e-171   
ref|WP_021876756.1|  Putative Asparagine--tRNA ligase                   508   2e-171   
ref|WP_016563191.1|  asparagine--tRNA ligase                            508   2e-171   
ref|WP_003363706.1|  asparaginyl-tRNA synthetase                        508   2e-171   
ref|WP_012264099.1|  asparaginyl-tRNA synthetase                        507   2e-171   
ref|WP_021804397.1|  asparaginyl-tRNA ligase                            508   2e-171   
ref|WP_035985388.1|  asparaginyl-tRNA synthetase                        507   2e-171   
ref|WP_008274683.1|  asparaginyl-tRNA synthetase                        507   2e-171   
ref|WP_013724574.1|  asparaginyl-tRNA synthetase                        507   2e-171   
ref|WP_005973826.1|  asparaginyl-tRNA synthetase                        507   2e-171   
ref|WP_039257622.1|  asparaginyl-tRNA synthetase                        507   3e-171   
ref|WP_022398833.1|  asparagine--tRNA ligase                            507   3e-171   
ref|WP_009545016.1|  MULTISPECIES: asparaginyl-tRNA synthetase          507   3e-171   
dbj|GAL94183.1|  asparaginyl-tRNA synthetase                            506   3e-171   
ref|WP_015184818.1|  asparaginyl-tRNA synthetase                        507   3e-171   
ref|WP_022255911.1|  asparagine--tRNA ligase                            507   3e-171   
ref|WP_015166066.1|  asparaginyl-tRNA synthetase                        507   3e-171   
ref|WP_019935428.1|  asparaginyl-tRNA synthetase                        507   3e-171   
ref|WP_029599128.1|  asparaginyl-tRNA synthetase                        507   4e-171   
ref|WP_032839338.1|  asparaginyl-tRNA synthetase                        506   4e-171   
gb|AHF08304.1|  asparaginyl-tRNA synthetase                             506   4e-171   
ref|WP_009424531.1|  asparaginyl-tRNA synthetase                        506   5e-171   
ref|WP_039249754.1|  asparaginyl-tRNA synthetase                        506   5e-171   
ref|WP_018397888.1|  asparaginyl-tRNA synthetase                        506   5e-171   
ref|WP_022005815.1|  asparagine--tRNA ligase                            506   5e-171   
ref|WP_017951880.1|  hypothetical protein                               506   5e-171   
ref|WP_016523117.1|  asparaginyl-tRNA synthetase                        507   5e-171   
ref|WP_002788181.1|  asparaginyl-tRNA synthetase                        506   5e-171   
ref|WP_039252306.1|  asparaginyl-tRNA synthetase                        506   6e-171   
ref|WP_021898881.1|  asparagine--tRNA ligase                            506   6e-171   
ref|WP_005337387.1|  MULTISPECIES: asparaginyl-tRNA synthetase          506   7e-171   
ref|WP_005335150.1|  asparaginyl-tRNA synthetase                        506   7e-171   
ref|WP_017296839.1|  asparaginyl-tRNA synthetase                        506   7e-171   
gb|EFG35352.1|  asparaginyl-tRNA synthetase                             506   7e-171   
ref|WP_039223508.1|  MULTISPECIES: asparaginyl-tRNA synthetase          506   7e-171   
ref|WP_015218025.1|  asparaginyl-tRNA synthetase                        506   8e-171   
ref|WP_004268833.1|  asparaginyl-tRNA synthetase                        506   8e-171   
ref|WP_002751832.1|  asparaginyl-tRNA synthetase                        505   8e-171   
ref|WP_022171456.1|  asparagine--tRNA ligase                            506   9e-171   
ref|WP_007310200.1|  asparaginyl-tRNA synthetase                        506   9e-171   
ref|WP_011721324.1|  asparaginyl-tRNA synthetase                        506   1e-170   
ref|WP_006528960.1|  asparaginyl-tRNA synthetase                        506   1e-170   
ref|WP_022069337.1|  asparagine--tRNA ligase                            506   1e-170   
ref|WP_035379491.1|  asparaginyl-tRNA synthetase                        505   1e-170   
ref|XP_010258934.1|  PREDICTED: asparagine--tRNA ligase, chloropl...    509   1e-170   
ref|WP_002797787.1|  asparaginyl-tRNA synthetase                        505   1e-170   
ref|WP_008205249.1|  asparaginyl-tRNA synthetase                        505   1e-170   
gb|ERK60120.1|  asparagine--tRNA ligase                                 506   2e-170   
ref|WP_005903564.1|  asparaginyl-tRNA synthetase                        505   2e-170   
ref|WP_006423528.1|  asparaginyl-tRNA synthetase                        505   2e-170   
ref|WP_022364950.1|  asparagine--tRNA ligase                            505   2e-170   
ref|WP_002759085.1|  asparaginyl-tRNA synthetase                        504   2e-170   
ref|WP_010941817.1|  asparaginyl-tRNA synthetase                        505   2e-170   
ref|WP_008235039.1|  Asparaginyl-tRNA synthetase                        505   2e-170   
ref|WP_024831962.1|  asparaginyl-tRNA synthetase [                      505   2e-170   
ref|WP_026088823.1|  asparaginyl-tRNA synthetase                        504   2e-170   
ref|WP_014826239.1|  asparaginyl-tRNA synthetase                        504   3e-170   
gb|AIW89827.1|  asparaginyl-tRNA synthetase                             505   3e-170   
ref|WP_002748194.1|  asparaginyl-tRNA synthetase                        504   3e-170   
ref|WP_022258455.1|  asparaginyl-tRNA synthetase                        504   3e-170   
ref|WP_023035870.1|  asparaginyl-tRNA synthetase                        504   3e-170   
ref|WP_039645687.1|  asparaginyl-tRNA synthetase                        504   3e-170   
ref|WP_008803596.1|  asparaginyl-tRNA synthetase                        504   4e-170   
ref|WP_005891431.1|  asparaginyl-tRNA synthetase                        504   4e-170   
ref|WP_022008948.1|  asparagine--tRNA ligase                            504   4e-170   
ref|WP_021835264.1|  Asparaginyl-tRNA synthetase                        504   4e-170   
ref|WP_022820055.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_007305014.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_003493091.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_010244738.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_018212034.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_003369787.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_003512025.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_036630172.1|  MULTISPECIES: asparaginyl-tRNA synthetase          504   5e-170   
ref|WP_023040815.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_013657575.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_027638510.1|  asparaginyl-tRNA synthetase                        504   5e-170   
ref|WP_011243022.1|  asparaginyl-tRNA synthetase                        504   6e-170   
ref|WP_029597927.1|  asparaginyl-tRNA synthetase                        504   6e-170   
ref|WP_005913587.1|  MULTISPECIES: asparaginyl-tRNA synthetase          503   6e-170   
ref|WP_002777828.1|  asparaginyl-tRNA synthetase                        503   6e-170   
ref|WP_018307535.1|  asparaginyl-tRNA synthetase                        503   6e-170   
ref|WP_027095547.1|  asparaginyl-tRNA synthetase [                      504   6e-170   
ref|WP_027365787.1|  asparaginyl-tRNA synthetase                        503   7e-170   
ref|WP_011462263.1|  asparaginyl-tRNA synthetase                        503   8e-170   
ref|WP_039636569.1|  asparaginyl-tRNA synthetase                        503   8e-170   
ref|WP_029759408.1|  asparaginyl-tRNA synthetase                        503   8e-170   
ref|WP_027400177.1|  asparaginyl-tRNA synthetase                        503   8e-170   
ref|WP_029730515.1|  asparaginyl-tRNA synthetase                        503   8e-170   
ref|WP_035214432.1|  asparaginyl-tRNA synthetase                        503   9e-170   
ref|WP_035056099.1|  asparaginyl-tRNA synthetase                        503   9e-170   
ref|WP_033058473.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_007059840.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_012449817.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_004846036.1|  asparaginyl-tRNA synthetase [                      503   1e-169   
ref|WP_017825684.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_034841420.1|  asparaginyl-tRNA synthetase [                      503   1e-169   
ref|WP_027622705.1|  asparaginyl-tRNA synthetase [                      503   1e-169   
ref|WP_005365581.1|  asparaginyl-tRNA synthetase [                      503   1e-169   
ref|WP_004162092.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_016955031.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_012424079.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_026881841.1|  asparaginyl-tRNA synthetase                        503   1e-169   
ref|WP_022320593.1|  asparagine--tRNA ligase                            503   1e-169   
ref|WP_009167740.1|  asparaginyl-tRNA synthetase                        503   1e-169   
gb|EHL05237.1|  asparagine--tRNA ligase                                 504   1e-169   
ref|WP_008105441.1|  asparaginyl-tRNA synthetase                        503   2e-169   
emb|CDZ23417.1|  Asparagine-tRNA ligase [ [                             503   2e-169   
ref|WP_019492638.1|  asparaginyl-tRNA synthetase                        503   2e-169   
ref|WP_016515164.1|  Asparagine--tRNA ligase                            502   2e-169   
ref|WP_031574936.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_016320390.1|  asparagine-tRNA ligase                             503   2e-169   
ref|WP_010456158.1|  asparaginyl-tRNA synthetase                        503   2e-169   
ref|WP_008230261.1|  Asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_010560057.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_035473024.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_002782755.1|  Asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_012308064.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_022078672.1|  asparagine--tRNA ligase                            502   2e-169   
gb|KIH78252.1|  asparaginyl-tRNA synthetase                             502   2e-169   
ref|WP_003488589.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_025544437.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_014292264.1|  asparaginyl-tRNA synthetase                        502   2e-169   
ref|WP_022064177.1|  asparagine--tRNA ligase                            502   2e-169   
ref|WP_030007652.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_027127801.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_038641507.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_008820009.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_022604668.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_027939389.1|  asparaginyl-tRNA synthetase                        502   3e-169   
ref|WP_003447672.1|  asparaginyl-tRNA ligase                            501   4e-169   
ref|WP_020817214.1|  asparaginyl-tRNA synthetase [                      501   4e-169   
ref|WP_032078424.1|  asparaginyl-tRNA synthetase                        501   4e-169   
ref|WP_028577906.1|  asparaginyl-tRNA synthetase                        501   4e-169   
ref|WP_006187950.1|  asparaginyl-tRNA synthetase                        502   4e-169   
ref|WP_035016044.1|  asparaginyl-tRNA synthetase                        501   5e-169   
ref|WP_007785349.1|  asparaginyl-tRNA synthetase                        501   5e-169   
ref|WP_039309528.1|  asparaginyl-tRNA synthetase                        501   5e-169   
ref|WP_004330270.1|  MULTISPECIES: asparaginyl-tRNA synthetase          501   5e-169   
ref|WP_015838592.1|  asparaginyl-tRNA synthetase                        501   5e-169   
ref|WP_003022310.1|  asparaginyl-tRNA synthetase                        501   5e-169   
ref|WP_009062330.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_019124307.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_022367721.1|  asparagine--tRNA ligase                            501   6e-169   
ref|WP_038324313.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_014519857.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_035783113.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_010362982.1|  asparaginyl-tRNA synthetase                        501   6e-169   
ref|WP_006308923.1|  Asparaginyl-tRNA synthetase                        501   7e-169   
ref|WP_022516380.1|  asparagine--tRNA ligase                            501   7e-169   
ref|WP_039495838.1|  asparaginyl-tRNA synthetase                        501   7e-169   
ref|WP_006971389.1|  asparaginyl-tRNA synthetase                        501   7e-169   
ref|WP_022239524.1|  asparagine--tRNA ligase                            501   7e-169   
ref|WP_039154852.1|  asparaginyl-tRNA synthetase                        501   8e-169   
ref|WP_022785561.1|  asparaginyl-tRNA synthetase                        501   9e-169   
ref|WP_008800423.1|  asparaginyl-tRNA synthetase                        501   9e-169   
ref|WP_029966945.1|  asparaginyl-tRNA synthetase                        500   9e-169   
ref|WP_011340286.1|  asparaginyl-tRNA synthetase                        501   9e-169   
ref|WP_010379069.1|  MULTISPECIES: asparaginyl-tRNA synthetase          501   9e-169   
ref|WP_003356337.1|  asparaginyl-tRNA synthetase                        501   1e-168   
ref|WP_018346584.1|  asparaginyl-tRNA synthetase                        501   1e-168   
ref|WP_015719121.1|  asparaginyl-tRNA synthetase                        500   1e-168   
emb|CCA17790.1|  unnamed protein product                                502   1e-168   
ref|WP_014312291.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_033117320.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_016483223.1|  asparaginyl-tRNA synthetase                        501   1e-168   
ref|WP_035684591.1|  asparaginyl-tRNA synthetase                        500   1e-168   
gb|KGO13601.1|  asparaginyl-tRNA synthetase                             500   1e-168   
ref|WP_039168770.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_008371696.1|  MULTISPECIES: asparaginyl-tRNA synthetase          500   1e-168   
ref|WP_030033567.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_038268219.1|  asparaginyl-tRNA synthetase [                      500   1e-168   
ref|WP_011016098.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_014254382.1|  asparaginyl-tRNA synthetase [                      501   1e-168   
ref|WP_039090436.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_033064884.1|  asparaginyl-tRNA synthetase                        500   1e-168   
ref|WP_002737200.1|  asparaginyl-tRNA synthetase                        500   1e-168   
dbj|BAL52836.1|  asparaginyl-tRNA synthetase                            501   1e-168   
dbj|BAQ12666.1|  putative asparaginyl-tRNA synthetase                   500   2e-168   
ref|WP_028319856.1|  asparaginyl-tRNA synthetase                        499   2e-168   
ref|WP_009530881.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_013744833.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_022123234.1|  asparagine--tRNA ligase                            500   2e-168   
gb|EOS28584.1|  asparaginyl-tRNA synthetase                             500   2e-168   
ref|WP_039166820.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_009246876.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_011987559.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_004844040.1|  MULTISPECIES: asparaginyl-tRNA synthetase          500   2e-168   
ref|WP_006427511.1|  MULTISPECIES: asparaginyl-tRNA synthetase          500   2e-168   
ref|WP_012160180.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_039132930.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_005363508.1|  asparaginyl-tRNA synthetase                        500   2e-168   
ref|WP_015228968.1|  asparaginyl-tRNA synthetase                        499   2e-168   
ref|WP_011948326.1|  asparaginyl-tRNA synthetase                        499   2e-168   
ref|WP_024932777.1|  asparaginyl-tRNA synthetase                        499   2e-168   
ref|WP_003361391.1|  asparaginyl-tRNA synthetase                        499   2e-168   
ref|WP_012705222.1|  asparaginyl-tRNA synthetase                        499   3e-168   
ref|WP_039083290.1|  asparaginyl-tRNA synthetase                        499   3e-168   
ref|WP_034240691.1|  asparaginyl-tRNA synthetase                        499   3e-168   
ref|WP_008422779.1|  asparaginyl-tRNA synthetase                        499   3e-168   
ref|WP_005494189.1|  Asparaginyl-tRNA synthetase                        499   3e-168   
ref|XP_009530416.1|  hypothetical protein PHYSODRAFT_354926             500   3e-168   
ref|XP_005708519.1|  asparaginyl-tRNA synthetase                        503   3e-168   
ref|WP_037546675.1|  asparaginyl-tRNA synthetase                        499   3e-168   
ref|WP_039140965.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_039093212.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_035135065.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_014903851.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_015168780.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_005344365.1|  asparaginyl-tRNA synthetase                        499   4e-168   
ref|WP_039095379.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_019851549.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_005610449.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_026894534.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_010966534.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_004074646.1|  asparaginyl-tRNA synthetase                        499   5e-168   
ref|WP_009080645.1|  asparaginyl-tRNA synthetase                        499   6e-168   
ref|WP_002645326.1|  asparaginyl-tRNA synthetase                        499   6e-168   



>ref|XP_004234328.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Solanum lycopersicum]
Length=571

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/558 (83%), Positives = 508/558 (91%), Gaps = 2/558 (0%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPK-PPTHSVCLRRsfcsvvcsavssGEAV  295
             RLKPF AVR  S Y +  K    PN Y  + P+ PP   +  RRSFCSVV +A+SSGEAV
Sbjct  12    RLKPFYAVRFFSHYRRPIKVLN-PNFYSSYPPQLPPAPYLSRRRSFCSVVSAAISSGEAV  70

Query  296   QRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSS  475
             +RP   +   KE  ++ K+GEFR+RLR+ADIKGGP+EGLDRLGETLVVRGWVRT+RAQSS
Sbjct  71    ERPKFENIEAKEGVKTEKVGEFRKRLRVADIKGGPEEGLDRLGETLVVRGWVRTVRAQSS  130

Query  476   VTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkv  655
             VTFI++NDGSCLSNMQCVM  DAEGYDQVENGLI TGASVWI+GT+ SSQGSKQKIELKV
Sbjct  131   VTFIDINDGSCLSNMQCVMGSDAEGYDQVENGLISTGASVWIEGTVVSSQGSKQKIELKV  190

Query  656   vklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENG  835
              KLV+VGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV+RVRNAL++ATHKFFQENG
Sbjct  191   QKLVVVGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVSRVRNALSYATHKFFQENG  250

Query  836   FVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPA  1015
             FVWVSSPI+TASDCEGAGEQFCVTTLIPNS E  +SPV+ IP TESGSVDWSQDFFGK A
Sbjct  251   FVWVSSPIITASDCEGAGEQFCVTTLIPNSNEGGDSPVSAIPTTESGSVDWSQDFFGKRA  310

Query  1016  FLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCA  1195
             +LTVSGQLN ETYATAL+D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA
Sbjct  311   YLTVSGQLNGETYATALSDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACA  370

Query  1196  AAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkk  1375
              AYLQYVVQ++L+NCKEDM+FF+TWIEKGII RL+DVVEK  VQL+YTDA+ELLLK KKK
Sbjct  371   TAYLQYVVQHVLENCKEDMDFFDTWIEKGIINRLTDVVEKNFVQLSYTDAVELLLKAKKK  430

Query  1376  FEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVP  1555
             F+FPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVP
Sbjct  431   FDFPVKWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVP  490

Query  1556  RVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFA  1735
             RVGELIGGSQREERLEYLE+RLD +NLNKES+WWYLDLRRYGSVPHAGFGLGFERLVQFA
Sbjct  491   RVGELIGGSQREERLEYLEERLDHMNLNKESFWWYLDLRRYGSVPHAGFGLGFERLVQFA  550

Query  1736  TGIDNIRDAIPFPRTPGS  1789
             TGIDNIRDAIPFPRTPGS
Sbjct  551   TGIDNIRDAIPFPRTPGS  568



>ref|XP_006351539.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=571

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/558 (83%), Positives = 509/558 (91%), Gaps = 2/558 (0%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPK-PPTHSVCLRRsfcsvvcsavssGEAV  295
             RLKPF AVR  + Y +  K    PN Y  + PK  PT  +  RRSFCSVV +A+SSGEAV
Sbjct  12    RLKPFYAVRFFTHYRRPIKVLN-PNFYSSYPPKLHPTPYLSRRRSFCSVVSAAISSGEAV  70

Query  296   QRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSS  475
             +RP   +  TKE  ++ ++ EFR+RLR+ADIKGGP+EGLDRLGETLVVRGWVRT+RAQSS
Sbjct  71    ERPKFENIETKEGVKTEQVREFRKRLRVADIKGGPEEGLDRLGETLVVRGWVRTVRAQSS  130

Query  476   VTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkv  655
             VTFI++NDGSCLSNMQCVM  DAEGYDQVENGLI TGASVWI+GT+ SSQGSKQKIELKV
Sbjct  131   VTFIDINDGSCLSNMQCVMGSDAEGYDQVENGLISTGASVWIEGTVVSSQGSKQKIELKV  190

Query  656   vklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENG  835
              KLV+VGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV+RVRNAL++ATHKFFQENG
Sbjct  191   QKLVVVGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVSRVRNALSYATHKFFQENG  250

Query  836   FVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPA  1015
             FVWVSSPI+TASDCEGAGEQFCVTTLIPNS E  +SPV+ IP TESGSVDWSQDFFGK A
Sbjct  251   FVWVSSPIITASDCEGAGEQFCVTTLIPNSNEGGDSPVSAIPTTESGSVDWSQDFFGKRA  310

Query  1016  FLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCA  1195
             +LTVSGQLN ETYATAL+D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA
Sbjct  311   YLTVSGQLNGETYATALSDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACA  370

Query  1196  AAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkk  1375
              AYLQYVVQY+L+NCKEDM+FF+TWIEKGII RL+DVVEK  VQL+YTDA+ELLLK KKK
Sbjct  371   TAYLQYVVQYVLENCKEDMDFFDTWIEKGIINRLTDVVEKNFVQLSYTDAVELLLKAKKK  430

Query  1376  FEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVP  1555
             F+FPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVP
Sbjct  431   FDFPVKWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVP  490

Query  1556  RVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFA  1735
             RVGELIGGSQREERLEYLE+RLD++NLNKES+WWYLDLRRYGSVPHAGFGLGFERLVQFA
Sbjct  491   RVGELIGGSQREERLEYLEERLDNMNLNKESFWWYLDLRRYGSVPHAGFGLGFERLVQFA  550

Query  1736  TGIDNIRDAIPFPRTPGS  1789
             TGIDNIRDAIPFPRTPGS
Sbjct  551   TGIDNIRDAIPFPRTPGS  568



>ref|XP_009792294.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Nicotiana sylvestris]
Length=570

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/560 (83%), Positives = 500/560 (89%), Gaps = 7/560 (1%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCL---RRsfcsvvcsavssGE  289
             RLKPF  VR  + Y K  K    PN Y  F  K  T S+     RRSFCSVV +A+SSGE
Sbjct  12    RLKPFCTVRFFTHYRKPIKLL-TPNYYSSFPLKLRTISIPAPYRRRSFCSVVSAAISSGE  70

Query  290   AVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQ  469
             AV++P    F  K+  ++ ++ EF++RL I DIKGGPDEGL RLGETLVVRGWVRT+RAQ
Sbjct  71    AVEKP---KFEQKDGVKTEQVREFKKRLSIVDIKGGPDEGLGRLGETLVVRGWVRTVRAQ  127

Query  470   SSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIEl  649
             SSVTFI+VNDGSCLSNMQCVM  DAEGYDQV+NG I TGASVWI+GT+  SQGSKQKIEL
Sbjct  128   SSVTFIDVNDGSCLSNMQCVMGSDAEGYDQVDNGSISTGASVWIEGTVVGSQGSKQKIEL  187

Query  650   kvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQE  829
             KV KLV+VGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV+RVRNALA+ATHKFFQE
Sbjct  188   KVQKLVVVGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVSRVRNALAYATHKFFQE  247

Query  830   NGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGK  1009
             NGFVWVSSPI+TASDCEGAGEQF VTTLIP +KE  +SPVN IP TESGSVDWSQDFFGK
Sbjct  248   NGFVWVSSPIITASDCEGAGEQFRVTTLIPTTKEGGDSPVNAIPTTESGSVDWSQDFFGK  307

Query  1010  PAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMS  1189
              AFLTVSGQLN ETYATAL+D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+
Sbjct  308   QAFLTVSGQLNGETYATALSDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMA  367

Query  1190  CAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktk  1369
             CA AYLQYVVQY+L+NCKEDM+FFNTWIEKGII RLSDVVEK  VQLTYTDA+ELLLK K
Sbjct  368   CATAYLQYVVQYVLENCKEDMDFFNTWIEKGIINRLSDVVEKNFVQLTYTDAVELLLKAK  427

Query  1370  kkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDML  1549
             KKF+FPV WGCDLQSEHERYITEEAFGGCP+IIRDYPKDIKAFYMR+NDDGKTVAAMDML
Sbjct  428   KKFDFPVKWGCDLQSEHERYITEEAFGGCPIIIRDYPKDIKAFYMRQNDDGKTVAAMDML  487

Query  1550  VPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQ  1729
             VPRVGELIGGSQREERLEYLE+RLD+LNLNKES+WWYLDLRRYGSVPHAGFGLGFERLVQ
Sbjct  488   VPRVGELIGGSQREERLEYLEERLDNLNLNKESFWWYLDLRRYGSVPHAGFGLGFERLVQ  547

Query  1730  FATGIDNIRDAIPFPRTPGS  1789
             FATGIDNIRDAIPFPRTPGS
Sbjct  548   FATGIDNIRDAIPFPRTPGS  567



>gb|EYU33550.1| hypothetical protein MIMGU_mgv1a003763mg [Erythranthe guttata]
Length=565

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/560 (82%), Positives = 494/560 (88%), Gaps = 17/560 (3%)
 Frame = +2

Query  122   LKPFSAVRLLSLYH--KTTKTAAVPNSYLYFLPKPPTHSVCLR--RsfcsvvcsavssGE  289
             LKP SA RL SL+   K   T+A     L F     +H+   R  RS CSVV +AVSSGE
Sbjct  16    LKPLSAARLSSLFTNPKFNHTSA---PLLLF-----SHAALSRHHRSLCSVVPAAVSSGE  67

Query  290   AVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQ  469
             A + P        E+E+   I EFR++ +I DIKGG D+GLDRLGETLVVRGWVRTLR Q
Sbjct  68    ATKSP-----EPLELEKGANIREFRKKFKIVDIKGGDDQGLDRLGETLVVRGWVRTLRVQ  122

Query  470   SSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIEl  649
             SSVTFIEVNDGSCLSNMQCVMS DAEGYDQVE+G I TGASVWIQGT+ +SQGSKQK+EL
Sbjct  123   SSVTFIEVNDGSCLSNMQCVMSSDAEGYDQVESGSIATGASVWIQGTVVASQGSKQKVEL  182

Query  650   kvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQE  829
             KV KL+L+GKSDPSFPIQKKRVSREFLRT+AHLRPRTNTFGAVARVRNALA+ATHKFFQE
Sbjct  183   KVDKLILIGKSDPSFPIQKKRVSREFLRTQAHLRPRTNTFGAVARVRNALAYATHKFFQE  242

Query  830   NGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGK  1009
             NGFVW+SSPI+TASDCEGAGEQFCVTTLIPNS E TNS VN IPKT+ GS+DWS+DFFGK
Sbjct  243   NGFVWLSSPIITASDCEGAGEQFCVTTLIPNSSEATNSHVNAIPKTKDGSIDWSKDFFGK  302

Query  1010  PAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMS  1189
             PAFLTVSGQLNAETYATAL DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM+
Sbjct  303   PAFLTVSGQLNAETYATALTDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMA  362

Query  1190  CAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktk  1369
             CA AYLQYVV+YIL+NCKEDM+FFNTW+EKGII RL+DVVEK VVQLTYTDA+ LLLK  
Sbjct  363   CATAYLQYVVKYILENCKEDMDFFNTWVEKGIIDRLNDVVEKSVVQLTYTDAVALLLKAN  422

Query  1370  kkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDML  1549
             KKFEFPV WGCDLQSEHERYITE AFGGCPVIIRDYPK IKAFYMRENDDGKTVAAMDML
Sbjct  423   KKFEFPVTWGCDLQSEHERYITEVAFGGCPVIIRDYPKVIKAFYMRENDDGKTVAAMDML  482

Query  1550  VPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQ  1729
             VPR+GELIGGSQREERL+YLEKRLDDLNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQ
Sbjct  483   VPRIGELIGGSQREERLDYLEKRLDDLNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQ  542

Query  1730  FATGIDNIRDAIPFPRTPGS  1789
             FATGIDNIRDAIPFPR PGS
Sbjct  543   FATGIDNIRDAIPFPRAPGS  562



>ref|XP_006372859.1| asparaginyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP50656.1| asparaginyl-tRNA synthetase family protein [Populus trichocarpa]
Length=574

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/569 (79%), Positives = 493/569 (87%), Gaps = 22/569 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKT------------TKTAAVPNSYLYFLPKPPTHSVCLRRsfcsv  262
             RL P S +RLLS Y K+            TK  A+P  + + L       +  RR FCSV
Sbjct  13    RLTPGSTLRLLSFYPKSNPSNLSGILKTITKPHAIPPKFHHLLQ---LSGLPCRRFFCSV  69

Query  263   vcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVR  442
             +  A+ S E+ +    G+ G +       +GEFRR+L+IADIKGGPDEGLDR+G+T++V 
Sbjct  70    ISGALQSSESAKVEKKGEIGNR-------VGEFRRKLKIADIKGGPDEGLDRVGKTIIVM  122

Query  443   GWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASS  622
             GWVRTLR QSSVTFIEVNDGSCLSN+QCVM  +AEGYDQVE+GL+ TGAS+W+QGT+  S
Sbjct  123   GWVRTLRVQSSVTFIEVNDGSCLSNLQCVMDLEAEGYDQVESGLVTTGASIWMQGTVVKS  182

Query  623   QGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA  802
             QGSKQK+ELKV+K+V VGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA
Sbjct  183   QGSKQKVELKVIKIVAVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA  242

Query  803   FATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSV  982
             +ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP S+E  NSPV+ IPKT+ G +
Sbjct  243   YATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPGSQEAANSPVDGIPKTKDGLI  302

Query  983   DWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELA  1162
             DWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELA
Sbjct  303   DWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELA  362

Query  1163  FADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTD  1342
             FADL DDM+CA AYLQYVV++IL+NCKEDMEFFNTWIEKGII RLSDVVEK  VQLTYTD
Sbjct  363   FADLNDDMACATAYLQYVVRHILENCKEDMEFFNTWIEKGIIDRLSDVVEKDFVQLTYTD  422

Query  1343  AIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDG  1522
             AIELLLK KKKFEFP+ WGCDLQSEHERYITEE FGGCPVIIRDYPKDIKAFYMR+NDDG
Sbjct  423   AIELLLKAKKKFEFPLEWGCDLQSEHERYITEEVFGGCPVIIRDYPKDIKAFYMRQNDDG  482

Query  1523  KTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGF  1702
             KTVAAMDMLVPRVGELIGGSQREERLEY+E RLD+L LNKES+WWYLDLRRYGSVPHAGF
Sbjct  483   KTVAAMDMLVPRVGELIGGSQREERLEYIEDRLDELKLNKESFWWYLDLRRYGSVPHAGF  542

Query  1703  GLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             GLGFERLVQFATGIDNIRDAIPFPR PGS
Sbjct  543   GLGFERLVQFATGIDNIRDAIPFPRVPGS  571



>ref|XP_003635124.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Vitis vinifera]
 emb|CBI37350.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/573 (79%), Positives = 492/573 (86%), Gaps = 19/573 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKT----------TKTAAVPNSYLYFLPKPPTHSVCL------RRs  250
             R KP SAVRLLS Y KT          T+   +    LY    PP     +      RR 
Sbjct  12    RFKPQSAVRLLSAYTKTNPRNFPTTSQTRMVTLHFPQLYQPLTPPFIFFGVGAARPRRRC  71

Query  251   fcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGET  430
             FC+ +  A+SSGEA+++P    F     E   K+GEFR+RLR+ DIKGGPDEGLDRLG+T
Sbjct  72    FCTAISGALSSGEAIEKPKPEFF---SAETGEKVGEFRKRLRVVDIKGGPDEGLDRLGQT  128

Query  431   LVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGT  610
             L V+GWVRTLR QSSV FIEVNDGSCLSNMQCVM+ DA+GYDQVE+G I TGASV IQGT
Sbjct  129   LAVKGWVRTLRVQSSVIFIEVNDGSCLSNMQCVMNSDADGYDQVESGSITTGASVSIQGT  188

Query  611   IASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR  790
             + +SQGSKQK+ELKV+K+V VGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR
Sbjct  189   LVASQGSKQKVELKVLKIVTVGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR  248

Query  791   NALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTE  970
             NALA+ATHKFFQENGFVW+SSPI+TASDCEGAGEQFCVTTLIP+S+E T+S V+ IPK +
Sbjct  249   NALAYATHKFFQENGFVWISSPIITASDCEGAGEQFCVTTLIPSSREATDSTVDAIPKAK  308

Query  971   SGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIE  1150
              G +DWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIE
Sbjct  309   DGLIDWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIE  368

Query  1151  PELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQL  1330
             PELAFADL DDM+CA AYLQYVV YIL+NCKEDMEFFNTWIEKGII RLSDV EK  VQL
Sbjct  369   PELAFADLNDDMACATAYLQYVVTYILENCKEDMEFFNTWIEKGIINRLSDVAEKNFVQL  428

Query  1331  TYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRE  1510
             TYTDA+ELLL+  KKFEFPV WGCDLQSEHERYITE AFGGCPVIIRDYPKDIKAFYMR 
Sbjct  429   TYTDAVELLLRANKKFEFPVKWGCDLQSEHERYITEVAFGGCPVIIRDYPKDIKAFYMRR  488

Query  1511  NDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVP  1690
             NDDGKTVAAMDMLVPRVGELIGGSQREERLEYLE+RLDDL L+K+SYWWYLDLRRYGSVP
Sbjct  489   NDDGKTVAAMDMLVPRVGELIGGSQREERLEYLEERLDDLKLSKDSYWWYLDLRRYGSVP  548

Query  1691  HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS
Sbjct  549   HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  581



>ref|XP_011081398.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Sesamum indicum]
Length=561

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/487 (87%), Positives = 459/487 (94%), Gaps = 0/487 (0%)
 Frame = +2

Query  329   EVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSC  508
             E+E+  +I EFR++L+IADIKGGPD+GL+RLGE LVVRGWVRTLR QSSVTFIEVNDGSC
Sbjct  72    ELEKGVRIREFRKKLKIADIKGGPDQGLNRLGENLVVRGWVRTLRVQSSVTFIEVNDGSC  131

Query  509   LSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP  688
             LSNMQCV+S DAEGYDQVE+GLI TGA+VW+QGTI +SQGSKQK+EL V KLV VG SDP
Sbjct  132   LSNMQCVISSDAEGYDQVESGLISTGAAVWVQGTIVASQGSKQKVELNVDKLVTVGTSDP  191

Query  689   SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTA  868
             SFPIQKKRVSREFLRTKAHLRPRTNTFGAV+RVRNALA+ATHKFFQENGFVW+SSPI+TA
Sbjct  192   SFPIQKKRVSREFLRTKAHLRPRTNTFGAVSRVRNALAYATHKFFQENGFVWLSSPIITA  251

Query  869   SDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAE  1048
             SDCEGAGEQFCVTTL+P S+E T+SPVN IP+T+ G +DWSQDFFGKPAFLTVSGQLNAE
Sbjct  252   SDCEGAGEQFCVTTLVPTSREATDSPVNAIPRTKDGLIDWSQDFFGKPAFLTVSGQLNAE  311

Query  1049  TYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYI  1228
             TYATAL DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM+CA AYLQYVV+YI
Sbjct  312   TYATALTDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMACATAYLQYVVEYI  371

Query  1229  LDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDL  1408
             L+NCKEDM+FFNTWIEKGII RLSDVVEK+ VQL+YTDA+E+LLK KK FEFPV WGCDL
Sbjct  372   LENCKEDMDFFNTWIEKGIIARLSDVVEKRFVQLSYTDAVEILLKAKKTFEFPVTWGCDL  431

Query  1409  QSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQr  1588
             QSEHERYITEE F GCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVPRVGELIGGSQR
Sbjct  432   QSEHERYITEEVFSGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVPRVGELIGGSQR  491

Query  1589  eerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIP  1768
             EERLEYLE+RLDDL LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIP
Sbjct  492   EERLEYLEQRLDDLKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIP  551

Query  1769  FPRTPGS  1789
             FPR PGS
Sbjct  552   FPRAPGS  558



>ref|XP_011037109.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
Length=574

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/569 (78%), Positives = 491/569 (86%), Gaps = 22/569 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKT------------TKTAAVPNSYLYFLPKPPTHSVCLRRsfcsv  262
             RL P S +RLLS Y K+            TK  A+P  + + L       +  RR FCSV
Sbjct  13    RLTPGSTLRLLSFYPKSNPSNLSGILKTITKPHAIPPKFHHLLQ---LSGLPCRRFFCSV  69

Query  263   vcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVR  442
             +  A+ S E+ +    G+ G +       +GEFRR+L+IADIKGGPDEGLDR+G T++V 
Sbjct  70    ISGALQSSESAKVEKKGEIGNR-------VGEFRRKLKIADIKGGPDEGLDRVGNTIIVM  122

Query  443   GWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASS  622
             GWVRTLR QSSVTFIEVNDGSCLSN+QCVM  +AEGYDQVE+GL+ TGAS+W+QGT+  S
Sbjct  123   GWVRTLRVQSSVTFIEVNDGSCLSNLQCVMDLEAEGYDQVESGLVTTGASIWMQGTVVKS  182

Query  623   QGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA  802
             QGSKQK+ELKV+K+V VGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA
Sbjct  183   QGSKQKVELKVIKIVAVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA  242

Query  803   FATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSV  982
             +ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP S+E  NSPV+ IPKT+ G +
Sbjct  243   YATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPGSQEAVNSPVDGIPKTKDGLI  302

Query  983   DWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELA  1162
             DWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELA
Sbjct  303   DWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELA  362

Query  1163  FADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTD  1342
             FADL DDM+CA AYLQYVV++IL+NCKEDMEFFNTWIEKGII RLSDV EK  VQLTYTD
Sbjct  363   FADLNDDMACATAYLQYVVRHILENCKEDMEFFNTWIEKGIIDRLSDVAEKDFVQLTYTD  422

Query  1343  AIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDG  1522
             AIELLLK KKKFEFP+ WGCDLQSEHERYITEE FGGCPVIIRDYPKDIKAFYMR+NDDG
Sbjct  423   AIELLLKAKKKFEFPLEWGCDLQSEHERYITEEVFGGCPVIIRDYPKDIKAFYMRQNDDG  482

Query  1523  KTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGF  1702
             KTVAAMDMLVPRVGELIGGSQREERLEY+E RLD+L LNKES+WWYLDLRRYGSVPHAGF
Sbjct  483   KTVAAMDMLVPRVGELIGGSQREERLEYIEDRLDELKLNKESFWWYLDLRRYGSVPHAGF  542

Query  1703  GLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             GLGFERLVQFATGI+NIRDAIPFPR PGS
Sbjct  543   GLGFERLVQFATGIENIRDAIPFPRVPGS  571



>ref|XP_011026436.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
 ref|XP_011026438.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
 ref|XP_011026439.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
 ref|XP_011026440.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
 ref|XP_011026441.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
 ref|XP_011026442.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Populus euphratica]
Length=578

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/568 (78%), Positives = 487/568 (86%), Gaps = 16/568 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTT--------KTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsa  274
             RL P S +RLLS Y K+         KT   P++    +P P  H +             
Sbjct  13    RLNPGSTLRLLSFYPKSNPSNLPEILKTITKPHA----IP-PKFHHLFQLSGLPRRRFFC  67

Query  275   vssGEAVQRPLSGDFGTKEVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRG  445
                  A+Q   S   G  E E+S    ++GEFR++L+IADIKGGPDEGLDR+G+T+VV G
Sbjct  68    SVISGALQSNESAKVGFLEKEKSEVGNRVGEFRKKLKIADIKGGPDEGLDRVGKTIVVMG  127

Query  446   WVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQ  625
             WVRTLR QSSVTFIEVNDGSCLSNMQCVM  +AEGYDQVE+GLI TGAS+ +QGT+  SQ
Sbjct  128   WVRTLRVQSSVTFIEVNDGSCLSNMQCVMGLEAEGYDQVESGLITTGASILVQGTVVESQ  187

Query  626   GSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAF  805
             GSKQK+ELKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+
Sbjct  188   GSKQKVELKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAY  247

Query  806   ATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVD  985
             ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP S+E  NSPV+ IPKT+ G +D
Sbjct  248   ATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPGSQEVANSPVDRIPKTKDGLID  307

Query  986   WSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAF  1165
             WSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAF
Sbjct  308   WSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAF  367

Query  1166  ADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDA  1345
             ADL DDM+CA AYLQYVV++IL+NCKEDM+FFNTWIEKGI+ RL+DV EK  VQLTYTDA
Sbjct  368   ADLTDDMACATAYLQYVVRHILENCKEDMDFFNTWIEKGIVDRLTDVAEKDFVQLTYTDA  427

Query  1346  IElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGK  1525
             +ELLLK KKKFEFPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR+NDDGK
Sbjct  428   VELLLKAKKKFEFPVEWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRQNDDGK  487

Query  1526  TVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFG  1705
             TVAAMDMLVPRVGELIGGSQREERLEYLE RLD+LNLNKES+WWYLDLRRYGSVPHAGFG
Sbjct  488   TVAAMDMLVPRVGELIGGSQREERLEYLEDRLDELNLNKESFWWYLDLRRYGSVPHAGFG  547

Query  1706  LGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LGFERLVQFATG++NIRDAIPFPR PGS
Sbjct  548   LGFERLVQFATGLENIRDAIPFPRVPGS  575



>gb|KDP39873.1| hypothetical protein JCGZ_03404 [Jatropha curcas]
Length=579

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/573 (77%), Positives = 487/573 (85%), Gaps = 25/573 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTT-------------KTAAVPNSYLYFLP---KPPTHSVCLRRs  250
             R  P+S +R LS Y K+              K  A+P  +   LP   +P   S C    
Sbjct  13    RFSPYSTIRFLSSYSKSNPRNLPTTIPKTLLKPHALPPKFFRLLPPQGEPRRRSFC----  68

Query  251   fcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGET  430
               +V+  A+ SGE  ++    D   +  E   ++G FR++L+IADIKGGPDEGLDR+G T
Sbjct  69    --TVISGAMQSGERTKQESMED---RRGETGDRVGAFRKKLKIADIKGGPDEGLDRVGHT  123

Query  431   LVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGT  610
             LVV GWVRTLR QSSVTFIEVNDGSCLSNMQCVM  +AEGYDQV++GL+ TGAS+W+QGT
Sbjct  124   LVVMGWVRTLRVQSSVTFIEVNDGSCLSNMQCVMDMEAEGYDQVDSGLVTTGASIWVQGT  183

Query  611   IASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR  790
             +A SQGSKQK+ELKV K+V VGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVR
Sbjct  184   VAKSQGSKQKVELKVTKIVAVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR  243

Query  791   NALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTE  970
             NALAFATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP+S+E  +S V+ IPKT+
Sbjct  244   NALAFATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPSSREAVDSHVDGIPKTK  303

Query  971   SGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIE  1150
              G +DWSQDFFGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIE
Sbjct  304   DGLIDWSQDFFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIE  363

Query  1151  PELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQL  1330
             PELAFADL DDM+CA AYLQYVV++ILDNCKEDM FFNTWIEKGII RLSDV EK  VQL
Sbjct  364   PELAFADLNDDMACATAYLQYVVRHILDNCKEDMNFFNTWIEKGIIDRLSDVAEKNFVQL  423

Query  1331  TYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRE  1510
             TYTDA+ELLL+  KKFEFPV WGCDLQSEHERYITEEAFGGCPVIIRDYPK+IKAFYMR+
Sbjct  424   TYTDAVELLLRANKKFEFPVKWGCDLQSEHERYITEEAFGGCPVIIRDYPKEIKAFYMRQ  483

Query  1511  NDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVP  1690
             NDDGKTVAAMD+LVPRVGELIGGSQRE+RLEYLE RLD+L LNK+S+WWYLDLRRYGSVP
Sbjct  484   NDDGKTVAAMDLLVPRVGELIGGSQREDRLEYLEDRLDELKLNKDSFWWYLDLRRYGSVP  543

Query  1691  HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS
Sbjct  544   HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  576



>ref|XP_002309798.2| hypothetical protein POPTR_0007s01840g [Populus trichocarpa]
 gb|EEE90248.2| hypothetical protein POPTR_0007s01840g [Populus trichocarpa]
Length=578

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/575 (77%), Positives = 485/575 (84%), Gaps = 30/575 (5%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKT------------TKTAAVPNSYLYFLPK---PPTHSVCLRRsf  253
             RL P S +RLLS Y K+            TK  A+P  + +F      P     C     
Sbjct  13    RLNPGSTLRLLSFYPKSNPSNLPEILKTMTKPHAIPPKFHHFFQLSGLPRRRFFC-----  67

Query  254   csvvcsavssGEAVQRPLSGDFGTKEVEES---RKIGEFRRRLRIADIKGGPDEGLDRLG  424
                         A+Q   S   G  E E+S    ++GEFR++L+I DIKGGPDEGLDR+G
Sbjct  68    -------SVISGALQSNESAKVGFLEKEKSDVGNRVGEFRKKLKITDIKGGPDEGLDRVG  120

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             +T+VV GWVRTLR QSSVTFIEVNDGSCLSNMQCVM  +AEGYDQVE+GLI TGAS+ +Q
Sbjct  121   KTIVVMGWVRTLRVQSSVTFIEVNDGSCLSNMQCVMGLEAEGYDQVESGLITTGASILVQ  180

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVAR  784
             GT+  SQGSKQK+ELKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVAR
Sbjct  181   GTVVESQGSKQKVELKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVAR  240

Query  785   VRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPK  964
             VRNALA+ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP S+E  NSPV+ IPK
Sbjct  241   VRNALAYATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPGSQEVANSPVDRIPK  300

Query  965   TESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWM  1144
             T+ G +DWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWM
Sbjct  301   TKDGLIDWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWM  360

Query  1145  IEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVV  1324
             IEPELAFADL DDM+CA AYLQYVV++IL+NCKEDMEFFNTWIEKGII RL+DV EK  V
Sbjct  361   IEPELAFADLTDDMACATAYLQYVVKHILENCKEDMEFFNTWIEKGIIDRLTDVAEKDFV  420

Query  1325  QLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYM  1504
             QLTYTDA+ELLLK KKKFEFPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYM
Sbjct  421   QLTYTDAVELLLKAKKKFEFPVEWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYM  480

Query  1505  RENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGS  1684
             R+NDDGKTVAAMDMLVPRVGELIGGSQREERLEYLE RLD+L LNKES+WWYLDLRRYGS
Sbjct  481   RQNDDGKTVAAMDMLVPRVGELIGGSQREERLEYLEDRLDELKLNKESFWWYLDLRRYGS  540

Query  1685  VPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             VPHAGFGLGFERLVQFATG++NIRDAIPFPR PGS
Sbjct  541   VPHAGFGLGFERLVQFATGLENIRDAIPFPRVPGS  575



>ref|XP_007039833.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY24334.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
Length=570

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/561 (78%), Positives = 492/561 (88%), Gaps = 12/561 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTH---SVCLRRsfcsvvcsavssGE  289
             R KP+S +R LS Y K   T  +       LP+ P     +V  +R FCSVV +A+ SGE
Sbjct  15    RYKPYSTLRFLSFYSKNLTTPRLSPP----LPRRPFQFHSTVPPKRCFCSVVSAALQSGE  70

Query  290   AVQRPLSGDFGTKEV-EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRA  466
               +     +F  K+V E    +GEFR++L+IADIKGGPD GLDR+G+TLVV GWVRTLR 
Sbjct  71    RTKT----EFQEKKVCEMGNTVGEFRKKLKIADIKGGPDGGLDRVGQTLVVMGWVRTLRV  126

Query  467   QSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIE  646
             QSSVTF+EVNDGSCLSNMQCVM+ DAEGYDQVE+GLI TGAS+W+QGT+ +SQG+KQK+E
Sbjct  127   QSSVTFLEVNDGSCLSNMQCVMNSDAEGYDQVESGLIATGASIWVQGTLVASQGAKQKVE  186

Query  647   lkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQ  826
             LKV K+V+VG+SDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQ
Sbjct  187   LKVDKVVVVGQSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQ  246

Query  827   ENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFG  1006
             ENGFVW+SSPI+TASDCEGAGEQFCVTTLIP+S+E T+SPV  IP T+ G +DWSQDFFG
Sbjct  247   ENGFVWISSPIITASDCEGAGEQFCVTTLIPSSREATDSPVRAIPNTKDGLIDWSQDFFG  306

Query  1007  KPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM  1186
             KPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNT+RHLAEFWMIEPELAFADL DD 
Sbjct  307   KPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTTRHLAEFWMIEPELAFADLNDDT  366

Query  1187  SCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllkt  1366
             +CA AYLQYVV+++LDNCKEDMEFFNTWIEKGII RL+DV EK  VQL YTDAIELLLK 
Sbjct  367   ACATAYLQYVVRHVLDNCKEDMEFFNTWIEKGIIDRLNDVAEKDFVQLPYTDAIELLLKA  426

Query  1367  kkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDM  1546
             KKKFEFP+ WGCDLQSEHERYITEEAF GCPVIIRDYPK+IKAFYMR+NDDG+TVAAMDM
Sbjct  427   KKKFEFPLKWGCDLQSEHERYITEEAFNGCPVIIRDYPKEIKAFYMRQNDDGRTVAAMDM  486

Query  1547  LVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLV  1726
             LVPRVGELIGGSQREERLEYLE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFERLV
Sbjct  487   LVPRVGELIGGSQREERLEYLENRLDELKLSKESYWWYLDLRRYGSVPHAGFGLGFERLV  546

Query  1727  QFATGIDNIRDAIPFPRTPGS  1789
             QFATGI+NIRD IPFPRTPGS
Sbjct  547   QFATGIENIRDTIPFPRTPGS  567



>ref|XP_009348576.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X1 [Pyrus x bretschneideri]
Length=574

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/566 (78%), Positives = 493/566 (87%), Gaps = 15/566 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNS-YLYFLPK-PPTHSVCLRRsfcsvvcsavssGEA  292
             R  P+S +RLLS Y +T      P   +  FLP+     +V  RRSFC+++ +A+ SG A
Sbjct  12    RFNPYSTLRLLSFYPRTPLPCRTPTPIFPPFLPRLSRAAAVPRRRSFCTLISAALHSGGA  71

Query  293   VQRPLSGDFGTKEVEESRK-------IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWV  451
              +R         E+ E R+       +GEFR++L++ D+KGG DEGL+RLG++LVV GWV
Sbjct  72    AERT------KPEIAEERRSEGGNNRVGEFRKKLKVVDVKGGSDEGLERLGQSLVVMGWV  125

Query  452   RTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGS  631
             RTLR QSSVTFIEVNDGSCLSNMQCV+  DAEGYDQVE+G I TGAS+W+QG I++SQGS
Sbjct  126   RTLRVQSSVTFIEVNDGSCLSNMQCVLGSDAEGYDQVESGSITTGASIWVQGIISASQGS  185

Query  632   KQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFAT  811
             KQK+ELKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+AT
Sbjct  186   KQKVELKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYAT  245

Query  812   HKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWS  991
             HKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP+S+E ++SPV+ IPK++ G VDWS
Sbjct  246   HKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPSSREASHSPVDGIPKSKDGLVDWS  305

Query  992   QDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  1171
             QDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD
Sbjct  306   QDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  365

Query  1172  LEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIE  1351
             L DDM+CA+AYLQYVV++IL+NCKEDMEFFNTWIEKGII RLSDV EK  VQLTYTDA+E
Sbjct  366   LNDDMACASAYLQYVVRHILENCKEDMEFFNTWIEKGIIGRLSDVAEKDFVQLTYTDAVE  425

Query  1352  lllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTV  1531
             LLLK  KKFEFPV WGCDLQSEHERY+TEEAF GCPVI+RDYPK+IKAFYMR+NDDGKTV
Sbjct  426   LLLKANKKFEFPVKWGCDLQSEHERYLTEEAFRGCPVIVRDYPKEIKAFYMRQNDDGKTV  485

Query  1532  AAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLG  1711
             AAMDMLVPRVGELIGGSQREERLEYLE RLD+L L KESYWWYLDLRRYGSVPHAGFGLG
Sbjct  486   AAMDMLVPRVGELIGGSQREERLEYLEDRLDELKLEKESYWWYLDLRRYGSVPHAGFGLG  545

Query  1712  FERLVQFATGIDNIRDAIPFPRTPGS  1789
             FERLVQFATGIDNIRD IPFPR PGS
Sbjct  546   FERLVQFATGIDNIRDTIPFPRAPGS  571



>ref|XP_004288480.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=561

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/481 (85%), Positives = 455/481 (95%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             ++G+FR++L++ADIKGGPD+GLDRLG+TLVV GWVRTLR QS+VTFIEVNDGSCLSNMQC
Sbjct  78    RVGQFRKKLKVADIKGGPDQGLDRLGQTLVVTGWVRTLRVQSTVTFIEVNDGSCLSNMQC  137

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM  DAEGYDQVE+G + TGAS+W+QG +A+SQGSKQK+ELK+ K+V+VGKSDPSFPIQK
Sbjct  138   VMDSDAEGYDQVESGSVTTGASIWVQGVVAASQGSKQKVELKINKIVVVGKSDPSFPIQK  197

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATH FFQENGFVWVSSPI+T SDCEGA
Sbjct  198   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHNFFQENGFVWVSSPIITGSDCEGA  257

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S+E ++SP+N IPK E G VDWSQDFFGKPAFLTVSGQLNAETYATAL
Sbjct  258   GEQFCVTTLIPSSREVSDSPINGIPKKEDGRVDWSQDFFGKPAFLTVSGQLNAETYATAL  317

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQYVV+++LDNCKE
Sbjct  318   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQYVVRHVLDNCKE  377

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII+RL+DV EK  VQLTYTDA+ELLL+ KKKFEFPV WGCDLQSEHER
Sbjct  378   DMDFFNTWIEKGIIERLTDVAEKDFVQLTYTDAVELLLRAKKKFEFPVKWGCDLQSEHER  437

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAF GCPVI+RDYPK+IKAFYMR+NDDGKTVAAMDMLVPRVGELIGGSQREERLEY
Sbjct  438   YITEEAFSGCPVIVRDYPKEIKAFYMRQNDDGKTVAAMDMLVPRVGELIGGSQREERLEY  497

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LNKE+YWWYLDLRRYGSVPHAGFGLGFERLVQFATG++NIRD IPFPRTPG
Sbjct  498   LEDRLDELKLNKEAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMENIRDVIPFPRTPG  557

Query  1787  S  1789
             S
Sbjct  558   S  558



>ref|XP_006440310.1| hypothetical protein CICLE_v10019519mg [Citrus clementina]
 gb|ESR53550.1| hypothetical protein CICLE_v10019519mg [Citrus clementina]
Length=563

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/561 (77%), Positives = 488/561 (87%), Gaps = 16/561 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             RL+P+S +R LS Y K      +   Y  F P      +  RR F SV+  A+ SGE  +
Sbjct  12    RLRPYSTLRCLSFYPKN-----LTKPYPVFPPLIRRSPISPRRLFSSVISGALHSGERTK  66

Query  299   RPLS----GDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRA  466
               L+    G+ G+K       +GEFR++L+I D+KGGP+EGLDR+G+ +VV GWVRTLRA
Sbjct  67    SELAEKQMGEMGSK-------VGEFRKKLKIVDVKGGPNEGLDRVGQMIVVAGWVRTLRA  119

Query  467   QSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIE  646
             QSSVTFIEVNDGSCLSNMQCVM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+E
Sbjct  120   QSSVTFIEVNDGSCLSNMQCVMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVE  179

Query  647   lkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQ  826
             LKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQ
Sbjct  180   LKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQ  239

Query  827   ENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFG  1006
             ENGF+W+SSPI+TASDCEGAGEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQDFF 
Sbjct  240   ENGFIWISSPIITASDCEGAGEQFCVTTLIPSSREAAESPVDAIPKTKDGLIDWSQDFFE  299

Query  1007  KPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM  1186
             KPAFLTVSGQLNAETYATAL++VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM
Sbjct  300   KPAFLTVSGQLNAETYATALSNVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDM  359

Query  1187  SCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllkt  1366
             +CA AYLQYVV+YILDNCKEDM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K 
Sbjct  360   ACATAYLQYVVRYILDNCKEDMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKA  419

Query  1367  kkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDM  1546
             KKKFEFPV WGCDLQSEHERY+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDM
Sbjct  420   KKKFEFPVKWGCDLQSEHERYLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDM  479

Query  1547  LVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLV  1726
             LVP++GELIGGSQREERLEYLE RLD+L LN++SYWWYLDLR YGSVPHAGFGLGFERLV
Sbjct  480   LVPQIGELIGGSQREERLEYLEGRLDELKLNRDSYWWYLDLRHYGSVPHAGFGLGFERLV  539

Query  1727  QFATGIDNIRDAIPFPRTPGS  1789
             QFATG++NIRDAIPFPRTPGS
Sbjct  540   QFATGVENIRDAIPFPRTPGS  560



>ref|XP_006477189.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=563

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/557 (77%), Positives = 485/557 (87%), Gaps = 8/557 (1%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             RL+P+S +R LS Y K      +   Y  F P      +  RR F SV+  A+ SGE  +
Sbjct  12    RLRPYSTLRCLSFYPKN-----LTKPYPVFPPLIRRSPISPRRFFSSVISGALHSGERTK  66

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
               L+     ++ +   K+GEFR++L+I D+KGGPDEGLDR+G  +VV GWVRTLRAQSSV
Sbjct  67    SELAEK---QKGQMGSKVGEFRKKLKIVDVKGGPDEGLDRVGLMIVVAGWVRTLRAQSSV  123

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIEVNDGSCLSNMQCVM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV 
Sbjct  124   TFIEVNDGSCLSNMQCVMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVN  183

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF
Sbjct  184   KIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGF  243

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             +W+SSPI+TASDCEGAGEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQDFF KPAF
Sbjct  244   IWISSPIITASDCEGAGEQFCVTTLIPSSREAVESPVDAIPKTKDGLIDWSQDFFEKPAF  303

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA 
Sbjct  304   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACAT  363

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+YILDNCKEDM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKF
Sbjct  364   AYLQYVVRYILDNCKEDMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKF  423

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             EF V WGCDLQSEHERY+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR
Sbjct  424   EFLVKWGCDLQSEHERYLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPR  483

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             +GELIGGSQREERLEYLE RLD+L LN+++YWWYLDLR YGSVPHAGFGLGFERLVQFAT
Sbjct  484   IGELIGGSQREERLEYLEGRLDELKLNRDTYWWYLDLRHYGSVPHAGFGLGFERLVQFAT  543

Query  1739  GIDNIRDAIPFPRTPGS  1789
             G++NIRDAIPFPRTPGS
Sbjct  544   GVENIRDAIPFPRTPGS  560



>ref|XP_010689220.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=574

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/576 (75%), Positives = 475/576 (82%), Gaps = 35/576 (6%)
 Frame = +2

Query  119   RLKPFSAVRLLS------------LYHKTTKTAAVPN------SYLYFL-PKPPTHSVCL  241
             RL+P +A+R  S            L++ T    A+ +      S L+FL P P     C 
Sbjct  12    RLRPHTALRFFSRSFHPTIFTTPTLFYSTNPLNALTSHPHFSFSRLHFLSPHPRRSCFC-  70

Query  242   RRsfcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRL  421
                         ++G+ V+ P       + V+   K+G +R+RLRIADIKGGPDEGLDRL
Sbjct  71    --------TLTSAAGDDVKTP-------ENVDSGEKVGHYRKRLRIADIKGGPDEGLDRL  115

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G++LVVRGWVRT+R QSSVTFIEVNDGSCLSNMQCV+S DAEGYDQVE G I TGAS+ +
Sbjct  116   GQSLVVRGWVRTIRMQSSVTFIEVNDGSCLSNMQCVVSSDAEGYDQVEAGCISTGASIMV  175

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
              G +  S G+KQK+ELK  K+V VG+SDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA
Sbjct  176   HGVVVGSPGTKQKVELKADKIVTVGESDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  235

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNALA+ATHKFFQ+NGFVW+SSPI+TASDCEGAGEQFCVTTLIP S E   S    IP
Sbjct  236   RVRNALAYATHKFFQDNGFVWISSPIITASDCEGAGEQFCVTTLIPTSLEALESSAGTIP  295

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             KTE G +DWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFW
Sbjct  296   KTEEGLIDWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFW  355

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPELAFADL DDM+CAAAYLQYVV+YILDNCKEDM+FFNTWIEKGII RL+DV  K  
Sbjct  356   MIEPELAFADLNDDMACAAAYLQYVVRYILDNCKEDMDFFNTWIEKGIINRLNDVAVKDF  415

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
             VQ+TYTDA+ +LLK  KKFEFPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY
Sbjct  416   VQVTYTDAVNILLKADKKFEFPVKWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  475

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MRENDDGKTVAAMDMLVPR+GELIGGSQREERLE LE RLD+L L+KESYWWYLDLRRYG
Sbjct  476   MRENDDGKTVAAMDMLVPRIGELIGGSQREERLERLENRLDELKLSKESYWWYLDLRRYG  535

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             SVPHAGFGLGFERLVQFATGIDNIRDAIPFPR PGS
Sbjct  536   SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRAPGS  571



>ref|XP_010533903.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=554

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/558 (76%), Positives = 471/558 (84%), Gaps = 19/558 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHK-TTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAV  295
             RL P S +RLLS + K  T+ +++P      LP     S   R         +   G  V
Sbjct  12    RLTPLSTLRLLSFFPKFNTRPSSLPRR---LLPLFGGSSASARLRCLCSASLSSGDGRRV  68

Query  296   QRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSS  475
             +                K+GEFRR+LRIADIKGG DEGL R+G+TL V GWVRTLR QSS
Sbjct  69    ES---------------KVGEFRRKLRIADIKGGSDEGLGRVGQTLRVMGWVRTLRVQSS  113

Query  476   VTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkv  655
             VTFIE+NDGSCLSNMQCV++ DAEGYDQVE+G+++TGAS+ +QGT+ +SQGSKQK+ELK 
Sbjct  114   VTFIEINDGSCLSNMQCVLNSDAEGYDQVESGMVLTGASISVQGTLVASQGSKQKVELKA  173

Query  656   vklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENG  835
              K+V++G  D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATH FFQENG
Sbjct  174   EKIVVIGICDASYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHNFFQENG  233

Query  836   FVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPA  1015
             F+WVSSPI+TASDCEGAGEQFCVTTLIP+  E T+S V+ IPKT+ G +DWS+DFFGKPA
Sbjct  234   FIWVSSPIITASDCEGAGEQFCVTTLIPSCNETTDSSVDTIPKTKEGLIDWSKDFFGKPA  293

Query  1016  FLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCA  1195
             FLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM+CA
Sbjct  294   FLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMACA  353

Query  1196  AAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkk  1375
              AYLQYVV++ILDNCKEDM+FFNTWIEKGI+ RLSDV EK  +QLTYTDAIELLLK  KK
Sbjct  354   TAYLQYVVRHILDNCKEDMDFFNTWIEKGIVNRLSDVAEKDFIQLTYTDAIELLLKVNKK  413

Query  1376  FEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVP  1555
             FEFPV WGCDLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVP
Sbjct  414   FEFPVKWGCDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVP  473

Query  1556  RVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFA  1735
             RVGELIGGSQREERL+ LE RLD LNL+K+SYWWYLDLRR+GSVPHAGFGLGFERLVQFA
Sbjct  474   RVGELIGGSQREERLDCLEARLDALNLSKDSYWWYLDLRRFGSVPHAGFGLGFERLVQFA  533

Query  1736  TGIDNIRDAIPFPRTPGS  1789
             TG+DNIRD IPFPRTPGS
Sbjct  534   TGVDNIRDVIPFPRTPGS  551



>ref|XP_010053478.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Eucalyptus grandis]
Length=576

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/581 (75%), Positives = 493/581 (85%), Gaps = 43/581 (7%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSV-----------------CLRR  247
             RLKP+S +RLL+L   ++   + P       P PP+ +                  CL  
Sbjct  12    RLKPYSTLRLLALC--SSNPLSKPR------PFPPSAAAFAPRRPFPPPAAAPRRRCL--  61

Query  248   sfcsvvcsavssGEAVQR-------PLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDE  406
               C+ + +A+ SGEAV+        P  G+FG +       +GEFR+RL+I++IKGGP+E
Sbjct  62    --CTAIAAALRSGEAVEAKKSELADPPRGEFGGR-------VGEFRKRLKISEIKGGPEE  112

Query  407   GLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITG  586
             GL  +G+TL V GWVRTLRAQSSVTFIEVNDGSCLSNMQCVM  DAEGYDQVE+GL+ TG
Sbjct  113   GLGLVGQTLTVMGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMDSDAEGYDQVESGLVSTG  172

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             AS+WIQG + +SQGSKQK+ELKV K++LVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNT
Sbjct  173   ASIWIQGILVASQGSKQKVELKVKKIMLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNT  232

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             FGAV+RVRNALA+ATHKFFQENGFVWVSSPI+T+SDCEGAGEQFCVTTLIP+S E T +P
Sbjct  233   FGAVSRVRNALAYATHKFFQENGFVWVSSPIITSSDCEGAGEQFCVTTLIPSSGETTATP  292

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             ++ IPKTE+G +DWSQDFF KPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNT+RH
Sbjct  293   IDAIPKTENGLIDWSQDFFAKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTARH  352

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
             LAEFWMIEPELAFADL+DDM+CA AYLQYVV+++L+NCKEDMEFFNTWIEKGII RL+DV
Sbjct  353   LAEFWMIEPELAFADLDDDMACATAYLQYVVRHVLENCKEDMEFFNTWIEKGIIDRLTDV  412

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             V K  VQLTYTDA+ELL+K+KKKFEFPV WGCDLQSEHERYITE+ F GCPVIIRDYPKD
Sbjct  413   VNKDFVQLTYTDAVELLVKSKKKFEFPVKWGCDLQSEHERYITEQVFRGCPVIIRDYPKD  472

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR+NDDG+TVAAMDMLVPRVGELIGGSQREERLEYLE RLDDL LNK++YWWYLD
Sbjct  473   IKAFYMRQNDDGRTVAAMDMLVPRVGELIGGSQREERLEYLEARLDDLKLNKDTYWWYLD  532

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LRRYGSVPHAGFGLGFERLVQFATGI+NIRD IPFPR PGS
Sbjct  533   LRRYGSVPHAGFGLGFERLVQFATGIENIRDTIPFPRAPGS  573



>ref|XP_004147209.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 ref|XP_004162346.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN55862.1| hypothetical protein Csa_3G020020 [Cucumis sativus]
Length=562

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/557 (76%), Positives = 478/557 (86%), Gaps = 9/557 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             R  P S +R +S   +      +P+ ++ F P  P HS C  R       SA  + E  +
Sbjct  12    RFNPCSTLRFISGLPRK-----LPH-HILFPPIFPRHSSCYFRRSFCSAVSAGEAAEKTK  65

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
               +S D+   +V    K+GEFR++LRI++IKGG DEG+DRLG+T VV GWVRTLR QSSV
Sbjct  66    PDVSKDW---KVTRGEKVGEFRKKLRISEIKGGRDEGVDRLGQTFVVMGWVRTLRVQSSV  122

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TF+EVNDGSC+SNMQCV+    EGYDQVE+GLI TGASVW++G + +SQGSKQK+ELK+ 
Sbjct  123   TFMEVNDGSCISNMQCVIDSTTEGYDQVESGLITTGASVWVEGVVVASQGSKQKVELKLQ  182

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+++VGKSDPSFP+QKK+VSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF
Sbjct  183   KVIVVGKSDPSFPVQKKKVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGF  242

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTLIP+S EP  S V  IPKT+ G +DWSQDFFGKPAF
Sbjct  243   VWVSSPIITASDCEGAGEQFCVTTLIPSSGEPARSDVGSIPKTKEGFIDWSQDFFGKPAF  302

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDMSCA 
Sbjct  303   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMSCAT  362

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV++IL+NCKED++FFNTWIEKGII RL+++VE   VQL YTDAIELLL+  KKF
Sbjct  363   AYLQYVVRHILENCKEDLDFFNTWIEKGIIDRLTNLVENDFVQLPYTDAIELLLRANKKF  422

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             E+PV WG DLQSEHERYITE AFGGCPVIIRDYP+DIKAFYMR+NDDGKTVAAMDMLVP+
Sbjct  423   EYPVKWGSDLQSEHERYITEVAFGGCPVIIRDYPRDIKAFYMRQNDDGKTVAAMDMLVPK  482

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             +GELIGGSQREERL+YLE RLDDL LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF T
Sbjct  483   IGELIGGSQREERLDYLEARLDDLKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVT  542

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GIDNIRDAIPFPR+PGS
Sbjct  543   GIDNIRDAIPFPRSPGS  559



>gb|KDO61441.1| hypothetical protein CISIN_1g011197mg [Citrus sinensis]
Length=487

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/481 (84%), Positives = 451/481 (94%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+I D+KGGP+EGLDR+G  +VV GWVRTLRAQSSVTFIEVNDGSCLSNMQC
Sbjct  4     KVGEFRKKLKIVDVKGGPNEGLDRVGLMIVVAGWVRTLRAQSSVTFIEVNDGSCLSNMQC  63

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV K+VLVGKSDPS+PIQK
Sbjct  64    VMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVNKIVLVGKSDPSYPIQK  123

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF+W+SSPI+TASDCEGA
Sbjct  124   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFIWISSPIITASDCEGA  183

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQDFF KPAFLTVSGQLNAETYATAL
Sbjct  184   GEQFCVTTLIPSSREAAESPVDAIPKTKDGLIDWSQDFFEKPAFLTVSGQLNAETYATAL  243

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             ++VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+YILDNCKE
Sbjct  244   SNVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACATAYLQYVVRYILDNCKE  303

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKFEF V WGCDLQSEHER
Sbjct  304   DMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKFEFLVKWGCDLQSEHER  363

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             Y+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR+GELIGGSQREERLEY
Sbjct  364   YLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPRIGELIGGSQREERLEY  423

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LN++SYWWYLDLR YGSVPHAGFGLGFERLVQFATG++NIRDAIPFPRTPG
Sbjct  424   LEGRLDELKLNRDSYWWYLDLRHYGSVPHAGFGLGFERLVQFATGVENIRDAIPFPRTPG  483

Query  1787  S  1789
             S
Sbjct  484   S  484



>gb|KCW77787.1| hypothetical protein EUGRSUZ_D02080 [Eucalyptus grandis]
Length=627

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/581 (75%), Positives = 493/581 (85%), Gaps = 43/581 (7%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSV-----------------CLRR  247
             RLKP+S +RLL+L   ++   + P       P PP+ +                  CL  
Sbjct  63    RLKPYSTLRLLALC--SSNPLSKPR------PFPPSAAAFAPRRPFPPPAAAPRRRCL--  112

Query  248   sfcsvvcsavssGEAVQR-------PLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDE  406
               C+ + +A+ SGEAV+        P  G+FG +       +GEFR+RL+I++IKGGP+E
Sbjct  113   --CTAIAAALRSGEAVEAKKSELADPPRGEFGGR-------VGEFRKRLKISEIKGGPEE  163

Query  407   GLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITG  586
             GL  +G+TL V GWVRTLRAQSSVTFIEVNDGSCLSNMQCVM  DAEGYDQVE+GL+ TG
Sbjct  164   GLGLVGQTLTVMGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMDSDAEGYDQVESGLVSTG  223

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             AS+WIQG + +SQGSKQK+ELKV K++LVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNT
Sbjct  224   ASIWIQGILVASQGSKQKVELKVKKIMLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNT  283

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             FGAV+RVRNALA+ATHKFFQENGFVWVSSPI+T+SDCEGAGEQFCVTTLIP+S E T +P
Sbjct  284   FGAVSRVRNALAYATHKFFQENGFVWVSSPIITSSDCEGAGEQFCVTTLIPSSGETTATP  343

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             ++ IPKTE+G +DWSQDFF KPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNT+RH
Sbjct  344   IDAIPKTENGLIDWSQDFFAKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTARH  403

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
             LAEFWMIEPELAFADL+DDM+CA AYLQYVV+++L+NCKEDMEFFNTWIEKGII RL+DV
Sbjct  404   LAEFWMIEPELAFADLDDDMACATAYLQYVVRHVLENCKEDMEFFNTWIEKGIIDRLTDV  463

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             V K  VQLTYTDA+ELL+K+KKKFEFPV WGCDLQSEHERYITE+ F GCPVIIRDYPKD
Sbjct  464   VNKDFVQLTYTDAVELLVKSKKKFEFPVKWGCDLQSEHERYITEQVFRGCPVIIRDYPKD  523

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR+NDDG+TVAAMDMLVPRVGELIGGSQREERLEYLE RLDDL LNK++YWWYLD
Sbjct  524   IKAFYMRQNDDGRTVAAMDMLVPRVGELIGGSQREERLEYLEARLDDLKLNKDTYWWYLD  583

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LRRYGSVPHAGFGLGFERLVQFATGI+NIRD IPFPR PGS
Sbjct  584   LRRYGSVPHAGFGLGFERLVQFATGIENIRDTIPFPRAPGS  624



>ref|XP_010258932.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=588

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/574 (74%), Positives = 480/574 (84%), Gaps = 17/574 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCL-----------------RR  247
             RL+P SA R +S  +  T    V   +     K PT    L                 RR
Sbjct  12    RLRPQSAARFISFLNNITTGRNVLTGFRTLTNKAPTFPPFLHCYPGVRHLRRDSPAFNRR  71

Query  248   sfcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGE  427
              F S +  A+SS EAV++         +V   +K+ EFR+RLRIADIKGGPDEGLDR+G+
Sbjct  72    CFSSAIVGAISSEEAVEKAKKEFLEKPDVGTGQKVREFRKRLRIADIKGGPDEGLDRVGQ  131

Query  428   TLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQG  607
             TLVV+GWVRTLR Q S+TF+EVNDGSCLSNMQCV++ DAEGYDQVE+G I TGASVW++G
Sbjct  132   TLVVKGWVRTLRVQRSITFMEVNDGSCLSNMQCVINSDAEGYDQVESGSISTGASVWVEG  191

Query  608   TIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARV  787
              I  SQGS QK+EL+V K++ VGKSDPSFPIQKKR+SREFLRTKAHLRPRTNTFGAV+RV
Sbjct  192   AIVESQGSGQKVELRVTKVITVGKSDPSFPIQKKRISREFLRTKAHLRPRTNTFGAVSRV  251

Query  788   RNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKT  967
             RNALA+ATHKFFQENGFVW+SSPIVTASDCEGAGEQFCVTTLIP+S++ ++S V+ IPKT
Sbjct  252   RNALAYATHKFFQENGFVWISSPIVTASDCEGAGEQFCVTTLIPSSRDASDSLVDTIPKT  311

Query  968   ESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMI  1147
             + G +DWSQDFFGKPAFLTVSGQLNAETYA+AL DVYTFGPTFRAENSNTSRHLAEFWMI
Sbjct  312   DDGLIDWSQDFFGKPAFLTVSGQLNAETYASALCDVYTFGPTFRAENSNTSRHLAEFWMI  371

Query  1148  EPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQ  1327
             EPELAFADL DDM+CA AYL+YVV+++LDNCKEDM+FFNTWIEKGII RLSDV EK  V 
Sbjct  372   EPELAFADLSDDMACATAYLKYVVRHVLDNCKEDMDFFNTWIEKGIIDRLSDVAEKNFVH  431

Query  1328  LTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR  1507
             L YT+AIELLLK K+KFEFPV WGCDLQSEHERY+TEEAF GCPVII DYPK+IKAFYMR
Sbjct  432   LAYTEAIELLLKAKRKFEFPVKWGCDLQSEHERYVTEEAFAGCPVIITDYPKEIKAFYMR  491

Query  1508  ENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSV  1687
              NDDG TVAAMD+LVPRVGELIGGSQREERLEYLE RLD+L LNKE+YWWYLDLRR+GSV
Sbjct  492   LNDDGSTVAAMDVLVPRVGELIGGSQREERLEYLEDRLDELKLNKETYWWYLDLRRFGSV  551

Query  1688  PHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             PHAGFGLGFERLVQF TGI+NIRDAIPFPRTPGS
Sbjct  552   PHAGFGLGFERLVQFVTGIENIRDAIPFPRTPGS  585



>ref|XP_007210255.1| hypothetical protein PRUPE_ppa003379mg [Prunus persica]
 gb|EMJ11454.1| hypothetical protein PRUPE_ppa003379mg [Prunus persica]
Length=579

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/497 (83%), Positives = 457/497 (92%), Gaps = 9/497 (2%)
 Frame = +2

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
             RP SG+          ++GEFR++L++ DIKGGPDEGL+RL ++LVV GWVRTLR QSSV
Sbjct  89    RPESGN---------NRVGEFRKKLKVVDIKGGPDEGLERLSQSLVVMGWVRTLRVQSSV  139

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIEVNDGSCLSNMQCV+  DAEGYDQVE+GLI TGAS+W+QG +A+SQGSKQK+ELKV 
Sbjct  140   TFIEVNDGSCLSNMQCVLGLDAEGYDQVESGLITTGASIWVQGILAASQGSKQKVELKVK  199

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+V+VGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF
Sbjct  200   KIVVVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGF  259

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTLIP+++E ++SPV+ IP+ + G VDWSQDFFGKPAF
Sbjct  260   VWVSSPIITASDCEGAGEQFCVTTLIPSTREASHSPVDGIPRLKDGLVDWSQDFFGKPAF  319

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA 
Sbjct  320   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACAT  379

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+++L+NCKEDMEFFNTWIEKGII RL+DV +K  VQLTYTDA+ELLL+  KKF
Sbjct  380   AYLQYVVRHVLENCKEDMEFFNTWIEKGIIDRLNDVADKDFVQLTYTDAVELLLRANKKF  439

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             EFPV WGCDLQSEHERY+TEEAF GCPVI+RDYPKDIKAFYMR NDDGKTVAAMDMLVPR
Sbjct  440   EFPVKWGCDLQSEHERYLTEEAFSGCPVIVRDYPKDIKAFYMRRNDDGKTVAAMDMLVPR  499

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             VGELIGGSQREERLEYLE+RLD+  LNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQFAT
Sbjct  500   VGELIGGSQREERLEYLEERLDESKLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  559

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GI+NIRD IPFPR PGS
Sbjct  560   GIENIRDVIPFPRAPGS  576



>emb|CDY42978.1| BnaA01g17760D [Brassica napus]
Length=563

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/560 (76%), Positives = 472/560 (84%), Gaps = 14/560 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             RL PFS +R LS +  +      P+ Y  F P    H   L     +             
Sbjct  12    RLTPFSTLRFLSFFPISN-----PSHYSLFRP----HRRPLFEDSPANSRRRCFCTATSV  62

Query  299   RPLSGDFGTKEVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQ  469
              P S D   K   E R   K+GEFR++LRIA++KGG DEGL R+G++L V GWVRTLR+Q
Sbjct  63    SPSSSD--GKNNHEQRIGSKVGEFRKKLRIAEVKGGADEGLGRVGQSLSVMGWVRTLRSQ  120

Query  470   SSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIEl  649
             SSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE G ++TGASV +QGTI +SQG+KQK+EL
Sbjct  121   SSVTFIEINDGSCLSNLQCVMNPDAEGYDQVEAGSVLTGASVCVQGTIVASQGTKQKVEL  180

Query  650   kvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQE  829
             KV K++LVGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE
Sbjct  181   KVHKIILVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQE  240

Query  830   NGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGK  1009
             +GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E TN+ ++ IPKT+ G VDWSQDFFGK
Sbjct  241   SGFVWVASPIITASDCEGAGEQFCVTTLIPSSHETTNTSIDAIPKTKGGLVDWSQDFFGK  300

Query  1010  PAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMS  1189
             PAFLTVSGQLN ETYATAL+D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+
Sbjct  301   PAFLTVSGQLNGETYATALSDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMA  360

Query  1190  CAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktk  1369
             CA AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII RLSDVVEK+ +QL+YTDAIELLLK  
Sbjct  361   CATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIHRLSDVVEKEFLQLSYTDAIELLLKAN  420

Query  1370  kkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDML  1549
             K FEFPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDML
Sbjct  421   KNFEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDML  480

Query  1550  VPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQ  1729
             VPRVGELIGGSQREERL  LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQ
Sbjct  481   VPRVGELIGGSQREERLGVLEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLGFERLVQ  540

Query  1730  FATGIDNIRDAIPFPRTPGS  1789
             FATGIDNIRD IPFPR+PGS
Sbjct  541   FATGIDNIRDVIPFPRSPGS  560



>gb|KHG03082.1| Asparagine--tRNA ligase [Gossypium arboreum]
Length=563

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/563 (77%), Positives = 488/563 (87%), Gaps = 24/563 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKP----PTHSVCLR-Rsfcsvvcsavss  283
             R KP+S +R LS Y K       P S   F P P    P HS   R R FCSV+ +A+ S
Sbjct  16    RFKPYSTLRFLSFYSKN------PKSPRLFPPLPRRPVPFHSAIPRKRCFCSVISAALQS  69

Query  284   GEAVQRPLSGDFGTKEV-EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTL  460
             GE  +R    +F  K+V E    +GEFR++L+IADIKGGPDEGL+R+G+T+VV GWVRTL
Sbjct  70    GEMKKR----EFPEKKVGEMGNTVGEFRKKLKIADIKGGPDEGLNRVGQTVVVMGWVRTL  125

Query  461   RAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQK  640
             R QSSVTF+EVNDGS LSNMQCVM+ DAEGYDQVE+GLI TGAS+W+QGT+ +SQGSKQK
Sbjct  126   RVQSSVTFLEVNDGSSLSNMQCVMNSDAEGYDQVESGLIATGASIWVQGTLVASQGSKQK  185

Query  641   IElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKF  820
             +ELKV K+V+VGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGA+ARVRNALA+ATHKF
Sbjct  186   VELKVEKVVVVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAIARVRNALAYATHKF  245

Query  821   FQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDF  1000
             FQENGFVW+SSPI+TASDCEGAGEQFCVTTLIP+S+E  +SPV+ IP T++G +DWSQDF
Sbjct  246   FQENGFVWISSPIITASDCEGAGEQFCVTTLIPSSREAADSPVDAIPNTKNGLIDWSQDF  305

Query  1001  FGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLED  1180
             FGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+D
Sbjct  306   FGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDD  365

Query  1181  DMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElll  1360
             DM+CA AYLQYVV+++LDNCKEDMEFFNTWIEKG+I RL+DV EK  VQLTYTDAI LLL
Sbjct  366   DMACATAYLQYVVRHVLDNCKEDMEFFNTWIEKGVIDRLNDVAEKDFVQLTYTDAIGLLL  425

Query  1361  ktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAM  1540
             K KKKFEFPV WGCDLQSEHERYITEEAF GCP        +IKAFYMR+NDDGKTVAAM
Sbjct  426   KAKKKFEFPVKWGCDLQSEHERYITEEAFKGCP--------EIKAFYMRQNDDGKTVAAM  477

Query  1541  DMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFER  1720
             DMLVPRVGELIGGSQREERL+YLE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFER
Sbjct  478   DMLVPRVGELIGGSQREERLDYLENRLDELKLSKESYWWYLDLRRYGSVPHAGFGLGFER  537

Query  1721  LVQFATGIDNIRDAIPFPRTPGS  1789
             LVQFATGI+NIRDAIPFPR PGS
Sbjct  538   LVQFATGIENIRDAIPFPRAPGS  560



>ref|XP_009108309.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Brassica rapa]
Length=562

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/564 (75%), Positives = 484/564 (86%), Gaps = 23/564 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLP-KPPTH----SVCLRRsfcsvvcsavss  283
             RL PFS++R LS +         P+SY  F P + P+     +   RR FC+ V  +  S
Sbjct  12    RLTPFSSLRFLSFF---------PSSYPLFSPLRRPSFEGFPANARRRCFCTAVSESTGS  62

Query  284   GEA--VQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRT  457
             GE   V       FG++       +GEFRR+L+IA++KGG D+GL R+G++L + GWVRT
Sbjct  63    GEGKKVDNSYENRFGSR-------VGEFRRKLKIAEVKGGADQGLGRVGQSLSIMGWVRT  115

Query  458   LRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQ  637
             LR+QSSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G ++TGAS+ +QGTI +SQG+KQ
Sbjct  116   LRSQSSVTFIEINDGSCLSNLQCVMNPDAEGYDQVESGSVLTGASISVQGTIVASQGTKQ  175

Query  638   KIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHK  817
             K+ELKV K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHK
Sbjct  176   KVELKVEKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHK  235

Query  818   FFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQD  997
             FFQE+GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E T+S ++ IPKT+ G VDWSQD
Sbjct  236   FFQESGFVWVASPIITASDCEGAGEQFCVTTLIPSSHETTDSSIDAIPKTKGGLVDWSQD  295

Query  998   FFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLE  1177
             FFGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL 
Sbjct  296   FFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLN  355

Query  1178  DDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIEll  1357
             DDM+CA AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII RLS+VVEK+ +QL YTDAIELL
Sbjct  356   DDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIHRLSEVVEKEFLQLGYTDAIELL  415

Query  1358  lktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAA  1537
             LK  KKFEFPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAA
Sbjct  416   LKANKKFEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAA  475

Query  1538  MDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFE  1717
             MDMLVPR+GELIGGSQREERLE LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFE
Sbjct  476   MDMLVPRIGELIGGSQREERLEVLEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLGFE  535

Query  1718  RLVQFATGIDNIRDAIPFPRTPGS  1789
             RLVQFATGIDNIRD IPFPR+PGS
Sbjct  536   RLVQFATGIDNIRDVIPFPRSPGS  559



>ref|XP_008448845.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X1 [Cucumis melo]
Length=562

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/557 (75%), Positives = 474/557 (85%), Gaps = 9/557 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             R  P S +R ++   +        + ++ F P    HS    R        A  + E  +
Sbjct  12    RFNPCSTLRFITGLPRKL------SHHILFPPISRRHSSYYFRRSFCSAVPAGEAAEKTK  65

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
               +S D+   +V    K+GEFR++LRI++IKGG DEGLDRLG+T VV+GWVRTLR QSSV
Sbjct  66    PDVSKDW---KVTRGEKVGEFRKKLRISEIKGGRDEGLDRLGQTFVVKGWVRTLRVQSSV  122

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TF+EVNDGSC+SNMQCV+    EGYDQVE+GLI TGASVW++G + +SQGSKQK+ELK+ 
Sbjct  123   TFMEVNDGSCISNMQCVIDSTTEGYDQVESGLITTGASVWVEGVVVASQGSKQKVELKLQ  182

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+V+VGKSDPS+P+QKK+VSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQENGF
Sbjct  183   KVVMVGKSDPSYPVQKKKVSREFLRTKAHLRPRTNTFGAVARVRNVLAYATHKFFQENGF  242

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTLIP+S EP +S V  IPKT+ G +DWSQDFFGKPAF
Sbjct  243   VWVSSPIITASDCEGAGEQFCVTTLIPSSGEPASSDVGSIPKTKEGFIDWSQDFFGKPAF  302

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDMSCA 
Sbjct  303   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMSCAT  362

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+++L+NCKED++FFNTWIEKGII RL+++VE   VQL YTDAIELLL+  KKF
Sbjct  363   AYLQYVVRHVLENCKEDLDFFNTWIEKGIIDRLTNLVENDFVQLPYTDAIELLLRANKKF  422

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             E+PV WG DLQSEHERYITE AFGGCPVIIRDYP+DIKAFYMR+NDDGKTVAAMDMLVP+
Sbjct  423   EYPVKWGSDLQSEHERYITEVAFGGCPVIIRDYPRDIKAFYMRQNDDGKTVAAMDMLVPK  482

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             +GELIGGSQREERL+YLE RLDDL LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF T
Sbjct  483   IGELIGGSQREERLDYLEARLDDLKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVT  542

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GIDNIRDAIPFPR+PGS
Sbjct  543   GIDNIRDAIPFPRSPGS  559



>ref|XP_002870111.1| hypothetical protein ARALYDRAFT_914989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46370.1| hypothetical protein ARALYDRAFT_914989 [Arabidopsis lyrata subsp. 
lyrata]
Length=567

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/561 (74%), Positives = 472/561 (84%), Gaps = 12/561 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             RL P+S +R LS +  +  +        Y L +PP H V                  AV 
Sbjct  12    RLTPYSTLRFLSFFSISNPS--------YSLFRPPRHRVLPLIDAFPTNSRRRCFCTAVS  63

Query  299   RPLSGDFGTK----EVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRA  466
               L    G K    E     K+GEFR++L+IA++KGG DEGL R+G++L + GWVRTLR+
Sbjct  64    ESLGSGEGNKVDNFEKRFGSKVGEFRKKLKIAEVKGGADEGLGRVGQSLNIMGWVRTLRS  123

Query  467   QSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIE  646
             QSSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+E
Sbjct  124   QSSVTFIEINDGSCLSNLQCVMNSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVE  183

Query  647   lkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQ  826
             LKV K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQ
Sbjct  184   LKVEKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQ  243

Query  827   ENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFG  1006
             E+GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFFG
Sbjct  244   ESGFVWVASPIITASDCEGAGEQFCVTTLIPSSHENTDTSIDAIPKTKGGLIDWSQDFFG  303

Query  1007  KPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM  1186
             KPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM
Sbjct  304   KPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDM  363

Query  1187  SCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllkt  1366
             +CA AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIE+LLK 
Sbjct  364   ACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEVLLKA  423

Query  1367  kkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDM  1546
              +KF+FPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDM
Sbjct  424   NRKFDFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDM  483

Query  1547  LVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLV  1726
             LVPR+GELIGGSQREERLE LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLV
Sbjct  484   LVPRIGELIGGSQREERLEVLEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLV  543

Query  1727  QFATGIDNIRDAIPFPRTPGS  1789
             QF TGIDNIRD IPFPRTP S
Sbjct  544   QFVTGIDNIRDVIPFPRTPAS  564



>emb|CDY58174.1| BnaA08g30290D [Brassica napus]
Length=562

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/564 (75%), Positives = 482/564 (85%), Gaps = 23/564 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLP--KPPTHSV---CLRRsfcsvvcsavss  283
             RL PFS +R LS +         P+SY  F P  +P +        RR FC+ V  +  S
Sbjct  12    RLTPFSTLRFLSFF---------PSSYSLFSPLSRPISEGFPANARRRCFCTAVTESAGS  62

Query  284   GEA--VQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRT  457
             GE   V       FG++       +GEFRR+L+IA++KGG D+GL R+G++L + GWVRT
Sbjct  63    GEGKKVDNSYENRFGSR-------VGEFRRKLKIAEVKGGADQGLGRVGQSLSIMGWVRT  115

Query  458   LRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQ  637
             LR+QSSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G ++TGAS+ +QGTI +SQG+KQ
Sbjct  116   LRSQSSVTFIEINDGSCLSNLQCVMNPDAEGYDQVESGSVLTGASISVQGTIVASQGTKQ  175

Query  638   KIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHK  817
             K+ELKV K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHK
Sbjct  176   KVELKVEKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHK  235

Query  818   FFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQD  997
             FFQE+GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E T+S ++ IPKT+ G VDWSQD
Sbjct  236   FFQESGFVWVASPIITASDCEGAGEQFCVTTLIPSSHETTDSSIDAIPKTKGGLVDWSQD  295

Query  998   FFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLE  1177
             FFGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL 
Sbjct  296   FFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLN  355

Query  1178  DDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIEll  1357
             DDM+CA AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII RLS+VVEK+ +QL YTDAIELL
Sbjct  356   DDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIHRLSEVVEKEFLQLGYTDAIELL  415

Query  1358  lktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAA  1537
             LK  KKFE+PV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAA
Sbjct  416   LKANKKFEYPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAA  475

Query  1538  MDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFE  1717
             MDMLVPR+GELIGGSQREERL+ LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFE
Sbjct  476   MDMLVPRIGELIGGSQREERLDVLEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLGFE  535

Query  1718  RLVQFATGIDNIRDAIPFPRTPGS  1789
             RLVQFATGIDNIRD IPFPR+PGS
Sbjct  536   RLVQFATGIDNIRDVIPFPRSPGS  559



>gb|KFK32185.1| hypothetical protein AALP_AA6G208600 [Arabis alpina]
Length=565

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/566 (75%), Positives = 474/566 (84%), Gaps = 24/566 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAA-----VPNSYLYFLPKPPTHSVCLRRsfcsvvcsavss  283
             RL P+S +R LS +  +  + +     VP   L F    PT   C               
Sbjct  12    RLAPYSTLRFLSFFPISNPSYSLFRRQVPRRILPFFEAYPTRR-CF--------------  56

Query  284   GEAVQRPLSGDFGTK-EVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWV  451
               AV   LS   G K E  E R   K+GEFR++LRIA++KGG D+GL R+GE+L + GWV
Sbjct  57    CTAVSESLSSGEGKKVENYEKRFGSKVGEFRKKLRIAEVKGGEDQGLSRVGESLSMMGWV  116

Query  452   RTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGS  631
             RTLR+QSSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G I+TGAS+ +QGTI +SQG+
Sbjct  117   RTLRSQSSVTFIEINDGSCLSNLQCVMNPDAEGYDQVESGSILTGASISVQGTIVASQGT  176

Query  632   KQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFAT  811
             KQK+ELKV K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTF AVARVRN LAFAT
Sbjct  177   KQKVELKVDKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFSAVARVRNTLAFAT  236

Query  812   HKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWS  991
             HKFFQE+GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E T+S ++ IPKT+ G VDWS
Sbjct  237   HKFFQESGFVWVASPIITASDCEGAGEQFCVTTLIPSSHETTDSAIDAIPKTKGGLVDWS  296

Query  992   QDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  1171
             +DFFGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD
Sbjct  297   KDFFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  356

Query  1172  LEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIE  1351
             L DDM+CA AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII RL+DVVEK  +QL YTDAIE
Sbjct  357   LNDDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIHRLTDVVEKDFLQLGYTDAIE  416

Query  1352  lllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTV  1531
             LLLK  KKFEFPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTV
Sbjct  417   LLLKANKKFEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTV  476

Query  1532  AAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLG  1711
             AAMDMLVPR+GELIGGSQREERL+ LE RLD L L+KESYWWYLDLRRYGSVPHAGFGLG
Sbjct  477   AAMDMLVPRIGELIGGSQREERLDVLEARLDALKLDKESYWWYLDLRRYGSVPHAGFGLG  536

Query  1712  FERLVQFATGIDNIRDAIPFPRTPGS  1789
             FERLVQFATGIDNIRD IPFPR+PGS
Sbjct  537   FERLVQFATGIDNIRDVIPFPRSPGS  562



>gb|KDO61440.1| hypothetical protein CISIN_1g011197mg [Citrus sinensis]
Length=491

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/485 (83%), Positives = 449/485 (93%), Gaps = 4/485 (1%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+I D+KGGP+EGLDR+G  +VV GWVRTLRAQSSVTFIEVNDGSCLSNMQC
Sbjct  4     KVGEFRKKLKIVDVKGGPNEGLDRVGLMIVVAGWVRTLRAQSSVTFIEVNDGSCLSNMQC  63

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV K+VLVGKSDPS+PIQK
Sbjct  64    VMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVNKIVLVGKSDPSYPIQK  123

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF+W+SSPI+TASDCEGA
Sbjct  124   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFIWISSPIITASDCEGA  183

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQDFF KPAFLTVSGQLNAETYATAL
Sbjct  184   GEQFCVTTLIPSSREAAESPVDAIPKTKDGLIDWSQDFFEKPAFLTVSGQLNAETYATAL  243

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYV----VQYILD  1234
             ++VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQ      V+YILD
Sbjct  244   SNVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACATAYLQLYSCMQVRYILD  303

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKFEF V WGCDLQS
Sbjct  304   NCKEDMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKFEFLVKWGCDLQS  363

Query  1415  EHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQree  1594
             EHERY+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR+GELIGGSQREE
Sbjct  364   EHERYLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPRIGELIGGSQREE  423

Query  1595  rleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP  1774
             RLEYLE RLD+L LN++SYWWYLDLR YGSVPHAGFGLGFERLVQFATG++NIRDAIPFP
Sbjct  424   RLEYLEGRLDELKLNRDSYWWYLDLRHYGSVPHAGFGLGFERLVQFATGVENIRDAIPFP  483

Query  1775  RTPGS  1789
             RTPGS
Sbjct  484   RTPGS  488



>ref|NP_193462.1| asparaginyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O48593.3|SYNO_ARATH RecName: Full=Asparagine--tRNA ligase, chloroplastic/mitochondrial; 
AltName: Full=Asparaginyl-tRNA synthetase; Short=AsnRS; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL84964.1| AT4g17300/dl4685w [Arabidopsis thaliana]
 gb|AEE83874.1| asparaginyl-tRNA synthetase [Arabidopsis thaliana]
Length=567

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/497 (81%), Positives = 453/497 (91%), Gaps = 3/497 (1%)
 Frame = +2

Query  308   SGDFGTKEVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
             SGD    E  E R   K+GEFR++LRIA++KGG DEGL R+G++L + GWVRTLR+QSSV
Sbjct  68    SGDGNKVESYEKRFGSKVGEFRKKLRIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSV  127

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV 
Sbjct  128   TFIEINDGSCLSNLQCVMTSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVE  187

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+++VG+ D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GF
Sbjct  188   KIIVVGECDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGF  247

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWV+SPI+TASDCEGAGEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFFGKPAF
Sbjct  248   VWVASPIITASDCEGAGEQFCVTTLIPSSHENTDTSIDAIPKTKGGLIDWSQDFFGKPAF  307

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA 
Sbjct  308   LTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACAT  367

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIE+LLK  KKF
Sbjct  368   AYLQYVVKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEILLKANKKF  427

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             +FPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPR
Sbjct  428   DFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPR  487

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             +GELIGGSQREERLE LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF T
Sbjct  488   IGELIGGSQREERLEVLEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVT  547

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GIDNIRD IPFPRTP S
Sbjct  548   GIDNIRDVIPFPRTPAS  564



>emb|CAA10904.1| asparaginyl-tRNA synthetase [Arabidopsis thaliana]
Length=566

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/497 (81%), Positives = 453/497 (91%), Gaps = 3/497 (1%)
 Frame = +2

Query  308   SGDFGTKEVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
             SGD    E  E R   K+GEFR++LRIA++KGG DEGL R+G++L + GWVRTLR+QSSV
Sbjct  67    SGDGNKVESYEKRFGSKVGEFRKKLRIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSV  126

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV 
Sbjct  127   TFIEINDGSCLSNLQCVMTSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVE  186

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+++VG+ D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GF
Sbjct  187   KIIVVGECDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGF  246

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWV+SPI+TASDCEGAGEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFFGKPAF
Sbjct  247   VWVASPIITASDCEGAGEQFCVTTLIPSSHEYTDTSIDAIPKTKGGLIDWSQDFFGKPAF  306

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA 
Sbjct  307   LTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACAT  366

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+Y+LDNCKEDMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIE+LLK  KKF
Sbjct  367   AYLQYVVKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEILLKANKKF  426

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             +FPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPR
Sbjct  427   DFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPR  486

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             +GELIGGSQREERLE LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF T
Sbjct  487   IGELIGGSQREERLEVLEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVT  546

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GIDNIRD IPFPRTP S
Sbjct  547   GIDNIRDVIPFPRTPAS  563



>ref|XP_010110832.1| Asparagine--tRNA ligase [Morus notabilis]
 gb|EXC28311.1| Asparagine--tRNA ligase [Morus notabilis]
Length=531

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/557 (75%), Positives = 465/557 (83%), Gaps = 44/557 (8%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             +LK +SA+RLLS Y      +A+P   L+F P  P    CL                   
Sbjct  16    KLKSYSALRLLSFY------SAIPTRPLFFPPIRPRPLRCL-------------------  50

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
                           +  + EFR++L +ADIKGGPD+GLDRLG+TLVV+GWVRTLR QS+V
Sbjct  51    -----------CSVASGVEEFRKKLSVADIKGGPDQGLDRLGQTLVVKGWVRTLRLQSTV  99

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIEVNDGSCLSNMQCV+  D EGY QVE+G + TGAS+W+QG + SSQGSKQK+ELKV 
Sbjct  100   TFIEVNDGSCLSNMQCVLDPDTEGYGQVESGSVATGASIWVQGIVVSSQGSKQKVELKVK  159

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K++++GKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF
Sbjct  160   KILVIGKSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGF  219

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTL+P+S++  +SPV+ IPKT+ G +DWSQDFFGKPAF
Sbjct  220   VWVSSPIITASDCEGAGEQFCVTTLMPSSRDDVDSPVDGIPKTKDGLIDWSQDFFGKPAF  279

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA 
Sbjct  280   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACAT  339

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+Y+L+NCKEDMEFFNTWIEKGII RLS+V  K+ VQLTYTDAIELL + KKKF
Sbjct  340   AYLQYVVRYVLENCKEDMEFFNTWIEKGIIDRLSNVAAKEFVQLTYTDAIELLQRAKKKF  399

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             EF V WGCDLQSEHERYITEEAF GCP        +IKAFYMR+NDDGKTVAAMD+LVPR
Sbjct  400   EFSVEWGCDLQSEHERYITEEAFSGCP--------EIKAFYMRQNDDGKTVAAMDLLVPR  451

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             VGELIGGSQREERLEYLE RLD L LNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQFAT
Sbjct  452   VGELIGGSQREERLEYLEDRLDQLKLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  511

Query  1739  GIDNIRDAIPFPRTPGS  1789
             G++NIRDAIPFPRTPGS
Sbjct  512   GLENIRDAIPFPRTPGS  528



>emb|CDY50134.1| BnaCnng18830D [Brassica napus]
Length=562

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/559 (75%), Positives = 477/559 (85%), Gaps = 13/559 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEA--  292
             RL PFS +R  S +H  +K    P    +F   P       RR FC+ V  +  SGE   
Sbjct  12    RLTPFSTLRFSSFFH-ISKPLFRPLRRPFFEGFPAN---ARRRCFCTAVSESTGSGEGKK  67

Query  293   VQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQS  472
             V       FG+K       +GEFRR+L+IA++KGG D+GL R+G++L + GWVRTLR+QS
Sbjct  68    VDNSYENRFGSK-------VGEFRRKLKIAEVKGGADQGLGRVGQSLSIMGWVRTLRSQS  120

Query  473   SVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElk  652
             SVTFIE+NDGSCLSN+QCVM+ DAEGY QVE+G ++TGAS+ +QGTI +SQG+KQK+ELK
Sbjct  121   SVTFIEINDGSCLSNLQCVMNPDAEGYHQVESGSVLTGASISVQGTIVASQGTKQKVELK  180

Query  653   vvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQEN  832
             V K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQE+
Sbjct  181   VDKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQES  240

Query  833   GFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKP  1012
             GFVWV+SPI+TASDCEGAGEQFCVTTLIP+S E T+S ++ IPKT+ G VDWSQDFFGKP
Sbjct  241   GFVWVASPIITASDCEGAGEQFCVTTLIPSSHETTDSSIDAIPKTKGGLVDWSQDFFGKP  300

Query  1013  AFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSC  1192
             AFLTVSGQLN ETYATAL+DVY FGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+C
Sbjct  301   AFLTVSGQLNGETYATALSDVYMFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMAC  360

Query  1193  AAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkk  1372
             A AYLQYVV+Y+LDNCKEDMEFF+TWI+KGII RLS+VVEK+ +QL YTDAIELLLK  K
Sbjct  361   ATAYLQYVVKYVLDNCKEDMEFFDTWIDKGIIHRLSEVVEKEFLQLGYTDAIELLLKANK  420

Query  1373  kFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLV  1552
             KFEFPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLV
Sbjct  421   KFEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLV  480

Query  1553  PRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF  1732
             PR+GELIGGSQREERLE LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQF
Sbjct  481   PRIGELIGGSQREERLEVLEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLGFERLVQF  540

Query  1733  ATGIDNIRDAIPFPRTPGS  1789
             ATGIDNIRD IPFPR+PGS
Sbjct  541   ATGIDNIRDVIPFPRSPGS  559



>ref|XP_009144600.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Brassica rapa]
Length=563

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/481 (84%), Positives = 448/481 (93%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++LRIA++KGG DEGL R+G++L V GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  80    KVGEFRKKLRIAEVKGGEDEGLGRVGQSLSVMGWVRTLRSQSSVTFIEINDGSCLSNLQC  139

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ +AEGYDQVE G ++TGASV +QGTI +SQGSKQK+ELKV K++LVGK D S+PIQK
Sbjct  140   VMNPEAEGYDQVEAGSVLTGASVSVQGTIVASQGSKQKVELKVHKIILVGKCDSSYPIQK  199

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  200   KRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  259

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E TN+ ++ IPKT+ G VDWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  260   GEQFCVTTLIPSSHETTNTSIDAIPKTKGGLVDWSQDFFGKPAFLTVSGQLNGETYATAL  319

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+ +LDNCKE
Sbjct  320   SDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKCVLDNCKE  379

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWIEKGII RLSDVVEK+ +QL+YTDAIELLLK  KKFEFPV WG DLQSEHER
Sbjct  380   DMEFFDTWIEKGIIHRLSDVVEKEFLQLSYTDAIELLLKANKKFEFPVKWGLDLQSEHER  439

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERL+ 
Sbjct  440   YITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERLQV  499

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRD IPFPR+PG
Sbjct  500   LEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDVIPFPRSPG  559

Query  1787  S  1789
             S
Sbjct  560   S  560



>ref|XP_008238532.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Prunus mume]
Length=577

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/497 (82%), Positives = 453/497 (91%), Gaps = 11/497 (2%)
 Frame = +2

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
             RP SG+          ++GEFR++L++ DIKGGPDEGL+RLG++LVV GWVRTLR QSSV
Sbjct  89    RPESGN---------NRVGEFRKKLKVVDIKGGPDEGLERLGQSLVVMGWVRTLRVQSSV  139

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TFIEVNDGSCLSNMQCV+  DAEGYDQVE+GLI TGAS+W+QG +A+SQGSKQK+ELKV 
Sbjct  140   TFIEVNDGSCLSNMQCVLGLDAEGYDQVESGLITTGASIWVQGILAASQGSKQKVELKVK  199

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+V+V     S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF
Sbjct  200   KIVVVXXX--SYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGF  257

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTLIP+++E ++SPV+ IP+ + G VDWSQDFFGKPAF
Sbjct  258   VWVSSPIITASDCEGAGEQFCVTTLIPSTREASHSPVDGIPRLKDGLVDWSQDFFGKPAF  317

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA 
Sbjct  318   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACAT  377

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+++L+NCKEDMEFFNTWIEKGII RL+DV +K  VQLTYTDA+ELLL+  KKF
Sbjct  378   AYLQYVVRHVLENCKEDMEFFNTWIEKGIIDRLNDVADKDFVQLTYTDAVELLLRANKKF  437

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             EFPV WGCDLQSEHERY+TEEAF GCPVI+RDYPKDIKAFYMR NDDGKTVAAMDMLVPR
Sbjct  438   EFPVKWGCDLQSEHERYLTEEAFSGCPVIVRDYPKDIKAFYMRRNDDGKTVAAMDMLVPR  497

Query  1559  VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  1738
             VGELIGGSQREERLEYLE+RLD+  LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFAT
Sbjct  498   VGELIGGSQREERLEYLEERLDESKLNKDNYWWYLDLRRYGSVPHAGFGLGFERLVQFAT  557

Query  1739  GIDNIRDAIPFPRTPGS  1789
             GI+NIRD IPFPR PGS
Sbjct  558   GIENIRDVIPFPRAPGS  574



>ref|XP_006414245.1| hypothetical protein EUTSA_v10024799mg [Eutrema salsugineum]
 gb|ESQ55698.1| hypothetical protein EUTSA_v10024799mg [Eutrema salsugineum]
Length=564

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/566 (73%), Positives = 477/566 (84%), Gaps = 25/566 (4%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVC--LRRsfcsvvcsavssG--  286
             RL  +S +R LS                +F    P+HS+   LRR    ++ +    G  
Sbjct  12    RLTQYSTLRFLS----------------FFSISKPSHSLFRPLRRPVLPLLDANARRGCF  55

Query  287   -EAVQRPLSGDFGTK-EVEESR---KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWV  451
               AV   L    G K E  E R   K+GEFRR+L+IA++KGG D+GL R+GE+L + GWV
Sbjct  56    CTAVSESLGSGEGKKVESYEKRFGSKVGEFRRKLKIAEVKGGEDQGLGRVGESLSIVGWV  115

Query  452   RTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGS  631
             RTLR+QSSVTFIE+NDGSCLSN+QCV++ D +GYDQVE+G I+TGAS+ +QGT+ +SQG+
Sbjct  116   RTLRSQSSVTFIEINDGSCLSNLQCVLNSDVDGYDQVESGSILTGASISVQGTLVASQGT  175

Query  632   KQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFAT  811
             KQK+ELKV K+++VGK D S+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+AT
Sbjct  176   KQKVELKVEKIIVVGKCDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYAT  235

Query  812   HKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWS  991
             HKFFQE GF+WV+SPI+TA+DCEGAGEQFCVTTLIP+S + T+S ++ IPKT+ G +DWS
Sbjct  236   HKFFQERGFIWVASPIITAADCEGAGEQFCVTTLIPSSHKTTDSSIDAIPKTKGGLIDWS  295

Query  992   QDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  1171
             QDFFGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD
Sbjct  296   QDFFGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  355

Query  1172  LEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIE  1351
             L+DDM+CA AYLQYVV+Y+LD+CKEDMEFF+TWIEKGII+RLSDVVEK  +QL YTDAIE
Sbjct  356   LDDDMACATAYLQYVVKYVLDHCKEDMEFFDTWIEKGIIQRLSDVVEKDFLQLGYTDAIE  415

Query  1352  lllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTV  1531
             LLLK  + FEFPV WG DLQSEHERYITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTV
Sbjct  416   LLLKANRNFEFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTV  475

Query  1532  AAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLG  1711
             AAMDMLVPR+GELIGGSQREER++ LE RLD+L L+KESYWWYLDLRRYGSVPHAGFGLG
Sbjct  476   AAMDMLVPRIGELIGGSQREERIDVLEARLDELKLDKESYWWYLDLRRYGSVPHAGFGLG  535

Query  1712  FERLVQFATGIDNIRDAIPFPRTPGS  1789
             FERLVQFATGIDNIRD IPFPR+PGS
Sbjct  536   FERLVQFATGIDNIRDVIPFPRSPGS  561



>ref|XP_006826798.1| hypothetical protein AMTR_s00010p00025770 [Amborella trichopoda]
 gb|ERM94035.1| hypothetical protein AMTR_s00010p00025770 [Amborella trichopoda]
Length=604

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/495 (81%), Positives = 449/495 (91%), Gaps = 1/495 (0%)
 Frame = +2

Query  308   SGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFI  487
             +G+   K  E   K+ EFR+RL+IA+IKGG DEGLDRLG+ LVVRGWVRT R QSS+TFI
Sbjct  107   TGELALKMSESGEKVREFRKRLKIAEIKGGHDEGLDRLGQNLVVRGWVRTCRVQSSITFI  166

Query  488   EVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklv  667
             EVNDGSCLSNMQCVM+ DAEGYDQV +G + TGASV I+G +  SQGSKQK+EL++ KL+
Sbjct  167   EVNDGSCLSNMQCVMNDDAEGYDQVLSGSVNTGASVCIEGILVKSQGSKQKVELQIEKLI  226

Query  668   lvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVW  844
             +VG+ DP SFPIQKKR S+E+LRT AHLRPRTNTFGAV RVRNALA+ATHKFFQENGFVW
Sbjct  227   IVGQCDPISFPIQKKRASKEYLRTIAHLRPRTNTFGAVMRVRNALAYATHKFFQENGFVW  286

Query  845   VSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLT  1024
             ++SPI+TASDCEGAGEQFCVTTL P+S+E  NS V++IP T+ G VDWSQDFFG+PAFLT
Sbjct  287   IASPIITASDCEGAGEQFCVTTLFPSSREGHNSGVSDIPSTKDGLVDWSQDFFGRPAFLT  346

Query  1025  VSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAY  1204
             VSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA A+
Sbjct  347   VSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAF  406

Query  1205  LQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEF  1384
             LQYVV+Y+L+NCKEDM+FFNTWIEKGII+RLSDV E+  VQLTYTDAIELLL+  KKFEF
Sbjct  407   LQYVVRYVLENCKEDMDFFNTWIEKGIIRRLSDVAERDFVQLTYTDAIELLLRANKKFEF  466

Query  1385  PVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVG  1564
             PV WGCDLQSEHERYITE+A GG PVIIRDYPKDIKAFYMRENDDGKTVAAMD+LVPRVG
Sbjct  467   PVKWGCDLQSEHERYITEDAVGGSPVIIRDYPKDIKAFYMRENDDGKTVAAMDLLVPRVG  526

Query  1565  ELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGI  1744
             ELIGGSQREERLE+LE RL +L LNKE+YWWYLDLRR+GSVPHAGFGLGFERLVQFATGI
Sbjct  527   ELIGGSQREERLEFLENRLHELELNKETYWWYLDLRRFGSVPHAGFGLGFERLVQFATGI  586

Query  1745  DNIRDAIPFPRTPGS  1789
             DNIRDAIPFPR+PGS
Sbjct  587   DNIRDAIPFPRSPGS  601



>ref|XP_010449638.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=567

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/481 (82%), Positives = 446/481 (93%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+IA++KGG DEGL R+G++L + GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  84    KVGEFRKKLKIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCLSNLQC  143

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV K+++VGK D S+PIQK
Sbjct  144   VLNSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVEKIIVVGKCDSSYPIQK  203

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  204   KRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  263

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  264   GEQFCVTTLIPSSHENTDTSIDAIPKTKGGLIDWSQDFFGKPAFLTVSGQLNGETYATAL  323

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+Y+LD+CKE
Sbjct  324   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDHCKE  383

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIELLLK  KKF+FPV WG DLQSEHER
Sbjct  384   DMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIELLLKANKKFDFPVKWGLDLQSEHER  443

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPR+GELIGGSQREERLE 
Sbjct  444   YITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGELIGGSQREERLEV  503

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF TGIDNIRD IPFPR P 
Sbjct  504   LEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFPRAPA  563

Query  1787  S  1789
             S
Sbjct  564   S  564



>ref|XP_010434685.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=567

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/481 (82%), Positives = 445/481 (93%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+IA++KGG DEGL R+G++L + GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  84    KVGEFRKKLKIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCLSNLQC  143

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV K+++VGK D S+PIQK
Sbjct  144   VLNSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVKKIIVVGKCDSSYPIQK  203

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  204   KRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  263

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFF KPAFLTVSGQLN ETYATAL
Sbjct  264   GEQFCVTTLIPSSHENTDTSIDAIPKTKGGLIDWSQDFFEKPAFLTVSGQLNGETYATAL  323

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+Y+LDNCKE
Sbjct  324   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKE  383

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIELLLK  KKF+FPV WG DLQSEHER
Sbjct  384   DMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIELLLKANKKFDFPVKWGLDLQSEHER  443

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPR+GELIGGSQREERLE 
Sbjct  444   YITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGELIGGSQREERLEV  503

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF TGIDNIRD IPFPR P 
Sbjct  504   LEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFPRAPA  563

Query  1787  S  1789
             S
Sbjct  564   S  564



>ref|XP_004508904.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=551

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/485 (81%), Positives = 444/485 (92%), Gaps = 3/485 (1%)
 Frame = +2

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             + + K+ +FR++L++AD+KG   + LD +G TLV+ GWVRTLR QSSVTF+E+NDGSCLS
Sbjct  67    DTANKVSQFRKKLKVADVKG---DQLDVIGHTLVITGWVRTLRLQSSVTFLEINDGSCLS  123

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSF  694
             NMQCV+  + EGYDQVE+G I TGASVW+QG + +SQG+KQK+ELKV K+VLVGKSDPSF
Sbjct  124   NMQCVLDSEVEGYDQVESGFITTGASVWVQGVLVNSQGTKQKVELKVNKIVLVGKSDPSF  183

Query  695   PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASD  874
             PIQKKRVSREFLRTKAHLRPRTNTF AVARVRNALA+ATHKFFQENGF+WVSSPI+TASD
Sbjct  184   PIQKKRVSREFLRTKAHLRPRTNTFSAVARVRNALAYATHKFFQENGFIWVSSPIITASD  243

Query  875   CEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETY  1054
             CEGAGEQFCVTTLIPNS E ++SPV+ IPK     +DWSQDFFGKPAFLTVSGQLNAETY
Sbjct  244   CEGAGEQFCVTTLIPNSHETSDSPVDAIPKVNDRLIDWSQDFFGKPAFLTVSGQLNAETY  303

Query  1055  ATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILD  1234
             ATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V+++ILD
Sbjct  304   ATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHILD  363

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDMEFFNTWI+KGII RLSDV EK V+Q+TYT+A++LL +  KKFEFPV WGCDLQS
Sbjct  364   NCKEDMEFFNTWIDKGIIDRLSDVAEKDVLQITYTEAVDLLSRANKKFEFPVKWGCDLQS  423

Query  1415  EHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQree  1594
             EHERYITE AFGGCPVIIRDYPKDIKAFYMR+NDDG+TVAAMDMLVP++GELIGGSQREE
Sbjct  424   EHERYITEVAFGGCPVIIRDYPKDIKAFYMRQNDDGRTVAAMDMLVPKIGELIGGSQREE  483

Query  1595  rleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP  1774
             RLE+LE RLDDL LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFP
Sbjct  484   RLEHLEARLDDLKLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFP  543

Query  1775  RTPGS  1789
             RTPGS
Sbjct  544   RTPGS  548



>ref|XP_010440027.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=567

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/481 (82%), Positives = 446/481 (93%), Gaps = 0/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+IA++KGG DEGL R+G++L + GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  84    KVGEFRKKLKIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSVTFIEMNDGSCLSNLQC  143

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV K+++VGK D S+PIQK
Sbjct  144   VLNSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVEKIIVVGKCDASYPIQK  203

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  204   KRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  263

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E T++ ++ IPKT+ G +DWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  264   GEQFCVTTLIPSSHENTDTSIDAIPKTKGGLIDWSQDFFGKPAFLTVSGQLNGETYATAL  323

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+Y+L+NCKE
Sbjct  324   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLNNCKE  383

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIELLLK  KKF+FPV WG DLQSEHER
Sbjct  384   DMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIELLLKANKKFDFPVKWGLDLQSEHER  443

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE+AFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPR+GELIGGSQREERL+ 
Sbjct  444   YITEDAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGELIGGSQREERLDV  503

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF TGIDNIRD IPFPR P 
Sbjct  504   LEARLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFPRAPA  563

Query  1787  S  1789
             S
Sbjct  564   S  564



>gb|AES90907.2| asparagine-tRNA ligase [Medicago truncatula]
Length=546

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/485 (81%), Positives = 444/485 (92%), Gaps = 4/485 (1%)
 Frame = +2

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             + + K+ +FR++L+++D+K G     D LG TLV++GWVRTLR QSSVTF+E+NDGSCLS
Sbjct  63    DATNKVPQFRKKLKVSDVKDGQ---FDSLGNTLVLQGWVRTLRLQSSVTFLEINDGSCLS  119

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSF  694
             NMQCV+  + EGYDQVE+GLI TGASVW+QG +  SQG+KQK+ELK+ K+VLVGKSDPSF
Sbjct  120   NMQCVLDTEVEGYDQVESGLITTGASVWVQGIVVKSQGTKQKVELKLNKIVLVGKSDPSF  179

Query  695   PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASD  874
             PIQKKRVSREFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASD
Sbjct  180   PIQKKRVSREFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASD  239

Query  875   CEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETY  1054
             CEGAGEQFCVTTLIPNS E  +SPV+ IPK +   +DWSQDFFGKPAFLTVSGQLNAETY
Sbjct  240   CEGAGEQFCVTTLIPNSHETADSPVDAIPKNDK-LIDWSQDFFGKPAFLTVSGQLNAETY  298

Query  1055  ATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILD  1234
             ATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V+++ILD
Sbjct  299   ATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHILD  358

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDMEFFNTWI+KGII RLSDV EK V+Q+TYT+A++LL +  KKFEFPV WGCDLQS
Sbjct  359   NCKEDMEFFNTWIDKGIIDRLSDVAEKDVLQITYTEAVDLLSRANKKFEFPVKWGCDLQS  418

Query  1415  EHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQree  1594
             EHERYITEEAFGGCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVP++GELIGGSQREE
Sbjct  419   EHERYITEEAFGGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVPKIGELIGGSQREE  478

Query  1595  rleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP  1774
             RLE+LE RLDDL LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFP
Sbjct  479   RLEHLEARLDDLKLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFP  538

Query  1775  RTPGS  1789
             RTPGS
Sbjct  539   RTPGS  543



>ref|XP_007155659.1| hypothetical protein PHAVU_003G220700g [Phaseolus vulgaris]
 gb|ESW27653.1| hypothetical protein PHAVU_003G220700g [Phaseolus vulgaris]
Length=547

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/481 (81%), Positives = 442/481 (92%), Gaps = 2/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             ++ +FR++LR+++IK G  +G + LG  LVV+GWVRTLR QSSVTFIE+NDGSCLSNMQC
Sbjct  66    RVEQFRKKLRVSEIKEG--DGANVLGRDLVVQGWVRTLRLQSSVTFIEINDGSCLSNMQC  123

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ +AEGYDQVE+GL+ TGASVW+QG +  SQGSKQK+ELKV K+VL GKSDPSFPIQK
Sbjct  124   VLNSEAEGYDQVESGLVTTGASVWVQGVVVKSQGSKQKVELKVNKIVLTGKSDPSFPIQK  183

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR S+EFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVW+SSPI+TASDCEGA
Sbjct  184   KRASKEFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWISSPIITASDCEGA  243

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S++ T+SPV+ IPK     +DWSQDFFGKPAFLTVSGQLNAETYATAL
Sbjct  244   GEQFCVTTLIPSSQDTTDSPVDAIPKKNDRLIDWSQDFFGKPAFLTVSGQLNAETYATAL  303

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA+AYLQ+V++Y+LDNCKE
Sbjct  304   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACASAYLQFVIKYVLDNCKE  363

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFFNTWI KGI+ RLSDV +K VVQ+TYT+AI+LL  + KKFEFPV WGCDLQSEHER
Sbjct  364   DMEFFNTWINKGIVDRLSDVADKDVVQITYTEAIDLLSGSNKKFEFPVKWGCDLQSEHER  423

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAF GCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVP +GELIGGSQREERLEY
Sbjct  424   YITEEAFNGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVPGIGELIGGSQREERLEY  483

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPRTPG
Sbjct  484   LEARLDELKLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFPRTPG  543

Query  1787  S  1789
             S
Sbjct  544   S  544



>ref|XP_010933671.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Elaeis guineensis]
Length=593

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/546 (75%), Positives = 464/546 (85%), Gaps = 22/546 (4%)
 Frame = +2

Query  155   LYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQRPLSGDFGTKEV  334
             L+H+    A  P+S     P P     C R        +  +  +A ++P +        
Sbjct  66    LFHRPLVLAPSPDS-----PAPRWRLFCSR--------TLPADAKACEKPAA--------  104

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             E  +KI EFR+RLRI D+KGGPDEG+DRLG+ L +RGWVRT R QSSVTFIEVNDGSCLS
Sbjct  105   EAGKKIREFRKRLRIVDVKGGPDEGMDRLGQALAIRGWVRTCRVQSSVTFIEVNDGSCLS  164

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-  691
             N+QCVM+ DAEGYDQVE+G + TGASV ++G + SSQGSKQK+ELKV +LV +GKSDP+ 
Sbjct  165   NLQCVMNIDAEGYDQVESGAVTTGASVLVEGIVVSSQGSKQKVELKVARLVTIGKSDPTT  224

Query  692   FPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTAS  871
             +PIQKKR +REFLR+ AHLRPRTNTFGAV RVRNALA+ATHKFFQENGFVW+SSPI+TAS
Sbjct  225   YPIQKKRATREFLRSIAHLRPRTNTFGAVTRVRNALAYATHKFFQENGFVWISSPIITAS  284

Query  872   DCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAET  1051
             DCEGAGEQFCVTTLIPN++E T+S VN IP ++ G +DWSQDFFG+PAFLTVSGQLNAET
Sbjct  285   DCEGAGEQFCVTTLIPNTREGTDSLVNTIPTSKDGKIDWSQDFFGRPAFLTVSGQLNAET  344

Query  1052  YATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYIL  1231
             YA+AL DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL
Sbjct  345   YASALCDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYIL  404

Query  1232  DNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQ  1411
             +NCKEDM+FFNTWIEKGII RL+DVVEK  VQLTY+DA+ELLL  K+KFEFPV WG DLQ
Sbjct  405   ENCKEDMDFFNTWIEKGIINRLNDVVEKDFVQLTYSDAVELLLGAKRKFEFPVKWGLDLQ  464

Query  1412  SEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQre  1591
             SEHERYITE AF G PVII DYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQRE
Sbjct  465   SEHERYITEIAFAGRPVIISDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQRE  524

Query  1592  erleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPF  1771
             ERLEYL  RL++LNLNK+SYWWYLDLRR+GSVPHAGFGLGFERLVQFATGI+NIRDAIPF
Sbjct  525   ERLEYLGSRLEELNLNKDSYWWYLDLRRFGSVPHAGFGLGFERLVQFATGIENIRDAIPF  584

Query  1772  PRTPGS  1789
             PRTPGS
Sbjct  585   PRTPGS  590



>emb|CDY35583.1| BnaC01g21050D [Brassica napus]
Length=560

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/483 (82%), Positives = 443/483 (92%), Gaps = 2/483 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFRR+LR+A++KGG DEGL R+G++L V GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  75    KVGEFRRKLRVAEVKGGADEGLGRVGQSLSVMGWVRTLRSQSSVTFIEINDGSCLSNLQC  134

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQVE G ++TGASV +QGTI +SQG+KQK+ELKV K++LVGK D S+PIQK
Sbjct  135   VMNPDAEGYDQVEAGSVLTGASVSVQGTIVASQGTKQKVELKVHKIILVGKCDSSYPIQK  194

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTN+FGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  195   KRVSREFLRTKAHLRPRTNSFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  254

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVT LIP+S E T+SP++ IPKT+ G VDWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  255   GEQFCVTILIPSSHETTDSPIDAIPKTKGGLVDWSQDFFGKPAFLTVSGQLNGETYATAL  314

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYV--VQYILDNC  1240
             +D+YTFGPTFRAENSNTSRHLAEFWM+EPELAFADL+DDM+CA AYL     V+Y+LDNC
Sbjct  315   SDIYTFGPTFRAENSNTSRHLAEFWMLEPELAFADLDDDMACATAYLSSTSYVKYVLDNC  374

Query  1241  KEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEH  1420
             KEDMEFF+TWIEKGI  RLSDVVEK+ +QL+YTDAIELLLK  K+FEFPV WG DLQSEH
Sbjct  375   KEDMEFFDTWIEKGITHRLSDVVEKEFLQLSYTDAIELLLKANKEFEFPVKWGLDLQSEH  434

Query  1421  ERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerl  1600
             ERYITEEAF G PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERL
Sbjct  435   ERYITEEAFEGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERL  494

Query  1601  eylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRT  1780
             E LE RLD L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRD IPFPR+
Sbjct  495   EVLEARLDGLKLDKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDVIPFPRS  554

Query  1781  PGS  1789
             PGS
Sbjct  555   PGS  557



>ref|XP_009388048.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=583

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/486 (82%), Positives = 445/486 (92%), Gaps = 2/486 (0%)
 Frame = +2

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             E   K+ EFR+RLRIAD+KGGPDEG+DRLGE LVVRGW+RT R QS+VTFIE+NDGSCLS
Sbjct  96    EAGEKVREFRKRLRIADVKGGPDEGMDRLGEVLVVRGWIRTCRVQSTVTFIEINDGSCLS  155

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-  691
             NMQCVMS DAEGYD VE+G I TG SV I+GT+ SSQGSKQK+ELKV +L+L+GKSDPS 
Sbjct  156   NMQCVMSSDAEGYDLVESGFITTGTSVLIEGTVVSSQGSKQKVELKVARLILIGKSDPSA  215

Query  692   FPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTAS  871
             +PIQKKR +REFLR  AHLRPRTNTFGAV RVRNALA+ATHKFFQENGFVW+SSPI+TAS
Sbjct  216   YPIQKKRATREFLRAIAHLRPRTNTFGAVTRVRNALAYATHKFFQENGFVWISSPIITAS  275

Query  872   DCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAET  1051
             DCEGAGEQFCVTTLI N+ E ++ P+N IP T  G+VDWSQDFFGKPAFLTVSGQLNAET
Sbjct  276   DCEGAGEQFCVTTLISNAGE-SDCPLNSIPTTTEGNVDWSQDFFGKPAFLTVSGQLNAET  334

Query  1052  YATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYIL  1231
             YA+AL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL
Sbjct  335   YASALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYIL  394

Query  1232  DNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQ  1411
             +NCKEDM+FFNTWIEKGII RL DVV+K  +QLTY+DA+ LLLK+KKKFEFPV WG DLQ
Sbjct  395   ENCKEDMDFFNTWIEKGIINRLKDVVKKDFIQLTYSDAVGLLLKSKKKFEFPVKWGLDLQ  454

Query  1412  SEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQre  1591
             SEHERYITE AFGG PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQRE
Sbjct  455   SEHERYITEIAFGGRPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQRE  514

Query  1592  erleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPF  1771
             ERL+YLE RLD+L L+K+SYWWYLDLRR+GSVPHAGFGLGFERLVQFATGI+NIRDAIPF
Sbjct  515   ERLDYLESRLDELKLSKDSYWWYLDLRRFGSVPHAGFGLGFERLVQFATGIENIRDAIPF  574

Query  1772  PRTPGS  1789
             PR+PGS
Sbjct  575   PRSPGS  580



>ref|XP_009348577.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=545

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/566 (74%), Positives = 469/566 (83%), Gaps = 44/566 (8%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNS-YLYFLPK-PPTHSVCLRRsfcsvvcsavssGEA  292
             R  P+S +RLLS Y +T      P   +  FLP+     +V  RRSFC+++ +A+ SG A
Sbjct  12    RFNPYSTLRLLSFYPRTPLPCRTPTPIFPPFLPRLSRAAAVPRRRSFCTLISAALHSGGA  71

Query  293   VQRPLSGDFGTKEVEESRK-------IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWV  451
              +R         E+ E R+       +GEFR++L++ D+KGG DEGL+RLG++LVV GWV
Sbjct  72    AERT------KPEIAEERRSEGGNNRVGEFRKKLKVVDVKGGSDEGLERLGQSLVVMGWV  125

Query  452   RTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGS  631
             RTLR QSSVTFIEVNDGSCLSNMQCV+  DAEGYDQVE+G I TGAS+W+QG I++SQGS
Sbjct  126   RTLRVQSSVTFIEVNDGSCLSNMQCVLGSDAEGYDQVESGSITTGASIWVQGIISASQGS  185

Query  632   KQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFAT  811
             KQK+ELKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+AT
Sbjct  186   KQKVELKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYAT  245

Query  812   HKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWS  991
             HKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP+S+E ++SPV+ IPK++ G VDWS
Sbjct  246   HKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPSSREASHSPVDGIPKSKDGLVDWS  305

Query  992   QDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  1171
             QDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD
Sbjct  306   QDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFAD  365

Query  1172  LEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIE  1351
             L DDM+CA+AYLQYVV++IL+NCKEDMEFFNTWIEKGII RLS                 
Sbjct  366   LNDDMACASAYLQYVVRHILENCKEDMEFFNTWIEKGIIGRLS-----------------  408

Query  1352  lllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTV  1531
                         V WGCDLQSEHERY+TEEAF GCPVI+RDYPK+IKAFYMR+NDDGKTV
Sbjct  409   ------------VKWGCDLQSEHERYLTEEAFRGCPVIVRDYPKEIKAFYMRQNDDGKTV  456

Query  1532  AAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLG  1711
             AAMDMLVPRVGELIGGSQREERLEYLE RLD+L L KESYWWYLDLRRYGSVPHAGFGLG
Sbjct  457   AAMDMLVPRVGELIGGSQREERLEYLEDRLDELKLEKESYWWYLDLRRYGSVPHAGFGLG  516

Query  1712  FERLVQFATGIDNIRDAIPFPRTPGS  1789
             FERLVQFATGIDNIRD IPFPR PGS
Sbjct  517   FERLVQFATGIDNIRDTIPFPRAPGS  542



>ref|XP_003525844.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Glycine max]
 gb|KHN44069.1| Asparagine--tRNA ligase, chloroplastic/mitochondrial [Glycine 
soja]
Length=551

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/481 (81%), Positives = 438/481 (91%), Gaps = 2/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             ++ +FRR+LR+++IK G  +G D  G  LVV+GWVRTLR QS VTF+E+NDGSCLSNMQC
Sbjct  70    RVQQFRRKLRVSEIKEG--DGADVFGRNLVVQGWVRTLRIQSIVTFLEINDGSCLSNMQC  127

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ +AEGYDQVE+GL+ TGASVW+QG +  SQGSKQK+ELKV K+VL+GKSDPSFPIQK
Sbjct  128   VLNSEAEGYDQVESGLVTTGASVWVQGVVVKSQGSKQKVELKVNKIVLIGKSDPSFPIQK  187

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASDCEGA
Sbjct  188   KRASREFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASDCEGA  247

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E T+SPV+ IPKT  G +DWSQDFFGKPAFLTVSGQLN ETYAT+L
Sbjct  248   GEQFCVTTLIPSSHETTDSPVDAIPKTNDGLIDWSQDFFGKPAFLTVSGQLNGETYATSL  307

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V++++LDNCKE
Sbjct  308   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHVLDNCKE  367

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWI KGII RLSDV +K VVQ+TYT+AI+LL    KKFEFPV WG DLQSEHER
Sbjct  368   DMEFFDTWINKGIIDRLSDVADKDVVQITYTEAIDLLSGANKKFEFPVKWGSDLQSEHER  427

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEEAF GCPVIIRDYPKDIKAFYMR+NDDG+TVAAMDMLVP +GELIGGSQREERLEY
Sbjct  428   YITEEAFSGCPVIIRDYPKDIKAFYMRQNDDGRTVAAMDMLVPGIGELIGGSQREERLEY  487

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLDDL LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPRTPG
Sbjct  488   LEARLDDLKLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFPRTPG  547

Query  1787  S  1789
             S
Sbjct  548   S  548



>gb|EPS73970.1| hypothetical protein M569_00785, partial [Genlisea aurea]
Length=554

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/558 (74%), Positives = 463/558 (83%), Gaps = 21/558 (4%)
 Frame = +2

Query  119   RLKPF-SAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAV  295
             RLKPF  A  LLSL++++T     P              + L  S  +V  S       V
Sbjct  14    RLKPFIGAASLLSLFNRSTLIRTSP--------------ILLHFSCTAVSTSPSRFCSVV  59

Query  296   QRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSS  475
                +     T EV+   ++ +FR++LRI D KGGPD+GL+RLGETL V GWVRT R QS+
Sbjct  60    SAAVPARAETSEVKYGAEVRQFRKKLRIVDAKGGPDQGLNRLGETLSVSGWVRTFRVQST  119

Query  476   VTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkv  655
             VTFIE+NDGSCLSNMQCVM+ DA+GYDQVE+GLI TGASV +QG+I +SQGSKQK+ELKV
Sbjct  120   VTFIEINDGSCLSNMQCVMTSDADGYDQVESGLISTGASVSVQGSIVASQGSKQKVELKV  179

Query  656   vklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENG  835
              KLV++GKSDPSFPIQKKRVSREFLRTKAHLRPRTN FGAV+RVRNALA+ATHKFFQENG
Sbjct  180   EKLVMIGKSDPSFPIQKKRVSREFLRTKAHLRPRTNCFGAVSRVRNALAYATHKFFQENG  239

Query  836   FVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPA  1015
             FVWVSSPI+TASDCEGAGEQFCVTTLIP+S +  +S    IP T+ G +DWSQDFFGKPA
Sbjct  240   FVWVSSPIITASDCEGAGEQFCVTTLIPSSGDAADSSPKSIPVTQDGLIDWSQDFFGKPA  299

Query  1016  FLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCA  1195
             FLTVSGQLNAETYA+AL DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDM+CA
Sbjct  300   FLTVSGQLNAETYASALTDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMACA  359

Query  1196  AAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkk  1375
              AYLQYVV++IL+NCKEDMEFF+ WIEKGII RL+DV EK  VQLTYTDAIELL K  KK
Sbjct  360   TAYLQYVVKHILENCKEDMEFFDAWIEKGIIARLNDVAEKNPVQLTYTDAIELLSKANKK  419

Query  1376  FEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVP  1555
             FEFP+ WGCDLQSEHERYITEEAF G PVI       IKAFYMRENDDG+TVAAMDMLVP
Sbjct  420   FEFPIAWGCDLQSEHERYITEEAFSGRPVIA------IKAFYMRENDDGRTVAAMDMLVP  473

Query  1556  RVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFA  1735
             RVGELIGGSQREERLE LE+RLDD+NL+K+ YWWYLDLRRYGSVPHAGFGLGFERLVQF 
Sbjct  474   RVGELIGGSQREERLERLERRLDDMNLDKDGYWWYLDLRRYGSVPHAGFGLGFERLVQFV  533

Query  1736  TGIDNIRDAIPFPRTPGS  1789
             TG++NIRDAIPFPR+PGS
Sbjct  534   TGMENIRDAIPFPRSPGS  551



>ref|XP_003550908.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Glycine max]
Length=550

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/481 (81%), Positives = 437/481 (91%), Gaps = 2/481 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             ++ +FRR+LR+++IK G  +G D LG  LVV+GWVRTLR QSSVTF+E+NDGSCLSNMQC
Sbjct  69    RVQQFRRKLRVSEIKEG--DGADVLGRNLVVQGWVRTLRIQSSVTFLEINDGSCLSNMQC  126

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ +AEGYDQVE+GL+ TGASVW+QG +  SQGSKQK+ELKV K+VL+GKSDPSFPIQK
Sbjct  127   VLNSEAEGYDQVESGLVTTGASVWVQGVVVKSQGSKQKVELKVNKIVLIGKSDPSFPIQK  186

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASDCEGA
Sbjct  187   KRASREFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASDCEGA  246

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E  +SPV+ IPKT  G +DWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  247   GEQFCVTTLIPSSHETNDSPVDAIPKTNDGLIDWSQDFFGKPAFLTVSGQLNGETYATAL  306

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V++++LDNCKE
Sbjct  307   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHVLDNCKE  366

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+ WI KGII RLSDV +K VVQ+TYT+AI+LL    KKFEFPV WG DLQSEHER
Sbjct  367   DMEFFDAWINKGIIDRLSDVADKDVVQITYTEAIDLLSGANKKFEFPVKWGSDLQSEHER  426

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITEE F GCPVIIRDYPKDIKAFYMR+NDDG+TVAAMDMLVP +GELIGGSQREERLEY
Sbjct  427   YITEEVFSGCPVIIRDYPKDIKAFYMRQNDDGRTVAAMDMLVPGIGELIGGSQREERLEY  486

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLDDL LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPRTPG
Sbjct  487   LEARLDDLKLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFPRTPG  546

Query  1787  S  1789
             S
Sbjct  547   S  547



>ref|XP_008373763.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Malus domestica]
Length=545

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/570 (73%), Positives = 468/570 (82%), Gaps = 52/570 (9%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKT-----TKTAAVPNSYLYFLPK-PPTHSVCLRRsfcsvvcsavs  280
             R  P+  +RLLS Y +T     T T   P     FLP+     +V  RRSFC+++ +A+ 
Sbjct  12    RFNPYXTLRLLSFYXRTPLPRRTXTPIFPP----FLPRLSRAAAVPRRRSFCTLISAALH  67

Query  281   sGEAVQRPLSGDFGTKEVEESRK-------IGEFRRRLRIADIKGGPDEGLDRLGETLVV  439
             SG A +R         E+ E R+       +GEFR++L++ D+KGG DEGL+RLG++LVV
Sbjct  68    SGGAAERT------KPEIAEDRRSEGGNNRVGEFRKKLKVVDVKGGSDEGLERLGQSLVV  121

Query  440   RGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIAS  619
              GWVRTLR QSSVTFIEVNDGSCLSNMQCV+  DAEGYDQVE+G I TGAS+W+QG I++
Sbjct  122   MGWVRTLRVQSSVTFIEVNDGSCLSNMQCVLGSDAEGYDQVESGSITTGASIWVQGIISA  181

Query  620   SQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNAL  799
             SQGSKQK+ELKV K+VLVGKSDPS+PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNAL
Sbjct  182   SQGSKQKVELKVNKIVLVGKSDPSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNAL  241

Query  800   AFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGS  979
             A+ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP+S+E ++SPV+ IPK+  G 
Sbjct  242   AYATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTTLIPSSREASHSPVDGIPKSXDGL  301

Query  980   VDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPEL  1159
             VDWSQDFFGKPAFLTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPEL
Sbjct  302   VDWSQDFFGKPAFLTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPEL  361

Query  1160  AFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYT  1339
             AFADL DDM+CA+AYLQYVV++IL+NCKEDMEFFNTWIEKGII RLS             
Sbjct  362   AFADLNDDMACASAYLQYVVRHILENCKEDMEFFNTWIEKGIIGRLS-------------  408

Query  1340  DAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDD  1519
                             V WGCDLQSEHERY+TEEAF GCPVI+RDYPK+IKAFYMR+NDD
Sbjct  409   ----------------VKWGCDLQSEHERYLTEEAFRGCPVIVRDYPKEIKAFYMRQNDD  452

Query  1520  GKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAG  1699
             GKTVAAMDMLVPRVGELIGGSQREERLEYLE RLD+L L KESYWWYLDLRRYGSVPHAG
Sbjct  453   GKTVAAMDMLVPRVGELIGGSQREERLEYLEDRLDELKLEKESYWWYLDLRRYGSVPHAG  512

Query  1700  FGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             FGLGFERLVQFATGIDNIRD IPFPR PGS
Sbjct  513   FGLGFERLVQFATGIDNIRDTIPFPRAPGS  542



>ref|XP_003608710.1| Asparaginyl-tRNA synthetase [Medicago truncatula]
Length=565

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/504 (78%), Positives = 444/504 (88%), Gaps = 23/504 (5%)
 Frame = +2

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             + + K+ +FR++L+++D+K G     D LG TLV++GWVRTLR QSSVTF+E+NDGSCLS
Sbjct  63    DATNKVPQFRKKLKVSDVKDGQ---FDSLGNTLVLQGWVRTLRLQSSVTFLEINDGSCLS  119

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSF  694
             NMQCV+  + EGYDQVE+GLI TGASVW+QG +  SQG+KQK+ELK+ K+VLVGKSDPSF
Sbjct  120   NMQCVLDTEVEGYDQVESGLITTGASVWVQGIVVKSQGTKQKVELKLNKIVLVGKSDPSF  179

Query  695   PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASD  874
             PIQKKRVSREFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASD
Sbjct  180   PIQKKRVSREFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASD  239

Query  875   CEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETY  1054
             CEGAGEQFCVTTLIPNS E  +SPV+ IPK +   +DWSQDFFGKPAFLTVSGQLNAETY
Sbjct  240   CEGAGEQFCVTTLIPNSHETADSPVDAIPKNDK-LIDWSQDFFGKPAFLTVSGQLNAETY  298

Query  1055  ATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILD  1234
             ATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V+++ILD
Sbjct  299   ATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHILD  358

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDMEFFNTWI+KGII RLSDV EK V+Q+TYT+A++LL +  KKFEFPV WGCDLQS
Sbjct  359   NCKEDMEFFNTWIDKGIIDRLSDVAEKDVLQITYTEAVDLLSRANKKFEFPVKWGCDLQS  418

Query  1415  EHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR------------  1558
             EHERYITEEAFGGCPVIIRDYPKDIKAFYMR+NDDGKTVAAMDMLVP+            
Sbjct  419   EHERYITEEAFGGCPVIIRDYPKDIKAFYMRQNDDGKTVAAMDMLVPKLGALIVCQCWAG  478

Query  1559  -------VGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFE  1717
                    +GELIGGSQREERLE+LE RLDDL LNK++YWWYLDLRRYGSVPHAGFGLGFE
Sbjct  479   EPRDYITIGELIGGSQREERLEHLEARLDDLKLNKDAYWWYLDLRRYGSVPHAGFGLGFE  538

Query  1718  RLVQFATGIDNIRDAIPFPRTPGS  1789
             RLVQFATG+DNIRD IPFPRTPGS
Sbjct  539   RLVQFATGMDNIRDVIPFPRTPGS  562



>gb|KHN09822.1| Asparagine--tRNA ligase, chloroplastic/mitochondrial, partial 
[Glycine soja]
Length=526

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/473 (82%), Positives = 429/473 (91%), Gaps = 2/473 (0%)
 Frame = +2

Query  371   LRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             LR+++IK G  +G D  G  LVV+GWVRTLR QSSVTF+E+NDGSCLSNMQCV++ +AEG
Sbjct  53    LRVSEIKEG--DGADVFGRNLVVQGWVRTLRIQSSVTFLEINDGSCLSNMQCVLNSEAEG  110

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFL  730
             YDQVE+GL+ TGASVW+QG +  SQGSKQK+ELKV K+VL+GKSDPSFPIQKKR SREFL
Sbjct  111   YDQVESGLVTTGASVWVQGVVVKSQGSKQKVELKVNKIVLIGKSDPSFPIQKKRASREFL  170

Query  731   RTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTT  910
             RTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASDCEGAGEQFCVTT
Sbjct  171   RTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASDCEGAGEQFCVTT  230

Query  911   LIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGP  1090
             LIP+S E  +SPV+ IPKT  G +DWSQDFFGKPAFLTVSGQLN ETYATAL+DVYTFGP
Sbjct  231   LIPSSHETNDSPVDAIPKTNDGLIDWSQDFFGKPAFLTVSGQLNGETYATALSDVYTFGP  290

Query  1091  TFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTW  1270
             TFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V++++LDNCKEDMEFF+ W
Sbjct  291   TFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHVLDNCKEDMEFFDAW  350

Query  1271  IEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFG  1450
             I KGII RLSDV +K VVQ+TYT+AI+LL    KKFEFPV WG DLQSEHERYITEE F 
Sbjct  351   INKGIIDRLSDVADKDVVQITYTEAIDLLSGANKKFEFPVKWGSDLQSEHERYITEEVFS  410

Query  1451  GCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddl  1630
             GCPVIIRDYPKDIKAFYMR+NDDG+TVAAMDMLVP +GELIGGSQREERLEYLE RLDDL
Sbjct  411   GCPVIIRDYPKDIKAFYMRQNDDGRTVAAMDMLVPGIGELIGGSQREERLEYLEARLDDL  470

Query  1631  NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              LNK++YWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPRTPGS
Sbjct  471   KLNKDAYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDVIPFPRTPGS  523



>gb|KDO61438.1| hypothetical protein CISIN_1g011197mg [Citrus sinensis]
Length=460

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/481 (81%), Positives = 430/481 (89%), Gaps = 27/481 (6%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+I D+KGGP+EGLDR+G  +VV GWVRTLRAQSSVTFIEVNDGSCLSNMQC
Sbjct  4     KVGEFRKKLKIVDVKGGPNEGLDRVGLMIVVAGWVRTLRAQSSVTFIEVNDGSCLSNMQC  63

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV K+VLVGKSDPS+PIQK
Sbjct  64    VMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVNKIVLVGKSDPSYPIQK  123

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF+W+SSPI+TASDCEGA
Sbjct  124   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFIWISSPIITASDCEGA  183

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTL                           DFF KPAFLTVSGQLNAETYATAL
Sbjct  184   GEQFCVTTL---------------------------DFFEKPAFLTVSGQLNAETYATAL  216

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             ++VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+YILDNCKE
Sbjct  217   SNVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACATAYLQYVVRYILDNCKE  276

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKFEF V WGCDLQSEHER
Sbjct  277   DMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKFEFLVKWGCDLQSEHER  336

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             Y+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR+GELIGGSQREERLEY
Sbjct  337   YLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPRIGELIGGSQREERLEY  396

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LN++SYWWYLDLR YGSVPHAGFGLGFERLVQFATG++NIRDAIPFPRTPG
Sbjct  397   LEGRLDELKLNRDSYWWYLDLRHYGSVPHAGFGLGFERLVQFATGVENIRDAIPFPRTPG  456

Query  1787  S  1789
             S
Sbjct  457   S  457



>ref|XP_004957710.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=550

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/481 (80%), Positives = 433/481 (90%), Gaps = 4/481 (1%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFR+RLR+AD+KGG DEG   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  70    VGEFRKRLRVADVKGGEDEGAALVGKELAVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  129

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQK  706
             ++ D EGYDQ+++  + TGASV ++G +ASSQG KQK+ELKV K+ ++GKSDP SFPIQK
Sbjct  130   LTPDTEGYDQIDS--VTTGASVLVEGVVASSQGGKQKVELKVSKITVIGKSDPTSFPIQK  187

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ+NGFVWVSSPI+TASDCEGA
Sbjct  188   KRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVSSPIITASDCEGA  247

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQF VTTL+ NS E   S + +IP T+ G VDWSQDFF KPAFLTVSGQLN ETYA+AL
Sbjct  248   GEQFYVTTLLSNSAE-GGSLLKDIPATKDGRVDWSQDFFCKPAFLTVSGQLNGETYASAL  306

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNT+RHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL+NCKE
Sbjct  307   SDIYTFGPTFRAENSNTARHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYILENCKE  366

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTW+EKGII+RL+DVVEK  V L+YTDA+ELLL +KKKFEFPV WG DLQSEHER
Sbjct  367   DMDFFNTWVEKGIIERLNDVVEKNFVHLSYTDAVELLLGSKKKFEFPVKWGLDLQSEHER  426

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE AF G PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQREERL++
Sbjct  427   YITEVAFSGRPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQREERLDH  486

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+ NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR PG
Sbjct  487   LEARLDEQNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRVPG  546

Query  1787  S  1789
             S
Sbjct  547   S  547



>ref|XP_006658561.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like, 
partial [Oryza brachyantha]
Length=484

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/481 (81%), Positives = 433/481 (90%), Gaps = 4/481 (1%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFRRR R+AD+KGG DEG   +G  L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  4     VGEFRRRTRVADVKGGEDEGSAWVGRQLAVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  63

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQK  706
             ++ D EGYDQ+++  I TGASV ++G IASSQG KQK+ELKV K++++G+SDP SFPIQK
Sbjct  64    LTPDTEGYDQIDS--IATGASVLVEGIIASSQGGKQKVELKVSKIIVIGESDPTSFPIQK  121

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ+NGFVWV+SPI+TASDCEGA
Sbjct  122   KRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVASPIITASDCEGA  181

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQF VTTLI NS E   S V +IP T+ G VDWSQDFF KPAFLTVSGQLN ETYATAL
Sbjct  182   GEQFYVTTLISNSAE-GGSLVKDIPSTKDGRVDWSQDFFCKPAFLTVSGQLNGETYATAL  240

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA++YLQYVV+YIL+NCKE
Sbjct  241   SDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACASSYLQYVVKYILENCKE  300

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII RL+DVVEK  V L+Y+DAIELL+ +KKKFEFPV WG DLQSEHER
Sbjct  301   DMDFFNTWIEKGIIDRLNDVVEKNFVHLSYSDAIELLVGSKKKFEFPVKWGLDLQSEHER  360

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE AFGG PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQREERL+Y
Sbjct  361   YITEVAFGGRPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQREERLDY  420

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+LNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPR PG
Sbjct  421   LEGRLDELNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDTIPFPRVPG  480

Query  1787  S  1789
             S
Sbjct  481   S  481



>gb|KDO61439.1| hypothetical protein CISIN_1g011197mg [Citrus sinensis]
Length=461

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/481 (80%), Positives = 426/481 (89%), Gaps = 26/481 (5%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+I D+KGGP+EGLDR+G  +VV GWVRTLRAQSSVTFIEVNDGSCLSNMQC
Sbjct  4     KVGEFRKKLKIVDVKGGPNEGLDRVGLMIVVAGWVRTLRAQSSVTFIEVNDGSCLSNMQC  63

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV K+VLVGKSDPS+PIQK
Sbjct  64    VMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVNKIVLVGKSDPSYPIQK  123

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF+W+SSPI+TASDCEGA
Sbjct  124   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFIWISSPIITASDCEGA  183

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQ                        
Sbjct  184   GEQFCVTTLIPSSREAAESPVDAIPKTKDGLIDWSQ------------------------  219

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
               VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+YILDNCKE
Sbjct  220   --VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACATAYLQYVVRYILDNCKE  277

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKFEF V WGCDLQSEHER
Sbjct  278   DMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKFEFLVKWGCDLQSEHER  337

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             Y+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR+GELIGGSQREERLEY
Sbjct  338   YLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPRIGELIGGSQREERLEY  397

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+L LN++SYWWYLDLR YGSVPHAGFGLGFERLVQFATG++NIRDAIPFPRTPG
Sbjct  398   LEGRLDELKLNRDSYWWYLDLRHYGSVPHAGFGLGFERLVQFATGVENIRDAIPFPRTPG  457

Query  1787  S  1789
             S
Sbjct  458   S  458



>ref|XP_008796093.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Phoenix dactylifera]
Length=464

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/461 (82%), Positives = 421/461 (91%), Gaps = 1/461 (0%)
 Frame = +2

Query  410   LDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGA  589
             +DRLG+ L +RGWVRT R QSSVTFIE+NDGSCLSN+QCVM+ DAEGYDQVE+G + TGA
Sbjct  1     MDRLGQALAIRGWVRTCRVQSSVTFIELNDGSCLSNLQCVMNIDAEGYDQVESGAVTTGA  60

Query  590   SVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNT  766
             SV ++G + SSQGSKQK+ELKV +LV +GKSDP ++PIQKKR +REFLRT AHLRPRTNT
Sbjct  61    SVLVEGIVVSSQGSKQKVELKVARLVTIGKSDPLTYPIQKKRATREFLRTIAHLRPRTNT  120

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             FGAV RVRN LA+ATHKFFQENGFVW+SSPI+TASDCEGAGEQFCVTTLIPN++E T+  
Sbjct  121   FGAVTRVRNTLAYATHKFFQENGFVWISSPIITASDCEGAGEQFCVTTLIPNTREGTDCL  180

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             VN IP ++ G +DWSQDFFGKPAFLTVSGQLNAETYA+AL DVYTFGPTFRAENSNTSRH
Sbjct  181   VNTIPTSKDGKIDWSQDFFGKPAFLTVSGQLNAETYASALCDVYTFGPTFRAENSNTSRH  240

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
             LAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL+NCKEDM+FFNTWIEKGII RL+DV
Sbjct  241   LAEFWMIEPELAFADLNDDMACATAYLQYVVKYILENCKEDMDFFNTWIEKGIINRLNDV  300

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             VEK  VQLTY+DA+ELLL  KKKFEFPV WG DLQSEHERYITE AF G PVIIRDYPK+
Sbjct  301   VEKDFVQLTYSDAVELLLGAKKKFEFPVKWGLDLQSEHERYITEVAFAGRPVIIRDYPKE  360

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQREERLEYL  RL++LNLNK+SYWWYLD
Sbjct  361   IKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQREERLEYLGSRLEELNLNKDSYWWYLD  420

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LRR+GSVPHAGFGLGFERLVQFATGI+NIRDAIPFPR PGS
Sbjct  421   LRRFGSVPHAGFGLGFERLVQFATGIENIRDAIPFPRAPGS  461



>ref|XP_002460704.1| hypothetical protein SORBIDRAFT_02g033440 [Sorghum bicolor]
 gb|EER97225.1| hypothetical protein SORBIDRAFT_02g033440 [Sorghum bicolor]
Length=552

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/481 (80%), Positives = 432/481 (90%), Gaps = 4/481 (1%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFR+RLR+AD+KGG DEG   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  72    VGEFRKRLRVADVKGGEDEGAAWVGKELTVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  131

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQK  706
             ++ D EGYDQ+++  + TGASV ++G +ASSQG KQK+ELKV K+ ++GKSDP SFPIQK
Sbjct  132   LTPDTEGYDQIDS--VTTGASVLVEGVVASSQGGKQKVELKVSKITVIGKSDPTSFPIQK  189

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ+NGFVWVSSPI+TASDCEGA
Sbjct  190   KRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVSSPIITASDCEGA  249

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQF VTTL+ NS E   S + +IP T+ G VDWSQDFF KPAFLTVSGQLN ETYA+AL
Sbjct  250   GEQFYVTTLLSNSAE-GGSLLKDIPATKDGRVDWSQDFFCKPAFLTVSGQLNGETYASAL  308

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNT+RHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL+NCKE
Sbjct  309   SDIYTFGPTFRAENSNTARHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYILENCKE  368

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTW+EKGII RL+DVVEK  + L+YTDA+ELLL +KK+FEFPV WG DLQSEHER
Sbjct  369   DMDFFNTWVEKGIIDRLNDVVEKNFIHLSYTDAVELLLGSKKEFEFPVKWGLDLQSEHER  428

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE A GG PVIIRDYPK+IKAFYMREN+DGKTVAAMD+LVPRVGELIGGSQREERL+Y
Sbjct  429   YITEVALGGRPVIIRDYPKEIKAFYMRENNDGKTVAAMDLLVPRVGELIGGSQREERLDY  488

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+ NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR PG
Sbjct  489   LEARLDEQNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRVPG  548

Query  1787  S  1789
             S
Sbjct  549   S  549



>ref|XP_008667385.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=549

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/480 (80%), Positives = 430/480 (90%), Gaps = 4/480 (1%)
 Frame = +2

Query  353   GEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVM  532
             GEFR+RLR+AD+KGG DEG   +G+ L VRGWVRT RAQ ++TF+EVNDGSCLSNMQCV+
Sbjct  70    GEFRKRLRVADVKGGEDEGAAWVGKELAVRGWVRTCRAQRTITFVEVNDGSCLSNMQCVL  129

Query  533   SQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKK  709
             + + EGYDQ+++  + TGASV ++G +ASSQG KQK+ELKV K+ ++GKSDP SFPIQKK
Sbjct  130   TPETEGYDQIDS--VTTGASVLVEGVVASSQGGKQKVELKVSKITVIGKSDPTSFPIQKK  187

Query  710   RVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAG  889
             R SREFLRT AHLRPRTNTFGAVARVRN LA+ATHKFFQ+NGFVWVSSPI+TASDCEGAG
Sbjct  188   RASREFLRTVAHLRPRTNTFGAVARVRNTLAYATHKFFQDNGFVWVSSPIITASDCEGAG  247

Query  890   EQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALN  1069
             EQF VTTL+ NS +   S + +IP T+ G VDWSQDFF KPAFLTVSGQLN ETYA+AL+
Sbjct  248   EQFYVTTLLSNSAD-GGSLLKDIPATKDGRVDWSQDFFCKPAFLTVSGQLNGETYASALS  306

Query  1070  DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKED  1249
             D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL+NCKED
Sbjct  307   DIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYILENCKED  366

Query  1250  MEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERY  1429
             M+FFNTWIEKGII RL+DVVEK  V L+YTDA+ELLL +KK+FEFPV WG DLQSEHERY
Sbjct  367   MDFFNTWIEKGIIDRLNDVVEKNFVHLSYTDAVELLLGSKKEFEFPVKWGLDLQSEHERY  426

Query  1430  ITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleyl  1609
             ITE AFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMD+LVPRVGELIGGSQREERL+YL
Sbjct  427   ITEVAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDLLVPRVGELIGGSQREERLDYL  486

Query  1610  ekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             E RLD+ NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIRD IPFPR PGS
Sbjct  487   EARLDEQNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIRDTIPFPRVPGS  546



>ref|XP_003560202.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
[Brachypodium distachyon]
Length=572

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/481 (80%), Positives = 432/481 (90%), Gaps = 5/481 (1%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFRRRLR+A++KGG DEG   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  93    VGEFRRRLRVAEVKGGEDEGAAWVGKELTVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  152

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQK  706
             ++ D EGYDQ++   + TGASV ++G +ASSQG KQK+ELKV K+V++G+SDP SFPIQK
Sbjct  153   LTPDTEGYDQID--CVTTGASVIVEGVVASSQGGKQKVELKVSKIVVIGESDPTSFPIQK  210

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRT AHLRPRTNTFGAVARVRNALAFATHKFFQ+NGFVWVSSPI+TASDCEGA
Sbjct  211   KRASREFLRTVAHLRPRTNTFGAVARVRNALAFATHKFFQDNGFVWVSSPIITASDCEGA  270

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQF VTTL+ N+ E     VN IP ++ G VDWSQDFF KPAFLTVSGQLN ETYA+AL
Sbjct  271   GEQFYVTTLLSNTAE-GGCLVNNIP-SKDGRVDWSQDFFCKPAFLTVSGQLNGETYASAL  328

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA+AYLQYVV+YIL+NCKE
Sbjct  329   SDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACASAYLQYVVKYILENCKE  388

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTW+EKGII RLSDV EK  VQ++Y+DAIELL+++ KKFEFPV WG DLQSEHER
Sbjct  389   DMDFFNTWVEKGIIDRLSDVAEKNFVQMSYSDAIELLIRSNKKFEFPVKWGLDLQSEHER  448

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE AF G PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQREERL++
Sbjct  449   YITEVAFSGRPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQREERLDH  508

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+ NLNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR PG
Sbjct  509   LEARLDESNLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRVPG  568

Query  1787  S  1789
             S
Sbjct  569   S  569



>gb|KDO61442.1| hypothetical protein CISIN_1g011197mg [Citrus sinensis]
Length=464

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/446 (84%), Positives = 416/446 (93%), Gaps = 0/446 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+I D+KGGP+EGLDR+G  +VV GWVRTLRAQSSVTFIEVNDGSCLSNMQC
Sbjct  4     KVGEFRKKLKIVDVKGGPNEGLDRVGLMIVVAGWVRTLRAQSSVTFIEVNDGSCLSNMQC  63

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQV++GLI TGAS+WIQG +  SQGSKQK+ELKV K+VLVGKSDPS+PIQK
Sbjct  64    VMTSDAEGYDQVKSGLITTGASIWIQGNVVPSQGSKQKVELKVNKIVLVGKSDPSYPIQK  123

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGF+W+SSPI+TASDCEGA
Sbjct  124   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFIWISSPIITASDCEGA  183

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S+E   SPV+ IPKT+ G +DWSQDFF KPAFLTVSGQLNAETYATAL
Sbjct  184   GEQFCVTTLIPSSREAAESPVDAIPKTKDGLIDWSQDFFEKPAFLTVSGQLNAETYATAL  243

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             ++VYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+YILDNCKE
Sbjct  244   SNVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLKDDMACATAYLQYVVRYILDNCKE  303

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FFNTWIEKGII RLS V E+  VQL+YTDAIELL+K KKKFEF V WGCDLQSEHER
Sbjct  304   DMDFFNTWIEKGIIDRLSTVAERDFVQLSYTDAIELLIKAKKKFEFLVKWGCDLQSEHER  363

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             Y+TEEAFGGCPVI+ DYPK+IKAFYMR+NDDG+TVAAMDMLVPR+GELIGGSQREERLEY
Sbjct  364   YLTEEAFGGCPVIVSDYPKEIKAFYMRQNDDGRTVAAMDMLVPRIGELIGGSQREERLEY  423

Query  1607  lekrlddlNLNKESYWWYLDLRRYGS  1684
             LE RLD+L LN++SYWWYLDLR YGS
Sbjct  424   LEGRLDELKLNRDSYWWYLDLRHYGS  449



>ref|XP_010258931.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=615

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/540 (73%), Positives = 447/540 (83%), Gaps = 17/540 (3%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCL-----------------RR  247
             RL+P SA R +S  +  T    V   +     K PT    L                 RR
Sbjct  12    RLRPQSAARFISFLNNITTGRNVLTGFRTLTNKAPTFPPFLHCYPGVRHLRRDSPAFNRR  71

Query  248   sfcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGE  427
              F S +  A+SS EAV++         +V   +K+ EFR+RLRIADIKGGPDEGLDR+G+
Sbjct  72    CFSSAIVGAISSEEAVEKAKKEFLEKPDVGTGQKVREFRKRLRIADIKGGPDEGLDRVGQ  131

Query  428   TLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQG  607
             TLVV+GWVRTLR Q S+TF+EVNDGSCLSNMQCV++ DAEGYDQVE+G I TGASVW++G
Sbjct  132   TLVVKGWVRTLRVQRSITFMEVNDGSCLSNMQCVINSDAEGYDQVESGSISTGASVWVEG  191

Query  608   TIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARV  787
              I  SQGS QK+EL+V K++ VGKSDPSFPIQKKR+SREFLRTKAHLRPRTNTFGAV+RV
Sbjct  192   AIVESQGSGQKVELRVTKVITVGKSDPSFPIQKKRISREFLRTKAHLRPRTNTFGAVSRV  251

Query  788   RNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKT  967
             RNALA+ATHKFFQENGFVW+SSPIVTASDCEGAGEQFCVTTLIP+S++ ++S V+ IPKT
Sbjct  252   RNALAYATHKFFQENGFVWISSPIVTASDCEGAGEQFCVTTLIPSSRDASDSLVDTIPKT  311

Query  968   ESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMI  1147
             + G +DWSQDFFGKPAFLTVSGQLNAETYA+AL DVYTFGPTFRAENSNTSRHLAEFWMI
Sbjct  312   DDGLIDWSQDFFGKPAFLTVSGQLNAETYASALCDVYTFGPTFRAENSNTSRHLAEFWMI  371

Query  1148  EPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQ  1327
             EPELAFADL DDM+CA AYL+YVV+++LDNCKEDM+FFNTWIEKGII RLSDV EK  V 
Sbjct  372   EPELAFADLSDDMACATAYLKYVVRHVLDNCKEDMDFFNTWIEKGIIDRLSDVAEKNFVH  431

Query  1328  LTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR  1507
             L YT+AIELLLK K+KFEFPV WGCDLQSEHERY+TEEAF GCPVII DYPK+IKAFYMR
Sbjct  432   LAYTEAIELLLKAKRKFEFPVKWGCDLQSEHERYVTEEAFAGCPVIITDYPKEIKAFYMR  491

Query  1508  ENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSV  1687
              NDDG TVAAMD+LVPRVGELIGGSQREERLEYLE RLD+L LNKE+YWWYLDLRR+GSV
Sbjct  492   LNDDGSTVAAMDVLVPRVGELIGGSQREERLEYLEDRLDELKLNKETYWWYLDLRRFGSV  551



>dbj|BAJ90664.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/481 (78%), Positives = 432/481 (90%), Gaps = 5/481 (1%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFRRR+R+A++KGG D+G   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  56    VGEFRRRIRVAEVKGGEDQGTSWVGKELTVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  115

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQK  706
             ++ + EGYDQ+++  I TGASV ++G +ASSQG KQK++LKV K++++G+SDP SFPIQK
Sbjct  116   LTPETEGYDQIDS--ITTGASVLVEGVVASSQGGKQKVDLKVSKIIVIGESDPTSFPIQK  173

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KR SREFLRT AHLRPRTNTFGAVARVRNALA+ATH FFQ+NGF+WVSSPI+TASDCEGA
Sbjct  174   KRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHNFFQDNGFIWVSSPIITASDCEGA  233

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQF VTTL+ NS E     VN IP ++ G VDWSQDFF KPAFLTVSGQLN ETYA+AL
Sbjct  234   GEQFYVTTLLSNSAE-GGCLVNSIP-SKDGRVDWSQDFFCKPAFLTVSGQLNGETYASAL  291

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +D+YTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA+AYLQYVV+YIL+NCKE
Sbjct  292   SDIYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACASAYLQYVVKYILENCKE  351

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DM+FF+TW+EKGII RL++V EK  VQ++Y+DAI+LL+ + KKFEFPV WG DLQSEHER
Sbjct  352   DMDFFDTWVEKGIIDRLNNVAEKNFVQMSYSDAIKLLIGSNKKFEFPVKWGLDLQSEHER  411

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerley  1606
             YITE AFGG PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LVPRVGELIGGSQREERL+Y
Sbjct  412   YITEVAFGGHPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLVPRVGELIGGSQREERLDY  471

Query  1607  lekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             LE RLD+ NLNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR PG
Sbjct  472   LEARLDESNLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRVPG  531

Query  1787  S  1789
             S
Sbjct  532   S  532



>dbj|BAC15528.1| putative asparaginyl-tRNA synthetase, chloroplast/mitochondrial 
precursor [Oryza sativa Japonica Group]
 dbj|BAD30675.1| putative asparaginyl-tRNA synthetase, chloroplast/mitochondrial 
precursor [Oryza sativa Japonica Group]
Length=584

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/508 (76%), Positives = 429/508 (84%), Gaps = 29/508 (6%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFRRR R+AD+KGG DEG   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  75    VGEFRRRTRVADVKGGEDEGAAWVGKQLAVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  134

Query  530   MSQDAEGYDQ-----------VENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvg  676
             ++ D EGYDQ            +   I TGASV ++G IASSQG KQK+ELKV K+ +  
Sbjct  135   LTPDTEGYDQYILLVNIFIGGCQIDSITTGASVLVEGVIASSQGGKQKVELKVSKISVAV  194

Query  677   ----------------kSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAF  805
                             +SDP SFPIQKKR SREFLRT AHLRPRTNTFGAVARVRNALA+
Sbjct  195   DNIIPGKHASSAFFIGESDPTSFPIQKKRASREFLRTVAHLRPRTNTFGAVARVRNALAY  254

Query  806   ATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVD  985
             ATHKFFQ+NGFVWV+SPI+TASDCEGAGEQF VTTLI NS E   S V +IP T+ G VD
Sbjct  255   ATHKFFQDNGFVWVASPIITASDCEGAGEQFYVTTLISNSAE-GGSLVKDIPSTKDGRVD  313

Query  986   WSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAF  1165
             WSQDFF KPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAF
Sbjct  314   WSQDFFCKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAF  373

Query  1166  ADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDA  1345
             ADL DDM+CA++YLQYVV+Y+L+NCKEDM+FFNTWIEKGII RL+DVVEK  V L+Y+DA
Sbjct  374   ADLNDDMACASSYLQYVVKYVLENCKEDMDFFNTWIEKGIIDRLNDVVEKNFVHLSYSDA  433

Query  1346  IElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGK  1525
             IELL+ +KKKFEFPV WG DLQSEHERYITE AFGG PVIIRDYPK+IKAFYMRENDDGK
Sbjct  434   IELLVGSKKKFEFPVKWGLDLQSEHERYITEVAFGGRPVIIRDYPKEIKAFYMRENDDGK  493

Query  1526  TVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFG  1705
             TVAAMD+LVPRVGELIGGSQREERL+YLE RLD+LNLNK+SYWWYLDLRRYGSVPHAGFG
Sbjct  494   TVAAMDLLVPRVGELIGGSQREERLDYLEARLDELNLNKDSYWWYLDLRRYGSVPHAGFG  553

Query  1706  LGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LGFERLVQFATG+DNIRD IPFPR PGS
Sbjct  554   LGFERLVQFATGMDNIRDTIPFPRVPGS  581



>ref|XP_001757621.1| predicted protein [Physcomitrella patens]
 gb|EDQ77678.1| predicted protein [Physcomitrella patens]
Length=501

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/484 (75%), Positives = 427/484 (88%), Gaps = 1/484 (0%)
 Frame = +2

Query  341   SRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNM  520
             S  + EFR+RLRIADIKGG D GL R+GET+VVRGWVRT R Q + +FIEVNDGS +SN+
Sbjct  15    SSSVPEFRKRLRIADIKGGEDGGLGRVGETMVVRGWVRTCRIQKTFSFIEVNDGSAVSNL  74

Query  521   QCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFP  697
             Q V+  D EGYD++E G + TGASV ++G +  S+G+KQK+ELK  KL L+G +DP SFP
Sbjct  75    QTVVLSDVEGYDKIEAGQVNTGASVAVEGVLVESKGAKQKVELKATKLTLIGGTDPASFP  134

Query  698   IQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDC  877
             IQKK+++RE+LR+ AHLRPRTNTFGAVARVR ALA+ATH+FF+E GFVWV+SPI+TASDC
Sbjct  135   IQKKKLTREYLRSVAHLRPRTNTFGAVARVRTALAYATHQFFREQGFVWVASPIITASDC  194

Query  878   EGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYA  1057
             EGAGEQFCVTTLIP+S E T +PV+++P T+ G +DWSQDFFGKPAFLTVSGQLN ETYA
Sbjct  195   EGAGEQFCVTTLIPSSHEDTKTPVSQVPTTKDGLIDWSQDFFGKPAFLTVSGQLNGETYA  254

Query  1058  TALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDN  1237
             TAL D+YTFGPTFRAENSNT+RHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+Y+LDN
Sbjct  255   TALCDIYTFGPTFRAENSNTTRHLAEFWMIEPELAFADLKDDMACATAYLQYVVRYVLDN  314

Query  1238  CKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSE  1417
             C ED+EFFN W+EKGII RL++VVEK  V +TYT+A+ELL K+KKKFEFPV WG DLQSE
Sbjct  315   CMEDLEFFNQWVEKGIITRLTNVVEKPFVHVTYTEAVELLQKSKKKFEFPVKWGADLQSE  374

Query  1418  HERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreer  1597
             HERY+TE AF G PVI+ DYPK+IKAFYMR+N+D KTVAAMD+LVPRVGELIGGSQREER
Sbjct  375   HERYLTEVAFSGNPVIVTDYPKEIKAFYMRQNEDEKTVAAMDILVPRVGELIGGSQREER  434

Query  1598  leylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR  1777
             LE LE+R+++L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQF+TGI+NIRD IPFPR
Sbjct  435   LEVLERRIEELGLSKESYWWYLDLRRYGSVPHAGFGLGFERLVQFSTGIENIRDVIPFPR  494

Query  1778  TPGS  1789
             TP S
Sbjct  495   TPNS  498



>gb|ABD65116.1| asparaginyl-tRNA synthetase, putative [Brassica oleracea]
Length=705

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/474 (79%), Positives = 419/474 (88%), Gaps = 8/474 (2%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFRR+LR+A++KGG DEGL R+G++L V GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  75    KVGEFRRKLRVAEVKGGADEGLGRVGQSLSVMGWVRTLRSQSSVTFIEINDGSCLSNLQC  134

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             VM+ DAEGYDQVE G ++TGASV +QGTI +SQG+KQK+ELKV K++LVGK D S+PIQK
Sbjct  135   VMNPDAEGYDQVEAGSVLTGASVSVQGTIVASQGTKQKVELKVHKIILVGKCDSSYPIQK  194

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTN+FGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  195   KRVSREFLRTKAHLRPRTNSFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  254

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVT LIP+S E T+SP++ IPKT+ G VDWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  255   GEQFCVTILIPSSHETTDSPIDAIPKTKGGLVDWSQDFFGKPAFLTVSGQLNGETYATAL  314

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFW-MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCK  1243
             +D+YTFGPTFRAENSNTSRHLAEFW ++ P          M+         V+Y+LDNCK
Sbjct  315   SDIYTFGPTFRAENSNTSRHLAEFWNLLLPTWM-------MTWPVPPPTSPVKYVLDNCK  367

Query  1244  EDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHE  1423
             EDMEFF+TWIEKGI  RLSDVVEK+ +QL+YTDAIELLLK  K+FEFPV WG DLQSEHE
Sbjct  368   EDMEFFDTWIEKGITHRLSDVVEKEFLQLSYTDAIELLLKANKEFEFPVKWGLDLQSEHE  427

Query  1424  RYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerle  1603
             RYITEEAF G PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERLE
Sbjct  428   RYITEEAFEGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERLE  487

Query  1604  ylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAI  1765
              LE RLD L L+KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRD +
Sbjct  488   VLEARLDGLKLDKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDDV  541


 Score =   267 bits (682),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  1280  GIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCP  1459
             GI     DVVEK+ +QL+YTDAIELLLK  K+FEFPV WG DLQSEHERYITEEAF G P
Sbjct  533   GIDNIRDDVVEKEFLQLSYTDAIELLLKANKEFEFPVKWGLDLQSEHERYITEEAFEGRP  592

Query  1460  VIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLN  1639
             VIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERLE LE RLD L L+
Sbjct  593   VIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQREERLEVLEARLDGLKLD  652

Query  1640  KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRD IPFPR+PGS
Sbjct  653   KESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDVIPFPRSPGS  702



>ref|XP_010258933.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X3 [Nelumbo nucifera]
Length=586

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/540 (69%), Positives = 424/540 (79%), Gaps = 46/540 (9%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCL-----------------RR  247
             RL+P SA R +S  +  T    V   +     K PT    L                 RR
Sbjct  12    RLRPQSAARFISFLNNITTGRNVLTGFRTLTNKAPTFPPFLHCYPGVRHLRRDSPAFNRR  71

Query  248   sfcsvvcsavssGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGE  427
              F S +  A+SS EAV++         +V   +K+ EFR+RLRIADIKGGPDEGLDR+G+
Sbjct  72    CFSSAIVGAISSEEAVEKAKKEFLEKPDVGTGQKVREFRKRLRIADIKGGPDEGLDRVGQ  131

Query  428   TLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQG  607
             TLVV+GWVRTLR Q S+TF+EVNDGSCLSNMQCV++ DAEGYDQVE+G I TGASVW++G
Sbjct  132   TLVVKGWVRTLRVQRSITFMEVNDGSCLSNMQCVINSDAEGYDQVESGSISTGASVWVEG  191

Query  608   TIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARV  787
              I  SQGS QK+EL+V K++ VGKSDPSFPIQKKR+SREFLRTKAHLRPRTNTFGAV+RV
Sbjct  192   AIVESQGSGQKVELRVTKVITVGKSDPSFPIQKKRISREFLRTKAHLRPRTNTFGAVSRV  251

Query  788   RNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKT  967
             RNALA+ATHKFFQENGFVW+SSPIVTASDCEGAGEQFCVTTLIP+S++ ++S V+ IPKT
Sbjct  252   RNALAYATHKFFQENGFVWISSPIVTASDCEGAGEQFCVTTLIPSSRDASDSLVDTIPKT  311

Query  968   ESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMI  1147
             + G +DWSQDFFGKPAFLTVSGQLNAETYA+AL DVYTFGPTFRAENSNTSRHLAEFWMI
Sbjct  312   DDGLIDWSQDFFGKPAFLTVSGQLNAETYASALCDVYTFGPTFRAENSNTSRHLAEFWMI  371

Query  1148  EPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQ  1327
             EPELAFADL DDM+CA AYL+YVV+++LDNCKEDM+FFNTWIEKGII RLS         
Sbjct  372   EPELAFADLSDDMACATAYLKYVVRHVLDNCKEDMDFFNTWIEKGIIDRLS---------  422

Query  1328  LTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMR  1507
                                 V WGCDLQSEHERY+TEEAF GCPVII DYPK+IKAFYMR
Sbjct  423   --------------------VKWGCDLQSEHERYVTEEAFAGCPVIITDYPKEIKAFYMR  462

Query  1508  ENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSV  1687
              NDDG TVAAMD+LVPRVGELIGGSQREERLEYLE RLD+L LNKE+YWWYLDLRR+GSV
Sbjct  463   LNDDGSTVAAMDVLVPRVGELIGGSQREERLEYLEDRLDELKLNKETYWWYLDLRRFGSV  522



>ref|XP_008448847.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial 
isoform X2 [Cucumis melo]
Length=501

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 405/491 (82%), Gaps = 11/491 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCLRRsfcsvvcsavssGEAVQ  298
             R  P S +R ++   +        + ++ F P    HS    R        A  + E  +
Sbjct  12    RFNPCSTLRFITGLPRKL------SHHILFPPISRRHSSYYFRRSFCSAVPAGEAAEKTK  65

Query  299   RPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSV  478
               +S D+   +V    K+GEFR++LRI++IKGG DEGLDRLG+T VV+GWVRTLR QSSV
Sbjct  66    PDVSKDW---KVTRGEKVGEFRKKLRISEIKGGRDEGLDRLGQTFVVKGWVRTLRVQSSV  122

Query  479   TFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvv  658
             TF+EVNDGSC+SNMQCV+    EGYDQVE+GLI TGASVW++G + +SQGSKQK+ELK+ 
Sbjct  123   TFMEVNDGSCISNMQCVIDSTTEGYDQVESGLITTGASVWVEGVVVASQGSKQKVELKLQ  182

Query  659   klvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGF  838
             K+V+VGKSDPS+P+QKK+VSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQENGF
Sbjct  183   KVVMVGKSDPSYPVQKKKVSREFLRTKAHLRPRTNTFGAVARVRNVLAYATHKFFQENGF  242

Query  839   VWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAF  1018
             VWVSSPI+TASDCEGAGEQFCVTTLIP+S EP +S V  IPKT+ G +DWSQDFFGKPAF
Sbjct  243   VWVSSPIITASDCEGAGEQFCVTTLIPSSGEPASSDVGSIPKTKEGFIDWSQDFFGKPAF  302

Query  1019  LTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAA  1198
             LTVSGQLNAETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDMSCA 
Sbjct  303   LTVSGQLNAETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMSCAT  362

Query  1199  AYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkF  1378
             AYLQYVV+++L+NCKED++FFNTWIEKGII RL+++VE   VQL YTDAIELLL+  KKF
Sbjct  363   AYLQYVVRHVLENCKEDLDFFNTWIEKGIIDRLTNLVENDFVQLPYTDAIELLLRANKKF  422

Query  1379  EFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPR  1558
             E+PV WG DLQSEHERYITE AFGGCPVIIRDYP+DIKAFYMR+NDDGKTVAAMDMLVP+
Sbjct  423   EYPVKWGSDLQSEHERYITEVAFGGCPVIIRDYPRDIKAFYMRQNDDGKTVAAMDMLVPK  482

Query  1559  --VGELIGGSQ  1585
                  L+ GS+
Sbjct  483   FPTQALVWGSK  493



>ref|XP_006283618.1| hypothetical protein CARUB_v10004675mg [Capsella rubella]
 gb|EOA16516.1| hypothetical protein CARUB_v10004675mg [Capsella rubella]
Length=491

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/405 (82%), Positives = 377/405 (93%), Gaps = 0/405 (0%)
 Frame = +2

Query  347   KIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQC  526
             K+GEFR++L+IA++KGG DEGL R+G++L + GWVRTLR+QSSVTFIE+NDGSCLSN+QC
Sbjct  84    KVGEFRKKLKIAEVKGGADEGLSRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCLSNLQC  143

Query  527   VMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQK  706
             V++ DAEGYDQVE+G I+TGASV +QGTI +SQG+KQK+ELKV K++LVGK D S+PIQK
Sbjct  144   VLNSDAEGYDQVESGSILTGASVSVQGTIVASQGTKQKVELKVEKIILVGKCDSSYPIQK  203

Query  707   KRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGA  886
             KRVSREFLRTKAHLRPRTNTFGAVARVRN LA+ATHKFFQE+GFVWV+SPI+TASDCEGA
Sbjct  204   KRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGA  263

Query  887   GEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATAL  1066
             GEQFCVTTLIP+S E TN+ ++ IPKT+ G +DWSQDFFGKPAFLTVSGQLN ETYATAL
Sbjct  264   GEQFCVTTLIPSSHENTNTSIDAIPKTKGGLIDWSQDFFGKPAFLTVSGQLNGETYATAL  323

Query  1067  NDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKE  1246
             +DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+DDM+CA AYLQYVV+Y+LDNCKE
Sbjct  324   SDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKE  383

Query  1247  DMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHER  1426
             DMEFF+TWIEKGII+RLSDV EK+ +QL YTDAIELLLK  KKF+FPV WG DLQSEHER
Sbjct  384   DMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIELLLKANKKFDFPVKWGLDLQSEHER  443

Query  1427  YITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRV  1561
             YITEEAFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMDMLVPRV
Sbjct  444   YITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRV  488



>ref|NP_001059657.2| Os07g0485400 [Oryza sativa Japonica Group]
 dbj|BAF21571.2| Os07g0485400 [Oryza sativa Japonica Group]
Length=553

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/504 (73%), Positives = 407/504 (81%), Gaps = 52/504 (10%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFRRR R+AD+KGG DEG   +G+ L VRGWVRT RAQ +VTF+EVNDGSCLSNMQCV
Sbjct  75    VGEFRRRTRVADVKGGEDEGAAWVGKQLAVRGWVRTCRAQRTVTFVEVNDGSCLSNMQCV  134

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvg-----------  676
             ++ D EGYDQ+++  I TGASV ++G IASSQG KQK+ELKV K+ +             
Sbjct  135   LTPDTEGYDQIDS--ITTGASVLVEGVIASSQGGKQKVELKVSKISVAVDNIIPGKHASS  192

Query  677   ------------kSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHK  817
                         +SDP SFPIQKKR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHK
Sbjct  193   AFFWFHFFVQIGESDPTSFPIQKKRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHK  252

Query  818   FFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQD  997
             FFQ+NGFVWV+SPI+TASDCEGAGEQF VTTLI NS E   S V +IP T+ G VDWSQD
Sbjct  253   FFQDNGFVWVASPIITASDCEGAGEQFYVTTLISNSAE-GGSLVKDIPSTKDGRVDWSQD  311

Query  998   FFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLE  1177
             FF KPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFW            
Sbjct  312   FFCKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFW------------  359

Query  1178  DDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIEll  1357
                          V+Y+L+NCKEDM+FFNTWIEKGII RL+DVVEK  V L+Y+DAIELL
Sbjct  360   -------------VKYVLENCKEDMDFFNTWIEKGIIDRLNDVVEKNFVHLSYSDAIELL  406

Query  1358  lktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAA  1537
             + +KKKFEFPV WG DLQSEHERYITE AFGG PVIIRDYPK+IKAFYMRENDDGKTVAA
Sbjct  407   VGSKKKFEFPVKWGLDLQSEHERYITEVAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAA  466

Query  1538  MDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFE  1717
             MD+LVPRVGELIGGSQREERL+YLE RLD+LNLNK+SYWWYLDLRRYGSVPHAGFGLGFE
Sbjct  467   MDLLVPRVGELIGGSQREERLDYLEARLDELNLNKDSYWWYLDLRRYGSVPHAGFGLGFE  526

Query  1718  RLVQFATGIDNIRDAIPFPRTPGS  1789
             RLVQFATG+DNIRD IPFPR PGS
Sbjct  527   RLVQFATGMDNIRDTIPFPRVPGS  550



>ref|XP_008653090.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like 
[Zea mays]
 tpg|DAA62718.1| TPA: hypothetical protein ZEAMMB73_156108 [Zea mays]
Length=425

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/425 (81%), Positives = 384/425 (90%), Gaps = 4/425 (1%)
 Frame = +2

Query  518   MQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SF  694
             MQCV++ + EGYDQ+++  + TGASV ++G +ASSQG KQK+ELKV K+ ++GKSDP SF
Sbjct  1     MQCVLTPETEGYDQIDS--VTTGASVLVEGVVASSQGGKQKVELKVSKITVIGKSDPTSF  58

Query  695   PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASD  874
             PIQKKR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ+NGFVWVSSPI+TASD
Sbjct  59    PIQKKRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVSSPIITASD  118

Query  875   CEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETY  1054
             CEGAGEQF VTTL+ NS E   S + +IP T+ G VDWSQDFF KPAFLTVSGQLN ETY
Sbjct  119   CEGAGEQFYVTTLLSNSTE-GGSLLKDIPATKDGRVDWSQDFFCKPAFLTVSGQLNGETY  177

Query  1055  ATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILD  1234
             A+AL+D+YTFGPTFRAENSNT+RHLAEFWMIEPELAFADL DDM+CA AYLQYVV+YIL+
Sbjct  178   ASALSDIYTFGPTFRAENSNTARHLAEFWMIEPELAFADLNDDMACATAYLQYVVKYILE  237

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDM+FFNTW+EKGII RL+DVVEK  V L+YTDA+ELLL +KKKFEFPV WG DLQS
Sbjct  238   NCKEDMDFFNTWVEKGIIDRLNDVVEKNFVHLSYTDAVELLLGSKKKFEFPVKWGLDLQS  297

Query  1415  EHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQree  1594
             EHERYITE AF G PVIIRDYPK+IKAFYMRENDDGKTVAAMD+LVPRVGELIGGSQREE
Sbjct  298   EHERYITEVAFDGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDLLVPRVGELIGGSQREE  357

Query  1595  rleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP  1774
             RL+YLE RLD+ NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP
Sbjct  358   RLDYLEARLDEQNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFP  417

Query  1775  RTPGS  1789
             R PGS
Sbjct  418   RVPGS  422



>ref|XP_007039834.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY24335.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
Length=401

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/378 (84%), Positives = 354/378 (94%), Gaps = 0/378 (0%)
 Frame = +2

Query  350   IGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCV  529
             +GEFR++L+IADIKGGPD GLDR+G+TLVV GWVRTLR QSSVTF+EVNDGSCLSNMQCV
Sbjct  5     VGEFRKKLKIADIKGGPDGGLDRVGQTLVVMGWVRTLRVQSSVTFLEVNDGSCLSNMQCV  64

Query  530   MSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKK  709
             M+ DAEGYDQVE+GLI TGAS+W+QGT+ +SQG+KQK+ELKV K+V+VG+SDPS+PIQKK
Sbjct  65    MNSDAEGYDQVESGLIATGASIWVQGTLVASQGAKQKVELKVDKVVVVGQSDPSYPIQKK  124

Query  710   RVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAG  889
             RVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKFFQENGFVW+SSPI+TASDCEGAG
Sbjct  125   RVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKFFQENGFVWISSPIITASDCEGAG  184

Query  890   EQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALN  1069
             EQFCVTTLIP+S+E T+SPV  IP T+ G +DWSQDFFGKPAFLTVSGQLNAETYATAL+
Sbjct  185   EQFCVTTLIPSSREATDSPVRAIPNTKDGLIDWSQDFFGKPAFLTVSGQLNAETYATALS  244

Query  1070  DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKED  1249
             DVYTFGPTFRAENSNT+RHLAEFWMIEPELAFADL DD +CA AYLQYVV+++LDNCKED
Sbjct  245   DVYTFGPTFRAENSNTTRHLAEFWMIEPELAFADLNDDTACATAYLQYVVRHVLDNCKED  304

Query  1250  MEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERY  1429
             MEFFNTWIEKGII RL+DV EK  VQL YTDAIELLLK KKKFEFP+ WGCDLQSEHERY
Sbjct  305   MEFFNTWIEKGIIDRLNDVAEKDFVQLPYTDAIELLLKAKKKFEFPLKWGCDLQSEHERY  364

Query  1430  ITEEAFGGCPVIIRDYPK  1483
             ITEEAF GCPVIIRDYPK
Sbjct  365   ITEEAFNGCPVIIRDYPK  382



>gb|EEC82046.1| hypothetical protein OsI_26023 [Oryza sativa Indica Group]
Length=377

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/371 (85%), Positives = 342/371 (92%), Gaps = 2/371 (1%)
 Frame = +2

Query  680   SDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSP  856
             SDP SFPIQKKR SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ+NGFVWV+SP
Sbjct  5     SDPTSFPIQKKRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVASP  64

Query  857   IVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQ  1036
             I+TASDCEGAGEQF VTTLI NS E   S V +IP T+ G VDWSQDFF KPAFLTVSGQ
Sbjct  65    IITASDCEGAGEQFYVTTLISNSAE-GGSLVKDIPSTKDGRVDWSQDFFCKPAFLTVSGQ  123

Query  1037  LNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYV  1216
             LN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA++YLQYV
Sbjct  124   LNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACASSYLQYV  183

Query  1217  VQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNW  1396
             V+Y+L+NCKEDM+FFNTWIEKGII RL+DVVEK  V L+Y+DAIELL+ +KKKFEFPV W
Sbjct  184   VKYVLENCKEDMDFFNTWIEKGIIDRLNDVVEKNFVHLSYSDAIELLVGSKKKFEFPVKW  243

Query  1397  GCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIG  1576
             G DLQSEHERYITE AFGG PVIIRDYPK+IKAFYMRENDDGKTVAAMD+LVPRVGELIG
Sbjct  244   GLDLQSEHERYITEVAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDLLVPRVGELIG  303

Query  1577  GSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIR  1756
             GSQREERL+YLE RLD+LNLNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQFATG+DNIR
Sbjct  304   GSQREERLDYLEARLDELNLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQFATGMDNIR  363

Query  1757  DAIPFPRTPGS  1789
             D IPFPR PGS
Sbjct  364   DTIPFPRVPGS  374



>gb|KEH31646.1| asparagine-tRNA ligase [Medicago truncatula]
Length=463

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/383 (79%), Positives = 345/383 (90%), Gaps = 4/383 (1%)
 Frame = +2

Query  335   EESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLS  514
             + + K+ +FR++L+++D+K G     D LG TLV++GWVRTLR QSSVTF+E+NDGSCLS
Sbjct  63    DATNKVPQFRKKLKVSDVKDGQ---FDSLGNTLVLQGWVRTLRLQSSVTFLEINDGSCLS  119

Query  515   NMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSF  694
             NMQCV+  + EGYDQVE+GLI TGASVW+QG +  SQG+KQK+ELK+ K+VLVGKSDPSF
Sbjct  120   NMQCVLDTEVEGYDQVESGLITTGASVWVQGIVVKSQGTKQKVELKLNKIVLVGKSDPSF  179

Query  695   PIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASD  874
             PIQKKRVSREFLRTKAHLR RTNTFGAVARVRNALA+ATHKFFQENGFVWVSSPI+TASD
Sbjct  180   PIQKKRVSREFLRTKAHLRARTNTFGAVARVRNALAYATHKFFQENGFVWVSSPIITASD  239

Query  875   CEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETY  1054
             CEGAGEQFCVTTLIPNS E  +SPV+ IPK +   +DWSQDFFGKPAFLTVSGQLNAETY
Sbjct  240   CEGAGEQFCVTTLIPNSHETADSPVDAIPKNDK-LIDWSQDFFGKPAFLTVSGQLNAETY  298

Query  1055  ATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILD  1234
             ATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL DDM+CA AYLQ+V+++ILD
Sbjct  299   ATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLNDDMACATAYLQFVIRHILD  358

Query  1235  NCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQS  1414
             NCKEDMEFFNTWI+KGII RLSDV EK V+Q+TYT+A++LL +  KKFEFPV WGCDLQS
Sbjct  359   NCKEDMEFFNTWIDKGIIDRLSDVAEKDVLQITYTEAVDLLSRANKKFEFPVKWGCDLQS  418

Query  1415  EHERYITEEAFGGCPVIIRDYPK  1483
             EHERYITEEAFGGCPVIIRDYPK
Sbjct  419   EHERYITEEAFGGCPVIIRDYPK  441



>emb|CDP09969.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/429 (76%), Positives = 364/429 (85%), Gaps = 9/429 (2%)
 Frame = +2

Query  119   RLKPFSAVRLLSLYHKTTKTAAVPNSYLYFLPKPPTHSVCL------RRsfcsvvcsavs  280
             RLK F+AVR  S Y KT KT   P  +    P     +  L       RSFCSV+ +AVS
Sbjct  13    RLKSFTAVRFFSFYRKTPKTHLTPTFHFPLKPSTSNSTPFLPLHYSRTRSFCSVISAAVS  72

Query  281   sGEAVQRPLSGDFGTKEVEESRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTL  460
             SGEA +   +  F   E+++  ++GEFR+RLRI D+KGGPDEGL+RL  TLVVRGWVRT 
Sbjct  73    SGEATK---TETFEKNELQKGERVGEFRKRLRIVDVKGGPDEGLNRLDATLVVRGWVRTF  129

Query  461   RAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQK  640
             RAQS +TFIEVNDGSCLSN+QCVMS DAEGYDQ+E+GLI TGAS+ +QG +  SQGSKQK
Sbjct  130   RAQSGITFIEVNDGSCLSNLQCVMSSDAEGYDQIESGLISTGASLLVQGVLVKSQGSKQK  189

Query  641   IElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKF  820
             +ELKV KL+LVG SDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALA+ATHKF
Sbjct  190   VELKVEKLILVGTSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAYATHKF  249

Query  821   FQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDF  1000
             FQENGFVWVSSPI+TASDCEGAGEQFCVTTLIP+S+E T+SPV  IP+TE GSVDWSQDF
Sbjct  250   FQENGFVWVSSPIITASDCEGAGEQFCVTTLIPSSRETTDSPVAAIPRTEDGSVDWSQDF  309

Query  1001  FGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLED  1180
             FGKPAFLTVSGQLN ETYATAL+DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADL+D
Sbjct  310   FGKPAFLTVSGQLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLDD  369

Query  1181  DMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElll  1360
             DM+CA AYLQYVVQYIL+NCKEDM+FFNTWIEKGII RLSDVVEK  V LTYTDAI+LLL
Sbjct  370   DMACATAYLQYVVQYILENCKEDMDFFNTWIEKGIISRLSDVVEKSFVLLTYTDAIDLLL  429

Query  1361  ktkkkFEFP  1387
             K KKKFEFP
Sbjct  430   KAKKKFEFP  438



>ref|XP_009592734.1| PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial, 
partial [Nicotiana tomentosiformis]
Length=347

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/338 (91%), Positives = 323/338 (96%), Gaps = 0/338 (0%)
 Frame = +2

Query  776   VARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNE  955
             V+RVRNALA+ATHKFFQENGFVWVSSPI+TASDCEGAGEQF VTTLIP SKE  +SPVN 
Sbjct  7     VSRVRNALAYATHKFFQENGFVWVSSPIITASDCEGAGEQFRVTTLIPTSKECGDSPVNA  66

Query  956   IPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAE  1135
             IP TESGSVDWSQDFFGK AFLTVSGQLN ETYATAL+D+YTFGPTFRAENSNTSRHLAE
Sbjct  67    IPTTESGSVDWSQDFFGKQAFLTVSGQLNGETYATALSDIYTFGPTFRAENSNTSRHLAE  126

Query  1136  FWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEK  1315
             FWMIEPELAFADL+DDM+CA AYLQYVVQY+L+NCKEDM+FFNTWIEKGII RLSDVVEK
Sbjct  127   FWMIEPELAFADLDDDMACATAYLQYVVQYVLENCKEDMDFFNTWIEKGIINRLSDVVEK  186

Query  1316  KVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA  1495
               VQLTYTDAIELLLK  KKF+FPV WGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA
Sbjct  187   NFVQLTYTDAIELLLKATKKFDFPVKWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA  246

Query  1496  FYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRR  1675
             FYMR+NDDGKTVAAMDMLVPRVGELIGGSQREERLEYLE+RLD+LNLNKES+WWYLDLRR
Sbjct  247   FYMRQNDDGKTVAAMDMLVPRVGELIGGSQREERLEYLEERLDNLNLNKESFWWYLDLRR  306

Query  1676  YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS
Sbjct  307   YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  344



>ref|XP_001421099.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99392.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=503

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/479 (62%), Positives = 384/479 (80%), Gaps = 5/479 (1%)
 Frame = +2

Query  359   FRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQ  538
             + R  RIA +KG  D G  R+GE L +RGW R++R Q  + FI++NDGS +S MQ V+++
Sbjct  25    YGRPERIARVKGN-DGGASRVGEALELRGWARSVRTQKGMAFIDLNDGSAISGMQAVVNE  83

Query  539   DAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRV  715
              +  +D ++ G + TGA++ ++G + +S G KQ  EL V ++ ++G +DP ++P+QKKR 
Sbjct  84    GSAAWDALDAGGVSTGAALRVKGKLVASPGGKQAAELAVEEIDVIGTADPETYPLQKKRH  143

Query  716   SREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQ  895
             + E+LR+ AHLRPRTNT GAVARVRN LA+ATH FFQE+GF++ ++PI+TASDCEGAGEQ
Sbjct  144   TLEYLRSIAHLRPRTNTIGAVARVRNQLAYATHTFFQEHGFLYANTPIITASDCEGAGEQ  203

Query  896   FCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDV  1075
             F VTTL+   K   N P +++PK + GS+D+SQDFFGKP++LTVSGQLN E  A A+ND+
Sbjct  204   FQVTTLVEALK--NNRPSSDLPKNKDGSIDYSQDFFGKPSYLTVSGQLNGEIMACAVNDI  261

Query  1076  YTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDME  1255
             YTFGPTFRAENSNTSRHLAEFWM+EPELAFADL DDM CA AYL+Y + ++L++C ED+E
Sbjct  262   YTFGPTFRAENSNTSRHLAEFWMVEPELAFADLNDDMDCAEAYLKYCLNHVLEHCDEDLE  321

Query  1256  FFNTWIEKGIIK-RLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYI  1432
             FF   I K  ++ RL +V  ++  ++TYT+A+E +L  KKKFEFP+ WG DLQSEHERYI
Sbjct  322   FFEKNISKDNLRERLRNVASQEFARITYTEAVEHVLNAKKKFEFPIEWGSDLQSEHERYI  381

Query  1433  TEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleyle  1612
             +EE F   PVI+RDYPKDIKAFYMR NDD KTVAAMD+LVPRVGEL+GGSQREERL+ LE
Sbjct  382   SEEVFKDRPVIVRDYPKDIKAFYMRLNDDNKTVAAMDVLVPRVGELMGGSQREERLDVLE  441

Query  1613  krlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +R++++ L KESYWWYLDLRRYGS PHAGFGLGFERLVQ+ TG++NIRDAIPFPR PGS
Sbjct  442   RRIEEVGLEKESYWWYLDLRRYGSQPHAGFGLGFERLVQYVTGVENIRDAIPFPRYPGS  500



>gb|EMT10339.1| Asparaginyl-tRNA synthetase, chloroplastic/mitochondrial [Aegilops 
tauschii]
Length=583

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/499 (65%), Positives = 368/499 (74%), Gaps = 95/499 (19%)
 Frame = +2

Query  488   EVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvkl-  664
             EVNDGSCLSNMQCV++ + EGY Q+++  I TGASV ++G +ASSQG KQK+ELKV K+ 
Sbjct  112   EVNDGSCLSNMQCVLTPETEGYGQIDS--INTGASVLVEGVVASSQGVKQKVELKVSKII  169

Query  665   -------------------------------------------vlvgkSDP-SFPIQKKR  712
                                                          +G+SDP SFPIQKKR
Sbjct  170   VHWYADFSLHPWYALSLQQSFRLNENCAIWVEQGQLWVWYNCRTKIGESDPTSFPIQKKR  229

Query  713   VSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGE  892
              SREFLRT AHLRPRTNTFGAVARVRNALA+ATHKFFQ++GF+WVSSPI+TASDCEGAGE
Sbjct  230   ASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDSGFIWVSSPIITASDCEGAGE  289

Query  893   QFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALND  1072
             QF VTTL+ NS E     VN IP ++ G VDWSQ                          
Sbjct  290   QFYVTTLLSNSAE-GGCLVNSIP-SKDGRVDWSQ--------------------------  321

Query  1073  VYTFGPTFRAENSNTSRHLAEFW--------------------MIEPELAFADLEDDMSC  1192
             +YTFGPTFRAENSNTSRHLAEFW                    MIEPELAFADL DDM+C
Sbjct  322   IYTFGPTFRAENSNTSRHLAEFWNLTFVNIEFTAFFVSCVLGKMIEPELAFADLNDDMAC  381

Query  1193  AAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkk  1372
             A+AYLQYVV+YIL+NCKEDM+FF+TW+EKGII RL++V EK  VQ++Y+DAI+LL+ + K
Sbjct  382   ASAYLQYVVKYILENCKEDMDFFDTWVEKGIIDRLNNVAEKNFVQMSYSDAIKLLIGSNK  441

Query  1373  kFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLV  1552
             KFEFPV WG DLQSEHERYITE AFGG PVIIRDYPK+IKAFYMR+NDDGKTVAAMD+LV
Sbjct  442   KFEFPVKWGLDLQSEHERYITEVAFGGSPVIIRDYPKEIKAFYMRQNDDGKTVAAMDLLV  501

Query  1553  PRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQF  1732
             PRVGELIGGSQREERL+YLE RLD+ NLNK+SYWWYLDLRRYGSVPHAGFGLGFERLVQF
Sbjct  502   PRVGELIGGSQREERLDYLEARLDESNLNKDSYWWYLDLRRYGSVPHAGFGLGFERLVQF  561

Query  1733  ATGIDNIRDAIPFPRTPGS  1789
             ATGIDNIRDAIPFPR PGS
Sbjct  562   ATGIDNIRDAIPFPRVPGS  580



>ref|WP_032125010.1| asparaginyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=467

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 359/474 (76%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R +I  +K    E    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q + + D  
Sbjct  2     RTKIKSLKYQSAEAQSFIGHEVTLKGWVRTVRNQKTFTFIEINDGSTLSNFQIIATPDIP  61

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSRE  724
             GY  + N L  TG SV I+GT+  S G +Q +E+   ++ ++GK DP  +P+QKKR + E
Sbjct  62    GYANLINQLS-TGVSVAIKGTVVESPGKEQSLEMHATEVTIIGKCDPEVYPLQKKRHTFE  120

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAV RVRNALAFATH+FFQ  GF+++ +P++T SDCEGAG+ F V
Sbjct  121   FLRTIAHLRPRTNTIGAVTRVRNALAFATHQFFQSKGFLYIHTPVITGSDCEGAGKMFQV  180

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL     +P N P     KT  G VD++QDFFGKPA+LTVSGQLN E YA AL+DVYTF
Sbjct  181   TTL-----DPANPP-----KTPQGKVDYTQDFFGKPAYLTVSGQLNGEIYACALSDVYTF  230

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFADL D+M CA AYL+YV++Y+LDNC+EDMEFFN
Sbjct  231   GPTFRAENSNTSRHLAEFWMIEPEMAFADLNDNMDCAEAYLKYVLRYVLDNCQEDMEFFN  290

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               +  G+I+RL  V+     + +YT A+ +L K  K FEFPV WG DLQSEHER++ EE 
Sbjct  291   KHVSPGVIERLEHVINTPFERASYTYAVRVLEKANKSFEFPVKWGLDLQSEHERFLAEEF  350

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYPK IKAFYMR N+D KTVAAMD+LVP+VGE+IGGSQREERL +LE +L 
Sbjct  351   FAK-PVILTDYPKQIKAFYMRTNEDNKTVAAMDVLVPKVGEIIGGSQREERLSHLEAKLR  409

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL  E YWWYL+LR+YGSVPHAGFG GFERLVQFATG++NIRD IPFPR PG
Sbjct  410   EFNLPAEEYWWYLELRKYGSVPHAGFGAGFERLVQFATGMENIRDVIPFPRYPG  463



>gb|KIA78175.1| Asparagine--tRNA ligase [Parachlamydia acanthamoebae]
Length=469

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/474 (60%), Positives = 364/474 (77%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R++I  +K  P +    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q V + D  
Sbjct  4     RMKIKQLKNPPADRPSPVGSDVTIKGWVRTVRNQKTFTFIEINDGSTLSNFQVVANPDLP  63

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y++    L  TG SV IQGT+  S G  Q +EL   ++ ++G  DP ++P+QKKR S E
Sbjct  64    NYERTMQELS-TGVSVAIQGTVVESPGKNQSLELVAKEVKIIGPCDPETYPLQKKRHSYE  122

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAVAR+RNAL+FATH FFQ+ GF+++ +PI+T+SDCEGAG+ F V
Sbjct  123   FLRTIAHLRPRTNTLGAVARIRNALSFATHLFFQKKGFLYIHTPIITSSDCEGAGKMFRV  182

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             +TL P++          +P+T+ G VD+S+DFF KP +LTVSGQL  E YA+AL+D+YTF
Sbjct  183   STLDPDA----------LPRTKEGKVDYSKDFFEKPTYLTVSGQLEGEIYASALSDIYTF  232

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFAD+ DDM CA  YL+Y V+Y+L++C+ED++FFN
Sbjct  233   GPTFRAENSNTSRHLAEFWMIEPEMAFADINDDMDCAEEYLKYTVKYVLEHCEEDIDFFN  292

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              ++  G+ +RL  +V     + +Y+ A+ +L K  K FE+PV WG DLQSEHER++ EE 
Sbjct  293   QYVSPGLRERLEHIVNTPFERASYSYAVRILEKANKPFEYPVKWGSDLQSEHERFLAEEY  352

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVII DYPK+IK+FYMR NDD KTVAAMD+LVPR+GE+IGGSQRE+RL+YL++RL 
Sbjct  353   FSK-PVIITDYPKEIKSFYMRLNDDEKTVAAMDVLVPRIGEIIGGSQREDRLDYLKQRLI  411

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL +E YWWYLDLR+YGSVPHAGFGLGFERLVQF TGI+NIRDAIPFPR PG
Sbjct  412   ENNLKEEDYWWYLDLRKYGSVPHAGFGLGFERLVQFVTGIENIRDAIPFPRFPG  465



>ref|WP_013924786.1| asparaginyl-tRNA synthetase [Parachlamydia acanthamoebae]
 ref|YP_004651946.1| asparaginyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
 emb|CCB86092.1| asparaginyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=467

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/474 (60%), Positives = 364/474 (77%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R++I  +K  P +    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q V + D  
Sbjct  2     RMKIKQLKNPPADRPSPVGSDVTIKGWVRTVRNQKTFTFIEINDGSTLSNFQVVANPDLP  61

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y++    L  TG SV IQGT+  S G  Q +EL   ++ ++G  DP ++P+QKKR S E
Sbjct  62    NYERTMQELS-TGVSVAIQGTVVESPGKNQSLELVAKEVKIIGPCDPETYPLQKKRHSYE  120

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAVAR+RNAL+FATH FFQ+ GF+++ +PI+T+SDCEGAG+ F V
Sbjct  121   FLRTIAHLRPRTNTLGAVARIRNALSFATHLFFQKKGFLYIHTPIITSSDCEGAGKMFRV  180

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             +TL P++          +P+T+ G VD+S+DFF KP +LTVSGQL  E YA+AL+D+YTF
Sbjct  181   STLDPDA----------LPRTKEGKVDYSKDFFEKPTYLTVSGQLEGEIYASALSDIYTF  230

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFAD+ DDM CA  YL+Y V+Y+L++C+ED++FFN
Sbjct  231   GPTFRAENSNTSRHLAEFWMIEPEMAFADINDDMDCAEEYLKYTVKYVLEHCEEDIDFFN  290

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              ++  G+ +RL  +V     + +Y+ A+ +L K  K FE+PV WG DLQSEHER++ EE 
Sbjct  291   QYVSPGLRERLEHIVNTPFERASYSYAVRILEKANKPFEYPVKWGSDLQSEHERFLAEEY  350

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVII DYPK+IK+FYMR NDD KTVAAMD+LVPR+GE+IGGSQRE+RL+YL++RL 
Sbjct  351   FSK-PVIITDYPKEIKSFYMRLNDDEKTVAAMDVLVPRIGEIIGGSQREDRLDYLKQRLI  409

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL +E YWWYLDLR+YGSVPHAGFGLGFERLVQF TGI+NIRDAIPFPR PG
Sbjct  410   ENNLKEEDYWWYLDLRKYGSVPHAGFGLGFERLVQFVTGIENIRDAIPFPRFPG  463



>gb|EFB42308.1| hypothetical protein pah_c012o020 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=465

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/473 (60%), Positives = 363/473 (77%), Gaps = 13/473 (3%)
 Frame = +2

Query  371   LRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             ++I  +K  P +    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q V + D   
Sbjct  1     MKIKQLKNPPADRPSPVGSDVTIKGWVRTVRNQKTFTFIEINDGSTLSNFQVVANPDLPN  60

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREF  727
             Y++    L  TG SV IQGT+  S G  Q +EL   ++ ++G  DP ++P+QKKR S EF
Sbjct  61    YERTMQELS-TGVSVAIQGTVVESPGKNQSLELVAKEVKIIGPCDPETYPLQKKRHSYEF  119

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT AHLRPRTNT GAVAR+RNAL+FATH FFQ+ GF+++ +PI+T+SDCEGAG+ F V+
Sbjct  120   LRTIAHLRPRTNTLGAVARIRNALSFATHLFFQKKGFLYIHTPIITSSDCEGAGKMFRVS  179

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
             TL P++          +P+T+ G VD+S+DFF KP +LTVSGQL  E YA+AL+D+YTFG
Sbjct  180   TLDPDA----------LPRTKEGKVDYSKDFFEKPTYLTVSGQLEGEIYASALSDIYTFG  229

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWMIEPE+AFAD+ DDM CA  YL+Y V+Y+L++C+ED++FFN 
Sbjct  230   PTFRAENSNTSRHLAEFWMIEPEMAFADINDDMDCAEEYLKYTVKYVLEHCEEDIDFFNQ  289

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
             ++  G+ +RL  +V     + +Y+ A+ +L K  K FE+PV WG DLQSEHER++ EE F
Sbjct  290   YVSPGLRERLEHIVNTPFERASYSYAVRILEKANKPFEYPVKWGSDLQSEHERFLAEEYF  349

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                PVII DYPK+IK+FYMR NDD KTVAAMD+LVPR+GE+IGGSQRE+RL+YL++RL +
Sbjct  350   SK-PVIITDYPKEIKSFYMRLNDDEKTVAAMDVLVPRIGEIIGGSQREDRLDYLKQRLIE  408

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
              NL +E YWWYLDLR+YGSVPHAGFGLGFERLVQF TGI+NIRDAIPFPR PG
Sbjct  409   NNLKEEDYWWYLDLRKYGSVPHAGFGLGFERLVQFVTGIENIRDAIPFPRFPG  461



>ref|WP_011174896.1| asparaginyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 ref|YP_007345.1| asparaginyl-tRNA synthetase [Candidatus Protochlamydia amoebophila 
UWE25]
 sp|Q6MEC9.1|SYN_PARUW RecName: Full=Asparagine--tRNA ligase; AltName: Full=Asparaginyl-tRNA 
synthetase; Short=AsnRS [Candidatus Protochlamydia 
amoebophila UWE25]
 emb|CAF23070.1| probable asparagine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=467

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/474 (61%), Positives = 356/474 (75%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R +I  ++G   E    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q + + D  
Sbjct  2     RTKIKSLRGTTPEVRALIGHDITLKGWVRTVRNQKTFTFIEINDGSTLSNFQIIATPDIA  61

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSRE  724
             GYDQ+ N L  TG SV   GTI  S G +Q +E++   + ++GK DP  + +QKKR + E
Sbjct  62    GYDQLINQLS-TGVSVSAIGTIVESPGKEQNLEMQATAITIIGKCDPEVYLLQKKRHTFE  120

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPRTNT GAV RVRNALAFATH+FFQ+ GF+++ +PI+T SDCEGAG+ F V
Sbjct  121   FLRSIAHLRPRTNTIGAVTRVRNALAFATHQFFQKRGFLYIHTPIITGSDCEGAGKMFQV  180

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL  N+  P  +P         G VD++QDFFGKP +LTVSGQLN E YA AL+DVYTF
Sbjct  181   TTLDQNN--PARTP--------EGRVDYTQDFFGKPTYLTVSGQLNGEIYACALSDVYTF  230

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFADL D+M CA  YL+Y+++Y+LDNC+EDMEFFN
Sbjct  231   GPTFRAENSNTSRHLAEFWMIEPEMAFADLNDNMDCAEDYLKYILKYVLDNCQEDMEFFN  290

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               +   +I RL  V+     + +YT A+ +L K  KKFE+PV WG DLQSEHER++ EE 
Sbjct  291   KHVATDLISRLEHVINTSFERASYTYAVRILEKADKKFEYPVKWGLDLQSEHERFLAEEF  350

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PVI+ DYPKDIKAFYMR N+D KTVAAMD+LVP+VGE+IGGSQREERL  LE +L 
Sbjct  351   FGK-PVILTDYPKDIKAFYMRTNEDNKTVAAMDVLVPKVGEIIGGSQREERLSVLESKLK  409

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL  E YWWYL+LR++GSVPH+GFG GFERLVQF TG++NIRD IPFPR PG
Sbjct  410   EFNLPAEEYWWYLELRKFGSVPHSGFGAGFERLVQFTTGMENIRDVIPFPRHPG  463



>ref|WP_039356604.1| asparaginyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=467

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/474 (61%), Positives = 356/474 (75%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R +I  ++G   E    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q + + D  
Sbjct  2     RTKIKSLRGTTPEVRALIGHDITLKGWVRTVRNQKTFTFIEINDGSTLSNFQIIATPDIA  61

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSRE  724
             GYDQ+ N L  TG SV   GTI  S G +Q +E++   + ++GK DP  + +QKKR + E
Sbjct  62    GYDQLINQLS-TGVSVSAIGTIVESPGKEQNLEMQATAITIIGKCDPEVYLLQKKRHTFE  120

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPRTNT GAV RVRNALAFATH+FFQ+ GF+++ +PI+T SDCEGAG+ F V
Sbjct  121   FLRSIAHLRPRTNTIGAVTRVRNALAFATHQFFQKRGFLYIHTPIITGSDCEGAGKMFQV  180

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL  N+  P  +P         G VD++QDFFGKP +LTVSGQLN E YA AL+DVYTF
Sbjct  181   TTLDQNN--PARTP--------EGRVDYTQDFFGKPTYLTVSGQLNGEIYACALSDVYTF  230

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFADL D+M CA  YL+Y+++Y+LDNC+EDMEFFN
Sbjct  231   GPTFRAENSNTSRHLAEFWMIEPEMAFADLNDNMDCAEDYLKYILKYVLDNCQEDMEFFN  290

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               +   +I RL  V+     + +YT A+ +L K  KKFE+PV WG DLQSEHER++ EE 
Sbjct  291   KHVATDLISRLEHVINTSFERASYTYAVRILEKADKKFEYPVKWGLDLQSEHERFLAEEF  350

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PVI+ DYPKDIKAFYMR N+D KTVAAMD+LVP+VGE+IGGSQREERL  LE +L 
Sbjct  351   FGK-PVILTDYPKDIKAFYMRTNEDNKTVAAMDVLVPKVGEIIGGSQREERLSVLESKLR  409

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL  E YWWYL+LR++GSVPH+GFG GFERLVQF TG++NIRD IPFPR PG
Sbjct  410   EFNLPAEEYWWYLELRKFGSVPHSGFGAGFERLVQFTTGMENIRDVIPFPRHPG  463



>gb|KIC73525.1| Asparagine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=469

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/474 (61%), Positives = 356/474 (75%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R +I  ++G   E    +G  + ++GWVRT+R Q + TFIE+NDGS LSN Q + + D  
Sbjct  4     RTKIKSLRGTTPEVRALIGHDITLKGWVRTVRNQKTFTFIEINDGSTLSNFQIIATPDIA  63

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSRE  724
             GYDQ+ N L  TG SV   GTI  S G +Q +E++   + ++GK DP  + +QKKR + E
Sbjct  64    GYDQLINQLS-TGVSVSAIGTIVESPGKEQNLEMQATAITIIGKCDPEVYLLQKKRHTFE  122

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPRTNT GAV RVRNALAFATH+FFQ+ GF+++ +PI+T SDCEGAG+ F V
Sbjct  123   FLRSIAHLRPRTNTIGAVTRVRNALAFATHQFFQKRGFLYIHTPIITGSDCEGAGKMFQV  182

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL  N+  P  +P         G VD++QDFFGKP +LTVSGQLN E YA AL+DVYTF
Sbjct  183   TTLDQNN--PARTP--------EGRVDYTQDFFGKPTYLTVSGQLNGEIYACALSDVYTF  232

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AFADL D+M CA  YL+Y+++Y+LDNC+EDMEFFN
Sbjct  233   GPTFRAENSNTSRHLAEFWMIEPEMAFADLNDNMDCAEDYLKYILKYVLDNCQEDMEFFN  292

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               +   +I RL  V+     + +YT A+ +L K  KKFE+PV WG DLQSEHER++ EE 
Sbjct  293   KHVATDLISRLEHVINTSFERASYTYAVRILEKADKKFEYPVKWGLDLQSEHERFLAEEF  352

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PVI+ DYPKDIKAFYMR N+D KTVAAMD+LVP+VGE+IGGSQREERL  LE +L 
Sbjct  353   FGK-PVILTDYPKDIKAFYMRTNEDNKTVAAMDVLVPKVGEIIGGSQREERLSVLESKLR  411

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             + NL  E YWWYL+LR++GSVPH+GFG GFERLVQF TG++NIRD IPFPR PG
Sbjct  412   EFNLPAEEYWWYLELRKFGSVPHSGFGAGFERLVQFTTGMENIRDVIPFPRHPG  465



>emb|CDZ80908.1| Asparagine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=465

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/476 (60%), Positives = 364/476 (76%), Gaps = 20/476 (4%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRL-GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQ-D  541
             R RI +I+       D+L G  + ++GWVRT+R Q +  FIE+NDGS LSN Q V +  +
Sbjct  3     RTRIKEIQKN-----DQLIGSEIELKGWVRTVRNQKTFCFIEINDGSTLSNFQIVANAGE  57

Query  542   AEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgk-SDPSFPIQKKRVS  718
                YD +    I TGAS+ ++G I  S G  Q +E +   + ++G  S   + +QKKR S
Sbjct  58    IPNYDTLL-AQITTGASISVKGKIVQSPGKNQSVECQASSIEVLGTCSAEEYLLQKKRHS  116

Query  719   REFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQF  898
              EFLRT AHLRPRTNT GAVARVR+ALAFATHKFFQE GF+W+++PI+TASDCEGAG+ F
Sbjct  117   FEFLRTIAHLRPRTNTLGAVARVRSALAFATHKFFQEKGFLWINTPIITASDCEGAGKMF  176

Query  899   CVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVY  1078
              VTTL           ++++PK + G +D+S+DFF KPAFLTVSGQLN E +A AL+DVY
Sbjct  177   QVTTL----------EMDKLPKNQQGQIDYSKDFFEKPAFLTVSGQLNGEIFACALSDVY  226

Query  1079  TFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEF  1258
             TFGPTFRAENSNTSRHLAEFWMIEPE+AFAD+ D+M CA AYL+YV++Y+L+NC EDMEF
Sbjct  227   TFGPTFRAENSNTSRHLAEFWMIEPEMAFADIFDNMDCAEAYLKYVIKYVLENCAEDMEF  286

Query  1259  FNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITE  1438
             FN  I  G+++ L+ V++    +++YT AIE+L K+ KKFE+PV WG DLQSEHERY+ E
Sbjct  287   FNKMIAPGLLENLTLVMDTPFERVSYTKAIEILEKSNKKFEYPVKWGTDLQSEHERYLAE  346

Query  1439  EAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekr  1618
             E F   PVI+ DYP++IKAFYMR N+DGKTVAAMD+LVP++GE+IGGSQREERL+ L ++
Sbjct  347   EYFKK-PVILIDYPQEIKAFYMRSNEDGKTVAAMDVLVPKIGEIIGGSQREERLDVLLEK  405

Query  1619  lddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             +   NL+ E YWWYL+LR+YGSVPHAGFG+GFERLVQFATG++NIRD  PFPR PG
Sbjct  406   MKKFNLHPEDYWWYLELRKYGSVPHAGFGVGFERLVQFATGMENIRDVNPFPRYPG  461



>ref|XP_001422855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01214.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=448

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/445 (62%), Positives = 358/445 (80%), Gaps = 7/445 (2%)
 Frame = +2

Query  476   VTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkv  655
             + FI++NDGS +S MQ V+++ +  +D ++ G + TGA++ ++G + +S G KQ  EL V
Sbjct  1     MAFIDLNDGSAISGMQAVVNEGSAAWDALDAGGVSTGAALRVKGKLVASPGGKQAAELAV  60

Query  656   vklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQEN  832
              ++ ++G +DP ++P+QKKR + E+LR+ AHLRPRTNT GAVARVRN LA+ATH FFQE+
Sbjct  61    EEIDVIGTADPETYPLQKKRHTLEYLRSIAHLRPRTNTIGAVARVRNQLAYATHTFFQEH  120

Query  833   GFVWVSSPIVTASDCEGAGEQFCVTTLIPN-SKEPTNSPVNEIPKTES----GSVDWSQD  997
             GF++ ++PI+TASDCEGAGEQF VTTL+         +P + + + E+    GS+D+SQD
Sbjct  121   GFLYANTPIITASDCEGAGEQFQVTTLLNGFGAGEWTTPASVVDEQEAMNKDGSIDYSQD  180

Query  998   FFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLE  1177
             FFGKP++LTVSGQLN E  A A+ND+YTFGPTFRAENSNTSRHLAEFWM+EPELAFADL 
Sbjct  181   FFGKPSYLTVSGQLNGEIMACAVNDIYTFGPTFRAENSNTSRHLAEFWMVEPELAFADLN  240

Query  1178  DDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIK-RLSDVVEKKVVQLTYTDAIEl  1354
             DDM CA AYL+Y + ++L++C ED+EFF   I K  ++ RL +V  ++  ++TYT+A+E 
Sbjct  241   DDMDCAEAYLKYCLNHVLEHCDEDLEFFEKNISKDNLRERLRNVASQEFARITYTEAVEH  300

Query  1355  llktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVA  1534
             +L  KKKFEFP+ WG DLQSEHERYI+EE F   PVI+RDYPKDIKAFYMR NDD KTVA
Sbjct  301   VLNAKKKFEFPIEWGSDLQSEHERYISEEVFKDRPVIVRDYPKDIKAFYMRLNDDNKTVA  360

Query  1535  AMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGF  1714
             AMD+LVPRVGEL+GGSQREERL+ LE+R++++ L KESYWWYLDLRRYGS PHAGFGLGF
Sbjct  361   AMDVLVPRVGELMGGSQREERLDVLERRIEEVGLEKESYWWYLDLRRYGSQPHAGFGLGF  420

Query  1715  ERLVQFATGIDNIRDAIPFPRTPGS  1789
             ERLVQ+ TG++NIRDAIPFPR PGS
Sbjct  421   ERLVQYVTGVENIRDAIPFPRYPGS  445



>emb|CDR32992.1| Asparaginyl-tRNA synthetase [Criblamydia sequanensis CRIB-18]
Length=465

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 364/475 (77%), Gaps = 15/475 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R+++  IK G ++    LG+ + V+GW+RT+R Q + +F+E+NDGS L+++Q V+ Q   
Sbjct  2     RVKVKQIKSGGEKNA-FLGKEVTVKGWIRTVRNQKTFSFVELNDGSSLTSLQIVVDQKLP  60

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y ++ + L  TGAS+   G I      KQ +E+    L ++GK DP ++P+QKKR S E
Sbjct  61    NYAELISDLN-TGASIAATGKIVEGVDKKQ-LEMHADSLEIIGKCDPETYPLQKKRHSFE  118

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAVAR+RNALA+ATH+FFQ+ GF++V +PI+T SDCEGAG+ F V
Sbjct  119   FLRTIAHLRPRTNTLGAVARIRNALAYATHQFFQDRGFLYVHTPIITTSDCEGAGQLFQV  178

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL           V+ +PKT+ G +D+S+DFF KPA+LTVSGQL  E YA+A++D+YTF
Sbjct  179   TTL----------NVDNLPKTKEGKIDYSKDFFQKPAYLTVSGQLEGEIYASAVSDIYTF  228

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNT+RHLAEFWMIEPE+AFAD+ D+M    AYL++V QY+LDNC+EDM FFN
Sbjct  229   GPTFRAENSNTARHLAEFWMIEPEMAFADINDNMDNVEAYLKFVFQYVLDNCREDMLFFN  288

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              +I  G++  L  +V     + +YT A+ +L K+ + F+FP+ WG DLQSEHERY+ E+ 
Sbjct  289   KYISPGVLDTLQKIVGTPFERASYTYAVRILEKSGENFQFPIKWGMDLQSEHERYLVEKF  348

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVII DYPKDIKAFYM+EN+DGKTVAAMD+LVP+VGEL+GGSQRE+RL+ LE++L+
Sbjct  349   FDK-PVIITDYPKDIKAFYMKENNDGKTVAAMDVLVPKVGELVGGSQREDRLDILEEKLE  407

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                L K++YWWYL+LR+YGS+PHAG+G+GFERL++F TG++NIRD IPFPR PGS
Sbjct  408   RQGLPKDNYWWYLELRKYGSIPHAGYGVGFERLIRFVTGMENIRDVIPFPRYPGS  462



>ref|WP_015191718.1| asparaginyl-tRNA synthetase [Stanieria cyanosphaera]
 ref|YP_007131011.1| asparaginyl-tRNA synthetase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34045.1| asparaginyl-tRNA synthetase [Stanieria cyanosphaera PCC 7437]
Length=463

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 352/484 (73%), Gaps = 27/484 (6%)
 Frame = +2

Query  341   SRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNM  520
             +R+I E  R        G PDE       ++ ++GWVRT R     +F+EVNDGS L+N+
Sbjct  3     TRRIVELLR-------NGQPDE-------SVTIQGWVRTKRELKDFSFMEVNDGSSLANL  48

Query  521   QCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFP  697
             Q V+      Y+Q+    I TGASV + GT+ +S G  Q IELK     + G++DP ++P
Sbjct  49    QVVLDASLPDYEQLLKK-INTGASVEVSGTLVASVGKGQTIELKADSAQVYGEADPETYP  107

Query  698   IQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDC  877
             +QKKR S EFLR  +HLR RTNT GAV RVRNA A A H+FFQ+ GF+W+ SPI+TASDC
Sbjct  108   LQKKRHSFEFLRNISHLRSRTNTLGAVFRVRNACAAAIHQFFQDRGFLWIHSPIITASDC  167

Query  878   EGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYA  1057
             EGAGE F VT+L           +N+IPKT  G VD+SQDFFGKPA+LTVSGQL AE  A
Sbjct  168   EGAGELFTVTSL----------DLNKIPKTPQGEVDYSQDFFGKPAYLTVSGQLQAEVMA  217

Query  1058  TALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDN  1237
              A  +VYTFGPTFRAENSNTSRHLAEFWM+EPE+AF DLE D + A  +L+Y+ QY+LD 
Sbjct  218   MAFQNVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDQNLAEEFLKYMFQYVLDR  277

Query  1238  CKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSE  1417
             C EDMEFFN W+++ ++    +++  +  ++TYT+AI LL K  KKFEFPV WG DLQSE
Sbjct  278   CPEDMEFFNKWVDQTVLATADNIINNEFERITYTEAINLLEKADKKFEFPVQWGIDLQSE  337

Query  1418  HERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreer  1597
             HERY+ EE F   P+I+ +YPK+IKAFYMR NDDGKTVAAMD+L P++GE+IGGSQREER
Sbjct  338   HERYLAEELFKK-PLIVTNYPKEIKAFYMRLNDDGKTVAAMDVLAPKIGEIIGGSQREER  396

Query  1598  leylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR  1777
                LE+R+  L++  +S WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR
Sbjct  397   FAVLEERIQALDMETDSLWWYLDLRRYGTVPHAGFGLGFERIVQFMTGMGNIRDVIPFPR  456

Query  1778  TPGS  1789
             TP S
Sbjct  457   TPLS  460



>ref|XP_005713545.1| asparagine--tRNA ligase, chloroplast precursor [Chondrus crispus]
 emb|CDF33726.1| asparagine--tRNA ligase, chloroplast precursor [Chondrus crispus]
Length=544

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/491 (58%), Positives = 360/491 (73%), Gaps = 21/491 (4%)
 Frame = +2

Query  365   RRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             +R R+  ++  PDE  D +G TLVV+GWVRT+R Q    F+ +NDGS L+ +Q V+    
Sbjct  56    QRWRVRTVQEAPDE--DIVGRTLVVKGWVRTVRDQKKFAFLNLNDGSSLAGLQVVVDGGT  113

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSRE  724
               Y+ ++   + TG S+   G I  S G  Q +E+K   L L+G SD ++P+QKKR + E
Sbjct  114   PAYEVIQK--LTTGCSIAATGEIVRSLGKGQALEMKAQHLELIGTSDSAYPLQKKRHTLE  171

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR  AHLRPRTN+ GA+ARVR+ALAFATH+FF E GF++++SPI+TASDCEGAGE F V
Sbjct  172   FLRGIAHLRPRTNSIGAMARVRSALAFATHQFFTEQGFLYLNSPIITASDCEGAGEMFRV  231

Query  905   TTLIPNSKEPTNSPVNEIP-------KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATA  1063
             TT IP   + +  PV             +SG VD+S+DFFGKPAFLTVSGQL+AETYA+A
Sbjct  232   TTAIPMDPKASGIPVLSQADEQASGDAVKSGDVDFSKDFFGKPAFLTVSGQLSAETYASA  291

Query  1064  LNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCK  1243
             L+DVYTFGPTFRAENSNTSRHLAEFWMIEPE+AFA L DDMS A AY++YV   +L  C 
Sbjct  292   LSDVYTFGPTFRAENSNTSRHLAEFWMIEPEMAFASLADDMSNAEAYIKYVTTRVLTQCT  351

Query  1244  EDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkk-------kFEFPVNWGC  1402
             +D+EFF+ ++E G++++L  V+ +   ++TYT+A+ELL K  K       +FEF ++WGC
Sbjct  352   KDLEFFDKYVEPGLLEKLRVVMNESFARVTYTEAVELLEKANKRNKKGKRRFEFDISWGC  411

Query  1403  DLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMREN--DDGKTVAAMDMLVPRVGELIG  1576
             D QSEHERY+ EE F   PV + +YP  IKAFYMREN  D G+TV AMD+LVP +GELIG
Sbjct  412   DFQSEHERYLAEEHFKR-PVFVYNYPSGIKAFYMRENDGDGGQTVEAMDLLVPGIGELIG  470

Query  1577  GSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIR  1756
             GS RE+RL  LE+++    L KE+YWWYLDLRRYGSVPHAG+GLGFERL+QF TG+DNIR
Sbjct  471   GSAREDRLNVLERKMRASGLEKEAYWWYLDLRRYGSVPHAGYGLGFERLIQFVTGLDNIR  530

Query  1757  DAIPFPRTPGS  1789
             D IPFPR PGS
Sbjct  531   DVIPFPRYPGS  541



>ref|WP_036478667.1| asparaginyl-tRNA synthetase [Myxosarcina sp. GI1]
Length=463

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/473 (60%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       T  ++GWVRT R   +  F E+NDGS L+ +Q V+  D  
Sbjct  5     RIAEILKHGQPDE-------TATIKGWVRTKRELKNFAFSEINDGSSLAGLQVVLDADLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              YD +   L  TGA+V + GT+  S G  QKIELK   + + G++DP ++P+QKKR S E
Sbjct  58    NYDTILKQLA-TGAAVEVTGTLVESPGKGQKIELKANSVTVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT +HLR RTNT GAV RVRNA A A H+FFQE  F+W+ SPI+TASDCEGAGE F V
Sbjct  117   FLRTISHLRSRTNTLGAVFRVRNACANAIHQFFQERHFLWIHSPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           + ++PKTESG VD++QDFFGKPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------NLKDVPKTESGEVDYTQDFFGKPAYLTVSGQLQAEVMALAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE D + A  +L+Y+ +Y+LDNC EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDQNLAEEFLKYIFKYVLDNCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              W++K ++ +  +++  +  ++TYT+A+ LL K KKKFEFPV+WG DLQSEHERY+ EE 
Sbjct  287   KWVDKTLLAKAENIINSEFERVTYTEAVALLEKAKKKFEFPVSWGIDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P II +YPK+IKAFYMR +DD KTVAAMD++ P +GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FHK-PAIITNYPKEIKAFYMRLDDDEKTVAAMDVIAPGIGEIIGGSQREERLDILEKRIA  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             + N+  +  WWYLDLRRYGSVPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   EANIIADDLWWYLDLRRYGSVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP  458



>gb|KIC76212.1| Asparagine--tRNA ligase [Neochlamydia sp. EPS4]
Length=469

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 356/475 (75%), Gaps = 15/475 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGL-DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             R++I  +K  P  G+   LG+ + ++GWVRT+R Q + +F EVNDGS LSN Q +++ D 
Sbjct  4     RIKIKQLKY-PAPGVPSLLGQEVTIKGWVRTVRNQKTFSFAEVNDGSTLSNFQVILNPDL  62

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSR  721
               Y+++ + L  TG SV + G I  + G  Q  E++   L ++G  DP  +P+QKKR S 
Sbjct  63    PDYEKILSHLS-TGVSVAVVGKIVENPGKDQAWEMQAKSLTIIGTCDPEVYPLQKKRHSF  121

Query  722   EFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFC  901
             EFLR+ AHLRPRTNT GA+ R+RN+LAFATH F+Q+ GF+++ +P++TASDCEGAG+ F 
Sbjct  122   EFLRSIAHLRPRTNTLGAITRLRNSLAFATHLFYQQKGFLYLHTPVITASDCEGAGKMFR  181

Query  902   VTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             VTTL P++           P   +G VD+SQDFFGKPA+LTVSGQLN E YA+AL+DVYT
Sbjct  182   VTTLDPSA----------TPHLPNGQVDYSQDFFGKPAYLTVSGQLNGEIYASALSDVYT  231

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWMIEPE+AFAD+ D+M  A  YL++V++Y LDNC EDMEFF
Sbjct  232   FGPTFRAENSNTSRHLAEFWMIEPEMAFADINDNMDNAEEYLKFVLKYALDNCAEDMEFF  291

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             +  +  G+I+RL  V+     + TY+ A+ +L K+ K FE+PV WG DLQSEHERY+ EE
Sbjct  292   DKHVSTGLIERLQHVINTPFERATYSYAVRILEKSGKNFEYPVKWGLDLQSEHERYLAEE  351

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   PVI+ DYPK IKAFYMR+N D KTVAAMD+LVP++GE+IGGSQREERL+ LE +L
Sbjct  352   FFAK-PVILTDYPKQIKAFYMRDNSDNKTVAAMDVLVPKIGEIIGGSQREERLDVLEHKL  410

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
                 L+ + YWWYL+LR+YG+VPHAG+G+GFERL+QF +G++NIRD IPFPR PG
Sbjct  411   KAGGLSPDDYWWYLELRKYGTVPHAGYGVGFERLIQFVSGMENIRDVIPFPRYPG  465



>ref|WP_013182621.1| asparaginyl-tRNA synthetase [Waddlia chondrophila]
 ref|YP_003709920.1| asparaginyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 gb|ADI38914.1| asparaginyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90418.1| Asparaginyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=467

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 355/474 (75%), Gaps = 13/474 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R +I D+K  P    + +G+ + ++GWVRT+R Q + TFIEVNDGS LSN Q +   +  
Sbjct  2     RTKIKDLKNPPKGFQEIIGKEVTIKGWVRTVRNQKTFTFIEVNDGSTLSNFQVIADPEIP  61

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSRE  724
              Y ++   L  TG SV I+G I  S G  Q +E++   + ++G  D  ++P+QKKR S E
Sbjct  62    NYQKLAEQLT-TGTSVSIEGAIVESPGKGQAVEMQAKSIQIIGSCDVENYPLQKKRHSFE  120

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPRTNT GAVARVR+ALA+ATHKFFQE GF++V +P++TASDCEGAGE F V
Sbjct  121   FLRSIAHLRPRTNTLGAVARVRSALAYATHKFFQEKGFIYVQTPVITASDCEGAGELFRV  180

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             +TL P           + P+ E G +D+S+DFF +PAFLTVSGQLN E +A + +D+YTF
Sbjct  181   STLDPE----------KAPRNEQGGIDYSKDFFERPAFLTVSGQLNGEIFALSHSDIYTF  230

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A AY+++++QY++DNC+ED+EFF+
Sbjct  231   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDMDMDNAEAYVKFLLQYLMDNCQEDLEFFD  290

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              +I KG+I RL  ++E    + +YT A+ +L K+ ++F++PV WG DLQSEHERY++E+ 
Sbjct  291   KFISKGLIDRLKLIIETSFERASYTYAMRILEKSGERFDYPVRWGLDLQSEHERYLSEKY  350

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PV I DYPK+IK FYMR NDD KTVA MD+L P++GE+IGGSQREER  YL++R+ 
Sbjct  351   FNK-PVFITDYPKEIKPFYMRLNDDEKTVANMDLLFPKIGEIIGGSQREERHGYLKERMK  409

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             +  +N + YWWY++LR YG+ PHAG+GLGFER+VQFATG++NIRD I FPR PG
Sbjct  410   EAKMNLDDYWWYMELREYGTAPHAGYGLGFERMVQFATGVENIRDVIAFPRYPG  463



>ref|WP_006507577.1| asparaginyl-tRNA synthetase [Xenococcus sp. PCC 7305]
 gb|ELS05333.1| asparaginyl-tRNA synthetase [Xenococcus sp. PCC 7305]
Length=463

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R+ADI   G PDE        ++++GWVRT RA     F EVNDGS L+ +Q V+  +  
Sbjct  5     RVADILKNGQPDE-------KVIIKGWVRTKRALKGFAFAEVNDGSSLAGLQVVLDGEVP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +    I TGAS+ + GT+ +SQG  QKIELK    ++ G++DP ++P+QKKR S E
Sbjct  58    EYETLLKK-INTGASIEVSGTLVASQGKGQKIELKADSAIIYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT +HLR RTNT GAV RVRNA A A H+FFQ+ GF+W+ SPI+TASDCEGAGE F V
Sbjct  117   FLRTISHLRSRTNTLGAVFRVRNACAAAIHQFFQDKGFLWIHSPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +N++P+ E G VD++QDFFGKPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFDLNKLPQNEQGQVDFTQDFFGKPAYLTVSGQLQAEVMAMAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DLE D + A  +L+Y+ Q++LD C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGDQNLAEEFLKYIFQFVLDKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              W++K I+    +++  +  ++TYT+AI LL K  KKFEFPV WG DLQSEHERY+ EE 
Sbjct  287   KWVDKTILATADNIINNEFARITYTEAIALLEKADKKFEFPVEWGIDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ +YPKDIKAFYMR +D  KTVAAMD+L P +GE+IGGSQREERL+ LE+R++
Sbjct  347   FKK-PAIVTNYPKDIKAFYMRLDDGEKTVAAMDVLAPNIGEIIGGSQREERLDVLERRIE  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             ++N+  ES  WYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   EMNIEAESIGWYLDLRRYGTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP  458



>ref|WP_017652700.1| asparaginyl-tRNA synthetase [Microchaete sp. PCC 7126]
Length=463

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +L+V+GWVRT R      FIEVNDGS L+N+Q V+ QD  
Sbjct  5     RIAEILRNGQPDE-------SLLVQGWVRTKRDLKGFAFIEVNDGSSLANLQIVIHQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + GT+ +SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYETIVKQLN-TGASVEVTGTLVASQGKGQRIELKAETVKVHGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTN+FGAV RVRNA + A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNSFGAVFRVRNACSTAIHQFFQERGFLWIHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             ++L           +  IP+T + +VD+SQDFFGKP +LTVSGQL AE  A A  +VYTF
Sbjct  177   SSL----------DLKNIPRTPNQAVDYSQDFFGKPTYLTVSGQLEAEVMAMAFANVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+++ +Y+L+ C+EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHIFKYVLETCREDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYT+AI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATADNIINNQFERLTYTEAIKLLEKANVKFEYPVSWGLDLQSEHERYLAEQQ  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTV AMD+L P++GE+IGGSQREERLE LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVRAMDILAPKIGEIIGGSQREERLEVLEKRIT  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMANIRDVIPFPRTP  458



>ref|WP_015139158.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7524]
 ref|YP_007076319.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7524]
 gb|AFY48722.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7524]
Length=463

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 349/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +LVV+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIAEILRSGQPDE-------SLVVQGWVRTKRDLKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV ++G + +SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYEAILKQLN-TGASVEVKGVLVASQGKGQRIELKAEAVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSAAIHQFFQERGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+SQDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQAVDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L+++  Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDGDMDLAEAFLKHIFSYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYTDAI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATAENIINNQFERLTYTDAIKLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTV AMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVRAMDILAPKIGEIIGGSQREERLDVLERRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_039383095.1| asparaginyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC77238.1| Asparagine--tRNA ligase [Neochlamydia sp. TUME1]
Length=467

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/475 (57%), Positives = 356/475 (75%), Gaps = 15/475 (3%)
 Frame = +2

Query  368   RLRIADIKGGPDEGL-DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             R++I  +K  P  G+   LG+ + ++GWVRT+R Q + +F EVNDGS LSN Q +++ D 
Sbjct  2     RVKIKQLKY-PAPGVPSLLGQEVTIKGWVRTVRNQKTFSFAEVNDGSTLSNFQVILNPDL  60

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSR  721
               Y+++ + L  TG SV + G I  + G  Q  E++   L ++G  DP  +P+QKKR S 
Sbjct  61    PDYEKILSHLS-TGVSVAVVGKIVENPGKDQAWEMQAKSLTIIGTCDPEVYPLQKKRHSF  119

Query  722   EFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFC  901
             EFLR+ AHLRPRTNT GA+ R+RN+LAFATH F+Q+ GF+++ +P++TASDCEGAG+ F 
Sbjct  120   EFLRSIAHLRPRTNTLGAITRLRNSLAFATHLFYQQKGFLYLHTPVITASDCEGAGKMFR  179

Query  902   VTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             VTTL P++           P   +G VD+SQDFFGKPA+LTVSGQLN E YA+AL+DVYT
Sbjct  180   VTTLDPSA----------TPHLPNGQVDYSQDFFGKPAYLTVSGQLNGEIYASALSDVYT  229

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWMIEPE+AFAD+ D+M  A  YL++V++Y L+NC EDMEFF
Sbjct  230   FGPTFRAENSNTSRHLAEFWMIEPEMAFADINDNMDNAEEYLKFVLKYALNNCAEDMEFF  289

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             +  +  G+I+R+  V+     + TY+ A+ +L K+ K FE+PV WG DLQSEHERY+ EE
Sbjct  290   DKHVSTGLIERMQHVINTPFERATYSYAVRILEKSGKNFEYPVKWGLDLQSEHERYLAEE  349

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   PVI+ DYPK IKAFYMR+N D KTVAAMD+LVP++GE+IGGSQREERL+ LE +L
Sbjct  350   FFAK-PVILTDYPKQIKAFYMRDNSDNKTVAAMDVLVPKIGEIIGGSQREERLDVLEHKL  408

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
                 L+ + YWWYL+LR+YG+VPHAG+G+GFERL+QF +G++NIRD IPFPR PG
Sbjct  409   KAGGLSPDDYWWYLELRKYGTVPHAGYGVGFERLIQFVSGMENIRDVIPFPRYPG  463



>ref|WP_009344629.1| asparaginyl-tRNA synthetase [Raphidiopsis brookii]
 gb|EFA71552.1| Asparaginyl-tRNA synthetase, class IIb [Raphidiopsis brookii 
D9]
Length=463

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 345/456 (76%), Gaps = 13/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ETLVVRGWVRT R     TF+E+NDGSCL+N+Q V++QD   Y  +    I TGASV + 
Sbjct  17    ETLVVRGWVRTKRELKGFTFLEINDGSCLANLQIVINQDLPQYQTIIKQ-INTGASVEVG  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G + +SQG  Q+IELK   + + G +DP ++P+QKKR S EFLR+ AHLR RTN+FGAV 
Sbjct  76    GVLVASQGKGQRIELKAEGVKVYGDADPETYPLQKKRHSFEFLRSIAHLRSRTNSFGAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQ+ GF+WV +PI+TASDCEGAGE F VT+L           + +IP
Sbjct  136   RVRNACATAIHQFFQQRGFMWVHTPILTASDCEGAGELFSVTSL----------NLKDIP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             + E+  VD+SQDFFGKP +LTVSGQL AE  A A  +VYTFGPTFRAENS+TSRHLAEFW
Sbjct  186   RKENQEVDYSQDFFGKPTYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSHTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DLE DM+ A  +L+++ +Y+++NC++DMEFFN  I+  +++   ++V  + 
Sbjct  246   MVEPEMAFCDLEGDMNLAEDFLKHIFRYVMENCEQDMEFFNERIDNTVLETAENIVNNQF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +LTYTDAI++L K + KF++PV WG DLQSEHERY+ E+ F   PVI+ DYP  IKAFY
Sbjct  306   ERLTYTDAIQMLEKAEVKFDYPVEWGLDLQSEHERYLAEQLFKK-PVIVTDYPAQIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ N+D KTV AMD+L P++GE+IGGSQREERL+ LE+R+    +  E  WWYLDLRRYG
Sbjct  365   MKLNNDEKTVRAMDILAPKIGEIIGGSQREERLDILERRVLAQGMKPEDLWWYLDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  425   TVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_028973342.1| asparaginyl-tRNA synthetase [Spirochaeta cellobiosiphila]
Length=462

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 340/456 (75%), Gaps = 14/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + ++V+GW RT R   +  F+E+NDGS L N+Q  + +    ++ +    I TGASVW +
Sbjct  17    QAVIVQGWCRTKRDSKNHAFLELNDGSSLKNIQIFIDKSKHDFEDLSK--ISTGASVWTK  74

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  S G  Q +EL   +L ++G++  + +P+QKKR S EFLR  AHLR RTNTFGAV 
Sbjct  75    GLLVESPGQNQAVELHADELAIIGEAPAADYPLQKKRHSFEFLRDIAHLRTRTNTFGAVM  134

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNAL++A H++FQ N F +V +PI+TASDCEGAGE F VTT+           +N++P
Sbjct  135   RVRNALSYAVHQYFQNNSFQYVHTPIITASDCEGAGEMFQVTTM----------DLNKLP  184

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
              TE   +D+S DFFGK A LTVSGQLN ETYA AL DVYTFGPTFRAENSNTSRHLAEFW
Sbjct  185   LTEDKQIDYSHDFFGKEAHLTVSGQLNVETYAMALGDVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE++F D+E +M  A  +L++V+ Y+L+NC+EDM FFN WIEKGII  L  V+  + 
Sbjct  245   MIEPEMSFCDIEGNMDRAEDFLKFVLSYVLENCQEDMAFFNQWIEKGIIDNLKSVINSEF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +++YT+AI+ LL + KKFEFP+ WG DLQSEHE+Y+TEE + G PVI+ DYPK+IKAFY
Sbjct  305   HRISYTEAIDQLLASGKKFEFPIKWGEDLQSEHEKYLTEELYKG-PVIVTDYPKEIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ NDD KTV AMD+LVPR+GE+IGGS+RE   + L  R+    LN+E YWWYLDLR+YG
Sbjct  364   MKLNDDNKTVRAMDVLVPRLGEIIGGSEREWDYDKLLSRIKAAGLNEEDYWWYLDLRKYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             SVPH+GFGLGFERLVQ+ TG+ NIRD IPFPR PG+
Sbjct  424   SVPHSGFGLGFERLVQYVTGMQNIRDVIPFPRYPGN  459



>ref|WP_021360737.1| asparagine--tRNA ligase [Peptoclostridium difficile]
 gb|EQE05086.1| asparagine--tRNA ligase [Peptoclostridium difficile CD9]
 gb|EQE08647.1| asparagine--tRNA ligase [Peptoclostridium difficile CD8]
 gb|EQI96400.1| asparagine--tRNA ligase [Clostridium difficile P5]
 gb|EQJ06747.1| asparagine--tRNA ligase [Clostridium difficile P7]
 gb|EQJ17664.1| asparagine--tRNA ligase [Clostridium difficile P13]
 gb|EQJ79584.1| asparagine--tRNA ligase [Clostridium difficile P46]
 gb|EQJ83371.1| asparagine--tRNA ligase [Clostridium difficile P48]
 gb|EQJ96437.1| asparagine--tRNA ligase [Clostridium difficile P51]
 gb|EQK27660.1| asparagine--tRNA ligase [Clostridium difficile P73]
 gb|ERM34696.1| asparagine--tRNA ligase [Clostridium difficile P37]
 gb|ERM42355.1| asparagine--tRNA ligase [Clostridium difficile P68]
Length=465

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 346/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FIRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L++E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLSEEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_006277672.1| asparaginyl-tRNA synthetase [Cylindrospermopsis raciborskii]
 gb|EFA69367.1| Asparaginyl-tRNA synthetase, class IIb [Cylindrospermopsis raciborskii 
CS-505]
Length=463

 Score =   531 bits (1367),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 269/456 (59%), Positives = 345/456 (76%), Gaps = 13/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ETLVV+GWVRT R     TF+E+NDGSCL+N+Q V++QD   Y  +    I TGASV + 
Sbjct  17    ETLVVQGWVRTKRELKGFTFLEINDGSCLANLQIVINQDLPHYQTIIKQ-INTGASVEVG  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G + +SQG  Q+IELK   + + G +DP ++P+QKKR S EFLR+ AHLR RTN+FGAV 
Sbjct  76    GVLVASQGKGQRIELKAEAVKVYGDADPETYPLQKKRHSFEFLRSIAHLRSRTNSFGAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQ+ GF+WV +PI+TASDCEGAGE F VT+L           + +IP
Sbjct  136   RVRNACATAIHQFFQQRGFMWVHTPILTASDCEGAGELFSVTSL----------NLQDIP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             + E+  VD+SQDFFGKP +LTVSGQL AE  A A  +VYTFGPTFRAENS+TSRHLAEFW
Sbjct  186   RKENQDVDYSQDFFGKPTYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSHTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DLE DM+ A  +L+++ +Y+++NC++DMEFFN  I+  +++   ++V  + 
Sbjct  246   MVEPEMAFCDLEGDMNLAEEFLKHIFRYVMENCEQDMEFFNQRIDNTVLETAENIVNNQF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +L+YTDAI++L K + KF++PV WG DLQSEHERY+ E+ F   PVI+ DYP  IKAFY
Sbjct  306   ERLSYTDAIQILEKAEVKFDYPVEWGLDLQSEHERYLAEQLFKK-PVIVTDYPAQIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ N+D KTV AMD+L P++GE+IGGSQREERL+ LE+R+    +  E  WWYLDLRRYG
Sbjct  365   MKLNNDEKTVRAMDILAPKIGEIIGGSQREERLDILERRILAQGMKPEDLWWYLDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  425   TVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_036530798.1| asparaginyl-tRNA synthetase [Neosynechococcus sphagnicola]
 gb|KGF73821.1| asparaginyl-tRNA synthetase [Neosynechococcus sphagnicola sy1]
Length=462

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 346/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIAD+  +G PDE ++       V+GWVRT R     +F+E+NDGS L+N+Q V  +   
Sbjct  4     RIADVLKQGQPDEAIE-------VQGWVRTKRESKGFSFLEINDGSALANLQVVFPEQLP  56

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGAS+ + G + +S G  Q+IELK   + L G++DP S+P+QKKR S E
Sbjct  57    NYVDLIKRLN-TGASLQVAGVLVASPGKGQRIELKAATVTLYGEADPDSYPLQKKRHSFE  115

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLRPRTNT GAV RVRNA A A H+FFQ+ GF+WV +PI+T SDCEGAGE F V
Sbjct  116   FLRTLGHLRPRTNTLGAVFRVRNACATAIHQFFQQRGFLWVHTPIITTSDCEGAGEMFTV  175

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + ++P+TE+  VD+SQDFFG+PA+LTVSGQL AE  A A  +VYTF
Sbjct  176   TSL----------DLKQVPQTETQGVDYSQDFFGRPAYLTVSGQLEAEIMALAFTNVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+YV QY+L++C EDM FFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKYVFQYVLEHCSEDMAFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
             T I+  ++    ++V  + V+LTYT+AI  L K+ + FE+ V WG DLQSEHERY+ EE 
Sbjct  286   TRIDNSVLATAENIVSHEFVRLTYTEAIAQLQKSDRSFEYAVEWGLDLQSEHERYLAEEL  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR ++DG+TV AMD+L P++GE+IGGSQREERLE LE+R+ 
Sbjct  346   FQK-PVIVTDYPAQIKAFYMRLSEDGQTVRAMDILAPKIGEIIGGSQREERLEVLEQRIR  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                L+   YWWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR+P
Sbjct  405   AQGLDPAIYWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRSP  457



>ref|WP_021359414.1| asparagine--tRNA ligase [Peptoclostridium difficile]
 gb|EQE02628.1| asparagine--tRNA ligase [Peptoclostridium difficile CD3]
 gb|EQG28544.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00126]
 gb|EQG62578.1| asparagine--tRNA ligase [Clostridium difficile DA00142]
 gb|EQG76479.1| asparagine--tRNA ligase [Clostridium difficile DA00165]
 gb|EQG91036.1| asparagine--tRNA ligase [Clostridium difficile DA00191]
 gb|EQH05275.1| asparagine--tRNA ligase [Clostridium difficile DA00195]
 gb|EQH07782.1| asparagine--tRNA ligase [Clostridium difficile DA00197]
 gb|EQI34202.1| asparagine--tRNA ligase [Clostridium difficile Y215]
 gb|EQI81811.1| asparagine--tRNA ligase [Clostridium difficile Y384]
 gb|EQK65401.1| asparagine--tRNA ligase [Clostridium difficile F601]
Length=465

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 346/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V ++  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFNEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FIRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_016951423.1| asparaginyl-tRNA synthetase [Anabaena sp. PCC 7108]
Length=463

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 278/474 (59%), Positives = 350/474 (74%), Gaps = 20/474 (4%)
 Frame = +2

Query  374   RIADI-KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             RIA+I K G  E      E+L+V+GWVRT R      F+EVNDGS L N+Q V++QD   
Sbjct  5     RIAEILKNGQPE------ESLLVQGWVRTKRELKGFAFLEVNDGSSLGNLQIVINQDLPD  58

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREF  727
             Y+ +    I TGASV I G + +SQG  Q+IELK   + + G +DP ++P+QKKR S EF
Sbjct  59    YEGILKQ-INTGASVEITGVLVASQGKGQRIELKADSVKVYGDADPDTYPLQKKRHSFEF  117

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT AHLR RTN+FGAV RVRNA + A H+FFQE GF+WV +PI+TASDCEGAGE F VT
Sbjct  118   LRTIAHLRSRTNSFGAVFRVRNACSAAIHQFFQEKGFLWVHTPIITASDCEGAGELFSVT  177

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
              L           +  +P+TE+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTFG
Sbjct  178   NL----------NLKNVPRTENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTFG  227

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+++ +Y+++ C EDMEFFN 
Sbjct  228   PTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKFIFKYVMETCPEDMEFFNE  287

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
              I+K +++  ++++  +  +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ F
Sbjct  288   RIDKTVLETANNIINNQFERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQLF  347

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+  
Sbjct  348   KK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVLA  406

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
               +N E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  407   QGMNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_021375697.1| asparagine--tRNA ligase [Peptoclostridium difficile]
 gb|EQE85023.1| asparagine--tRNA ligase [Peptoclostridium difficile CD69]
 emb|CCL12100.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile E16]
Length=465

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 345/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              V++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FVRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_039753709.1| asparaginyl-tRNA synthetase [Hassallia byssoidea]
 gb|KIF29859.1| asparaginyl-tRNA synthetase [Hassallia byssoidea VB512170]
Length=463

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 278/475 (59%), Positives = 350/475 (74%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +L+++GWVRT R     +FIEVNDGS L+++Q VM+QD  
Sbjct  5     RIAEILRSGQPDE-------SLLIQGWVRTKRELKGFSFIEVNDGSSLASLQVVMNQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G +  SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYEAIIKKLN-TGASVEVTGVLVPSQGKGQRIELKAEMVKVYGEADPETYPLQKKRHSYE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFLWVHTPIITASDCEGAGELFNV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+            + +IP+TE+ +VD++QDFFG+P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSF----------NLKDIPRTENNAVDYAQDFFGRPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L++V +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDGDMDLAEAFLKHVFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYT+AI LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDDTVLATAENIINNQFQRLTYTEAISLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVSDYPAKIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_003430444.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile]
 ref|YP_001088759.1| asparagine--tRNA ligase [Peptoclostridium difficile 630]
 ref|YP_003215122.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile CD196]
 ref|YP_003218631.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile R20291]
 ref|YP_006199320.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile BI1]
 emb|CAJ69130.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile 630]
 emb|CBA64029.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile CD196]
 emb|CBE05234.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile R20291]
 gb|EHJ25667.1| asparagine--tRNA ligase [Peptoclostridium difficile 002-P50-2011]
 gb|EHJ26853.1| asparagine--tRNA ligase [Peptoclostridium difficile 050-P50-2011]
 gb|EHJ40826.1| asparagine--tRNA ligase [Peptoclostridium difficile 70-100-2010]
 gb|EQE09721.1| asparagine--tRNA ligase [Peptoclostridium difficile CD13]
 gb|EQE16665.1| asparagine--tRNA ligase [Peptoclostridium difficile CD17]
 gb|EQE19719.1| asparagine--tRNA ligase [Peptoclostridium difficile CD18]
 gb|EQE23825.1| asparagine--tRNA ligase [Peptoclostridium difficile CD21]
 gb|EQE27587.1| asparagine--tRNA ligase [Peptoclostridium difficile CD22]
 gb|EQE30064.1| asparagine--tRNA ligase [Peptoclostridium difficile CD34]
 gb|EQE34599.1| asparagine--tRNA ligase [Peptoclostridium difficile CD38]
 gb|EQE39506.1| asparagine--tRNA ligase [Peptoclostridium difficile CD40]
 gb|EQE43568.1| asparagine--tRNA ligase [Peptoclostridium difficile CD41]
 gb|EQE48158.1| asparagine--tRNA ligase [Peptoclostridium difficile CD39]
 gb|EQE48373.1| asparagine--tRNA ligase [Peptoclostridium difficile CD42]
 gb|EQE59080.1| asparagine--tRNA ligase [Peptoclostridium difficile CD44]
 gb|EQE62567.1| asparagine--tRNA ligase [Peptoclostridium difficile CD45]
 gb|EQE63047.1| asparagine--tRNA ligase [Peptoclostridium difficile CD46]
 gb|EQE69238.1| asparagine--tRNA ligase [Peptoclostridium difficile CD47]
 gb|EQE75114.1| asparagine--tRNA ligase [Peptoclostridium difficile CD49]
 gb|EQE77363.1| asparagine--tRNA ligase [Peptoclostridium difficile CD51]
 gb|EQE79628.1| asparagine--tRNA ligase [Peptoclostridium difficile CD68]
 gb|EQE91276.1| asparagine--tRNA ligase [Peptoclostridium difficile CD104]
 gb|EQE92512.1| asparagine--tRNA ligase [Peptoclostridium difficile CD70]
 gb|EQE95947.1| asparagine--tRNA ligase [Peptoclostridium difficile CD109]
 gb|EQF02890.1| asparagine--tRNA ligase [Peptoclostridium difficile CD131]
 gb|EQF06038.1| asparagine--tRNA ligase [Peptoclostridium difficile CD132]
 gb|EQF10232.1| asparagine--tRNA ligase [Peptoclostridium difficile CD133]
 gb|EQF13192.1| asparagine--tRNA ligase [Peptoclostridium difficile CD129]
 gb|EQF14538.1| asparagine--tRNA ligase [Peptoclostridium difficile CD144]
 gb|EQF18722.1| asparagine--tRNA ligase [Peptoclostridium difficile CD149]
 gb|EQF27649.1| asparagine--tRNA ligase [Peptoclostridium difficile CD159]
 gb|EQF31624.1| asparagine--tRNA ligase [Peptoclostridium difficile CD165]
 gb|EQF36481.1| asparagine--tRNA ligase [Peptoclostridium difficile CD166]
 gb|EQF39198.1| asparagine--tRNA ligase [Peptoclostridium difficile CD169]
 gb|EQF44980.1| asparagine--tRNA ligase [Peptoclostridium difficile CD170]
 gb|EQF50524.1| asparagine--tRNA ligase [Peptoclostridium difficile CD175]
 gb|EQF50767.1| asparagine--tRNA ligase [Peptoclostridium difficile CD178]
 gb|EQF53128.1| asparagine--tRNA ligase [Peptoclostridium difficile CD181]
 gb|EQF60427.1| asparagine--tRNA ligase [Peptoclostridium difficile CD200]
 gb|EQF63642.1| asparagine--tRNA ligase [Peptoclostridium difficile CD196]
 gb|EQF67831.1| asparagine--tRNA ligase [Peptoclostridium difficile CD206]
 gb|EQF68507.1| asparagine--tRNA ligase [Peptoclostridium difficile CD201]
 gb|EQF75497.1| asparagine--tRNA ligase [Peptoclostridium difficile CD212]
 gb|EQF78348.1| asparagine--tRNA ligase [Peptoclostridium difficile CD211]
 gb|EQF80704.1| asparagine--tRNA ligase [Peptoclostridium difficile 342]
 gb|EQF87417.1| asparagine--tRNA ligase [Peptoclostridium difficile 655]
 gb|EQF88437.1| asparagine--tRNA ligase [Peptoclostridium difficile 824]
 gb|EQF95081.1| asparagine--tRNA ligase [Peptoclostridium difficile 842]
 gb|EQF98483.1| asparagine--tRNA ligase [Peptoclostridium difficile 840]
 gb|EQG02450.1| asparagine--tRNA ligase [Peptoclostridium difficile 6041]
 gb|EQG10071.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00044]
 gb|EQG10162.1| asparagine--tRNA ligase [Peptoclostridium difficile 6057]
 gb|EQG11398.1| asparagine--tRNA ligase [Peptoclostridium difficile 6042]
 gb|EQG18996.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00062]
 gb|EQG19214.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00065]
 gb|EQG25599.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00114]
 gb|EQG33960.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00129]
 gb|EQG34774.1| asparagine--tRNA ligase [Peptoclostridium difficile DA00128]
 gb|EQG40631.1| asparagine--tRNA ligase [Clostridium difficile DA00131]
 gb|EQG43327.1| asparagine--tRNA ligase [Clostridium difficile DA00132]
 gb|EQG45242.1| asparagine--tRNA ligase [Clostridium difficile DA00134]
 gb|EQG51931.1| asparagine--tRNA ligase [Clostridium difficile DA00141]
 gb|EQG57077.1| asparagine--tRNA ligase [Clostridium difficile DA00145]
 gb|EQG65719.1| asparagine--tRNA ligase [Clostridium difficile DA00154]
 gb|EQG69547.1| asparagine--tRNA ligase [Clostridium difficile DA00160]
 gb|EQG79214.1| asparagine--tRNA ligase [Clostridium difficile DA00167]
 gb|EQG82340.1| asparagine--tRNA ligase [Clostridium difficile DA00183]
 gb|EQG83903.1| asparagine--tRNA ligase [Clostridium difficile DA00174]
 gb|EQG94784.1| asparagine--tRNA ligase [Clostridium difficile DA00189]
 gb|EQG94982.1| asparagine--tRNA ligase [Clostridium difficile DA00193]
 gb|EQH03365.1| asparagine--tRNA ligase [Clostridium difficile DA00196]
 gb|EQH12593.1| asparagine--tRNA ligase [Clostridium difficile DA00203]
 gb|EQH18223.1| asparagine--tRNA ligase [Clostridium difficile DA00210]
 gb|EQH21694.1| asparagine--tRNA ligase [Clostridium difficile DA00212]
 gb|EQH23016.1| asparagine--tRNA ligase [Clostridium difficile DA00211]
 gb|EQH29025.1| asparagine--tRNA ligase [Clostridium difficile DA00215]
 gb|EQH35449.1| asparagine--tRNA ligase [Clostridium difficile DA00232]
 gb|EQH35536.1| asparagine--tRNA ligase [Clostridium difficile DA00238]
 gb|EQH38563.1| asparagine--tRNA ligase [Clostridium difficile DA00216]
 gb|EQH42113.1| asparagine--tRNA ligase [Clostridium difficile DA00244]
 gb|EQH46994.1| asparagine--tRNA ligase [Clostridium difficile DA00246]
 gb|EQH51609.1| asparagine--tRNA ligase [Clostridium difficile DA00245]
 gb|EQH55330.1| asparagine--tRNA ligase [Clostridium difficile DA00261]
 gb|EQH61034.1| asparagine--tRNA ligase [Clostridium difficile DA00275]
 gb|EQH64120.1| asparagine--tRNA ligase [Clostridium difficile DA00273]
 gb|EQH67516.1| asparagine--tRNA ligase [Clostridium difficile DA00256]
 gb|EQH70557.1| asparagine--tRNA ligase [Clostridium difficile DA00306]
 gb|EQH72747.1| asparagine--tRNA ligase [Clostridium difficile DA00305]
 gb|EQH75902.1| asparagine--tRNA ligase [Clostridium difficile DA00307]
 gb|EQH80571.1| asparagine--tRNA ligase [Clostridium difficile DA00310]
 gb|EQH82549.1| asparagine--tRNA ligase [Clostridium difficile DA00313]
 gb|EQH88398.1| asparagine--tRNA ligase [Clostridium difficile F152]
 gb|EQH93820.1| asparagine--tRNA ligase [Clostridium difficile F249]
 gb|EQH99052.1| asparagine--tRNA ligase [Clostridium difficile F501]
 gb|EQH99741.1| asparagine--tRNA ligase [Clostridium difficile F314]
 gb|EQI03802.1| asparagine--tRNA ligase [Clostridium difficile F253]
 gb|EQI05425.1| asparagine--tRNA ligase [Clostridium difficile Y10]
 gb|EQI11066.1| asparagine--tRNA ligase [Clostridium difficile Y21]
 gb|EQI17637.1| asparagine--tRNA ligase [Clostridium difficile Y41]
 gb|EQI21366.1| asparagine--tRNA ligase [Clostridium difficile Y155]
 gb|EQI24076.1| asparagine--tRNA ligase [Clostridium difficile Y165]
 gb|EQI27665.1| asparagine--tRNA ligase [Clostridium difficile Y171]
 gb|EQI34923.1| asparagine--tRNA ligase [Clostridium difficile Y184]
 gb|EQI38441.1| asparagine--tRNA ligase [Clostridium difficile Y202]
 gb|EQI41073.1| asparagine--tRNA ligase [Clostridium difficile Y231]
 gb|EQI46167.1| asparagine--tRNA ligase [Clostridium difficile Y247]
 gb|EQI51276.1| asparagine--tRNA ligase [Clostridium difficile Y270]
 gb|EQI56667.1| asparagine--tRNA ligase [Clostridium difficile Y266]
 gb|EQI57556.1| asparagine--tRNA ligase [Clostridium difficile Y312]
 gb|EQI59423.1| asparagine--tRNA ligase [Clostridium difficile Y307]
 gb|EQI65968.1| asparagine--tRNA ligase [Clostridium difficile Y343]
 gb|EQI67542.1| asparagine--tRNA ligase [Clostridium difficile Y358]
 gb|EQI73056.1| asparagine--tRNA ligase [Clostridium difficile Y381]
 gb|EQI79957.1| asparagine--tRNA ligase [Clostridium difficile P1]
 gb|EQI80112.1| asparagine--tRNA ligase [Clostridium difficile Y401]
 gb|EQI86356.1| asparagine--tRNA ligase [Clostridium difficile P2]
 gb|EQI91308.1| asparagine--tRNA ligase [Clostridium difficile P3]
 gb|EQJ00173.1| asparagine--tRNA ligase [Clostridium difficile P6]
 gb|EQJ09737.1| asparagine--tRNA ligase [Clostridium difficile P8]
 gb|EQJ20844.1| asparagine--tRNA ligase [Clostridium difficile P9]
 gb|EQJ23443.1| asparagine--tRNA ligase [Clostridium difficile P15]
 gb|EQJ30179.1| asparagine--tRNA ligase [Clostridium difficile P19]
 gb|EQJ36192.1| asparagine--tRNA ligase [Clostridium difficile P20]
 gb|EQJ40719.1| asparagine--tRNA ligase [Clostridium difficile P23]
 gb|EQJ46434.1| asparagine--tRNA ligase [Clostridium difficile P25]
 gb|EQJ48323.1| asparagine--tRNA ligase [Clostridium difficile P24]
 gb|EQJ56120.1| asparagine--tRNA ligase [Clostridium difficile P29]
 gb|EQJ59825.1| asparagine--tRNA ligase [Clostridium difficile P32]
 gb|EQJ68034.1| asparagine--tRNA ligase [Clostridium difficile P42]
 gb|EQJ68252.1| asparagine--tRNA ligase [Clostridium difficile P38]
 gb|EQJ72237.1| asparagine--tRNA ligase [Clostridium difficile P36]
 gb|EQJ79425.1| asparagine--tRNA ligase [Clostridium difficile P45]
 gb|EQJ90324.1| asparagine--tRNA ligase [Clostridium difficile P49]
 gb|EQJ90697.1| asparagine--tRNA ligase [Clostridium difficile P50]
 gb|EQK00874.1| asparagine--tRNA ligase [Clostridium difficile P61]
 gb|EQK05184.1| asparagine--tRNA ligase [Clostridium difficile P59]
 gb|EQK05759.1| asparagine--tRNA ligase [Clostridium difficile P78]
 gb|EQK12212.1| asparagine--tRNA ligase [Clostridium difficile P69]
 gb|EQK16347.1| asparagine--tRNA ligase [Clostridium difficile P70]
 gb|EQK17993.1| asparagine--tRNA ligase [Clostridium difficile P72]
 gb|EQK22371.1| asparagine--tRNA ligase [Clostridium difficile P71]
 gb|EQK31396.1| asparagine--tRNA ligase [Clostridium difficile P74]
 gb|EQK33200.1| asparagine--tRNA ligase [Clostridium difficile P75]
 gb|EQK38934.1| asparagine--tRNA ligase [Clostridium difficile P77]
 gb|EQK50267.1| asparagine--tRNA ligase [Clostridium difficile F480]
 gb|EQK52695.1| asparagine--tRNA ligase [Clostridium difficile F525]
 gb|EQK56782.1| asparagine--tRNA ligase [Clostridium difficile F200]
 gb|EQK60451.1| asparagine--tRNA ligase [Clostridium difficile F548]
 gb|EQK69154.1| asparagine--tRNA ligase [Clostridium difficile CD90]
 gb|EQK75203.1| asparagine--tRNA ligase [Clostridium difficile CD113]
 gb|EQK75615.1| asparagine--tRNA ligase [Clostridium difficile CD92]
 gb|EQK76976.1| asparagine--tRNA ligase [Clostridium difficile CD111]
 gb|EQK84437.1| asparagine--tRNA ligase [Clostridium difficile CD127]
 gb|EQK87283.1| asparagine--tRNA ligase [Clostridium difficile P30]
 gb|EQK87846.1| asparagine--tRNA ligase [Clostridium difficile P31]
 gb|EQL06870.1| asparagine--tRNA ligase [Clostridium difficile CD88]
 gb|EQL08164.1| asparagine--tRNA ligase [Clostridium difficile CD86]
 gb|ERM25546.1| asparagine--tRNA ligase [Clostridium difficile P41]
 gb|ERM25603.1| asparagine--tRNA ligase [Clostridium difficile P33]
 gb|ERM29623.1| asparagine--tRNA ligase [Clostridium difficile DA00130]
 gb|ERM37526.1| asparagine--tRNA ligase [Clostridium difficile P64]
 gb|ERM45822.1| asparagine--tRNA ligase [Clostridium difficile F665]
 gb|ERM47862.1| asparagine--tRNA ligase [Clostridium difficile P53]
 emb|CCL02543.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile E13]
 emb|CCL07798.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile CD002]
 emb|CCL14565.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T22]
 emb|CCL18643.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E25]
 emb|CCL22563.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T15]
 emb|CCL26497.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T11]
 emb|CCL30465.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E15]
 emb|CCL34441.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T23]
 emb|CCL38301.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E19]
 emb|CCL40966.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E24]
 emb|CCL44723.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T42]
 emb|CCL49652.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T6]
 emb|CCL53621.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E14]
 emb|CCL57729.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T17]
 emb|CCL61291.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E9]
 emb|CCL65271.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E7]
 emb|CCL69230.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T3]
 emb|CCL72867.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E28]
 emb|CCL76557.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E23]
 emb|CCL81847.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile E12]
 emb|CCL83894.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T19]
 emb|CCL88057.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T10]
 emb|CCL92381.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Clostridium difficile T14]
 emb|CCL96533.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T61]
 gb|EZR30324.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile]
 emb|CDS85779.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile]
 emb|CDS87602.1| asparaginyl tRNA synthetase [Peptoclostridium difficile]
 emb|CDT14213.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile]
 emb|CEJ98855.1| Asparaginyl-tRNA synthetase (Asparagine--tRNAligase) (AsnRS) 
[Peptoclostridium difficile]
Length=465

 Score =   530 bits (1365),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 345/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FIRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_003423318.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile]
 gb|EFH07666.1| asparagine--tRNA ligase [Clostridium difficile NAP08]
 gb|EFH16100.1| asparagine--tRNA ligase [Clostridium difficile NAP07]
 emb|CCK87560.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T5]
 emb|CCK91014.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile T20]
 emb|CCK94696.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile E1]
 emb|CCK98656.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[Peptoclostridium difficile E10]
Length=465

 Score =   530 bits (1365),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 255/455 (56%), Positives = 344/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              V++TYT A+ELL+++   FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FVRITYTKAVELLIESGHDFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_011320339.1| asparaginyl-tRNA synthetase [Anabaena variabilis]
 ref|YP_324131.1| asparaginyl-tRNA synthetase [Anabaena variabilis ATCC 29413]
 gb|ABA23236.1| Asparaginyl-tRNA synthetase, class IIb [Anabaena variabilis ATCC 
29413]
Length=463

 Score =   530 bits (1364),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 346/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +LVV+GWVRT R      FIEVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGQPDE-------SLVVQGWVRTKRELKGFAFIEVNDGSSLGNLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G + +SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYAVIVKQLN-TGASVEVNGVLVASQGKGQRIELKAEAVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSAAIHQFFQERGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + +IP+TE+  +D+SQDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKQIPRTENQGIDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+++  ++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHIFNHVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYTDAI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATAENIINNQFERLTYTDAIKLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDVLAPKIGEIIGGSQREERLDVLERRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTP  458



>ref|WP_038811786.1| asparaginyl-tRNA synthetase [Peptoclostridium difficile]
Length=465

 Score =   530 bits (1364),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 345/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYSHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FIRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_006194614.1| asparaginyl-tRNA synthetase [Nodularia spumigena]
 gb|EAW46842.1| asparaginyl-tRNA synthetase [Nodularia spumigena CCY9414]
 gb|AHJ31500.1| Asparaginyl-tRNA synthetase [Nodularia spumigena CCY9414]
Length=463

 Score =   529 bits (1363),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 351/475 (74%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA++   G PD+       +LV++GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIAEVLRSGEPDD-------SLVIQGWVRTKRELKGFAFIEVNDGSSLANLQAVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+++   L  TGA+V + G + +SQG  Q+IEL+   + + G++DP ++P+QKKR S E
Sbjct  58    DYEEIIKKLN-TGAAVEVSGVLVASQGKGQRIELQAQAVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQ+ GF+WV +PI+TA+DCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSAAIHEFFQQRGFLWVHTPIITANDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           +  IP+T+S +VD++QDFFGKP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TGL----------DLKNIPRTKSEAVDYTQDFFGKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
              PTFRAENSNTSRHLAEFWM+EPE+AF DLE +M  A A+L++V +Y+L+ C EDMEFFN
Sbjct  227   APTFRAENSNTSRHLAEFWMVEPEMAFCDLEGNMDLAEAFLKHVFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++   +++  +  +LTYT+A++LL K   KFE+PVNWG DLQSEHERY+ E  
Sbjct  287   QRIDKTVLETADNIINNQFERLTYTEAVKLLEKADVKFEYPVNWGLDLQSEHERYLAEHL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTV AMD+L P++GE+IGGSQREERLE LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRVNDDEKTVRAMDILAPKIGEIIGGSQREERLEVLERRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWY+DLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMQPEDLWWYMDLRRYGTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTPQS  460



>ref|WP_010997802.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7120]
 ref|NP_487698.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7120]
 sp|P58692.1|SYN_NOSS1 RecName: Full=Asparagine--tRNA ligase; AltName: Full=Asparaginyl-tRNA 
synthetase; Short=AsnRS [Nostoc sp. PCC 7120]
 dbj|BAB75357.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7120]
Length=463

 Score =   529 bits (1363),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 346/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +LVV+GWVRT R      FIEVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGQPDE-------SLVVQGWVRTKRELKGFAFIEVNDGSSLGNLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G + +SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYAVIVKQLN-TGASVEVNGVLVASQGKGQRIELKAEAVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSAAIHQFFQERGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + +IP+TE+  +D+SQDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKQIPRTENQGIDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+++  ++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHIFNHVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYTDAI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATAENIINNQFERLTYTDAIKLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDVLAPKIGEIIGGSQREERLDVLERRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTP  458



>ref|WP_012407633.1| asparaginyl-tRNA synthetase [Nostoc punctiforme]
 ref|YP_001864554.1| asparaginyl-tRNA synthetase [Nostoc punctiforme PCC 73102]
 gb|ACC79611.1| asparaginyl-tRNA synthetase [Nostoc punctiforme PCC 73102]
Length=463

 Score =   529 bits (1362),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 346/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE          V+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIAEILRSGQPDESFQ-------VQGWVRTKRESKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGA+V   G + +S G  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYEAILKKLN-TGAAVEATGVLVASLGKGQRIELKAESVKVYGEADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQ+ GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSTAIHQFFQQRGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+SQDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQAVDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+++ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHIFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K ++    +++  +  +LTYT+AI++L K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDKSVLATAENIINNQFERLTYTEAIKVLEKADVKFEYPVSWGLDLQSEHERYLAEQQ  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTV AMD+L P++GE++GGSQREERLE LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVRAMDILAPKIGEIVGGSQREERLEVLERRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                L  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGLKPEELWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_021385136.1| asparagine--tRNA ligase [Peptoclostridium difficile]
 gb|EQF24079.1| asparagine--tRNA ligase [Peptoclostridium difficile CD160]
Length=465

 Score =   529 bits (1362),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 344/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + ++  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEI--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAVHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK + LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYAQDFFGKESNLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              V++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FVRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R+ ++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRIHEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_028088638.1| asparaginyl-tRNA synthetase [Dolichospermum circinale]
Length=463

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 346/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P+E       TLVV+GWVRT R      F+EVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGKPEE-------TLVVQGWVRTKRELKGFAFLEVNDGSSLGNLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +    I TGAS+ I G I +SQG  Q+IELK   + + G +DP ++P+QKKR S E
Sbjct  58    DYQGILKQ-INTGASIEISGVIVASQGKGQRIELKADTVKIYGDADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTN+FGAV RVRNA A A H+FF E GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRGRTNSFGAVFRVRNACATAIHQFFHERGFLWVHTPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +P+ E+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFNLKNVPRRENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+Y+ +Y+++ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKYIFKYVMETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++  ++++  +  +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDKTVLETANNIINNQFERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDILEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +N E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_026733548.1| asparaginyl-tRNA synthetase [Fischerella sp. PCC 9605]
Length=463

 Score =   528 bits (1360),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 277/474 (58%), Positives = 345/474 (73%), Gaps = 22/474 (5%)
 Frame = +2

Query  371   LRIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             LRIA+I   G PDE L        V+GWVRT R      FIEVNDGS L+N+Q V++QD 
Sbjct  4     LRIAEILRDGQPDESLK-------VQGWVRTKRELKDFAFIEVNDGSSLANLQIVINQDL  56

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSR  721
               Y+ +   L  TGASV + G + +S    Q++ELK   + + G++DP ++P+QKKR S 
Sbjct  57    PDYEAILKKLN-TGASVEVSGVLVASPAKGQRVELKANSVKVYGEADPETYPLQKKRHSF  115

Query  722   EFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFC  901
             EFLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F 
Sbjct  116   EFLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFMWVHTPIITASDCEGAGELFS  175

Query  902   VTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             VT+L           +  IP+TE+ +VD+S+DFF +P +LTVSGQL AE  A A  +VYT
Sbjct  176   VTSL----------DLKNIPRTETQTVDYSKDFFARPTYLTVSGQLEAEIMAMAFTNVYT  225

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A  +L+Y+ +Y+L+ C EDMEFF
Sbjct  226   FGPTFRAENSNTSRHLAEFWMVEPEMAFCDLQGDMDLAEEFLKYIFKYVLEKCPEDMEFF  285

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             N  I+  ++     ++  +  ++TYTDAI+LL K   KFE+PVNWG DLQSEHERY+ E+
Sbjct  286   NQRIDSTVLATADHIINNQFERITYTDAIKLLEKADVKFEYPVNWGLDLQSEHERYLCEQ  345

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   PVI+ DYP  IKAFYMR NDD KTV AMD+L P++GE+IGGSQREERLE LEKR+
Sbjct  346   QFKK-PVIVTDYPAQIKAFYMRLNDDEKTVRAMDILAPKIGEIIGGSQREERLEVLEKRI  404

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +   + +E  WWYLDLRRYG+VPHAGFGLGFERL+QF TG+ NIRD IPFPRTP
Sbjct  405   EAQGMKQEDLWWYLDLRRYGTVPHAGFGLGFERLIQFMTGMGNIRDVIPFPRTP  458



>ref|WP_026295068.1| asparaginyl-tRNA synthetase [Spirochaeta bajacaliforniensis]
Length=462

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 270/457 (59%), Positives = 342/457 (75%), Gaps = 14/457 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             GE L V GWVRT R   +V F+E++DGS   N+Q ++ +  EG   V +  I TGASV +
Sbjct  16    GERLTVYGWVRTKRDSKNVCFLELSDGSSFRNLQVIIDKAEEGKSSVIDS-ITTGASVEV  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              GT+A+S G  Q IEL+   L L+G++   ++P+QKKR S EFLR  AHLRPRTNTFGAV
Sbjct  75    TGTLAASPGKNQSIELQADTLKLIGEAPVDTYPLQKKRHSFEFLREIAHLRPRTNTFGAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRN L++A H+FFQE GF++V +P+++ SDCEGAGE F VTTL          P+  +
Sbjct  135   TRVRNQLSWAVHRFFQERGFIYVHTPLISTSDCEGAGEMFQVTTL----------PLENV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P  E G +D+SQDFFGK A LTVSGQL AE YA+A +DVYTFGPTFRAENSNT+RHLAEF
Sbjct  185   PLKE-GQIDYSQDFFGKRASLTVSGQLEAEIYASAFSDVYTFGPTFRAENSNTTRHLAEF  243

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AF DL  +M  A A+L+ ++  +L++C EDM+FFN W+EKGII  L  V++  
Sbjct  244   WMIEPEMAFCDLVGNMELAEAFLKNILSSVLEHCSEDMKFFNQWVEKGIIDSLEKVIDTP  303

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
                ++YT+A++ L   K  FEFPV WG DLQSEHER++TE    G PVI+ DYPK+IKAF
Sbjct  304   FTHMSYTEAVQALKTGKTNFEFPVEWGSDLQSEHERFLTETVCKG-PVIVTDYPKEIKAF  362

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YM+ NDDGK+VAAMD+LVPR+GE+IGGS+RE RL  LE+R+ D  LN E YWWYLDLRR+
Sbjct  363   YMKLNDDGKSVAAMDVLVPRLGEIIGGSERESRLSVLEQRIHDTGLNPEEYWWYLDLRRF  422

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             G+VPH+GFGLGFERL+Q+ TG+ NIRD IPFPRT G+
Sbjct  423   GTVPHSGFGLGFERLIQYVTGMQNIRDVIPFPRTVGN  459



>ref|WP_039204519.1| asparaginyl-tRNA synthetase [Aphanizomenon flos-aquae]
 gb|KHG39386.1| asparaginyl-tRNA synthetase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=463

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 276/475 (58%), Positives = 347/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P++       TLVV+GWVRT R      F+EVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGKPEQ-------TLVVQGWVRTKRELKGFAFLEVNDGSSLGNLQIVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +    I TG S+ + G + +SQG  Q+IELK   + + G +DP ++P+QKKR S E
Sbjct  58    DYQGILKQ-INTGGSIEVSGVLVASQGKGQRIELKADTVKVYGDADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTN+FGAV RVRNA A A H+FFQ+ GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRPRTNSFGAVFRVRNACATAIHQFFQQRGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +PKTE+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFNLKNVPKTENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+++ +Y+++ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKHIFKYVMETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +++  S+++  +  +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDNTVLETASNIINNQFERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>gb|KIE11165.1| asparaginyl-tRNA synthetase [Tolypothrix bouteillei VB521301]
Length=463

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 354/475 (75%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +LVV+GWVRT R      FIEVNDGS L+++Q V+++D  
Sbjct  5     RIAEILRNGQPDE-------SLVVQGWVRTKRELKGFAFIEVNDGSSLASLQVVINEDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
             GYD +   L  TGASV + G + +SQG  Q++ELK  K+ + G++DP ++P+QKKR S E
Sbjct  58    GYDSILKQLN-TGASVEVAGVLVASQGKGQRVELKANKVTVYGEADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TA+DCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFLWVHTPIITANDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + ++P+ ++ +VD+S+DFFGKP +LTVSGQL AE  ATA  +VYTF
Sbjct  177   TSL----------DLKDVPRKDTKAVDYSKDFFGKPTYLTVSGQLEAEVMATAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L+++ +Y+++NC EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLKGDMDLAEAFLKHIFKYVMENCAEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +I    +++  +  ++TYT+AI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVIATADNIINNEFERVTYTEAIKLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ +YP  IKAFYMR +DD KTVAAMD++ P++GE+IGGSQREERLE LE+R+ 
Sbjct  347   FKK-PTIVTNYPVQIKAFYMRLDDDEKTVAAMDIVAPKIGEIIGGSQREERLEILERRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRR+G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRFGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_019505273.1| asparaginyl-tRNA synthetase [Pleurocapsa sp. PCC 7319]
Length=463

 Score =   527 bits (1358),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 347/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             R+ADI   G PDE       ++ ++GWVRT R     +F+EVNDGS LS +Q V+  D  
Sbjct  5     RVADILKNGQPDE-------SVTIQGWVRTKRELKGFSFVEVNDGSSLSGLQAVLDADIP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGA+V I G +  S G  QKIE+K   + + G++D  ++P+QKKR S E
Sbjct  58    NYETILKQLG-TGAAVEITGKLVESPGKGQKIEMKAESITVYGEADSETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT +HLR RTNT GAV RVRNA A A H+FFQE  F+W+ SPI+TASDCEGAGE F V
Sbjct  117   FLRTISHLRSRTNTLGAVFRVRNACATAIHQFFQEKDFLWIHSPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           +N +PK + G +D+SQDFFGKPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------DLNNLPKNDQGEIDYSQDFFGKPAYLTVSGQLQAEVMAMAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE D + A  +L+Y+ QY+LD+C +DMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDQNLAEEFLKYIFQYVLDHCADDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
              W++K ++    +++  +  ++TYT+AI LL K KKKFEFPV WG DLQSEHERY+ E+ 
Sbjct  287   KWVDKSVLATADNIISNEFERVTYTEAITLLEKAKKKFEFPVEWGIDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ +YPKDIKAFYMR +D  KTV+AMD+L P +GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVTNYPKDIKAFYMRLDDGEKTVSAMDVLAPGIGEIIGGSQREERLDVLERRIK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             ++++  +  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   EMSIEADDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP  458



>ref|WP_007287700.1| asparaginyl-tRNA synthetase [Intestinibacter bartlettii]
 gb|EDQ95243.1| asparagine--tRNA ligase [Intestinibacter bartlettii DSM 16795]
Length=465

 Score =   527 bits (1358),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 260/455 (57%), Positives = 344/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             + +T+ V GW+RT R   +  FIE+NDGS   NMQ V+ +  E + ++  G +    S+ 
Sbjct  19    IDKTVKVAGWIRTSRMSKNFGFIELNDGSFFKNMQIVIDEKLENFKEI--GKLPISTSLL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             I+GT+ ++Q +KQ +E++  K+V+ G+SD S+P+QKKR + E+LRT AHLRPR+N F A 
Sbjct  77    IEGTLVATQNAKQPVEIQATKIVVEGESDNSYPLQKKRHTVEYLRTIAHLRPRSNLFSAA  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQ+  FV+  SPI+T SDCEGAGE F +TTL           +N++
Sbjct  137   FRVRSVAAYAIHKFFQDRNFVYAHSPIITGSDCEGAGEMFRLTTL----------DLNDV  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G VD+SQDFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKVDYSQDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADLED+M  A   ++Y++ Y+L+NC E+MEFFN++++KG+++RL  +V  +
Sbjct  247   WMIEPEIAFADLEDNMELAEDMIKYIINYVLENCPEEMEFFNSFVDKGLLERLHKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT AIELLL++ +KFE+PV WGCDLQ+EHERYITE+ F   PV + DYPK+IKAF
Sbjct  307   FIRITYTKAIELLLESGQKFEYPVEWGCDLQTEHERYITEQIF-NAPVFVTDYPKEIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE+IGGSQREER + L  R+ +  LN+E YWWYL+LR+Y
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIIGGSQREERYDLLMDRIKECGLNEEDYWWYLELRKY  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TGI NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYLTGISNIRDVIPFPRTP  460



>ref|WP_017289279.1| asparaginyl-tRNA synthetase [Leptolyngbya boryana]
Length=462

 Score =   527 bits (1358),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 347/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA++   G PDE       T+ ++GWVRT R Q   +FIEVNDGS ++ +Q V++QD  
Sbjct  4     RIAELLRAGQPDE-------TVTIQGWVRTKREQKGFSFIEVNDGSSMAGLQVVINQDVS  56

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y +     I TGASV + G +  S G  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  57    DY-EASLKRISTGASVEVSGVLVPSPGKGQRIELKADSVKVYGEADPETYPLQKKRHSFE  115

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR   HLR RTNT GAV RVRNA A A H+FFQE GF+WV +P++TASDCEGAGE F V
Sbjct  116   FLREIGHLRSRTNTLGAVFRVRNACATAIHQFFQERGFLWVHTPVITASDCEGAGEMFAV  175

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L  N K+P        P  +   +D+SQDFFGKPA+LTVSGQL AE  A A ++VYTF
Sbjct  176   TSL--NLKQP--------PLNDQKEIDYSQDFFGKPAYLTVSGQLEAEIMAMAFSNVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L+Y+  Y++++C EDMEFFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDGDMDLAEAFLKYIFSYVMEHCPEDMEFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I++ ++    +++  +  ++TYT AIELL K  KKFE+PV WG DLQSEHERY+ E+ 
Sbjct  286   KLIDQSVLSTAENIINNQFERITYTKAIELLEKADKKFEYPVEWGLDLQSEHERYLAEDL  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ DYP +IKAFYMR +DDGKTV AMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  346   FKK-PTIVTDYPAEIKAFYMRLSDDGKTVRAMDILAPKIGEIIGGSQREERLDVLERRIV  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                L+  +YWWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  405   QQGLDPATYWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTP  457



>ref|WP_028082726.1| asparaginyl-tRNA synthetase [Dolichospermum circinale]
Length=463

 Score =   527 bits (1358),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 347/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P+E       TLVV+GWVRT R      F+EVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGKPEE-------TLVVQGWVRTKRELKGFAFLEVNDGSSLGNLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +    I TGAS+ I G I +SQG  Q+IELK   + + G +DP ++P+QKKR S E
Sbjct  58    DYQGILKQ-INTGASIEISGVIVASQGKGQRIELKADTVKIYGDADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTN+FGAV RVRNA A A H+FF E GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRGRTNSFGAVFRVRNACATAIHQFFHERGFLWVHTPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +P++++  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFNLKNVPRSQNQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+Y+ +Y+++ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKYIFKYVMETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++  ++++  +  +LTYT+ ++LL K   KF++PV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDKTVLETANNIINNQFERLTYTEVVKLLEKADVKFDYPVSWGADLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP +IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVTDYPAEIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDILEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +N E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_021418214.1| asparagine--tRNA ligase [Peptoclostridium difficile]
 gb|EQJ17474.1| asparagine--tRNA ligase [Clostridium difficile P11]
Length=465

 Score =   527 bits (1357),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 344/455 (76%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V  +  E + +V  G +   +S+ 
Sbjct  19    IGKTVKVAGWIRTSRVSKNFGFIELNDGSFFKNMQIVFDEKVENFKEV--GKLAISSSIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E+    +V+ G+S  S+P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  77    VEGELVSTEGAKQPVEIHAKSIVVEGESYSSYPLQKKRHTLEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           +N+I
Sbjct  137   FRVRSIAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLNDI  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D++QDFFGK A LTVSGQLNAE  A +  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKIDYTQDFFGKEANLTVSGQLNAEIMALSFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++YV+ Y+L+N  E+MEFFN++I+KG+++RL+ +V  +
Sbjct  247   WMIEPEIVFADLEDNMELAEDMIKYVISYVLENAPEEMEFFNSFIDKGLLERLNKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT A+ELL+++  +FE+PV WGCDLQ+EHERYITE+ +  CPV + DYPKDIKAF
Sbjct  307   FIRITYTKAVELLIESGHEFEYPVEWGCDLQTEHERYITEQIY-NCPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R++++ L +E YWWYL+LR++
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLDRINEMGLREEDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  460



>ref|WP_015083044.1| asparaginyl-tRNA synthetase [Anabaena sp. 90]
 ref|YP_007000545.1| asparaginyl-tRNA synthetase [Anabaena sp. 90]
 gb|AFW96488.1| asparaginyl-tRNA synthetase [Anabaena sp. 90]
Length=463

 Score =   527 bits (1357),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 340/454 (75%), Gaps = 13/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ETLVV+GWVRT R      F+EVNDGS L N+Q V++Q+   Y  +    I TGAS+ + 
Sbjct  17    ETLVVQGWVRTKRELKGFAFLEVNDGSSLGNLQVVINQNLPDYQGILKQ-INTGASIEVS  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G + +SQG  Q+IELK   + + G +DP ++P+QKKR S EFLRT AHLRPRTN+FGAV 
Sbjct  76    GVLVASQGKGQRIELKADTVKVYGDADPDTYPLQKKRHSFEFLRTIAHLRPRTNSFGAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQ+ GF+WV +PI+TASDCEGAGE F VT          N  +  +P
Sbjct  136   RVRNACATAIHQFFQQRGFLWVHTPIITASDCEGAGELFSVT----------NFNLKNVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             KTE+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   KTENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSNTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DLE DM  A  +L+++ +Y+++ C +DMEFFN  I+  +++  ++++  + 
Sbjct  246   MVEPEMAFCDLEGDMDLAEEFLKHIFKYVMETCPQDMEFFNERIDNTVLETANNIINNQF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ F   PVI+ DYP  IKAFY
Sbjct  306   ERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQLFKK-PVIVTDYPAQIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+    +N E  WWYLDLRRYG
Sbjct  365   MRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVLAQGMNPEDLWWYLDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  425   TVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_006101797.1| asparaginyl-tRNA synthetase [Coleofasciculus chthonoplastes]
 gb|EDX74977.1| asparaginyl-tRNA synthetase [Coleofasciculus chthonoplastes PCC 
7420]
Length=463

 Score =   527 bits (1357),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 335/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ET+ ++GWVRT R      F+EVNDGSCL+N+Q +++ D   Y Q     + TGASV + 
Sbjct  17    ETVTIQGWVRTKRELKEFAFMEVNDGSCLANLQVILNPDVPDY-QTTLQRVNTGASVEVA  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  S G  Q+IEL+   + + G++DP ++P+QKKR S EFLRT  HLR RTNT GAV 
Sbjct  76    GVLVPSPGKGQRIELRANSVQVYGEADPATYPLQKKRHSFEFLRTIGHLRSRTNTIGAVL  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQE GF+W+ SPI+TASDCEGAGE F VT L           +NEIP
Sbjct  136   RVRNACANAIHQFFQERGFLWIHSPIITASDCEGAGELFTVTNL----------NLNEIP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             KTE   VD+SQDFFG+ A+LTVSGQL AE  A    +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   KTEDQLVDFSQDFFGRQAYLTVSGQLQAEVMAMTFGNVYTFGPTFRAENSNTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DL+ DM  A  +L+YV   +L+NC EDMEFFN  I+  ++    +++  + 
Sbjct  246   MVEPEMAFCDLQGDMDLAEEFLKYVFSSVLENCPEDMEFFNKRIDNSVLATADNIINNQF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYTDAI  L K  +KFE+PV WG DLQSEHERY+ EE F   PVI+ DYP  IKAFY
Sbjct  306   ERITYTDAIAQLEKADRKFEYPVEWGTDLQSEHERYLAEELFQK-PVIVSDYPVGIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR N+DGKTVAAMD+L P++GE+IGGSQREERL+ L++R+ +  +N E +WWYLDLRRYG
Sbjct  365   MRLNEDGKTVAAMDVLAPKIGEIIGGSQREERLDVLQQRIQNQGMNPEEFWWYLDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +V HAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  425   TVAHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPLS  460



>ref|WP_006439109.1| asparaginyl-tRNA synthetase [[Clostridium] hiranonis]
 gb|EEA86152.1| asparagine--tRNA ligase [ [[Clostridium] hiranonis DSM 13275]
Length=495

 Score =   528 bits (1359),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 342/456 (75%), Gaps = 13/456 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
              +G+T+ V GW+RT R   +  FIE+NDGS   NMQ V+ +  E + ++  G +   +S+
Sbjct  48    HVGQTVKVAGWIRTSRMSKNFGFIELNDGSFFKNMQIVLDEKLENFKEI--GKLPISSSI  105

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGA  775
              ++G + S++G+KQ +E+   K+ + G SD S+P+QKKR + E+LRT AHLRPR+NTF A
Sbjct  106   LVEGELVSTEGAKQPVEIHATKVEVEGMSDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSA  165

Query  776   VARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNE  955
             V RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TTL           +  
Sbjct  166   VFRVRSLAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRLTTL----------DMEN  215

Query  956   IPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAE  1135
             +P+TE G +D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +E
Sbjct  216   LPRTEEGKIDYSKDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASE  275

Query  1136  FWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEK  1315
             FWMIEPE+ FADLED+M  A   ++Y++ Y+++N  E+M+FFN++I+KG+++RL++VV  
Sbjct  276   FWMIEPEIVFADLEDNMELAEDMIKYIINYVMENAPEEMQFFNSFIDKGLLERLNNVVNS  335

Query  1316  KVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA  1495
               V++TYT AIELLL++  +FE PV WGCDLQ+EHERYITEE +   PV + DYPKDIKA
Sbjct  336   DFVRITYTKAIELLLESGHEFENPVEWGCDLQTEHERYITEEIY-KAPVFVTDYPKDIKA  394

Query  1496  FYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRR  1675
             FYMR N+DGKTV AMD+LVP VGE++GGSQREER + L  R+ ++NLN+E YWWYL+LR+
Sbjct  395   FYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDVLRARMQEMNLNEEDYWWYLELRK  454

Query  1676  YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             YG+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  455   YGTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  490



>ref|WP_027403107.1| asparaginyl-tRNA synthetase [Aphanizomenon flos-aquae]
Length=463

 Score =   526 bits (1356),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 347/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P++       TLVV+GWVRT R      F+EVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRSGKPEQ-------TLVVQGWVRTKRELKGFAFLEVNDGSSLGNLQIVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +    I TG S+ + G + +SQG  Q+IELK   + + G +DP ++P+QKKR S E
Sbjct  58    DYQGILKQ-INTGGSIEVSGVLVASQGKGQRIELKADTVKVYGDADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTN+FGAV RVRNA A A H+FFQ+ GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRPRTNSFGAVFRVRNACATAIHQFFQQRGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +PKTE+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFNLKNVPKTENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+++ +Y+++ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKHIFKYVMETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +++  ++++  +  +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDNTVLETANNIINNQFERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_022072260.1| MULTISPECIES: asparagine--tRNA ligase [Clostridiales]
 emb|CDA11083.1| asparagine--tRNA ligase [Clostridium bartlettii CAG:1329]
 gb|ETI92613.1| Asparagine-tRNA ligase [Intestinibacter bartlettii DORA_8_9]
Length=465

 Score =   526 bits (1355),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/455 (57%), Positives = 343/455 (75%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             + +T+ V GW+RT R   +  FIE+NDGS   NMQ V+ +  E + ++  G +    S+ 
Sbjct  19    IDKTVKVAGWIRTSRMSKNFGFIELNDGSFFKNMQIVIDEKLENFKEI--GKLPISTSLL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             I+GT+ ++Q +KQ +E++  K+V+ G+SD S+P+QKKR + E+LRT AHLRPR+N F A 
Sbjct  77    IEGTLVATQNAKQPVEIQATKIVVEGESDNSYPLQKKRHTVEYLRTIAHLRPRSNLFSAA  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQ+  FV+  SPI+T SDCEGAGE F +TTL           +N++
Sbjct  137   FRVRSVAAYAIHKFFQDRNFVYAHSPIITGSDCEGAGEMFRLTTL----------DLNDV  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G VD+SQDFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +EF
Sbjct  187   PKTEDGKVDYSQDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADLED+M  A   ++Y++ Y+L+NC E+MEFFN++++KG+++RL  +V  +
Sbjct  247   WMIEPEIAFADLEDNMELAEDMIKYIINYVLENCPEEMEFFNSFVDKGLLERLHKIVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT AIELLL++ +KFE+PV WGCDLQ+EHERYITE+ F   PV + DYPK+IKAF
Sbjct  307   FTRITYTKAIELLLESGQKFEYPVEWGCDLQTEHERYITEQIF-NAPVFVTDYPKEIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTV AMD+LVP VGE+IGGSQREER + L  R+ +  LN+E YWWYL+LR+Y
Sbjct  366   YMRMNEDGKTVRAMDLLVPGVGEIIGGSQREERYDLLMDRIKECGLNEEDYWWYLELRKY  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TGI NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYLTGISNIRDVIPFPRTP  460



>ref|WP_009787459.1| asparaginyl-tRNA synthetase [Lyngbya sp. PCC 8106]
 gb|EAW33966.1| asparaginyl-tRNA synthetase [Lyngbya sp. PCC 8106]
Length=463

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 278/475 (59%), Positives = 347/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE L        V+GWVRT R      F+EVNDGS ++N+Q V++ D E
Sbjct  5     RIAEILRSGQPDEAL-------TVQGWVRTKREFKEFAFVEVNDGSAMANLQVVLNLDLE  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + GT+  S    Q++ELK   +++ G +DP ++ +QKKR S E
Sbjct  58    NYQNILKQLN-TGASVEVVGTLVESPAKGQRVELKAESVIVYGDADPETYVLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRNA + A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRARTNTYGAVFRVRNACSAAVHQFFQERGFLWIHTPIITASDCEGAGEMFGV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L              +P TES  VD+S+DFFGKP FLTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------DFKNLPLTESKEVDFSRDFFGKPTFLTVSGQLQAEIMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DLE +M  A  +L+Y+ +++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGNMDLAEDFLKYIFKFVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++   +++  +  +LTYTDAI+LL K  KKFEFPV+WG DLQSEHERY+ E+ 
Sbjct  287   KRIDKTVLETADNIINNQFERLTYTDAIKLLEKADKKFEFPVSWGLDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYPKDIKAFYMR  DDGKTV AMD+L P++GE+IGGSQREERL+ LE R+ 
Sbjct  347   FKK-PVIVTDYPKDIKAFYMRLGDDGKTVRAMDVLAPKIGEIIGGSQREERLDVLENRMK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             ++++N E  WWYL+LR+YG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P S
Sbjct  406   EMDVNSEELWWYLELRKYGTVPHAGFGLGFERVVQFMTGMANIRDVIPFPRAPLS  460



>ref|WP_013254826.1| asparaginyl-tRNA synthetase [Spirochaeta smaragdinae]
 ref|YP_003803957.1| asparaginyl-tRNA synthetase [Spirochaeta smaragdinae DSM 11293]
 gb|ADK81363.1| asparaginyl-tRNA synthetase [Spirochaeta smaragdinae DSM 11293]
Length=462

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 269/457 (59%), Positives = 342/457 (75%), Gaps = 14/457 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             GE + V GWVRT R   +V F+E++DGS   N+Q ++ +  E    V +  I TGASV +
Sbjct  16    GERVTVYGWVRTKRDSKNVCFLELSDGSSFRNLQVIVDKAEEEKSPVIDS-ITTGASVEV  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              GT+A+S G  Q IEL+   L L+G++   S+P+QKKR S EFLR  AHLRPRTNTFGAV
Sbjct  75    TGTLAASPGKNQSIELQADSLKLIGEAPAESYPLQKKRHSFEFLREIAHLRPRTNTFGAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRN L++A H+FFQE GF++V +P+++ SDCEGAGE F VTTL          P+ ++
Sbjct  135   TRVRNQLSWAVHRFFQEQGFIYVHTPLISTSDCEGAGEMFQVTTL----------PLEKV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P  E G +D+SQDFFGK A LTVSGQL AE YA+A +DVYTFGPTFRAENSNT+RHLAEF
Sbjct  185   PLKE-GKIDYSQDFFGKRASLTVSGQLEAEIYASAFSDVYTFGPTFRAENSNTTRHLAEF  243

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AF DL  +M  A A+L+ ++  +L++C EDM+FFN W+EKGII  L  V++  
Sbjct  244   WMIEPEMAFCDLAGNMELAEAFLKNILSSVLEHCSEDMKFFNQWVEKGIIDSLEKVIDTP  303

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
                ++YT+A++ L   K  FEFPV WG DLQSEHER++TE    G PVI+ DYPK+IKAF
Sbjct  304   FTHMSYTEAVQALKTGKTNFEFPVEWGSDLQSEHERFLTETVCKG-PVIVTDYPKEIKAF  362

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YM+ NDDGK+VAAMD+LVPR+GE+IGGS+RE RL  LE+R+ D  LN E YWWYLDLRR+
Sbjct  363   YMKLNDDGKSVAAMDVLVPRLGEIIGGSERESRLSVLEQRIHDTGLNPEEYWWYLDLRRF  422

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             G+VPH+GFGLGFERL+Q+ TG+ NIRD IPFPRT G+
Sbjct  423   GTVPHSGFGLGFERLIQYVTGMQNIRDVIPFPRTVGN  459



>ref|WP_015148521.1| asparaginyl-tRNA synthetase [Oscillatoria acuminata]
 ref|YP_007085799.1| asparaginyl-tRNA synthetase [Oscillatoria acuminata PCC 6304]
 gb|AFY81879.1| asparaginyl-tRNA synthetase [Oscillatoria acuminata PCC 6304]
Length=463

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 276/463 (60%), Positives = 345/463 (75%), Gaps = 17/463 (4%)
 Frame = +2

Query  416   RLGE---TLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITG  586
             R GE   ++ ++GWVRT R     TF+EVNDGS L+N+Q V++ D   Y ++   L  TG
Sbjct  10    RTGEPQTSVTIQGWVRTKRELKEFTFVEVNDGSSLANLQIVLNPDLPQYTEILKQLN-TG  68

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTN  763
             AS+ + G +  S    Q+IEL   ++ L G+SDP ++P+QKKR S EFLRT  HLR RTN
Sbjct  69    ASLEVSGILVESPAKGQRIELNASEVKLYGESDPETYPLQKKRHSFEFLRTIGHLRGRTN  128

Query  764   TFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNS  943
             TFGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE   VT+L          
Sbjct  129   TFGAVFRVRNAAATAIHQFFQERGFLWVHTPIMTASDCEGAGEMLAVTSL----------  178

Query  944   PVNEIPKTE-SGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTS  1120
              + +IP+ E S  VD+ +DFFGKPA+LTVSGQL AE  A AL+DVYTFGPTFRAENSNTS
Sbjct  179   NLQDIPRLENSNQVDYGKDFFGKPAYLTVSGQLEAEVMAMALSDVYTFGPTFRAENSNTS  238

Query  1121  RHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLS  1300
             RHLAEFWM+EPE+AF DL  DM  A A+L+Y+ +++L+ C EDMEFFN  I+K +++  +
Sbjct  239   RHLAEFWMVEPEMAFCDLTGDMDLAEAFLKYIFKFVLEKCPEDMEFFNQRIDKTVLETAN  298

Query  1301  DVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYP  1480
             ++++ +  ++TYT+A+ LL K  KKFEFPV WG DLQSEHERY+ EE F   P I+ DYP
Sbjct  299   NIIDNQFERVTYTEAVALLKKADKKFEFPVEWGLDLQSEHERYLAEELFKK-PAIVTDYP  357

Query  1481  KDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWY  1660
              +IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERL+ L++RL+   L+ E YWWY
Sbjct  358   VEIKAFYMRLNDDNKTVAAMDILAPKIGEIIGGSQREERLDILQRRLEQQGLSIEDYWWY  417

Query  1661  LDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LDLRRYGSVPHAGFGLGFERLVQF TG+ NIRD IPFPR P S
Sbjct  418   LDLRRYGSVPHAGFGLGFERLVQFMTGMSNIRDVIPFPRAPLS  460



>ref|WP_029638590.1| asparaginyl-tRNA synthetase [[Scytonema hofmanni] UTEX B 1581]
Length=463

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 276/475 (58%), Positives = 349/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +++++GWVRT R      FIEVNDGS L+++Q VM+Q+  
Sbjct  5     RIAEILRSGQPDE-------SILIQGWVRTKRELKGFAFIEVNDGSSLASLQVVMNQNLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGAS+ + G +  SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYEAIIKKLN-TGASLEVTGVLVPSQGKGQRIELKAEMVEVYGEADPETYPLQKKRHSYE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACAAAIHQFFQERGFLWVHTPIITASDCEGAGELFNV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           + +IP+TE+ +VD++QDFFG+P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TGL----------NLKDIPRTENNAVDYAQDFFGRPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L++V +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDGDMDLAEAFLKHVFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYT+AI LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDDTVLATADNIINNEFQRLTYTEAISLLEKADVKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVSDYPAKIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRII  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTPQS  460



>ref|WP_016869073.1| asparaginyl-tRNA synthetase [Fischerella muscicola]
Length=463

 Score =   525 bits (1352),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 345/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PD+ L+       V+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIVEILRNGQPDDSLE-------VKGWVRTKRELKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S    Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYENILKKLN-TGASVEVSGVLVASPAKGQRVELKADSVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFMWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+S+DFF +P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQAVDYSKDFFARPTYLTVSGQLEAEIMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  DM  A  +L+Y+ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLHGDMDLAEEFLKYIFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYTDAI+LL K   +F++PVNWG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATADNIINNQFERITYTDAIKLLEKADVQFDYPVNWGLDLQSEHERYLCEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERLE LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVAAMDILAPKIGEIIGGSQREERLEVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKLEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_012629290.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7425]
 ref|YP_002484599.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7425]
 gb|ACL46238.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7425]
Length=467

 Score =   525 bits (1353),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 269/457 (59%), Positives = 339/457 (74%), Gaps = 15/457 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G  + V+GWVRT R Q   TF+EVNDGS L ++Q ++ +D   Y +V   L  TGASV +
Sbjct  18    GTRVKVKGWVRTKREQKEFTFLEVNDGSSLQSLQVILKRDLPNYTEVLKQLN-TGASVTV  76

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              G + +SQG  Q+IEL+  ++ + G++DP ++P+QKKR S EFLRT  HLR RTNT GAV
Sbjct  77    AGMLVASQGKNQRIELQADQVQVWGEADPETYPLQKKRHSLEFLRTIGHLRSRTNTLGAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              R+RNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VT+L           ++++
Sbjct  137   FRIRNACARAIHQFFQERGFLWVHTPIITASDCEGAGEMFAVTSL----------DLSKV  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P T    VD+SQDFFG+P +LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEF
Sbjct  187   PLTPDQKVDYSQDFFGRPTYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSNTSRHLAEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIE--KGIIKRLSDVVE  1312
             WM+EPE+AF DLE DM  A A+L+++ Q++LD C ED+ F N W++  K ++    +++ 
Sbjct  247   WMVEPEMAFCDLEGDMDLAEAFLKFIFQHVLDTCPEDLAFCNQWVDESKSVLATAENIIS  306

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI LL K+   FEFPV WG DLQSEHERY+ E+ F   PVI+ DYPK IK
Sbjct  307   HQFERITYTEAIALLEKSNHPFEFPVQWGLDLQSEHERYLAEQLFKK-PVIVTDYPKQIK  365

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE+IGGSQREERLE LE+R+ +  L+   YWWYLDLR
Sbjct  366   AFYMRLNEDGKTVRAMDVLAPKIGEIIGGSQREERLEVLEQRISEQGLDLAPYWWYLDLR  425

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             RYG+VPHAGFGLGFERLVQF TGI NIRD IPFPRTP
Sbjct  426   RYGTVPHAGFGLGFERLVQFMTGIGNIRDVIPFPRTP  462



>ref|WP_015217480.1| asparaginyl-tRNA synthetase [Anabaena cylindrica]
 ref|YP_007159778.1| asparaginyl-tRNA synthetase [Anabaena cylindrica PCC 7122]
 gb|AFZ60868.1| asparaginyl-tRNA synthetase [Anabaena cylindrica PCC 7122]
Length=463

 Score =   525 bits (1352),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 276/474 (58%), Positives = 346/474 (73%), Gaps = 20/474 (4%)
 Frame = +2

Query  374   RIADI-KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             RIA+I K G  E      E LV++ WVRT R      F+EVNDGS L N+Q V++QD   
Sbjct  5     RIAEILKTGEPE------EVLVIQAWVRTKRELKGFAFLEVNDGSSLGNLQIVINQDLPN  58

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREF  727
             Y+ +    I TGASV + G + +SQG  Q+IELK   + + G +DP ++P+QKKR S EF
Sbjct  59    YEGILKQ-INTGASVEVTGVLVASQGKGQRIELKANSVKVYGDADPDTYPLQKKRHSFEF  117

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT AHLR RTN+FGAV RVRNA + A H+FFQE  F+WV +PI+TASDCEGAGE F VT
Sbjct  118   LRTIAHLRSRTNSFGAVFRVRNACSAAIHQFFQEKRFLWVHTPIITASDCEGAGELFSVT  177

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
                       N  +  +P+TE+  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTFG
Sbjct  178   ----------NFNLKNVPRTENQEIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTFG  227

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+Y+ +Y+L+ C EDMEFFN 
Sbjct  228   PTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKYIFKYVLETCPEDMEFFNE  287

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
              I+K +++  ++++  +  +LTYT+A++LL K   KF++PV+WG DLQSEHERY+ E+ F
Sbjct  288   RIDKTVLETANNIINNQFERLTYTEAVKLLEKADVKFDYPVSWGADLQSEHERYLAEQLF  347

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+  
Sbjct  348   KK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVLA  406

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
               +N    WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  407   QGMNPADLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_013192229.1| asparaginyl-tRNA synthetase [Trichormus azollae]
 ref|YP_003722338.1| asparaginyl-tRNA synthetase ['Nostoc azollae' 0708]
 gb|ADI65215.1| asparaginyl-tRNA synthetase ['Nostoc azollae' 0708]
Length=463

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 346/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +L+++GWVRT R      F+EVNDGS L N+Q V++QD  
Sbjct  5     RIAEILRTGQPDE-------SLLIQGWVRTKRELKGFAFLEVNDGSSLGNLQIVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +    I TGASV + G + +SQG  Q+IELK   L + G +DP ++P+QKKR S E
Sbjct  58    NYEGILKQ-INTGASVEVSGVLVASQGKGQRIELKADVLKIYGDADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTN+FGAV RVRNA A A H+FFQE  F+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNSFGAVFRVRNACATAIHQFFQERDFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L             +IP+T +  +D+SQDFF KPA+LTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------DFKKIPRTGNQDIDYSQDFFSKPAYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+Y+ +Y+L+ C +DMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKYIFKYVLETCTQDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I++ +++    ++  +  +L+YTDA++ L K   KF++PV WG DLQSEHERY+ E+ 
Sbjct  287   ERIDRTVLETADYIISNQFERLSYTDAVKFLEKADVKFDYPVTWGTDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PV++ DYP  IKAFYMR +DD KTV AMD+LVP++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVVVTDYPAGIKAFYMRLSDDEKTVRAMDILVPKIGEIIGGSQREERLDVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             D  +N E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   DQGMNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_015162505.1| asparaginyl-tRNA synthetase [Chamaesiphon minutus]
 ref|YP_007099950.1| asparaginyl-tRNA synthetase [Chamaesiphon minutus PCC 6605]
 gb|AFY96423.1| asparaginyl-tRNA synthetase [Chamaesiphon minutus PCC 6605]
Length=463

 Score =   524 bits (1350),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 336/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + VRGW+R+ R      F+++NDGSC++N+Q V+ +    YD +    I TGAS+ +
Sbjct  16    GDAVTVRGWIRSKREAKEFAFVDINDGSCMANIQVVVDRHVPNYDTIVKQ-INTGASIEV  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              G +  S    Q+ E+K  ++ + G++DP ++P+QKKR S EFLR   HLR RTNT  AV
Sbjct  75    IGELVESPAKGQRFEVKASQVKIYGEADPETYPLQKKRHSFEFLREIGHLRSRTNTLSAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRNA A A H+FFQE GF+WV +PI++ASDCEGAGE F VTTL           +  +
Sbjct  135   FRVRNACAAAIHQFFQERGFLWVHTPIISASDCEGAGEMFNVTTL----------NLKNV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P T    +D+SQDFFGK A+LTVSGQL AE  A A ++VYTFGPTFRAENSNTSRHLAEF
Sbjct  185   PLTPDSQIDYSQDFFGKAAYLTVSGQLEAEVMAMAFSNVYTFGPTFRAENSNTSRHLAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AF DL +DM  A  +LQYV +Y+++NC+ DMEFFN  I+K ++    +++  +
Sbjct  245   WMIEPEMAFCDLREDMDLAETFLQYVFKYVMENCQADMEFFNERIDKSVLATAENIINNQ  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               +LTYT+AIELL K+ +KFE+PV+WG DLQSEHERY+ EE F   PVI+ DYP +IKAF
Sbjct  305   FERLTYTNAIELLEKSGQKFEYPVSWGLDLQSEHERYLAEEVFKK-PVILTDYPVEIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAAMD+L P++GE+IGGSQREERL+ LE+RL    LN   YWWYLDLRRY
Sbjct  364   YMRLNDDGKTVAAMDILAPKIGEIIGGSQREERLDVLERRLLAQGLNPADYWWYLDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  424   GTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRAP  458



>ref|WP_026722401.1| asparaginyl-tRNA synthetase [Fischerella sp. PCC 9431]
Length=463

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 346/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PD+ L+       V+GWVRT R     TFIEVNDGS L+N+Q V++QD  
Sbjct  5     RIVEILRNGQPDDSLE-------VKGWVRTKRELKGFTFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S    Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYENILKKLN-TGASVGVAGVLVASPAKGQRVELKADSVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFMWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+++DFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQTVDYTKDFFAKPTYLTVSGQLEAEIMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  DM  A  +L+Y+ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLHGDMDLAEEFLKYIFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   +F++PV+WG DLQSEHERY+ EE 
Sbjct  287   QRIDNTVLATADNIINNQFERITYTEAIKLLEKADVQFDYPVSWGLDLQSEHERYLCEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERLE LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVAAMDILAPKIGEIIGGSQREERLEVLERRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_021128388.1| asparagine--tRNA ligase [[Clostridium] sordellii]
 gb|EPZ57665.1| asparagine--tRNA ligase [ [[Clostridium] sordellii VPI 9048]
 emb|CEK37769.1| Asparaginyl-tRNA synthetase (Asparagine--tRNAligase) (AsnRS) 
[ [[Clostridium] sordellii]
Length=466

 Score =   524 bits (1349),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 256/459 (56%), Positives = 347/459 (76%), Gaps = 20/459 (4%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIIT----G  586
             +G+T+ V GW+RT R+  +  FIE+NDGS   NMQ V+S+D     ++EN   IT     
Sbjct  19    IGKTVKVAGWIRTSRSSKNFGFIELNDGSFFKNMQIVISED-----KLENFKEITKLPIS  73

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             +S+ ++G + S++G+KQ +E++  K+ + G+SD S+P+QKKR + E+LRT AHLRPR+NT
Sbjct  74    SSILVEGELVSTEGAKQPVEIQATKIEVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNT  133

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             F AV RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           
Sbjct  134   FSAVFRVRSLAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRLTTM----------D  183

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             +N IPKTE G++D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH
Sbjct  184   LNNIPKTEEGAIDYSKDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSFTQRH  243

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
              +EFWMIEPE+ FADLED+M  A   ++YV+ Y+++N  E+MEFFN++++KG++ RL++V
Sbjct  244   ASEFWMIEPEIVFADLEDNMELAEDMIKYVISYVMENAPEEMEFFNSFVDKGLMNRLNNV  303

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             V  +  ++TYT A+E+L ++   FE+PV WG DLQ+EHERY+TE+ F   PV + DYPKD
Sbjct  304   VNSEFTRITYTKAVEMLQESGHDFEYPVQWGDDLQTEHERYLTEQVF-KAPVFVTDYPKD  362

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L +R+ ++NLN+E YWWYL+
Sbjct  363   IKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVLLERIKEMNLNEEDYWWYLE  422

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             LR++G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  423   LRKFGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>emb|CEK35366.1| asparaginyl-tRNA ligase,Asparagine--tRNA ligase,asparaginyl-tRNA 
synthetase,Aspartyl/asparaginyl-tRNA synthetases,asparagine--tRNA 
ligase,tRNA synthetases class II (D, K and N) [ [[Clostridium] 
sordellii]
Length=466

 Score =   524 bits (1349),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 256/459 (56%), Positives = 347/459 (76%), Gaps = 20/459 (4%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIIT----G  586
             +G+T+ V GW+RT R+  +  FIE+NDGS   NMQ V+S+D     ++EN   IT     
Sbjct  19    IGKTVKVAGWIRTSRSSKNFGFIELNDGSFFKNMQIVISED-----KLENFKEITKLPIS  73

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             +S+ ++G + S++G+KQ +E++  K+ + G+SD S+P+QKKR + E+LRT AHLRPR+NT
Sbjct  74    SSILVEGELVSTEGAKQPVEIQATKIEVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNT  133

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             F AV RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           
Sbjct  134   FSAVFRVRSLAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFKLTTM----------D  183

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             +N IPKTE G++D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH
Sbjct  184   LNNIPKTEEGAIDYSKDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSFTQRH  243

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
              +EFWMIEPE+ FADLED+M  A   ++YV+ Y+++N  E+MEFFN++++KG++ RL++V
Sbjct  244   ASEFWMIEPEIVFADLEDNMELAEDMIKYVISYVMENAPEEMEFFNSFVDKGLMDRLNNV  303

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             V  +  ++TYT A+E+L ++   FE+PV WG DLQ+EHERY+TE+ F   PV + DYPKD
Sbjct  304   VNSEFTRITYTKAVEMLQESGHDFEYPVQWGDDLQTEHERYLTEQVF-KAPVFVTDYPKD  362

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L +R+ ++NLN+E YWWYL+
Sbjct  363   IKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVLLERIKEMNLNEEDYWWYLE  422

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             LR++G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  423   LRKFGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>ref|WP_015113755.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7107]
 ref|YP_007050694.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7107]
 gb|AFY43544.1| asparaginyl-tRNA synthetase [Nostoc sp. PCC 7107]
Length=463

 Score =   523 bits (1348),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 274/473 (58%), Positives = 347/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +LVV+GWVRT R      FIEVNDGS L+N+Q V+ QD  
Sbjct  5     RIAEILRSGQPDE-------SLVVQGWVRTKRDLKGFAFIEVNDGSSLANLQVVIHQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              ++ +   L  TGASV + G + +SQG  Q+IELK   + + G++DP ++P+QKKR S E
Sbjct  58    DFEAILKKLN-TGASVEVNGVLVASQGKGQRIELKAEAVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQE  F+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSTAIHQFFQERDFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+T++ +VD++QDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTDNQAVDYTQDFFTKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L+++  Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHIFNYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYTDAI+LL K   KF++PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDDTVLATAENIINNQFERLTYTDAIKLLEKADVKFDYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLERRVI  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               ++  E  WWYLDLRR+G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQDMKPEDLWWYLDLRRFGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>emb|CEJ73281.1| Asparaginyl-tRNA synthetase (Asparagine--tRNA ligase) (AsnRS) 
[ [[Clostridium] sordellii]
 emb|CEK30386.1| asparaginyl-tRNA ligase [ [[Clostridium] sordellii]
Length=466

 Score =   523 bits (1348),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 256/459 (56%), Positives = 347/459 (76%), Gaps = 20/459 (4%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIIT----G  586
             +G+T+ V GW+RT R+  +  FIE+NDGS   NMQ V+S+D     ++EN   IT     
Sbjct  19    IGKTVKVAGWIRTSRSSKNFGFIELNDGSFFKNMQIVISED-----KLENFKEITKLPIS  73

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             +S+ ++G + S++G+KQ +E++  K+ + G+SD S+P+QKKR + E+LRT AHLRPR+NT
Sbjct  74    SSILVEGELVSTEGAKQPVEIQATKIEVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNT  133

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             F AV RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           
Sbjct  134   FSAVFRVRSLAAYAIHKFFQERNFVYAHSPIITGSDCEGAGEMFRLTTM----------D  183

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             +N IPKTE G++D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH
Sbjct  184   LNNIPKTEEGAIDYSKDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSFTQRH  243

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
              +EFWMIEPE+ FADLED+M  A   ++YV+ Y+++N  E+MEFFN++++KG++ RL++V
Sbjct  244   ASEFWMIEPEIVFADLEDNMELAEDMIKYVISYVMENAPEEMEFFNSFVDKGLMDRLNNV  303

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             V  +  ++TYT A+E+L ++   FE+PV WG DLQ+EHERY+TE+ F   PV + DYPKD
Sbjct  304   VNSEFTRITYTKAVEMLQESGHDFEYPVQWGDDLQTEHERYLTEQVF-KAPVFVTDYPKD  362

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L +R+ ++NLN+E YWWYL+
Sbjct  363   IKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVLLERIKEMNLNEEDYWWYLE  422

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             LR++G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  423   LRKFGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>ref|WP_008182157.1| asparaginyl-tRNA synthetase [Moorea producens]
 gb|EGJ33522.1| asparaginyl-tRNA synthetase [Moorea producens 3L]
Length=462

 Score =   523 bits (1348),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 348/474 (73%), Gaps = 21/474 (4%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA++   G PD+       +L ++GWVRT R      F+EVNDGS ++N+Q V++ D  
Sbjct  5     RIAEVLRNGQPDQ-------SLTIQGWVRTKRELKDFAFMEVNDGSSMANLQVVLNPDLS  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREF  727
              Y+ +   L  TG+SV + G +  S G  Q+IE+K   + + G++D ++P+QKKR S EF
Sbjct  58    DYETILKRLN-TGSSVEVTGILVESLGKGQRIEVKASSVTVYGEADANYPLQKKRHSFEF  116

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT +HLR RTNT GAV RVRNA + A H+FFQE GF+WV +PI+TASDCEGAGE F VT
Sbjct  117   LRTISHLRSRTNTLGAVFRVRNACSNAIHQFFQERGFLWVHTPIITASDCEGAGELFSVT  176

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
              L           +  IPKT++ +VD++QDFFG+P +LTVSGQL AE  A A  DVYTFG
Sbjct  177   NL----------DLKNIPKTDNQAVDYTQDFFGRPTYLTVSGQLEAEIMAMAFRDVYTFG  226

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L++V + +L+NC ED+EFFN 
Sbjct  227   PTFRAENSNTSRHLAEFWMVEPEMAFCDLKGDMDLAEAFLKHVFKSVLENCPEDLEFFNK  286

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
              I+  ++    +++  +  ++TYTDAI LL KT +KFE+ V+WG DLQSEHERY+ EE F
Sbjct  287   RIDNNVLATADNIINNQFERITYTDAIALLEKTDRKFEYAVSWGVDLQSEHERYLAEELF  346

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                PVI+ DYP +IKAFYMR NDD KTVAAMD+L PR+GE+IGG+QREERL+ LEKR+ +
Sbjct  347   KK-PVIVTDYPVEIKAFYMRLNDDQKTVAAMDVLAPRIGEIIGGAQREERLDILEKRIQN  405

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
               +N E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   QGMNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPLS  459



>ref|WP_015205859.1| asparaginyl-tRNA synthetase [Cylindrospermum stagnale]
 ref|YP_007145280.1| asparaginyl-tRNA synthetase [Cylindrospermum stagnale PCC 7417]
 gb|AFZ22600.1| asparaginyl-tRNA synthetase [Cylindrospermum stagnale PCC 7417]
Length=463

 Score =   523 bits (1347),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 274/473 (58%), Positives = 344/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +L+V+GWVRT R      FIE+NDGS L+N+Q V++QD  
Sbjct  5     RIAEILRSGQPDE-------SLMVQGWVRTKRELKGFAFIELNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S G  Q+IELK   L + G +DP ++P+QKKR S E
Sbjct  58    DYEAIIKQLN-TGASVEVTGVLVASLGKGQRIELKAQTLKVYGDADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQ+ GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTVGHLRSRTNSFGAVFRVRNACSAAIHQFFQQRGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  +P+TE+  +D+SQDFF KP +LTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------NLKNVPRTENQEIDYSQDFFSKPTYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+++ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKHIFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYTDAI+LL +   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATAENIINNQFERLTYTDAIKLLEQADFKFEYPVSWGLDLQSEHERYLAEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LEKR+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLSDDEKTVRAMDILAPKIGEIIGGSQREERLDVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMANIRDVIPFPRTP  458



>ref|WP_021432526.1| asparagine--tRNA ligase [[Clostridium] bifermentans]
 gb|EQK42388.1| asparagine--tRNA ligase [ [[Clostridium] bifermentans ATCC 638]
Length=466

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/478 (54%), Positives = 352/478 (74%), Gaps = 23/478 (5%)
 Frame = +2

Query  362   RRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQD  541
             R  + I D+    +E    +G+++ V GW+RT RA  +  FIE+NDGS   NMQ V+S +
Sbjct  3     RDFIEIKDLYRNKEE---HIGKSIKVAGWIRTSRASKNFGFIELNDGSFFKNMQVVISDE  59

Query  542   AEGYDQVENGLIIT----GASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKK  709
                  ++EN   IT     +S+ ++G + +++G+KQ +E+    + L G+SD S+P+QKK
Sbjct  60    -----KLENFKEITKLPISSSILVEGELVATEGAKQPVEIHATNIELEGESDSSYPLQKK  114

Query  710   RVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAG  889
             R + E+LRT AHLRPR+NTF AV RVR+  A+A HKFFQ+  FV+  SPI+T SDCEGAG
Sbjct  115   RHTLEYLRTIAHLRPRSNTFSAVFRVRSLAAYAIHKFFQDRNFVYAHSPIITGSDCEGAG  174

Query  890   EQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALN  1069
             E F +TT+           +N IPKTE G++D+S DFFGK A LTVSGQLNAE  A A  
Sbjct  175   EMFRITTM----------DLNSIPKTEEGAIDYSNDFFGKEANLTVSGQLNAEIMALAFR  224

Query  1070  DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKED  1249
             +VYTFGPTFRAENS T RH +EFWMIEPE+AFADLED+M  A   ++YV+ Y++++  E+
Sbjct  225   NVYTFGPTFRAENSFTQRHASEFWMIEPEIAFADLEDNMELAEDMIKYVISYVMEHAPEE  284

Query  1250  MEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERY  1429
             MEFFN++I+KG+I+RL++VV  +  ++TYT A+E+L ++  +FE+PV WG DLQ+EHERY
Sbjct  285   MEFFNSFIDKGLIERLNNVVNSEFTRITYTKAVEMLQESGHEFEYPVQWGDDLQTEHERY  344

Query  1430  ITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleyl  1609
             +TE+ F   PV + DYPKDIKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L
Sbjct  345   LTEQVF-KAPVFVTDYPKDIKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVL  403

Query  1610  ekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               R+ ++NLN+E YWWYL+LR+YG+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  404   LDRIKEMNLNEEDYWWYLELRKYGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>ref|WP_025162005.1| MULTISPECIES: asparaginyl-tRNA synthetase [Clostridiales]
 gb|KGJ48656.1| asparaginyl-tRNA synthetase [Clostridium sp. NCR]
Length=466

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/478 (55%), Positives = 352/478 (74%), Gaps = 23/478 (5%)
 Frame = +2

Query  362   RRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQD  541
             R  + I D+    +E    +G+++ V GW+RT RA  +  FIE+NDGS   NMQ V+S +
Sbjct  3     RDFIEIKDLYRNKEE---YIGKSIKVAGWIRTSRASKNFGFIELNDGSFFKNMQVVISDE  59

Query  542   AEGYDQVENGLIIT----GASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKK  709
                  ++EN   IT     +S+ ++G + S++G+KQ +E+    + L G+SD S+P+QKK
Sbjct  60    -----KLENFKEITKLPISSSILVEGELVSTEGAKQPVEIHATNIELEGESDSSYPLQKK  114

Query  710   RVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAG  889
             R + E+LRT AHLRPR+NTF AV RVR+  A+A HKFFQ+  FV+  SPI+T SDCEGAG
Sbjct  115   RHTLEYLRTIAHLRPRSNTFSAVFRVRSLAAYAIHKFFQDRNFVYAHSPIITGSDCEGAG  174

Query  890   EQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALN  1069
             E F +TT+           +N IPKTE G++D+S DFFGK A LTVSGQLNAE  A A  
Sbjct  175   EMFRITTM----------DLNSIPKTEEGAIDYSNDFFGKEANLTVSGQLNAEIMALAFR  224

Query  1070  DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKED  1249
             +VYTFGPTFRAENS T RH +EFWMIEPE+AFADLED+M  A   ++YV+ Y++++  E+
Sbjct  225   NVYTFGPTFRAENSFTQRHASEFWMIEPEIAFADLEDNMELAEDMIKYVISYVMEHAPEE  284

Query  1250  MEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERY  1429
             MEFFN++I+KG+I+RL++VV  +  ++TYT A+E+L ++  +FE+PV WG DLQ+EHERY
Sbjct  285   MEFFNSFIDKGLIERLNNVVNSEFTRITYTKAVEMLQESGHEFEYPVQWGDDLQTEHERY  344

Query  1430  ITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleyl  1609
             +TE+ F   PV + DYPKDIKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L
Sbjct  345   LTEQVF-KAPVFVTDYPKDIKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVL  403

Query  1610  ekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               R+ ++NLN+E YWWYL+LR+YG+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  404   LDRIKEMNLNEEDYWWYLELRKYGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>ref|WP_039725923.1| asparaginyl-tRNA synthetase [Lyngbya confervoides]
 gb|KIF14210.1| asparaginyl-tRNA synthetase [Aphanocapsa montana BDHKU210001]
 gb|KIF39148.1| asparaginyl-tRNA synthetase [Lyngbya confervoides BDU141951]
Length=462

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 345/472 (73%), Gaps = 21/472 (4%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIAD+   G P       G++  ++GWVRT RAQ ++ FI VNDGSC+S +Q V   D  
Sbjct  5     RIADLLKSGQP-------GDSTTIQGWVRTKRAQKTLCFINVNDGSCMSGVQIVAESDMA  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREF  727
             GYD V +  I TGASV IQGT+  S    Q+IE+K  ++ + G +D S+P+QKKR S EF
Sbjct  58    GYDNVISQ-IATGASVEIQGTVVESPAKGQRIEVKAEQIRVFGGADESYPLQKKRHSFEF  116

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT  HLR RTNT GAV RVRNA A A H+FF++ GF+WV +PI+TASDCEGAGE F VT
Sbjct  117   LRTLGHLRSRTNTLGAVFRVRNAAAQAVHEFFRDRGFLWVHTPILTASDCEGAGEMFTVT  176

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
             +L           +N+ P T+   VD  QDFFGK A+LTVSGQL AE  A A  +VYTFG
Sbjct  177   SL----------NLNQPPLTKGNGVDVEQDFFGKSAYLTVSGQLEAEIMAMAFTNVYTFG  226

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWMIEPE+AF DL  +   A  +L+Y+ + +LD C++DM FFN 
Sbjct  227   PTFRAENSNTSRHLAEFWMIEPEMAFCDLMGNADLAEDFLKYIFKAVLDACEDDMAFFNQ  286

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
              I+  ++    +++  +  ++TYT+A+ELLLKT KKFEFPV WG DLQSEHERY+ E+ F
Sbjct  287   RIDDSVLATADNIINNEFARITYTEAVELLLKTDKKFEFPVEWGIDLQSEHERYLAEDLF  346

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                PVI+ DYP  IKAFYMR NDD KTVAAMD+L P+VGE+IGGSQREERL+ LE R+D+
Sbjct  347   KK-PVIVTDYPAAIKAFYMRLNDDQKTVAAMDVLAPKVGEIIGGSQREERLDILETRIDE  405

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               L +++YWWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AGLPRDAYWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  457



>ref|WP_023064824.1| asparagine--tRNA ligase [Lyngbya aestuarii]
 gb|ERT08992.1| asparagine--tRNA ligase [Lyngbya aestuarii BL J]
Length=463

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 276/475 (58%), Positives = 347/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE L        V+GWVRT R      F+EVNDGS ++N+Q V++ D E
Sbjct  5     RIAEILRSGQPDEAL-------TVQGWVRTKREFKEFAFVEVNDGSAMANLQVVLNLDLE  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + GT+  S    Q++ELK   +++ G +DP ++ +QKKR S E
Sbjct  58    NYQNILKQLN-TGASVEVVGTLVESPAKGQRVELKAESVIVYGDADPETYVLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRNA + A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRARTNTYGAVFRVRNACSAAVHQFFQERGFLWIHTPIITASDCEGAGEMFGV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L              +P TES  VD+S+DFFGKP FLTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------DFKNLPLTESKEVDFSRDFFGKPTFLTVSGQLQAEIMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DLE +M  A  +L+Y+ +++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGNMDLAEDFLKYIFKFVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++   +++  +  +LTYT+AI+LL K  KKF+FPV+WG DLQSEHERY+ E+ 
Sbjct  287   KRIDKTVLETADNIINNQFERLTYTEAIKLLEKADKKFDFPVSWGLDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYPKDIKAFYMR  DDGKTV AMD+L P++GE+IGGSQREERL+ LE R+ 
Sbjct  347   FKK-PVIVTDYPKDIKAFYMRLGDDGKTVRAMDVLAPKIGEIIGGSQREERLDILESRMK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             ++++N E  WWYL+LR+YG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P S
Sbjct  406   EMDVNSEELWWYLELRKYGTVPHAGFGLGFERVVQFMTGMANIRDVIPFPRAPLS  460



>ref|WP_013944267.1| asparaginyl-tRNA synthetase [Simkania negevensis]
 ref|YP_004672292.1| asparaginyl-tRNA synthetase [Simkania negevensis Z]
 emb|CCB89801.1| asparaginyl-tRNA synthetase [Simkania negevensis Z]
Length=464

 Score =   522 bits (1345),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 344/456 (75%), Gaps = 14/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             LG+ + V GW+RT+R Q S  FIE++DGSC S +Q V       Y + +   + TGA++ 
Sbjct  19    LGKNVTVCGWIRTVRDQKSFAFIEISDGSCFSTIQAVADAKLPSY-EAKIAELSTGAAIA  77

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             I G +  S G+KQK E++V  + L G     FP+QKKR S +FLR+ AHLRPRTNT GAV
Sbjct  78    ISGEVVKSPGNKQKYEIQVSSIELFGTCPNDFPLQKKRHSFDFLRSIAHLRPRTNTQGAV  137

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
             ARVR+ LA+ATH+FFQE GFV++ SPI+TASDCEGAGE F +TTL  ++           
Sbjct  138   ARVRSRLAYATHRFFQERGFVYLQSPIITASDCEGAGELFQITTLNLDN-----------  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P  + G +D+ QDFF KPAFLTVSGQLNAE YATAL+DVYTFGPTFRAENSNTSRHLAEF
Sbjct  187   PPRDKGKIDYKQDFFSKPAFLTVSGQLNAEAYATALSDVYTFGPTFRAENSNTSRHLAEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFA+L    + A  YL+ ++Q  L +C +DM+FFN  I+KGII+RL  V +  
Sbjct  247   WMIEPEMAFANLNTVANLAEDYLKCLIQEAL-SCDQDMQFFNEHIDKGIIERLQHVHDSP  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
              +++TYT+AI++L K+ K FE+PV WG DLQSEHERYI EE +   PVI+ +YPK+IKAF
Sbjct  306   FIRMTYTEAIDILKKSNKPFEYPVEWGSDLQSEHERYIAEE-YCKKPVILTNYPKEIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR N+DGKTVAA+D+LVP++GE+IGGSQREER + L K+++ + L+  +Y WYLDLR+Y
Sbjct  365   YMRNNEDGKTVAALDVLVPKIGEIIGGSQREERYDILTKKIEAIGLDPHAYAWYLDLRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G+VPH GFGLGFERLVQF TGI+NIRDAI FPR PG
Sbjct  425   GTVPHGGFGLGFERLVQFVTGIENIRDAIAFPRVPG  460



>ref|WP_012596410.1| MULTISPECIES: asparaginyl-tRNA synthetase [Cyanothece]
 ref|YP_002373305.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 8801]
 ref|YP_003138631.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 8802]
 gb|ACK67149.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 8801]
 gb|ACV01796.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 8802]
Length=463

 Score =   522 bits (1344),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 349/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI DI   G PD+       T+ V+GWVRT R     TFIEVNDGS ++N+Q V+     
Sbjct  5     RIRDILRHGQPDD-------TITVQGWVRTKRELKEFTFIEVNDGSSMANIQVVLDATLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y++V   L  TGASV + GT+  S G  Q+IE+K   + + G+SDP ++P+QKKR S E
Sbjct  58    NYEEVLKRLN-TGASVEVLGTLVPSPGKGQRIEVKASSIQVYGESDPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTNT GAV RVRNA A A H+FFQE  F+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNTLGAVMRVRNACATAIHRFFQERDFIWVHTPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+            +++IP+T+  +VD+SQDFFGK A+LTVSGQL AE  A A  +VYTF
Sbjct  177   TSF----------DLSKIPQTQEKTVDYSQDFFGKRAYLTVSGQLEAEVMAMAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE D   A A+L+Y+ +++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDQELAEAFLKYIFKFVLETCSEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K +++  ++++  +  ++TYT+A++LL K  ++FE+PV WG DLQSEHERY+ EE 
Sbjct  287   ERIDKSVLETANNIINNEFERITYTEAVKLLEKADRQFEYPVEWGIDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P+I+ +YP  IKAFYMR N+D KTVAAMD+L P++GE+IGGSQREERLE L++R+ 
Sbjct  347   FKK-PLIVTNYPAGIKAFYMRLNEDDKTVAAMDVLAPKIGEIIGGSQREERLEVLQQRIQ  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              L + +E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   KLGILEEDIWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPLS  460



>ref|WP_015954668.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7424]
 ref|YP_002377935.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7424]
 gb|ACK71067.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7424]
Length=463

 Score =   522 bits (1344),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 347/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA++  +G P+E       T+ + GWVRT R      F+EVNDGSC++N+Q V+     
Sbjct  5     RIAEVLKQGQPEE-------TVTIAGWVRTKRELKGFAFMEVNDGSCMANLQVVLDPQVP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              YD +    I TGASV ++G +  S G  Q+IELK   + L G++DP ++P+QKKR S E
Sbjct  58    DYDTLVQT-INTGASVVVKGNLVPSPGKGQRIELKATTVTLYGEADPQTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT GAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNTLGAVMRVRNACANAIHRFFQERGFLWVHTPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L            N++P+ +   +D+SQDFFGK A+LTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DFNKLPRNKQQEIDFSQDFFGKRAYLTVSGQLEAEIMALAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  D   A A+L+Y+ +++LD+C+EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLNGDQDLAEAFLKYIFKFVLDHCQEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +++   +++  +  ++TYT+AI LL K  ++FE+PV WG DLQSEHERY+ EE 
Sbjct  287   QRIDNTVLETAENIINNEFGRITYTEAIALLEKADRQFEYPVEWGVDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P+I+ +YPKDIKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERL+ LE R+ 
Sbjct  347   FKK-PLIVSNYPKDIKAFYMRLNDDDKTVAAMDVLAPKIGEIIGGSQREERLDVLENRIA  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              + L  E  WWYLDLRR+G+VPHAGFGLGFER+VQF TG+ NIRD IPFPRTP S
Sbjct  406   QMGLPPEDLWWYLDLRRFGTVPHAGFGLGFERVVQFMTGMGNIRDVIPFPRTPLS  460



>ref|WP_015223170.1| asparaginyl-tRNA synthetase [Cyanobacterium stanieri]
 ref|YP_007165503.1| asparaginyl-tRNA synthetase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ47854.1| asparaginyl-tRNA synthetase [Cyanobacterium stanieri PCC 7202]
Length=462

 Score =   522 bits (1344),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 272/473 (58%), Positives = 341/473 (72%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I  +G P+E +        ++GWVRT R     TFIEV+DGS L+N+Q +++QD  
Sbjct  4     RIINILRQGKPEEKVK-------IQGWVRTKRELKEFTFIEVSDGSSLANLQVILNQDLP  56

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSRE  724
              Y+ V   L  TGAS+ ++G +  S    QKIEL    + + G+ D   +P+QKKR S E
Sbjct  57    DYNNVIKKLS-TGASLAVEGVLVESPAKGQKIELHAQTITIYGECDGKDYPLQKKRHSLE  115

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT GAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  116   FLRTIAHLRGRTNTLGAVMRVRNACAQAVHQFFQEKGFLWVHTPIITASDCEGAGELFTV  175

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  ++ IP+ + G  D+++DFFGK A+LTVSGQL AE  A +  +VYTF
Sbjct  176   T----------NFNLDNIPRNDQGKTDYTEDFFGKKAYLTVSGQLEAEIMAMSFENVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DLE D + A  +L+YV +Y+LD+C EDMEFFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGDQNLAQEFLKYVFKYVLDHCPEDMEFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I   ++    +++  +  ++TYT+AI LL K  + F+FPV WG DLQSEHERY+ EE 
Sbjct  286   LRINNTVLANAENIINNEFARITYTEAINLLEKCDRTFQFPVEWGIDLQSEHERYLAEEY  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ +YPKDIKAFYMR N+D KTVAAMD+L P +GE+IGGSQREER + LE R+ 
Sbjct  346   FKK-PVIVTNYPKDIKAFYMRLNEDQKTVAAMDILAPNIGEIIGGSQREERYDILESRIK  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             ++N++ +  WWYLDLRRYG+VPHAGFGLGFERLVQF TGIDNIRD IPFPRTP
Sbjct  405   EMNIDPQELWWYLDLRRYGTVPHAGFGLGFERLVQFMTGIDNIRDVIPFPRTP  457



>ref|WP_027984655.1| asparaginyl-tRNA synthetase [delta proteobacterium PSCGC 5296]
Length=464

 Score =   522 bits (1344),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 263/456 (58%), Positives = 339/456 (74%), Gaps = 14/456 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLR-AQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             G  + V GW+RT R ++   +FIE+NDGSC +N+Q +     + Y+  E   +  G+S+ 
Sbjct  16    GANVTVGGWIRTRRDSKGGFSFIELNDGSCFANIQIIADNTLKNYN-TEVTKLFPGSSIV  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSREFLRTKAHLRPRTNTFGA  775
             + G +  SQG+ Q +E+K   + ++G   P  +P+QK+RVS E LR  AHLRPRTN+FGA
Sbjct  75    VHGKLVESQGAGQSVEIKAETVRVLGFCKPEEYPLQKQRVSFERLREVAHLRPRTNSFGA  134

Query  776   VARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNE  955
             V RVRN LAFATHKFFQE  F ++ SPI+T SDCEGAGE F VT+L           +N 
Sbjct  135   VTRVRNNLAFATHKFFQERNFYYLHSPIITCSDCEGAGEMFQVTSL----------DLNN  184

Query  956   IPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAE  1135
             +PK +  S+D+SQDFF +P+ LTVSGQLNAETYA AL +VYTFGPTFRAENSNT RHL+E
Sbjct  185   LPKNDKNSIDYSQDFFARPSNLTVSGQLNAETYACALGNVYTFGPTFRAENSNTRRHLSE  244

Query  1136  FWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEK  1315
             FWMIEPE+AFAD+ DD+  A  Y++++++ +LDNC+ED+ FF+  I+KG+I  L  + + 
Sbjct  245   FWMIEPEMAFADINDDVQLAEDYVRFLMKSVLDNCEEDLTFFDNRIQKGLIDNLKHIADS  304

Query  1316  KVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA  1495
                ++ YT A+E+L K +K F++PV WG DLQSEHERY+TEE F  CPV + DYPK+IKA
Sbjct  305   SFERINYTKAVEILQKAEKSFDYPVKWGLDLQSEHERYLTEEYF-KCPVTVTDYPKEIKA  363

Query  1496  FYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRR  1675
             FYMR NDDGKTVAA+D+LVP VGE+IGGSQREERL+ L +R+  +  N   YWWYLDLRR
Sbjct  364   FYMRMNDDGKTVAAIDVLVPGVGEIIGGSQREERLDMLVERIKSVGQNPADYWWYLDLRR  423

Query  1676  YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +GSVPHAGFGLGFER+VQF TG+ NIRD IPFPRTP
Sbjct  424   FGSVPHAGFGLGFERMVQFCTGMQNIRDVIPFPRTP  459



>gb|EKE07889.1| hypothetical protein ACD_17C00475G0001 [uncultured bacterium]
Length=452

 Score =   521 bits (1342),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 335/454 (74%), Gaps = 23/454 (5%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + + V GWVRTLR Q S  FIE+NDGS   N+Q V+      +  +   L  TGASV + 
Sbjct  16    DNVTVFGWVRTLRDQKSFAFIEINDGSTFGNLQIVLDSQCPNFVYLIKELT-TGASVRVM  74

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  S G  Q +EL+  ++ ++G  +   +P+QKKR S E+LRT AHLRPRTNT GAV 
Sbjct  75    GKLIKSPGKNQALELRASEIEIIGPCNAEKYPLQKKRHSFEYLRTIAHLRPRTNTQGAVL  134

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNALAFATH FFQ+ GF+++ +PI+T SDCEG GE F VTTL  N  E          
Sbjct  135   RVRNALAFATHLFFQKKGFLYLQTPIITGSDCEGGGEMFRVTTLDHNKPE----------  184

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
                       +DFFGK  FLTVSGQL AE  A AL+DVYTFGPTFRAENSNTSRHLAEFW
Sbjct  185   ----------KDFFGKATFLTVSGQLEAEIAACALSDVYTFGPTFRAENSNTSRHLAEFW  234

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AFADL+DD++CA  Y+Q+ VQY L+NCKEDM FF+  I+KG++ RL +++++  
Sbjct  235   MIEPEMAFADLQDDIACAEEYVQFTVQYALENCKEDMAFFDQHIDKGVLTRLENILKEPF  294

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++ YT+AIE+L K  K FEFPV WG DLQSEHER++ EE +   PV++ DYPK IKAFY
Sbjct  295   AKVPYTEAIEILKKASKNFEFPVGWGMDLQSEHERFLAEEHYQK-PVVVTDYPKHIKAFY  353

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDDGKTVAAMD+LVP++GELIGGSQREERL+ LE+++ +  LN+  YWWYL+LR YG
Sbjct  354   MRSNDDGKTVAAMDILVPKLGELIGGSQREERLDVLEEKIKECKLNRTDYWWYLELREYG  413

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +VPHAGFGLGFERLVQF TG++NIRDAIPFPR P
Sbjct  414   TVPHAGFGLGFERLVQFVTGVENIRDAIPFPRYP  447



>ref|WP_021428921.1| asparagine--tRNA ligase [[Clostridium] bifermentans]
 gb|EQK46869.1| asparagine--tRNA ligase [ [[Clostridium] bifermentans ATCC 19299]
Length=466

 Score =   521 bits (1343),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 261/478 (55%), Positives = 351/478 (73%), Gaps = 23/478 (5%)
 Frame = +2

Query  362   RRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQD  541
             R  + I D+    +E    +G+ + V GW+RT RA  +  FIE+NDGS   NMQ V+S +
Sbjct  3     RDFIEIKDLYRNKEE---YIGKRVKVAGWIRTSRASKNFGFIELNDGSFFKNMQVVISDE  59

Query  542   AEGYDQVENGLIIT----GASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKK  709
                  ++EN   IT     +S+ ++G + S++G+KQ +E+    + L G+SD S+P+QKK
Sbjct  60    -----KLENFKEITKLPISSSILVEGELVSTEGAKQPVEIHATNIELEGESDSSYPLQKK  114

Query  710   RVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAG  889
             R + E+LRT AHLRPR+NTF AV RVR+  A+A HKFFQ+  FV+  SPI+T SDCEGAG
Sbjct  115   RHTLEYLRTIAHLRPRSNTFSAVFRVRSLAAYAIHKFFQDRNFVYAHSPIITGSDCEGAG  174

Query  890   EQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALN  1069
             E F +TT+           +N IPKTE G++D+S DFFGK A LTVSGQLNAE  A A  
Sbjct  175   EMFRITTM----------DLNSIPKTEEGAIDYSNDFFGKEANLTVSGQLNAEIMALAFR  224

Query  1070  DVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKED  1249
             +VYTFGPTFRAENS T RH +EFWMIEPE+AFADLED+M  A   ++YV+ Y++++  E+
Sbjct  225   NVYTFGPTFRAENSFTQRHASEFWMIEPEIAFADLEDNMELAEDMIKYVISYVMEHAPEE  284

Query  1250  MEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERY  1429
             MEFFN++I+KG+I+RL++VV  +  ++TYT A+E+L ++  +FE+PV WG DLQ+EHERY
Sbjct  285   MEFFNSFIDKGLIERLNNVVNSEFTRITYTKAVEMLQESGYEFEYPVQWGDDLQTEHERY  344

Query  1430  ITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleyl  1609
             +TE+ F   PV + DYPKDIKAFYMR N+DGKTV AMD+LVP VGE++GGSQREER + L
Sbjct  345   LTEQVF-KAPVFVTDYPKDIKAFYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREERHDVL  403

Query  1610  ekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               R+ ++NLN+E YWWYL+LR+YG+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  404   LDRIKEMNLNEEDYWWYLELRKYGTATHSGFGLGFERIIMYMTGMANIRDVIPFPRTP  461



>ref|WP_006622580.1| MULTISPECIES: asparaginyl-tRNA synthetase [Arthrospira]
 emb|CCE19891.1| asparaginyl tRNA synthetase [Arthrospira sp. PCC 8005]
 gb|EKD08608.1| asparaginyl-tRNA synthetase [Arthrospira platensis C1]
 emb|CDM98405.1| asparaginyl tRNA synthetase [Arthrospira sp. PCC 8005]
Length=463

 Score =   521 bits (1343),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 349/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P       GE + V+GWVRT R     TF+EVNDGSC++N+Q V++ D  
Sbjct  5     RIAEILRTGKP-------GEAVTVQGWVRTKRELKEFTFVEVNDGSCMANLQVVLNPDLT  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G I SS    Q+IELK   + + G++DP ++ +QKKR S E
Sbjct  58    DYAAILRQLN-TGASVEVTGEIVSSPAKGQRIELKADTVQVYGEADPQTYVLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRNA A A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNTYGAVFRVRNACAAAVHQFFQERGFLWIHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +N +P TE+ +VD+SQDFFGK AFLTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLNHLPLTETKTVDFSQDFFGKRAFLTVSGQLEAEIMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DL+ +M  A A+L+++ + +L+ C ED+EFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLDGNMDLAEAFLKHIFKSVLEQCPEDLEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI LL K+ + FE+PV+WG DLQSEHERY+ EE 
Sbjct  287   QRIDNSVLATADNIINNEFERITYTEAIALLEKSDRTFEYPVSWGLDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP++IKAFYMR+NDD KTV AMD+L P+VGE+IGGSQREERL+ L+KR++
Sbjct  347   FKK-PVIVTDYPREIKAFYMRQNDDEKTVRAMDVLAPKVGEIIGGSQREERLDILQKRME  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
              L +N +  WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P
Sbjct  406   ALQINPDELWWYLDLRRYGTVPHAGFGLGFERVVQFMTGMANIRDVIPFPRAP  458



>ref|WP_017661521.1| asparaginyl-tRNA synthetase [Geitlerinema sp. PCC 7105]
Length=463

 Score =   521 bits (1342),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 271/454 (60%), Positives = 337/454 (74%), Gaps = 13/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ET  VRGWVRT R     +F+EVNDGS L+N+Q V+  +   YD +   L  TGASV + 
Sbjct  17    ETACVRGWVRTKRELKQFSFVEVNDGSSLANLQVVLDPELPDYDTLVKCLN-TGASVEVS  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             GT+  S    Q+IELK   + + G+ D  ++P+QKKR S EFLRT AHLR RTNT GAV 
Sbjct  76    GTLVESPAKGQRIELKATTVTVCGEVDSETYPLQKKRHSFEFLRTIAHLRSRTNTLGAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA + A H+FFQE GF+W+ +PI+TASDCEGAGE   VT             + ++P
Sbjct  136   RVRNAASDAIHRFFQERGFLWIHTPILTASDCEGAGELLSVTHF----------DLADVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +TE+ +VD+S+DFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   RTEAQAVDYSRDFFGKPAYLTVSGQLEAEVMAMAFGNVYTFGPTFRAENSNTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AF DL  DM  A  +L+Y+   +L+ C EDMEFFN  I+KG+++R  +++    
Sbjct  246   MIEPEMAFCDLAGDMDLAEDFLKYLFNAVLEACPEDMEFFNQRIDKGVLERAENILRHDF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +++YT+AIELL K  + FEFPV WG DLQSEHERY+ EE  G  P+I+ +YP++IKAFY
Sbjct  306   ERVSYTEAIELLEKADRTFEFPVEWGVDLQSEHERYLAEELLGK-PLIVYNYPRNIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTVAAMD+LVP++GE+IGGSQREERL+ LE+R+ +  LN+E YWWYLDLRRYG
Sbjct  365   MRLNDDEKTVAAMDVLVPKIGEIIGGSQREERLDVLERRIRESGLNREDYWWYLDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             SV HAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  425   SVSHAGFGLGFERLVQFVTGMANIRDVIPFPRAP  458



>ref|WP_011611843.1| asparaginyl-tRNA synthetase [Trichodesmium erythraeum]
 ref|YP_721948.1| asparaginyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
 gb|ABG51475.1| asparaginyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
Length=463

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 340/473 (72%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA I   G PD         + ++GWVRT R      F+EVNDGSCL+N+Q V++ D  
Sbjct  5     RIAKILGSGQPDA-------KVTIQGWVRTKRELKEFAFVEVNDGSCLANLQVVLNPDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y +    +  TGASV + G +  S    Q+IELK   +   G +DP ++P+QKKR S E
Sbjct  58    NYQESLQQMN-TGASVEMTGILVESPAKGQRIELKAESITAYGDADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRN  A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRGRTNTYGAVFRVRNTCANAIHQFFQERGFLWVHTPIITASDCEGAGEMFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           + +IP TE   +D+SQDFFGK AFLTVSGQL AE  ATAL++VYTF
Sbjct  177   TNL----------DLKKIPLTEKQDIDFSQDFFGKSAFLTVSGQLEAEIMATALSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DLE DM  A  +L+Y+ + +L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGDMDLAEEFLKYIFKSVLEGCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K + +    ++     ++TYT+A+ LL K  KKF++PV+WG DLQSEHERY+ EE 
Sbjct  287   KRIDKTVFETADTIINNSFERITYTEAVSLLEKADKKFDYPVDWGLDLQSEHERYLCEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTV AMD+LVP+VGE+IGGSQREERL+ LE+R+D
Sbjct  347   FKK-PVIVTDYPAKIKAFYMRLNDDAKTVRAMDVLVPKVGEIIGGSQREERLDVLERRID  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +  +NKE  WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P
Sbjct  406   EQEMNKEELWWYLDLRRYGTVPHAGFGLGFERVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_016878532.1| asparaginyl-tRNA synthetase [Chlorogloeopsis fritschii]
Length=463

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 274/473 (58%), Positives = 345/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE +        ++GWVRT R      FIEVNDGSCL+N+Q V++ +  
Sbjct  5     RIAEILRNGQPDESIK-------IQGWVRTKRELKDFAFIEVNDGSCLANLQVVVNAELP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S    Q+IELK  +L + G++DP ++P+QKKR S E
Sbjct  58    DYETLLKKLN-TGASVEVSGVLVASPAKGQRIELKAERLEVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE  F+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERDFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + +IP+TE+ +VD+S+DFFG+P +LTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLKDIPRTENQTVDYSKDFFGRPTYLTVSGQLEAEIMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DL  DM  A  +L+++ +Y+++ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLHGDMDLAEEFLKHIFKYVMEKCSEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATADNIINNQFERITYTEAIKLLEKADVKFEYPVSWGLDLQSEHERYLCEQT  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERLE LEKR+ 
Sbjct  347   FKK-PVIVTDYPTQIKAFYMRLNDDEKTVAAMDILAPKIGEIIGGSQREERLEVLEKRIQ  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_024268691.1| Asparaginyl-tRNA synthetase [Spirochaeta sp. L21-RPul-D2]
 ref|YP_008903489.1| Asparaginyl-tRNA synthetase [Spirochaeta sp. L21-RPul-D2]
 gb|AHC15788.1| Asparaginyl-tRNA synthetase [Spirochaeta sp. L21-RPul-D2]
Length=477

 Score =   521 bits (1342),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 348/474 (73%), Gaps = 13/474 (3%)
 Frame = +2

Query  359   FRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQ  538
             F +R R+  +       +D   + ++ +GWVRT R   +V F EVNDGS + N+Q ++ +
Sbjct  9     FMKRFRVKTLIS-----MDPQEDPVLCKGWVRTKRDSKNVVFFEVNDGSSMKNLQVILDK  63

Query  539   DAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRV  715
             D E   +     +  G+SV ++G +  S G  QK+EL    L + G +DP ++P+QKKR 
Sbjct  64    DKEILSEQMLQRLNNGSSVEVEGMLVESPGKNQKVELHCSALTIHGDADPETYPMQKKRH  123

Query  716   SREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQ  895
             S E+LR  AHLRPRTNTFGAVARVRN ++ A H FFQENGF+WV +PI+TASD EGAGE 
Sbjct  124   SFEYLREIAHLRPRTNTFGAVARVRNTMSRAVHDFFQENGFLWVHTPIITASDAEGAGEM  183

Query  896   FCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDV  1075
             F VTTL  +     +          SG +D+S+DFFGKP+FLTVSGQLNAE YA+A++ V
Sbjct  184   FQVTTLDLDGLAKADGA------KMSGGIDYSRDFFGKPSFLTVSGQLNAEIYASAMDRV  237

Query  1076  YTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDME  1255
             YTFGPTFRAENSNTSRHLAEFWMIEPE+AF DLE +M  + A+L++++  +L   ++DME
Sbjct  238   YTFGPTFRAENSNTSRHLAEFWMIEPEIAFCDLEANMDWSEAFLKHILATVLKESRDDME  297

Query  1256  FFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYIT  1435
             FF+  I+KGII++L  VVE    +++Y+DA+  L K+ + FE+PV+WG DLQSEHE+++T
Sbjct  298   FFDLRIQKGIIQQLEQVVESDFTRISYSDAVSQLEKSGRNFEYPVSWGADLQSEHEKFLT  357

Query  1436  EEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylek  1615
             EE F G PVI+ DYPK+IKAFYMR NDD KTV  MD+LVPR+GE+IGGSQREERL+ L +
Sbjct  358   EEIFKG-PVIVTDYPKEIKAFYMRLNDDEKTVRGMDVLVPRLGEIIGGSQREERLDVLSR  416

Query  1616  rlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR  1777
             RL +  L ++ YWWYLDLRR+GSVPH+GFGLGFERL+Q+ TG+ NIRD IPFPR
Sbjct  417   RLGESGLTEKDYWWYLDLRRFGSVPHSGFGLGFERLIQYVTGMQNIRDVIPFPR  470



>ref|WP_006517726.1| asparaginyl-tRNA synthetase [Leptolyngbya sp. PCC 7375]
 gb|EKV03360.1| asparaginyl-tRNA synthetase [Leptolyngbya sp. PCC 7375]
Length=463

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 339/455 (75%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + ++GWVRT R     +F+++NDGS ++ +Q ++    +GYD      I TGAS+ I
Sbjct  16    GDVVTIQGWVRTKRDSKKFSFLDINDGSSMTGLQVIVDVSLDGYDDAMK-RITTGASMVI  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              GT+A S G  Q++EL+   L +VG+SD  ++P+QKKR S EFLR   HLR RTNT GAV
Sbjct  75    SGTLAESPGKGQRVELQASSLDVVGESDAETYPLQKKRHSFEFLRGLGHLRSRTNTLGAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRNA A A H+FFQ  GF+W+ +PI+TASDCEGAGE F VT+L           ++++
Sbjct  135   FRVRNACASAIHEFFQSRGFLWIHTPILTASDCEGAGEMFTVTSL----------NLDKL  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PK + G VD+ QDFFGKP +LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEF
Sbjct  185   PKGDDGKVDYGQDFFGKPTYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSNTSRHLAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AF DLE +M  A  +L++V +Y+L+ C +DMEFFN  IEK +++   +++  +
Sbjct  245   WMMEPEMAFCDLEGNMDLAEEFLKFVFKYVLEACPDDMEFFNKRIEKTVLETADNIINNE  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYTDAI LL K  K FE+PV+WG D+QSEHERY+ EE F   PVI+ DYP +IKAF
Sbjct  305   FERITYTDAINLLEKCDKTFEYPVSWGLDMQSEHERYLAEEYFKK-PVIVTDYPTEIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR ND GKTVAAMD+L PR+GE+IGGSQREERL+ LE+R+ +  L K+ YWWYLDLRRY
Sbjct  364   YMRLNDGGKTVAAMDVLAPRIGEIIGGSQREERLDVLEQRITEAGLPKDDYWWYLDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   GTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP  458



>ref|WP_010474487.1| asparaginyl-tRNA synthetase [Acaryochloris sp. CCMEE 5410]
Length=463

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 265/455 (58%), Positives = 337/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             GE++ V+GWVRT R      F++VNDGS L  +Q V++QD   Y+Q    L+ TG+SV I
Sbjct  16    GESMKVQGWVRTKRELKEFAFLDVNDGSSLQGLQVVVNQDLPEYEQTLK-LLNTGSSVSI  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             +G + +SQG  Q++EL    + + G +D  ++P+QKKR S EFLRT AHLR RTNT G+V
Sbjct  75    EGELVASQGKNQRVELVAKAVQVWGTADLETYPLQKKRHSFEFLRTIAHLRSRTNTLGSV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              R+RNA + A H+FFQE  F+W+ +PI+TASDCEGAGEQ  VT+L           +  +
Sbjct  135   FRIRNACSQAIHQFFQERDFMWIHTPIITASDCEGAGEQLAVTSL----------NLQNV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P +E  +VD+SQDFFGKP +LTVSGQL  E  A+A  +VYTFGPTFRAENSNTSRHLAEF
Sbjct  185   PLSEDQTVDYSQDFFGKPTYLTVSGQLEGEIMASAFCNVYTFGPTFRAENSNTSRHLAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AF DL+ DM  A A+L++V + +L+ C ED EFFN  I+K +++    ++  +
Sbjct  245   WMVEPEVAFCDLQGDMDLAEAFLKHVFKSVLEQCPEDFEFFNLRIDKSVLETADTIINSE  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+  L K  +KFEFPV WG DLQSEHERY++EE F   PVI+ DYPK IKAF
Sbjct  305   FERITYTEAVNQLEKASRKFEFPVEWGLDLQSEHERYLSEELFKK-PVIVTDYPKQIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAAMD+LVP++GE+IGGSQREERL+ LE+R+    L  E YWWYLDLRRY
Sbjct  364   YMRMNDDDKTVAAMDVLVPKIGEIIGGSQREERLDLLEQRIIAQGLLLEDYWWYLDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   GTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTP  458



>ref|WP_026901716.1| asparaginyl-tRNA synthetase [Peptostreptococcaceae bacterium 
VA2]
Length=466

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 345/456 (76%), Gaps = 14/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQD-AEGYDQVENGLIITGASV  595
             +G+ + V GW+RT RA  +  F+E+NDGS   NMQ V+S++  E + ++    +   +S+
Sbjct  19    IGKKVAVAGWIRTSRASKNFGFVELNDGSFFKNMQIVLSEENLENFKEITK--LPISSSI  76

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGA  775
              ++G + S++G+KQ +E+    +V+ G+SD S+P+QKKR + E+LRT AHLRPR+NTF A
Sbjct  77    IVEGELVSTEGAKQPVEIHATNIVVEGESDSSYPLQKKRHTLEYLRTIAHLRPRSNTFSA  136

Query  776   VARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNE  955
             V RVR+  AFA HKFFQE  FV+  SPI+T SDCEGAGE F +TT+           + +
Sbjct  137   VFRVRSLAAFAVHKFFQERNFVYAHSPIITGSDCEGAGEMFRITTM----------DLAD  186

Query  956   IPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAE  1135
             IPKTE G +D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +E
Sbjct  187   IPKTEEGKIDYSKDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSFTQRHASE  246

Query  1136  FWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEK  1315
             FWMIEPE+ FADLED+M  A   ++YV+ Y+++N  E+MEFFN++++KG+++RL++VV  
Sbjct  247   FWMIEPEICFADLEDNMELAEDMIKYVINYVMENAPEEMEFFNSFVDKGLLERLNNVVSS  306

Query  1316  KVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKA  1495
             +  +L+YT A+E+L+++  KFE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIKA
Sbjct  307   EFTRLSYTKAVEMLIESGHKFEYPVKWGDDLQTEHERYLTEEIF-KAPVFVTDYPKDIKA  365

Query  1496  FYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRR  1675
             FYMR N+DGKTV AMD+LVP VGE++GGSQREER + L +R+ ++ LNKE YWWYL+LR+
Sbjct  366   FYMRMNEDGKTVRAMDLLVPGVGEIVGGSQREEREDKLLERIAEMGLNKEDYWWYLELRK  425

Query  1676  YGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   FGTATHSGFGLGFERIIMYMTGMSNIRDVIPFPRTP  461



>ref|WP_024614173.1| asparaginyl-tRNA synthetase [Clostridium sp. Ade.TY]
Length=464

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/456 (57%), Positives = 337/456 (74%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + + + GW+RTLRA ++  FIE+NDGS  SN+Q V     E + +V    I   +S+ 
Sbjct  18    LNKDVTISGWIRTLRASNAFGFIEINDGSFFSNIQVVFDNKLENFKEVSKLPI--SSSLK  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+  +  +KQ  E++  ++V+ G SD  +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVETPNAKQPFEIQAKEIVIEGMSDSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE  FV+ ++PI+T SDCEGAGE F VTTL           +NE 
Sbjct  136   FRVRSVAAYAIHKFFQEKNFVYTNTPILTGSDCEGAGEMFRVTTL----------DLNET  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G++D+SQDFFGK   LTVSGQLNAET+A A  +VYTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEDGAIDYSQDFFGKETNLTVSGQLNAETFALAFRNVYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE++FADLEDDM  A   L YV++Y++  C E++EFFN +I+KG+++RL+ V    
Sbjct  246   WMVEPEISFADLEDDMKLAEEMLTYVIKYVMKECPEEIEFFNKFIDKGLVERLNHVANSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L    KKF++PV WG DLQ+EHERY+TEE F   P  + DYPKDIKAF
Sbjct  306   FARVTYTEAVEILKNCGKKFDYPVEWGIDLQTEHERYLTEEHFKR-PTFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAAMD+LVP +GE+IGGSQREERL+ L+ R+ +LNL +E YWWYL+LR+Y
Sbjct  365   YMRMNDDNKTVAAMDLLVPGIGEIIGGSQREERLDVLKNRMSELNLAEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMSNIRDVIPFPRTTG  460



>ref|WP_017713084.1| asparaginyl-tRNA synthetase [Prochlorothrix hollandica]
Length=462

 Score =   520 bits (1339),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/453 (59%), Positives = 335/453 (74%), Gaps = 12/453 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + + ++GWVRT R Q   TF+E+NDGS L  +Q V+ QD   Y ++  G I TGA+V  Q
Sbjct  17    DVVTLKGWVRTKREQKEFTFVEINDGSSLKGLQAVLPQDLPNYGELVKG-ISTGAAVIFQ  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVAR  784
             G +  S G  Q++EL+V +  LVG  D S+P+QKKR S EFLRT AHLRPRTNT GAV R
Sbjct  76    GALVPSPGQGQRVELRVSQGELVGDCDASYPLQKKRHSFEFLRTIAHLRPRTNTLGAVMR  135

Query  785   VRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPK  964
             VRNA A A H+FFQ  GF+W+ +PI+TASDCEGAGE F VT+L           +N +P+
Sbjct  136   VRNACAAAIHEFFQGQGFLWIQTPIITASDCEGAGELFTVTSL----------DLNHVPR  185

Query  965   TESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWM  1144
              +SG+VD+ QDFFGK A+LTVSGQL  E  ATAL+++YTFGPTFRAENSNTSRHLAEFWM
Sbjct  186   GDSGAVDFGQDFFGKQAYLTVSGQLEGEIMATALSNIYTFGPTFRAENSNTSRHLAEFWM  245

Query  1145  IEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVV  1324
             +EPE+AF  LE +M+ A  +L+++ + +L+ C EDMEFFN  I++ ++ R   ++  +  
Sbjct  246   VEPEMAFCGLEGNMNLAEDFLKFIFRRVLELCPEDMEFFNDRIDQQVLDRAQTIINNEFA  305

Query  1325  QLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYM  1504
             ++TYT+AI+ L K  K F++PV WG DLQSEHERY+ EE F   P+I+ DYP  IKAFYM
Sbjct  306   RITYTEAIDHLEKASKVFDYPVAWGIDLQSEHERYLAEELFQK-PLIVTDYPTQIKAFYM  364

Query  1505  RENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGS  1684
             R +DD KTVAAMD+L P +GE+IGGSQREERL  LE+R+    L  E YWWYLDLRRYGS
Sbjct  365   RLSDDAKTVAAMDVLAPGIGEIIGGSQREERLGVLEQRIQAQGLPLEDYWWYLDLRRYGS  424

Query  1685  VPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             VPHAGFGLGFERLVQF TG+ NIRD IPFPR+P
Sbjct  425   VPHAGFGLGFERLVQFMTGMANIRDVIPFPRSP  457



>ref|WP_002599003.1| asparaginyl-tRNA synthetase [Clostridium colicanis]
 gb|ENZ00376.1| asparaginyl-tRNA synthetase [Clostridium colicanis 209318]
Length=464

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/458 (56%), Positives = 340/458 (74%), Gaps = 13/458 (3%)
 Frame = +2

Query  413   DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGAS  592
             D LG+ + + GW+RTLRA ++  FIE+NDGS   N+Q V     E + ++    I   +S
Sbjct  16    DHLGKEITITGWIRTLRASNAFGFIEINDGSFFKNIQVVFDNKLENFKEISKLPI--SSS  73

Query  593   VWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFG  772
             + + GT+  +  +KQ  E++  ++V+ G SD  +P+QKKR + E+LRT AHLRPR+N F 
Sbjct  74    LKVVGTLVETPNAKQPFEIQASEIVIEGMSDSDYPLQKKRHTFEYLRTIAHLRPRSNAFS  133

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVR+  A+A HKFFQE  FV+  +PI+T SDCEGAGE F VTTL  + + P      
Sbjct  134   AVFRVRSVAAYAIHKFFQEQHFVYTHTPILTGSDCEGAGEMFRVTTL--DLQNP------  185

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
               PKTE+G +D+S+DFFGK   LTVSGQLN ETYA A  ++YTFGPTFRAENSNT+RH A
Sbjct  186   --PKTENGDIDYSKDFFGKETNLTVSGQLNGETYALAFRNIYTFGPTFRAENSNTARHAA  243

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWM+EPE++FADLED+M  A   L YV++Y++D C E+++FFN +I+KG+++RL+ VV 
Sbjct  244   EFWMVEPEISFADLEDNMKLAEDMLTYVIKYVMDECPEEIQFFNQFIDKGLVERLNHVVN  303

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
                 ++TYTDA+E+L    + FE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIK
Sbjct  304   SDFARVTYTDAVEILKSCGRTFEYPVEWGIDLQTEHERYLTEEHFKK-PVFVTDYPKDIK  362

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDD KTVAAMD+LVP +GE+IGGSQREERL+ L+KR+ +LNLN+E YWWYL+LR
Sbjct  363   AFYMRMNDDNKTVAAMDLLVPGIGEIIGGSQREERLDLLKKRMAELNLNEEDYWWYLELR  422

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             +YG   H+G+GLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  423   KYGETKHSGYGLGFERLIMYITGMTNIRDVIPFPRTTG  460



>ref|WP_006456769.1| asparaginyl-tRNA synthetase [Synechococcus sp. PCC 7335]
 gb|EDX86985.1| asparaginyl-tRNA synthetase [Synechococcus sp. PCC 7335]
Length=468

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 269/460 (58%), Positives = 340/460 (74%), Gaps = 19/460 (4%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYD-QVENGLIITGASVW  598
             GE+L ++GWVRT R+    TFIEVNDGS ++ +Q +  +D   Y+ Q+E   I TGASV 
Sbjct  17    GESLTIQGWVRTKRSAKKFTFIEVNDGSSMNGLQVIAPEDIPDYEKQIER--ISTGASVQ  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFLRTKAHLRPRTNTFGA  775
             I GT+A S G  Q++EL+  ++ + G+SD  ++P+QKKR S EFLRT  HLR RTNT GA
Sbjct  75    ITGTLAESPGKGQRVELQASEIEVFGESDGETYPLQKKRHSFEFLRTIGHLRSRTNTLGA  134

Query  776   VARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNE  955
             V RVRNA A A H+FF +  F+W+ +PI+TASDCEGAGE F VT             ++ 
Sbjct  135   VFRVRNACATAIHEFFWKRDFLWMHTPILTASDCEGAGEMFTVTRF----------NLDS  184

Query  956   IPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAE  1135
             IPKTESG  D+ QDFFG+PA+LTVSGQL AE  + A ++VYTFGPTFRAENSNT+RHLAE
Sbjct  185   IPKTESGKADYGQDFFGRPAYLTVSGQLEAEIMSMAFSNVYTFGPTFRAENSNTARHLAE  244

Query  1136  FWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEK  1315
             FWM+EPE+AF DLE +M  A A+L+YV  Y++++C +DM FFN  I+K +++   ++++ 
Sbjct  245   FWMVEPEMAFCDLEGNMDLAEAFLKYVFSYVMEHCADDMAFFNQRIDKTVLETAENIIDN  304

Query  1316  KVVQLTYTDAIElllktk----kkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPK  1483
                ++TYTDAI  L +      K FEFPV WG DLQSEHERY+ EE F   PVI+ DYP 
Sbjct  305   DFERITYTDAIAQLERAIENGDKTFEFPVKWGIDLQSEHERYLAEELFKK-PVIVTDYPA  363

Query  1484  DIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYL  1663
             +IKAFYMR NDD KTVAAMD+L PR+GE+IGG+QREERL+ LE+R+    L +E YWWYL
Sbjct  364   EIKAFYMRLNDDNKTVAAMDVLAPRIGEIIGGAQREERLDVLERRIKAAGLPQEDYWWYL  423

Query  1664  DLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             DLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   DLRRYGTVPHAGFGLGFERLVQFMTGMSNIRDVIPFPRTP  463



>ref|WP_006616883.1| asparaginyl-tRNA synthetase [Arthrospira platensis]
 gb|KDR57409.1| asparaginyl-tRNA synthetase [Arthrospira platensis str. Paraca]
Length=463

 Score =   520 bits (1338),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 273/473 (58%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P       GE + V+GWVRT R     TF+EVNDGSC++N+Q V++ D  
Sbjct  5     RIAEILRTGKP-------GEAVTVQGWVRTKRELKEFTFVEVNDGSCMANLQVVLNPDLT  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G I SS    Q+IELK   + + G++DP ++ +QKKR S E
Sbjct  58    DYAAILRQLN-TGASVEVVGEIVSSPAKGQRIELKADTVRVYGEADPQTYVLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRNA A A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNTYGAVFRVRNACAAAVHQFFQERGFLWIHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +N +P T++ ++D+SQDFFGK AFLTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLNNLPLTDTKAIDFSQDFFGKRAFLTVSGQLEAEIMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DL+ +M  A A+L+++ + +L+ C ED+EFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLDGNMDLAEAFLKHIFKSVLEQCPEDLEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI LL K+ + FE+PV+WG DLQSEHERY+ EE 
Sbjct  287   QRIDNSVLATADNIINNEFERITYTEAIALLEKSDRTFEYPVSWGLDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP++IKAFYMR+N+DGKTV AMD+L P+VGE+IGGSQREERL+ L+KR++
Sbjct  347   FKK-PVIVTDYPQEIKAFYMRQNEDGKTVRAMDVLAPKVGEIIGGSQREERLDILQKRME  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
              L +N +  WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P
Sbjct  406   ALQINPDELWWYLDLRRYGTVPHAGFGLGFERVVQFMTGMANIRDVIPFPRAP  458



>ref|WP_015202795.1| asparaginyl-tRNA synthetase [Crinalium epipsammum]
 ref|YP_007142187.1| asparaginyl-tRNA synthetase [Crinalium epipsammum PCC 9333]
 gb|AFZ12677.1| asparaginyl-tRNA synthetase [Crinalium epipsammum PCC 9333]
Length=463

 Score =   520 bits (1338),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 271/474 (57%), Positives = 346/474 (73%), Gaps = 24/474 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PDE       ++ ++GWVRT R      F+EVNDGS L+++Q V++ D  
Sbjct  5     RIVEILRNGQPDE-------SVTIKGWVRTKRELKDFAFVEVNDGSSLASLQVVLNPDIP  57

Query  548   GY-DQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSR  721
             GY D V+   + TGASV + G + +S    Q+IELK   + + G++DP ++P+QKKR S 
Sbjct  58    GYADAVKR--LNTGASVEVAGVLVASPAKGQRIELKAESVKVYGEADPQTYPLQKKRHSF  115

Query  722   EFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFC  901
             EFLR   HLR RTNT  AV RVRNA A+A HKFFQE GF+WV +PI++ASDCEGAGE F 
Sbjct  116   EFLREIGHLRSRTNTLSAVFRVRNACAYAIHKFFQEKGFLWVHTPIISASDCEGAGEMFT  175

Query  902   VTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             VT             + ++P+T+S  VD+S+DFFGK ++LTVSGQL AE  A A ++VYT
Sbjct  176   VTRF----------NLQDVPQTDSKKVDYSKDFFGKQSYLTVSGQLEAEVMAMAFSNVYT  225

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWMIEPE+AF DL+ DM  A  +L+Y+ +Y+L+ C EDMEFF
Sbjct  226   FGPTFRAENSNTSRHLAEFWMIEPEMAFCDLQGDMDLAEEFLKYIFKYVLETCPEDMEFF  285

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             N  I+  ++    +++  +  +L+Y+DAI LL K  K+FE+PVNWG DLQSEHERY+ EE
Sbjct  286   NQRIDNSVLATADNIINNQFERLSYSDAIALLEKADKQFEYPVNWGLDLQSEHERYLAEE  345

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   PVI+ DYP +IKAFYMR N+D KTVAAMD+L P++GE+IGGSQREERL+ LE+R+
Sbjct  346   VFEK-PVILTDYPVEIKAFYMRLNEDAKTVAAMDILAPKIGEIIGGSQREERLDVLERRI  404

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +   L+K  YWWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  405   EAQGLDKADYWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_017747073.1| asparaginyl-tRNA synthetase [Scytonema hofmanni]
Length=463

 Score =   520 bits (1338),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 270/475 (57%), Positives = 348/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI ++   G PDE       +LVV+GWVRT R      FIEVNDGS L+++Q V+++D  
Sbjct  5     RITEVLRNGQPDE-------SLVVQGWVRTKRELKGFAFIEVNDGSSLASLQVVINEDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              YD +    I TGASV I G + +SQG  Q++ELK  ++ + G +DP ++P+QKKR S E
Sbjct  58    DYDSILKQ-INTGASVEIAGVLVASQGKGQRVELKANQVTVYGGADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+  HLR RTN+FGAV RVRNA A A H+FFQE GF+W+ +PI+TA+DCEGAGE F V
Sbjct  117   FLRSIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFLWIHTPIITANDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + ++P+ E+ +VD+S+DFFGKP +LTVSGQL AE  ATA  +VYTF
Sbjct  177   TSL----------DLKDVPRKETKAVDYSKDFFGKPTYLTVSGQLQAEVMATAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L+++ +Y++  C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLKGDMDLAEAFLKHIFKYVMKTCAEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +I    +++  +  ++TYT+AI+LL K   KF++PV+WG DLQSEHERY+ E  
Sbjct  287   QRIDNTVIATADNIINNEFERVTYTEAIKLLEKADVKFDYPVSWGLDLQSEHERYLAEHL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ +YP  IKAFYMR +DD KTVAAMD+L P++GE+IGGSQREERLE LE+R+ 
Sbjct  347   FKK-PTIVTNYPVQIKAFYMRLDDDEKTVAAMDILAPKIGEIIGGSQREERLEILERRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRR+G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRFGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_015130970.1| asparaginyl-tRNA synthetase [Calothrix sp. PCC 7507]
 ref|YP_007068007.1| asparaginyl-tRNA synthetase [Calothrix sp. PCC 7507]
 gb|AFY35173.1| asparaginyl-tRNA synthetase [Calothrix sp. PCC 7507]
Length=463

 Score =   520 bits (1338),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 272/473 (58%), Positives = 344/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE       +L+V+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIAEILRSGQPDE-------SLLVQGWVRTKRELKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G + +SQG  Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYAAIVKQLN-TGASVEVTGILVASQGKGQRVELKAETVKVHGEADPDTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA + A H+FFQ  GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACSTAIHQFFQTRGFLWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             ++L           +  IP+ +  +VD+SQDFF KP +LTVSGQL AE  A A ++VYTF
Sbjct  177   SSL----------DLKNIPRIKDQAVDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A  +L+++ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEEFLKHIFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  +LTYT+AI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATAENIINNQFERLTYTEAIKLLEKADVKFEYPVSWGLDLQSEHERYLAEQQ  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR N+D KTV AMD+L P++GE++GGSQREERLE LE+R+ 
Sbjct  347   FKK-PVIVTDYPVQIKAFYMRLNEDEKTVRAMDILAPKIGEIVGGSQREERLEVLERRIK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMQPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFITGMANIRDVIPFPRTP  458



>ref|WP_014274085.1| asparaginyl-tRNA synthetase [Arthrospira platensis]
 ref|YP_005066694.1| asparaginyl-tRNA synthetase [Arthrospira platensis NIES-39]
 dbj|BAI88156.1| asparaginyl-tRNA synthetase [Arthrospira platensis NIES-39]
Length=463

 Score =   519 bits (1337),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 273/473 (58%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G P       GE + V+GWVRT R     TF+EVNDGSC++N+Q V++ D  
Sbjct  5     RIAEILRTGKP-------GEAVTVQGWVRTKRELKEFTFVEVNDGSCMANLQVVLNPDLT  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y  +   L  TGASV + G I SS    Q+IELK   + + G++DP ++ +QKKR S E
Sbjct  58    DYAAILRQLN-TGASVEVVGEIVSSPAKGQRIELKADTVQVYGEADPQTYVLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT+GAV RVRNA A A H+FFQE GF+W+ +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRSRTNTYGAVFRVRNACAAAVHQFFQERGFLWIHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +N +P T++ ++D+SQDFFGK AFLTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLNNLPLTDTKAIDFSQDFFGKRAFLTVSGQLEAEIMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DL+ +M  A A+L+++ + +L+ C ED+EFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLDGNMDLAEAFLKHIFKSVLEQCPEDLEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI LL K+ + FE+PV+WG DLQSEHERY+ EE 
Sbjct  287   QRIDNSVLATADNIINNEFERITYTEAIALLEKSDRTFEYPVSWGLDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP++IKAFYMR+N+DGKTV AMD+L P+VGE+IGGSQREERL+ L+KR++
Sbjct  347   FKK-PVIVTDYPQEIKAFYMRQNEDGKTVRAMDVLAPKVGEIIGGSQREERLDILQKRME  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
              L +N +  WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P
Sbjct  406   ALQINPDELWWYLDLRRYGTVPHAGFGLGFERVVQFMTGMANIRDVIPFPRAP  458



>emb|CDM69707.1| Asparagine-tRNA ligase [Clostridium sp. M2/40]
Length=463

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 264/462 (57%), Positives = 345/462 (75%), Gaps = 13/462 (3%)
 Frame = +2

Query  404   EGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIIT  583
             E  D  G+T+ V GWVRT+R+ ++  FIE+NDGS   N+Q V     + + ++    I  
Sbjct  12    ESDDFAGKTVKVSGWVRTIRSNNNFGFIELNDGSFFKNLQVVFENTLDNFKEISK--IAI  69

Query  584   GASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTN  763
              +S+ I+G +  +  SKQ +ELK   +V+ G S+  +P+QKKR + E+LRT AHLRPR+N
Sbjct  70    SSSLEIEGEVVLTPNSKQPLELKATNIVIHGHSNSDYPLQKKRHTMEYLRTIAHLRPRSN  129

Query  764   TFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNS  943
             TF AV RVR   A+A HKFF E GFV+V++PI+TASDCEGAGE F +TTL P  K P   
Sbjct  130   TFSAVFRVRGLAAYAIHKFFNERGFVYVNTPIITASDCEGAGEMFRLTTLDP--KNP---  184

Query  944   PVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSR  1123
                  P TE G VD+SQDFFGKPA LTVSGQLN ETYA A  ++YTFGPTFRAENSNT R
Sbjct  185   -----PLTEDGEVDFSQDFFGKPANLTVSGQLNGETYALAFRNIYTFGPTFRAENSNTGR  239

Query  1124  HLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSD  1303
             H +EFWM+EPE+AFA+L D + CA   ++Y++ Y+L+N  E+MEFF+ +I+KG++ RL++
Sbjct  240   HASEFWMVEPEMAFAELTDYLDCAEDMIKYIINYVLENAPEEMEFFSNFIDKGLMDRLNN  299

Query  1304  VVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPK  1483
             VV  +  ++TYT+A+E+L K  K+F++PV WG DLQ+EHERY++EE F   PV + DYPK
Sbjct  300   VVNSEFARITYTEAVEILQKCNKEFQYPVEWGIDLQTEHERYLSEEVFKR-PVFVTDYPK  358

Query  1484  DIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYL  1663
             DIKAFYMR NDDGKTVAA D+L P VGE+IGGSQREERL+ LE R+++L LNKE YWWYL
Sbjct  359   DIKAFYMRLNDDGKTVAAADLLAPGVGEIIGGSQREERLDILEARMEELGLNKEDYWWYL  418

Query  1664  DLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +LR+YG   H+GFGLGFER++ + TG+ NIRD IPFPRTPG+
Sbjct  419   ELRKYGETKHSGFGLGFERILMYLTGMSNIRDVIPFPRTPGN  460



>ref|WP_017315943.1| asparaginyl-tRNA synthetase [Mastigocladopsis repens]
Length=463

 Score =   519 bits (1336),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 351/473 (74%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE L       +V+GWVRT R     +FIEVNDGS L+++Q V++QD  
Sbjct  5     RIAEILRSGQPDEWL-------IVQGWVRTKRELKGFSFIEVNDGSSLASLQVVLNQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              YD +   L  TGAS+ + G + +S G  Q+IELKV K+ + G++DP ++P+QKKR S E
Sbjct  58    DYDDILKKLN-TGASLEVAGVLVASVGKGQRIELKVEKVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TA+DCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFLWVHTPIITANDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + ++P+TE+ ++D+S+DFF KP +LTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLKDVPRTETKAIDYSKDFFAKPTYLTVSGQLEAEVMAMAFTNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF  L++DM  A A+L+++ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCQLKEDMDLAEAFLKHIFKYVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   KFE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATADNIINNEFERITYTEAIKLLEKADVKFEYPVSWGLDLQSEHERYLCEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ +YP  IKAFYMR +DD KTVAAMD+L P++GE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PVIVSNYPAQIKAFYMRLDDDEKTVAAMDILAPKIGEIIGGSQREERLDVLERRIL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                +  E  WWYLDLRR+G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  406   AQGMKPEDLWWYLDLRRFGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_039678290.1| asparaginyl-tRNA synthetase [Terrisporobacter sp. 08-306576]
 gb|KHS58523.1| asparaginyl-tRNA synthetase [Terrisporobacter sp. 08-306576]
Length=465

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 256/471 (54%), Positives = 350/471 (74%), Gaps = 16/471 (3%)
 Frame = +2

Query  371   LRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             +++ D+    ++ +D+    + V GW+RT R   +  FIE+NDGS   NMQ V+    E 
Sbjct  6     IQVKDLYRDKEQYIDK---DVKVAGWIRTSRISKNFGFIELNDGSFFKNMQVVLDDKLEN  62

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFL  730
             +  +  G +   +S+ ++G + +++G+KQ +E+   K+V+ G+SD S+P+QKKR + E+L
Sbjct  63    FKNI--GKLPISSSILVEGKLVATEGAKQPVEIHATKVVVEGESDNSYPLQKKRHTVEYL  120

Query  731   RTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTT  910
             RT AHLRPR+N F AV RVR+  A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TT
Sbjct  121   RTIAHLRPRSNMFSAVFRVRSVAAYAVHKFFQERNFVYSHSPIITGSDCEGAGEMFRITT  180

Query  911   LIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGP  1090
             L           ++ +PKTE G +D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGP
Sbjct  181   L----------DLDNVPKTEEGKIDYSEDFFGKEANLTVSGQLNAEIMALAFRNVYTFGP  230

Query  1091  TFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTW  1270
             TFRAENS T RH +EFWMIEPE+AFADLED+M  A   ++Y++ Y+L++C E+MEFFN +
Sbjct  231   TFRAENSYTGRHASEFWMIEPEIAFADLEDNMELAEDMVKYIINYVLEHCPEEMEFFNAF  290

Query  1271  IEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFG  1450
             ++KG+++RL+++V    V++TYT A+ELLL++ +KFE+PV WG DLQ+EHERYITE+ F 
Sbjct  291   VDKGLLERLNNIVSSDFVRITYTKAVELLLESGQKFEYPVEWGIDLQTEHERYITEQIF-  349

Query  1451  GCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddl  1630
               PV + DYPKDIKAFYMR N+DGKTV AMD+LVP VGE+IGGSQREER + L +R+++ 
Sbjct  350   NAPVFVTDYPKDIKAFYMRLNEDGKTVRAMDLLVPGVGEIIGGSQREEREDVLLERIEEF  409

Query  1631  NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
              LNKE YWWYL+LR++G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  410   GLNKEDYWWYLELRKFGTATHSGFGLGFERMIMYLTGVSNIRDVIPFPRTP  460



>ref|WP_017715250.1| asparaginyl-tRNA synthetase [Oscillatoria sp. PCC 10802]
Length=463

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 268/473 (57%), Positives = 347/473 (73%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I   G PDE        + V+GWVRT R      F+E+NDGS ++N+Q +++ D  
Sbjct  5     RIAEILRNGQPDE-------PVTVQGWVRTKRELKEFAFVELNDGSSMANLQVLLNPDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
               + V   L+ TG SV + G +  S    Q+IELK  ++ + G++DP ++P+QKKR S E
Sbjct  58    DSEGVLK-LLNTGTSVEVAGVLVESPAKGQRIELKASEVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTNTFGAV RVRNA A+A HKFFQE GF+W+ +P++TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNTFGAVFRVRNACAWAIHKFFQERGFMWIHTPVITASDCEGAGEMFAV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + ++P+T+  +VD+S+DFFGKPAFLTVSGQL AE  A A  +VYTF
Sbjct  177   TSL----------DLKDVPRTDKQAVDYSKDFFGKPAFLTVSGQLEAEVMAMAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ DM  A A+L+Y+ +++L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLQGDMDLAEAFLKYIFKHVLETCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K ++    +++  +  ++TYT+AI LL K  K FE+PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDKSVLATADNIINSQFERVTYTEAIRLLEKADKTFEYPVSWGLDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ DYP  IKAFYMR N+D KTVAAMD+L P++GE++GGSQREERL+ LE+R+ 
Sbjct  347   FKK-PTIVTDYPVGIKAFYMRLNEDEKTVAAMDILAPKIGEIVGGSQREERLDVLERRIK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                L+ E+YWWY+DLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  406   AQGLDIENYWWYMDLRRYGTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRAP  458



>ref|WP_015175718.1| asparaginyl-tRNA synthetase [Oscillatoria nigro-viridis]
 ref|YP_007114823.1| asparaginyl-tRNA synthetase [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ06407.1| asparaginyl-tRNA synthetase [Oscillatoria nigro-viridis PCC 7112]
Length=463

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 345/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA I   G PDE       T+ V+GWVRT R      F+EVNDGS ++N+Q V++ D  
Sbjct  5     RIAAILRAGEPDE-------TVTVQGWVRTKRELKEFAFVEVNDGSAMANLQVVINSDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              ++ V   L  TGAS+ + G + +S    Q+IELK  ++ + G +DP ++P+QKKR S E
Sbjct  58    DFENVLKQLN-TGASLEVSGVLVASPAKGQRIELKASQVQVYGDADPQTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAV RVRNA + A H+FFQE GF+WV +PI+ ASDCEGAGE F V
Sbjct  117   FLRTIAHLRPRTNTHGAVFRVRNACSAAVHQFFQERGFLWVHTPIIAASDCEGAGEMFAV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +P+T+S  VD+++DFFGK A+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFDLKNVPRTDSQEVDYAKDFFGKRAYLTVSGQLEAEVMAMAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF DL+ DM  A A+L+Y+ +Y+L++C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDLQGDMDLAEAFLKYIFKYVLEHCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K ++    +++  +  ++TYT+AI LL K  KKF+FPV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDKTVLATAENIINNQFERITYTEAIALLEKADKKFDFPVSWGLDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ DYP  IKAFYMR N+D KTV AMD+L P +GE+IGGSQREERL+ LE+R++
Sbjct  347   FKK-PTIVSDYPVGIKAFYMRLNEDEKTVRAMDVLAPNIGEIIGGSQREERLDVLERRME  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +NKE  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P S
Sbjct  406   AQGMNKEELWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAPLS  460



>ref|WP_015358646.1| MULTISPECIES: asparagine--tRNA ligase AsnS [Ruminiclostridium]
 ref|YP_007372565.1| asparagine--tRNA ligase AsnS [ [[Clostridium] stercorarium subsp. 
stercorarium DSM 8532]
 ref|YP_007679009.1| asparaginyl-tRNA synthetase [ [[Clostridium] stercorarium subsp. 
stercorarium DSM 8532]
 gb|AGC67955.1| asparagine--tRNA ligase AsnS [ [[Clostridium] stercorarium subsp. 
stercorarium DSM 8532]
 gb|AGI38991.1| asparaginyl-tRNA synthetase [ [[Clostridium] stercorarium subsp. 
stercorarium DSM 8532]
Length=463

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 336/448 (75%), Gaps = 13/448 (3%)
 Frame = +2

Query  437   VRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIA  616
             V GWVRT+R   +  FIE+NDGSCL N+Q V       + +V    +  G+S+ ++G + 
Sbjct  23    VCGWVRTIRLSKTFGFIELNDGSCLQNLQIVFDDQLPNFMEVSK--LNVGSSLVVKGNLV  80

Query  617   SSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNA  796
              +  +KQ  E+K   + + G S P +P+QKKR S EFLRT AHLRPRTNTF AV RVR+ 
Sbjct  81    LTPQAKQPFEIKATSVTVEGTSTPEYPLQKKRHSFEFLRTIAHLRPRTNTFSAVFRVRSL  140

Query  797   LAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESG  976
             LA+A HKFFQENGFV+V +PI+T+SDCEGAGE F VTTL           ++ +P+   G
Sbjct  141   LAYAIHKFFQENGFVYVHTPIITSSDCEGAGEMFRVTTL----------DLDNLPRNNDG  190

Query  977   SVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPE  1156
             +VD+S+DFFGK  +LTVSGQL+ ETY  A + VYTFGPTFRAENSNT RH AEFWM+EPE
Sbjct  191   AVDFSEDFFGKSTYLTVSGQLSVETYCMAFSKVYTFGPTFRAENSNTVRHAAEFWMVEPE  250

Query  1157  LAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTY  1336
             +AFADL+DDM  A A L+YV+ Y+++N  ++MEFFN +I+ G+I+RL+ V + +   +TY
Sbjct  251   IAFADLKDDMELAEAMLKYVINYVMENAPKEMEFFNNFIDNGLIERLTLVKDSQFEHVTY  310

Query  1337  TDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMREND  1516
             TDAI++L K  + F++PV WGCDLQ+EHERY+TE+ F   PV + DYPKDIKAFYMR ND
Sbjct  311   TDAIKILEKADQDFQYPVYWGCDLQTEHERYLTEKYFKK-PVFVTDYPKDIKAFYMRLND  369

Query  1517  DGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHA  1696
             DGKTVAAMD+LVP VGE+IGGSQREER +YLE+R+ +L +  E YWWYL+LR+YG+V HA
Sbjct  370   DGKTVAAMDLLVPGVGEIIGGSQREERYDYLERRIKELGMKMEDYWWYLELRKYGTVKHA  429

Query  1697  GFGLGFERLVQFATGIDNIRDAIPFPRT  1780
             GFGLGFER + + TG+ NIRD IPFPRT
Sbjct  430   GFGLGFERALMYITGMQNIRDVIPFPRT  457



>ref|WP_018664257.1| Asparaginyl-tRNA synthetase [Thermobrachium celere]
 emb|CDF59040.1| Asparaginyl-tRNA synthetase [Thermobrachium celere DSM 8682]
Length=463

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/473 (55%), Positives = 345/473 (73%), Gaps = 13/473 (3%)
 Frame = +2

Query  371   LRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             +   ++K    E    L E + V GWVRT+R+  +  FIE+NDG+   N+Q V  +  E 
Sbjct  1     MHTVEVKQLYRESQKYLNEDVRVSGWVRTVRSSKAFGFIELNDGTFFKNLQIVFDEKLEN  60

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFL  730
             + QVE   +   +S+ ++G +  + G+KQ  E+   ++++ G S   +P+QKKR + E+L
Sbjct  61    FKQVEK--LPISSSITVEGKLVETPGAKQPFEVHATRIIIEGMSSSDYPLQKKRHTFEYL  118

Query  731   RTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTT  910
             RT AHLRPR+NTF AV RVR+  AFA HKFFQE GFV+V++PI+T SDCEGAGE F VTT
Sbjct  119   RTIAHLRPRSNTFSAVFRVRSVAAFAIHKFFQEKGFVYVNTPIITGSDCEGAGEMFRVTT  178

Query  911   LIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGP  1090
             L           +N IP+ E GSVD+S+DFFG+ A LTVSGQL AE +A A   VYTFGP
Sbjct  179   L----------DLNNIPRKEDGSVDFSEDFFGREANLTVSGQLEAEIFALAYKKVYTFGP  228

Query  1091  TFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTW  1270
             TFRAENSNT+RH +EFWMIEPE+AFADL D M  A   ++Y+++Y+L+N  E+MEFFN +
Sbjct  229   TFRAENSNTARHASEFWMIEPEMAFADLNDYMDIAEEMVKYIIKYVLENAPEEMEFFNNF  288

Query  1271  IEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFG  1450
             I+  +  RL++V+  +  ++TYT+AIELL K+ K+F++PV WGCDLQ+EHERYITEE F 
Sbjct  289   IDNTLFDRLNNVLNSEFARITYTEAIELLKKSGKQFQYPVEWGCDLQTEHERYITEEIFK  348

Query  1451  GCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddl  1630
               PV + +YPKDIKAFYMR NDDGKTVAA D+LVP VGE+IGGSQREER + L +R+++L
Sbjct  349   K-PVFVTNYPKDIKAFYMRLNDDGKTVAAADLLVPGVGEIIGGSQREERYDVLVRRIEEL  407

Query  1631  NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              + KE YWWYL+LR+YG   H+GFGLGFER++ + TG+ NIRD IPFPRTPG+
Sbjct  408   GMKKEDYWWYLELRKYGETKHSGFGLGFERMIMYLTGMSNIRDVIPFPRTPGN  460



>ref|WP_016863384.1| asparaginyl-tRNA synthetase [Fischerella muscicola]
Length=463

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 270/475 (57%), Positives = 345/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PD+ L+       V+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIVEILRNGQPDDSLE-------VKGWVRTKRELKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S    Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYENILKKLN-TGASVEVAGVLVASPAKGQRVELKADSVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A HKFFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHKFFQERGFMWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+++DFF +P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQTVDYTKDFFARPTYLTVSGQLEAEIMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF D+  DM  A  +L+Y+ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCDIHGDMDLAEEFLKYIFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   +F++PV+WG DLQSEHER++ E+ 
Sbjct  287   QRIDNTVLAIADNIINNQFERITYTEAIKLLEKADVQFDYPVSWGLDLQSEHERFLCEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE++GGSQREERLE LE+R+ 
Sbjct  347   FKK-PVIVTDYPAQIKAFYMRLNDDEKTVAAMDILAPKIGEIVGGSQREERLEVLERRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKLEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_009457499.1| MULTISPECIES: asparaginyl-tRNA synthetase [Fischerella]
 gb|EHC12122.1| Asparaginyl-tRNA synthetase [Fischerella sp. JSC-11]
Length=463

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 342/475 (72%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PDE L        V+GWVRT R      FIE+NDGS L+N+Q V++QD  
Sbjct  5     RIVEILRNGKPDESLK-------VKGWVRTKRELKGFAFIEINDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV   G + +S    Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYENILKKLN-TGASVEASGILVASPAKGQRVELKADSIKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFMWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+S+DFF +P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQAVDYSKDFFARPTYLTVSGQLEAEIMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  DM  A  +L+Y+ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLHGDMDLAEEFLKYIFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   +F++PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLATADNIINNQFERITYTEAIKLLEKADVQFDYPVSWGLDLQSEHERYLCEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F    VI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERLE LEKR+ 
Sbjct  347   FKKT-VIVTDYPAQIKAFYMRLNDDEKTVAAMDILAPKIGEIIGGSQREERLEVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKLEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>ref|WP_017303432.1| asparaginyl-tRNA synthetase [Spirulina subsalsa]
Length=463

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 271/475 (57%), Positives = 349/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  368   RLRIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQD  541
             + RI  I   G PDE       +++++GWVRT RA     F+E+NDGS L+N+Q V+++ 
Sbjct  3     KTRIVQILRHGQPDE-------SVLIQGWVRTTRALKGFAFVELNDGSSLANLQVVINEA  55

Query  542   AEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVS  718
                Y+ +   L I G+SV ++G + +SQG  Q+IE+   K+ + G+SDP ++P+QKKR S
Sbjct  56    FPDYEALIKRLTI-GSSVAVEGVLVASQGKGQRIEVNPSKIEVFGESDPETYPLQKKRHS  114

Query  719   REFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQF  898
              EFLR   HLR RTNT GAV RVRNA + A H+FFQE GF+WV +P++TASDCEGAGE F
Sbjct  115   FEFLRGLGHLRSRTNTLGAVFRVRNACSSAIHQFFQERGFLWVHTPLITASDCEGAGELF  174

Query  899   CVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVY  1078
              VTTL P  K P        PKT  G +D+SQDFFGKPA+LTVSGQL AE  A + +DVY
Sbjct  175   SVTTLDP--KNP--------PKTPQGEIDYSQDFFGKPAYLTVSGQLEAEIMAMSFSDVY  224

Query  1079  TFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEF  1258
             TFGPTFRAENSNTSRHLAEFWM+EPE+AF DL+ +M  A A+L+++ + +L+ C EDM+F
Sbjct  225   TFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLQGNMDLAEAFLKHIFKTVLEQCPEDMDF  284

Query  1259  FNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITE  1438
             FN  I++ ++    +++  +  +++YT+AI LL K  +KFE+PV WG DLQSEHERY+ E
Sbjct  285   FNQRIDQTVLATADNIINNQFERISYTEAIALLEKADRKFEYPVEWGLDLQSEHERYLAE  344

Query  1439  EAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekr  1618
             E F   PVI+RDYPK IKAFYMR NDD +TVAAMD+L P++GE+IGGSQREERL  LE+R
Sbjct  345   ELFKK-PVIVRDYPKGIKAFYMRLNDDNQTVAAMDVLAPKIGEIIGGSQREERLNVLEQR  403

Query  1619  lddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             + D  +  E  WWY DLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPRTP
Sbjct  404   IQDNQMPLEELWWYRDLRRYGTVPHAGFGLGFERVVQFMTGMGNIRDVIPFPRTP  458



>ref|WP_007353368.1| MULTISPECIES: asparaginyl-tRNA synthetase [Kamptonema]
 emb|CBN54141.1| asparaginyl-tRNA synthetase [ [[Oscillatoria] sp. PCC 6506]
Length=463

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 266/474 (56%), Positives = 343/474 (72%), Gaps = 20/474 (4%)
 Frame = +2

Query  365   RRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             +R+ +    G PDE +        V+GWVRT R     TF+EVNDGS ++N+Q V++ + 
Sbjct  4     QRIAVLLRNGQPDENV-------TVQGWVRTKRELKEFTFVEVNDGSAMANLQVVINLNL  56

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSR  721
               Y+ +   L  TGASV + G + +S    Q+IELK   + + G +DP ++P+QKKR S 
Sbjct  57    PNYEHIVKQLN-TGASVEVTGVLVASPAKGQRIELKASAVTVYGDADPQTYPLQKKRHSF  115

Query  722   EFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFC  901
             EFLRT AHLR RTNT+ AV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F 
Sbjct  116   EFLRTIAHLRSRTNTYSAVFRVRNACAHAVHQFFQERGFLWVHTPIITASDCEGAGEMFS  175

Query  902   VTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             VT          N  +  IP+ +   +D+++DFFGKPA+LTVSGQL AE  A A  +VYT
Sbjct  176   VT----------NFDLKNIPRNDREQIDFTKDFFGKPAYLTVSGQLEAEVMAMAFGNVYT  225

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWMIEPE+AF DLE DM  A A+L+++ +Y+L+ C+ED+EFF
Sbjct  226   FGPTFRAENSNTSRHLAEFWMIEPEMAFCDLEGDMDLAEAFLKHIFKYVLETCQEDIEFF  285

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             N  I+K ++    +++  +  ++TYT+A+ LL +  K+FEFPV WG DLQSEHERY+ EE
Sbjct  286   NERIDKTVLATAENIINNQFERITYTEAVRLLEQADKQFEFPVKWGLDLQSEHERYLAEE  345

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   P I+ DYP +IKAFYMR +DD KTV AMD+L P++GE+IGGSQREERL+ LE+R+
Sbjct  346   LFKK-PTIVTDYPVEIKAFYMRLSDDEKTVRAMDVLAPKIGEIIGGSQREERLDVLERRI  404

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +   +NKE  WWYLDLRRYG+VPHAGFGLGFER+VQF TG+ NIRD IPFPR P
Sbjct  405   EAQGMNKEDLWWYLDLRRYGTVPHAGFGLGFERVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_012162530.1| asparaginyl-tRNA synthetase [Acaryochloris marina]
 ref|YP_001516349.1| asparaginyl-tRNA synthetase [Acaryochloris marina MBIC11017]
 gb|ABW27035.1| asparaginyl-tRNA synthetase [Acaryochloris marina MBIC11017]
Length=463

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/455 (58%), Positives = 338/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             GE++ V+GWVRT R      F++VNDGS L  +Q V++Q+   Y+Q    L+ TG+SV I
Sbjct  16    GESIKVQGWVRTKRELKEFAFLDVNDGSSLQGLQVVVNQNLPEYEQTLK-LLNTGSSVSI  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             +G + +SQG  Q++EL    + + G +D  ++P+QKKR S EFLRT AHLR RTNT G+V
Sbjct  75    EGELVASQGKNQRVELVAKAVQVWGTADLETYPLQKKRHSFEFLRTIAHLRSRTNTLGSV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              R+RNA + A H+FFQ+  F+W+ +PI+TASDCEGAGEQ  VT+L           + ++
Sbjct  135   FRIRNACSQAIHQFFQDRDFMWIHTPIITASDCEGAGEQLAVTSL----------NLQDV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P +E  +VD+SQDFFGKP +LTVSGQL  E  A+A  +VYTFGPTFRAENSNTSRHLAEF
Sbjct  185   PLSEDQTVDYSQDFFGKPTYLTVSGQLEGEIMASAFCNVYTFGPTFRAENSNTSRHLAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AF DL+ DM  A A+L++V + +L+ C ED EFFN  I+K +++    ++  +
Sbjct  245   WMVEPEVAFCDLQGDMDLAEAFLKHVFKSVLEQCPEDFEFFNLRIDKSVLETADTIINSE  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+  L K  +KFEFPV WG DLQSEHERY++EE F   PVI+ DYPK IKAF
Sbjct  305   FERITYTEAVNQLEKASRKFEFPVEWGLDLQSEHERYLSEELFKK-PVIVTDYPKQIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAAMD+LVP++GE+IGGSQREERL+ LE+R+    L  E YWWYLDLRRY
Sbjct  364   YMRMNDDDKTVAAMDVLVPKIGEIIGGSQREERLDLLEQRIVAQGLPLEDYWWYLDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   GTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTP  458



>ref|WP_026788669.1| asparaginyl-tRNA synthetase [Planktothrix rubescens]
Length=463

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 268/457 (59%), Positives = 336/457 (74%), Gaps = 13/457 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             +L ET+ V+GWVRT R     TF+EVNDGS L+N+Q V++ D   Y  +   L  TGASV
Sbjct  14    KLNETVTVQGWVRTKRELKEFTFVEVNDGSALANLQVVLNPDLADYGNILKQLN-TGASV  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              I G +  S    Q+IELK  ++ + G++D  ++P+QKKR S EFLR   HLR RTNT G
Sbjct  73    EISGVLVESPAKGQRIELKASQVTVYGEADAETYPLQKKRHSFEFLREIGHLRARTNTLG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VT          N  + 
Sbjct  133   AVFRVRNACASAVHQFFQERGFLWVHTPIITASDCEGAGEMFSVT----------NFKLK  182

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             +IP TES  VD+ QDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLA
Sbjct  183   DIPLTESQQVDYDQDFFGKPAYLTVSGQLEAEIMAMAFGNVYTFGPTFRAENSNTSRHLA  242

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE DM  A  +L+Y+ + +L+ C EDMEFFN  I+K +++   +++ 
Sbjct  243   EFWMIEPEMAFCDLEGDMDLAEDFLKYIFKSVLETCPEDMEFFNERIDKSVLETAHNIIN  302

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI +L K  K+FE+PV+WG DLQSEHERY+ EE F   P ++ DYPK+IK
Sbjct  303   NEFGRITYTEAIAILEKADKQFEYPVSWGLDLQSEHERYLAEEYFKK-PTMVTDYPKEIK  361

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE++GGSQREERLE LE R+  L +N E  WWYL+LR
Sbjct  362   AFYMRLNEDGKTVRAMDVLAPKIGEIVGGSQREERLEMLENRMKTLGINPEELWWYLELR  421

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +YG+VPHAGFGLGF+R+VQF TG+ NIRD IPFPR P
Sbjct  422   KYGTVPHAGFGLGFDRVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_004821328.1| asparaginyl-tRNA synthetase [Peptoniphilus indolicus]
 gb|EGY79689.1| asparagine--tRNA ligase [Peptoniphilus indolicus ATCC 29427]
Length=446

 Score =   517 bits (1331),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 253/457 (55%), Positives = 344/457 (75%), Gaps = 14/457 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             + + +V+ GW++T RA  +  FIE+NDGS  S++Q V   + + + ++E   I   +S+ 
Sbjct  1     MNKEIVIEGWIKTSRASKNFGFIELNDGSSFSSLQIVYGDEVDNFSEIEKYTI--SSSLK  58

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             I+GT+  S GSKQ IE+   K+  +  S+P++P+QKKR + E+LRT+AHLRPRTN F AV
Sbjct  59    IEGTVVESPGSKQSIEVHAKKVTPISISEPTYPLQKKRHTVEYLRTQAHLRPRTNLFNAV  118

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+ +A+A HKFFQ+ GFV+V +PI+TASD EGAGE F VTTL           +N++
Sbjct  119   FRVRSIIAYAIHKFFQDRGFVYVHTPIITASDAEGAGEMFQVTTL----------DLNDV  168

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PK E G VD+S+DFF K   LTVSGQL AE +A A  +VYTFGPTFRAENSNT RH AEF
Sbjct  169   PKKE-GKVDFSEDFFSKATNLTVSGQLEAEVFAEAFGNVYTFGPTFRAENSNTQRHAAEF  227

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFAD+  +M  A   L+Y+++Y+L+N +E+M FFN++++KG+++RL +VV   
Sbjct  228   WMIEPEIAFADINVNMDIAEEMLKYIIKYVLENAEEEMNFFNSFVDKGLLERLDNVVNSD  287

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+AIE+L  +K +F++PV WG DLQ+EHERY+TEE +   PV + +YPK+IKAF
Sbjct  288   FGRVTYTEAIEVLKNSKTEFKYPVEWGVDLQTEHERYLTEEVYKK-PVFVTNYPKEIKAF  346

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YM+EN+D KTVAAMD+LVP VGE+IGGSQRE++LE LE ++  L +N E Y+WYLDLRRY
Sbjct  347   YMKENEDKKTVAAMDLLVPGVGEIIGGSQREDKLEVLEGKMKSLGMNLEDYYWYLDLRRY  406

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             GSVPH+G+GLGFER V + TG+ NIRD IPFPRT G+
Sbjct  407   GSVPHSGYGLGFERAVMYITGVKNIRDVIPFPRTVGT  443



>ref|WP_008311987.1| asparaginyl-tRNA synthetase [Leptolyngbya sp. PCC 6406]
Length=462

 Score =   517 bits (1332),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 334/454 (74%), Gaps = 12/454 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+T+ ++GWVRT R Q + +FI +NDGS L  +Q V  +    Y+ V    I TGASV +
Sbjct  16    GDTVTIQGWVRTKREQKTFSFININDGSTLGGIQVVADEQTADYEAVLK-RINTGASVAV  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
              G +A S    Q++ELK   L + G++D ++P+QKKR S EFLRT  HLR RTNT GAV 
Sbjct  75    TGVLAESPAKGQRLELKAQTLEVFGEADDTYPLQKKRHSFEFLRTLGHLRSRTNTLGAVF  134

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FF E GF+W+ +PI+T+SDCEGAGE F VT+L           +N  P
Sbjct  135   RVRNACAQAIHQFFHERGFLWIHTPILTSSDCEGAGELFTVTSL----------DLNHPP  184

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +T   +VD+SQDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  185   QTAEHTVDFSQDFFGKPAYLTVSGQLEAEIMAMAFTNVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF +L  +M  A A+L+YV +Y+LD+C+EDM FFN  I+  ++     +   + 
Sbjct  245   MVEPEMAFCNLGGNMDLAEAFLKYVFRYVLDHCEEDMAFFNQRIDDTVLATADAIANSEF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT+A+  L K+ + FEFPV WG DLQSEHERY+ EE F   P+I+ DYP  IKAFY
Sbjct  305   ARITYTEAVTQLQKSGQSFEFPVEWGIDLQSEHERYLAEEVFKR-PLIVTDYPAAIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDDGKTVAAMD+L P+VGE+IGGSQREERL+ LE+R+D   L +++YWWYLDLRRYG
Sbjct  364   MRLNDDGKTVAAMDVLAPKVGEIIGGSQREERLDILERRIDAAGLPRDAYWWYLDLRRYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   TVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTP  457



>ref|WP_009630358.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 7509]
Length=462

 Score =   517 bits (1332),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 342/473 (72%), Gaps = 20/473 (4%)
 Frame = +2

Query  377   IADI-KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGY  553
             IADI K G  E        L ++GWVRT R      FIEVNDGS L+N+Q V++     Y
Sbjct  5     IADILKNGQPEA------ELTIKGWVRTKRDLKGFAFIEVNDGSSLANLQVVLNSQMPDY  58

Query  554   DQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFL  730
             + +   L  TGASV + G +  SQG  Q+IEL+     + G++D  ++P+QKKR S EFL
Sbjct  59    EDLLKRLN-TGASVEVTGKLVPSQGKGQRIELQATTATVYGEADVDTYPLQKKRHSFEFL  117

Query  731   RTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTT  910
             RT  HLR RTN+FGAV RVRNA A A H+FFQ+ GF+WV +PI+T+SDCEGAGE F VT 
Sbjct  118   RTIGHLRSRTNSFGAVFRVRNACATAIHQFFQQRGFLWVHTPIITSSDCEGAGELFTVTN  177

Query  911   LIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGP  1090
             L           + ++P T+   VD+SQDFFGKPA+LTVSGQL AE  A A ++VYTF P
Sbjct  178   L----------DLKKVPLTDKQEVDYSQDFFGKPAYLTVSGQLEAEIMAMAFSNVYTFAP  227

Query  1091  TFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTW  1270
             TFRAENSNTSRHLAEFWM+EPE+AF +L+ DM  A A+L++V +Y+++ C EDMEFFN  
Sbjct  228   TFRAENSNTSRHLAEFWMVEPEMAFCNLQGDMDLAEAFLKHVFKYVMETCPEDMEFFNDR  287

Query  1271  IEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFG  1450
             I+K +++   ++++ +  +LTYTDA+ LL K    FE+PV+WG DLQSEHERY+ E+ F 
Sbjct  288   IDKTVLETAQNIIDNEFERLTYTDAVSLLEKAPVTFEYPVSWGLDLQSEHERYLAEQLFK  347

Query  1451  GCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddl  1630
               P I+ DYP  IKAFYMR NDD KTV+AMD+L P++GE+IGGSQREERL+ LE+R+ + 
Sbjct  348   K-PAIVTDYPVGIKAFYMRLNDDQKTVSAMDILAPKIGEIIGGSQREERLDVLEQRMRNQ  406

Query  1631  NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              LN E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  407   GLNPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMANIRDVIPFPRTPLS  459



>ref|WP_021285529.1| asparaginyl-tRNA synthetase [Clostridium sp. BL8]
 gb|EQB86014.1| asparaginyl-tRNA synthetase [Clostridium sp. BL8]
Length=463

 Score =   517 bits (1332),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 263/451 (58%), Positives = 336/451 (75%), Gaps = 13/451 (3%)
 Frame = +2

Query  437   VRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIA  616
             + GWVRTLR+  +  FIEVNDGS   N+Q +  +  E + +VE   I   +S+ + G + 
Sbjct  23    ISGWVRTLRSSKAFGFIEVNDGSFFKNVQVIFEETLENFKEVEKLSI--SSSITVIGNVV  80

Query  617   SSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNA  796
              +  +KQ  E+K  K+V+ G+S   +P+QKKR + E+LRT AHLRPR+N F AV RVR+ 
Sbjct  81    LTPEAKQPFEIKATKIVVEGESSSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAVFRVRSL  140

Query  797   LAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESG  976
              AFA HKFFQE GFV+  +PI+T SDCEGAGE F VTT+           +N IPKTE G
Sbjct  141   TAFAIHKFFQERGFVYTHTPIITGSDCEGAGEMFRVTTM----------DLNSIPKTEEG  190

Query  977   SVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPE  1156
              +D+ QDFFGK   LTVSGQL AE YA A  +VYTFGPTFRAENSNT RH AEFWMIEPE
Sbjct  191   KIDYKQDFFGKETNLTVSGQLAAEAYALAFRNVYTFGPTFRAENSNTPRHAAEFWMIEPE  250

Query  1157  LAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTY  1336
             +AFADL DDM  A   ++Y++ Y+++N  E+MEFFN++++KG+I+RL++V   +  ++TY
Sbjct  251   IAFADLSDDMELAEDMVKYIINYVMENAPEEMEFFNSFVDKGLIERLTNVANSEFGKITY  310

Query  1337  TDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMREND  1516
             T+A+ELL K  K+F++PV WGCDLQ+EHERYITEE +   PV + DYPKDIKAFYMR ND
Sbjct  311   TEAVELLKKADKEFQYPVEWGCDLQTEHERYITEEVYKK-PVFVTDYPKDIKAFYMRMND  369

Query  1517  DGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHA  1696
             D KTVAA D+LVP VGELIGGSQREERL+ LEKR+++L L+KE YWWYL+LR+YG   HA
Sbjct  370   DNKTVAATDLLVPGVGELIGGSQREERLDLLEKRIEELGLHKEDYWWYLELRKYGGTKHA  429

Query  1697  GFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             GFGLGFER++ + TG+ NIRD IPFPRT G+
Sbjct  430   GFGLGFERMIMYLTGMSNIRDVIPFPRTTGT  460



>ref|WP_026794100.1| MULTISPECIES: asparaginyl-tRNA synthetase [Planktothrix]
Length=463

 Score =   517 bits (1331),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 336/457 (74%), Gaps = 13/457 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             +L ET+ V+GWVRT R     TF+E+NDGS L+N+Q V++ D   Y  +   L  TGASV
Sbjct  14    KLNETVTVQGWVRTKRELKEFTFVEINDGSALANLQVVLNPDLADYGNILKQLN-TGASV  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              I G +  S    Q+IELK  ++ + G++D  ++P+QKKR S EFLR   HLR RTNT G
Sbjct  73    EISGVLVESPAKGQRIELKASQVTVYGEADAETYPLQKKRHSFEFLREIGHLRARTNTLG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VT          N  + 
Sbjct  133   AVFRVRNACASAVHQFFQERGFLWVHTPIITASDCEGAGEMFSVT----------NFKLK  182

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             +IP TES  VD+ QDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLA
Sbjct  183   DIPLTESQQVDYDQDFFGKPAYLTVSGQLEAEIMAMAFGNVYTFGPTFRAENSNTSRHLA  242

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE DM  A  +L+Y+ + +L+ C EDMEFFN  I+K +++   +++ 
Sbjct  243   EFWMIEPEMAFCDLEGDMDLAEDFLKYIFKSVLETCPEDMEFFNERIDKSVLETAHNIIN  302

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI +L K  K+FE+PV+WG DLQSEHERY+ EE F   P ++ DYPK+IK
Sbjct  303   NEFGRITYTEAIAILEKADKQFEYPVSWGLDLQSEHERYLAEEYFKK-PTMVTDYPKEIK  361

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE++GGSQREERLE LE R+  L +N E  WWYL+LR
Sbjct  362   AFYMRLNEDGKTVRAMDVLAPKIGEIVGGSQREERLEMLENRMKTLGINPEELWWYLELR  421

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +YG+VPHAGFGLGF+R+VQF TG+ NIRD IPFPR P
Sbjct  422   KYGTVPHAGFGLGFDRVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_019498293.1| asparaginyl-tRNA synthetase [Pseudanabaena sp. PCC 6802]
Length=462

 Score =   517 bits (1331),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 264/450 (59%), Positives = 331/450 (74%), Gaps = 14/450 (3%)
 Frame = +2

Query  437   VRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIA  616
             V+GWVRT R    +TF+E+NDGSCL  +Q V+SQD   Y+++    I TGA+V ++G + 
Sbjct  21    VQGWVRTKREAKGLTFLEINDGSCLQGLQVVVSQDIPDYERIIKQ-ISTGAAVGVEGVLV  79

Query  617   SSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRN  793
             +S G  Q+IE++   + + G +DP ++P+QKKR S EFLRT AHLRPRTNTFGAV RVRN
Sbjct  80    TSPGKGQRIEMQAQSVQIFGAADPETYPLQKKRHSFEFLRTIAHLRPRTNTFGAVFRVRN  139

Query  794   ALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTES  973
             A ++A HKFFQE  F+WV +P++TASDCEGAGE F VTT+        + P+        
Sbjct  140   ACSYAIHKFFQERDFLWVHTPVITASDCEGAGEMFAVTTIDLAKLVGASKPI--------  191

Query  974   GSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEP  1153
                D+ QDFFGKPAFLTVSGQL AE  A A ++VYTFGPTFRAENSNTSRHLAEFWMIEP
Sbjct  192   ---DYEQDFFGKPAFLTVSGQLEAEIMAMAFSNVYTFGPTFRAENSNTSRHLAEFWMIEP  248

Query  1154  ELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLT  1333
             E+AF DLE D   A  +L+Y+  Y+L+ C EDM FF   I   ++     +V++K  +++
Sbjct  249   EMAFCDLEGDADLAEDFLKYIFSYVLETCPEDMAFFQERISDRVMVNAQKIVDEKFERIS  308

Query  1334  YTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMREN  1513
             YT+AI+LL K+ K FEFPV WG D+QSEHERY+ EE F   PV++ DYP +IKAFYMR +
Sbjct  309   YTEAIKLLEKSDKDFEFPVKWGLDMQSEHERYLAEELFQK-PVVVMDYPTEIKAFYMRLD  367

Query  1514  DDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPH  1693
             + GKTV AMD+L P +GE+IGGSQREERL+ LE R+    LN E YWWYLDLRRYG+VPH
Sbjct  368   ESGKTVRAMDVLAPGIGEIIGGSQREERLDVLENRIKSAGLNPEDYWWYLDLRRYGTVPH  427

Query  1694  AGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             AGFGLGFERLVQF TG+ NIRD IPFPR+P
Sbjct  428   AGFGLGFERLVQFITGMGNIRDVIPFPRSP  457



>ref|WP_013322851.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7822]
 ref|YP_003888021.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7822]
 gb|ADN14746.1| asparaginyl-tRNA synthetase [Cyanothece sp. PCC 7822]
Length=463

 Score =   517 bits (1331),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 344/475 (72%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I  +  PDE       T+ + GWVRT R      F+EVNDGS ++N+Q V+     
Sbjct  5     RIAEILKQAQPDE-------TVTIGGWVRTKRELKGFAFMEVNDGSSMANLQVVLDPQVP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              YD +    I TGASV + GT+  S G  Q+IELK   + L G++DP ++P+QKKR S E
Sbjct  58    SYDSLLQQ-INTGASVVVTGTLVPSPGKGQRIELKATSVTLYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLR RTNT GAV RVRNA A A H+FFQE GF+WV +PI+TA+DCEGAGE F V
Sbjct  117   FLRTIAHLRGRTNTLGAVMRVRNACANAIHRFFQERGFLWVHTPIITANDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           + ++P+ E   +D+SQDFFGK A+LTVSGQL AE  A A  +VYTF
Sbjct  177   TNL----------DLKKLPRNEQQGIDFSQDFFGKRAYLTVSGQLEAEIMALAFQNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL+ D   A A+L+Y+ + +LD+C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLDGDQDLAEAFLKYIFKSVLDSCLEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +++   +++  +  ++TYT+AIELL K  +KFE+PV WG DLQSEHERY+ EE 
Sbjct  287   QRIDNTVLETAENIINNEFGRITYTEAIELLEKADRKFEYPVEWGIDLQSEHERYLAEEL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P+I+ +YPKDIKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERL  LE+R+ 
Sbjct  347   FKK-PLIVTNYPKDIKAFYMRLNDDNKTVAAMDVLAPKIGEIIGGSQREERLNVLEERIK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              + +  E  WWYLDLRR+G+VPHAGFGLGFER+VQF TG+ NIRD IPFPRTP S
Sbjct  406   QMGMLPEDLWWYLDLRRFGTVPHAGFGLGFERVVQFMTGMGNIRDVIPFPRTPLS  460



>ref|WP_011058304.1| asparaginyl-tRNA synthetase [Thermosynechococcus elongatus]
 ref|NP_683262.1| asparaginyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
 sp|Q8DG51.1|SYN_THEEB RecName: Full=Asparagine--tRNA ligase; AltName: Full=Asparaginyl-tRNA 
synthetase; Short=AsnRS [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC10024.1| asparaginyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
Length=462

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 267/459 (58%), Positives = 329/459 (72%), Gaps = 13/459 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             ++G+ + V+GWVRT R     TF+ +NDGS L+ +Q V+             L  TGA+ 
Sbjct  13    QVGDRITVKGWVRTKRELKECTFVNLNDGSTLAGLQVVIPNTVAAATPTMKDLT-TGAAA  71

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
                G +  S G  Q IEL   ++ L G +DP ++P+QKKR S EFLRT AHLRPRTNT G
Sbjct  72    EFTGELVRSPGKNQAIELHAEEIHLWGTADPETYPLQKKRHSFEFLRTIAHLRPRTNTLG  131

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VTTL           + 
Sbjct  132   AVMRVRNACATAIHQFFQERGFLWVHTPIITASDCEGAGELFTVTTL----------DLT  181

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             + PKT  G +D+SQDFFG+ A+LTVSGQL AE  ATA  +VYTFGPTFRAENSNTSRHLA
Sbjct  182   QPPKTPEGKIDFSQDFFGRRAYLTVSGQLEAEIMATAFTNVYTFGPTFRAENSNTSRHLA  241

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWM+EPE+AF DL  DM  A A+LQ+V +Y+LD+C EDM FF   I+  ++     +  
Sbjct  242   EFWMVEPEMAFCDLRGDMELAEAFLQFVFRYVLDHCPEDMAFFQERIDHSVMATAEQMAT  301

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
             +    L+Y++AI++L K+ + FEFPV WG DLQSEHERY+ EE +   PVI+ DYP  IK
Sbjct  302   QPFAHLSYSEAIQVLEKSGRAFEFPVAWGLDLQSEHERYLAEE-YCQRPVIVYDYPAAIK  360

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDDGKTVAAMD+L P++GE+IGGSQREER + L++R+    L+   YWWYLDLR
Sbjct  361   AFYMRLNDDGKTVAAMDILAPKIGEIIGGSQREERFDVLQERIVTQGLDPAPYWWYLDLR  420

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             RYGSVPHAGFGLGFERLVQF TG+DNIRD IPFPRTPG+
Sbjct  421   RYGSVPHAGFGLGFERLVQFMTGMDNIRDVIPFPRTPGN  459



>ref|WP_017321492.1| asparaginyl-tRNA synthetase [cyanobacterium PCC 7702]
Length=464

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 273/474 (58%), Positives = 343/474 (72%), Gaps = 23/474 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA+I  KG PDE +        V+GWVRT R      FIEVNDGSCL+N+Q V++QD  
Sbjct  5     RIAEILRKGQPDESVK-------VQGWVRTKRELKGFAFIEVNDGSCLANLQVVVNQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV I G + +S    Q++ELK   +++ G++DP ++P+QKKR S E
Sbjct  58    DYELILKKLN-TGASVEISGVLVASPAKGQRLELKANNIIVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+  HLR RTN+FGAV R+RNA A A H+FFQE GF+WV +PI+TA+DCEGAGE F V
Sbjct  117   FLRSIGHLRARTNSFGAVFRIRNACAVAIHQFFQERGFLWVHTPIITANDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGS-VDWSQDFFGKPAFLTVSGQLNAETYATALNDVYT  1081
             T+            +  IP+TE+   VD+S+DFF +P +LTVSGQL AE  A A + VYT
Sbjct  177   TSF----------DLKNIPRTENQQEVDYSKDFFARPTYLTVSGQLEAEILAMAFSKVYT  226

Query  1082  FGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFF  1261
             FGPTFRAENSNTSRHLAEFWMIEPE+AF DL  DM  A  +L+Y+ +Y+++ C EDMEFF
Sbjct  227   FGPTFRAENSNTSRHLAEFWMIEPEMAFCDLHGDMDLAEEFLKYIFKYVIEKCPEDMEFF  286

Query  1262  NTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEE  1441
             N  I+  ++    +++     ++TYT+AI+LL K   KFE+PV WG DLQSEHERY+ E+
Sbjct  287   NQRIDNTVLATADNIINNNFERITYTEAIKLLEKADAKFEYPVKWGLDLQSEHERYLCEQ  346

Query  1442  AFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrl  1621
              F   PVI+ DYP +IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERLE LEKR+
Sbjct  347   LFKK-PVIVTDYPIEIKAFYMRVNDDEKTVAAMDILAPKIGEIIGGSQREERLEILEKRI  405

Query  1622  ddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
                 +  E  WWYLDLRRYG+VPHAGFGLGFERL+QF TG+ NIRD IPFPRTP
Sbjct  406   KAQGMKTEDLWWYLDLRRYGTVPHAGFGLGFERLIQFMTGMGNIRDVIPFPRTP  459



>ref|WP_035292809.1| asparaginyl-tRNA synthetase [Clostridium sp. KNHs214]
Length=463

 Score =   516 bits (1329),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 258/457 (56%), Positives = 338/457 (74%), Gaps = 13/457 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+ + + GWVRT+RA  +  FIEVNDGS   N+Q V  +  E ++++  G +   AS+ 
Sbjct  17    IGKEVKLSGWVRTVRASKAFGFIEVNDGSFFKNVQIVFDEALENFNEL--GKLPISASIE  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+  + G+KQ  E+K  K++ +G S   +P+QKKR + E+LR+ AHLRPR+N F AV
Sbjct  75    VMGTVVETPGAKQPFEIKASKVIKIGNSSTDYPLQKKRHTFEYLRSIAHLRPRSNAFSAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE GFV+V +PI+T SDCEGAGE F VTTL           +  +
Sbjct  135   FRVRSIAAYAVHKFFQEQGFVYVHTPIITGSDCEGAGEMFRVTTL----------DMENL  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PK E G VD+SQDFFGK A LTVSGQL  E YA A  ++YTFGPTFRAENSNT RH +EF
Sbjct  185   PKDEKGKVDYSQDFFGKSANLTVSGQLEGEIYALAFRNIYTFGPTFRAENSNTGRHASEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADLEDDM  A   ++Y+++Y+++N  E++EFFN++I+KG+  RL++V+   
Sbjct  245   WMIEPEIAFADLEDDMDLAEEMVKYIIKYVMENAPEEIEFFNSFIDKGLKDRLNNVLNSD  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               +++YT+A+ELL K   +F++PV WGCDLQ+EHERYITE+ +   PV + DYPKDIKAF
Sbjct  305   FARISYTEAVELLKKADVEFKYPVEWGCDLQTEHERYITEKIYNK-PVFVTDYPKDIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAA D+LVP VGE+IG SQREERL+ LE R+ +L L KE YWWYL+LR+Y
Sbjct  364   YMRINDDNKTVAATDLLVPGVGEIIGASQREERLDVLEARIAELGLEKEDYWWYLELRKY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             G   HAGFGLGFER++ + TG+ NIRD IPFPRTPGS
Sbjct  424   GETKHAGFGLGFERMIMYLTGMSNIRDVIPFPRTPGS  460



>ref|WP_009625861.1| asparaginyl-tRNA synthetase [Pseudanabaena biceps]
 gb|ELS33961.1| asparaginyl-tRNA synthetase [Pseudanabaena biceps PCC 7429]
Length=466

 Score =   516 bits (1328),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 270/461 (59%), Positives = 331/461 (72%), Gaps = 18/461 (4%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             ++ ++ +VRGWVRT R    + F+E+NDGS L  +Q V+ QD +GY+ +    I TG S+
Sbjct  14    QVNDSYLVRGWVRTKREGKGIAFLELNDGSSLQGLQIVLPQDLDGYETLVKQ-ITTGTSI  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              + G +  S G  Q++E++   + + G +DP ++P+QKKR S EFLRT AHLRPRTN FG
Sbjct  73    EVSGILVESMGKGQRVEMQATAIAVFGTADPETYPLQKKRHSIEFLRTIAHLRPRTNMFG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA AFA H+FFQE GF+WV +PIVTASDCEGAGE F VTTL  N    T  PV 
Sbjct  133   AVFRVRNACAFAIHQFFQERGFLWVHTPIVTASDCEGAGEMFGVTTLDLNKVAATGKPV-  191

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
                       D+SQDFFGKPAFLTVSGQL AE  ATA ++VYTFGPTFRAENSNTSRHLA
Sbjct  192   ----------DFSQDFFGKPAFLTVSGQLEAEIMATAFSNVYTFGPTFRAENSNTSRHLA  241

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE D   A  +L+Y+  Y+L  C +DMEFF   +   ++     +VE
Sbjct  242   EFWMIEPEMAFCDLEGDADLAEDFLKYIFNYVLATCPKDMEFFQERVNDRVMVNAQKIVE  301

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
             +K  ++TYT+AI +L    K FE+PV WG DLQSEHER++ EE F   PVI+ DYP  IK
Sbjct  302   EKFERITYTEAIAILENCSKTFEYPVQWGLDLQSEHERFLAEEHFQK-PVIVMDYPLGIK  360

Query  1493  AFYMREND----DGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWY  1660
             AFYMR N+    D +TV AMD+L P VGE+IGGSQREERL+ LE R+ ++ LN E YWWY
Sbjct  361   AFYMRVNEGTASDRQTVRAMDILAPGVGEIIGGSQREERLDVLESRIRNVGLNPEDYWWY  420

Query  1661  LDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             LDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  421   LDLRRYGTVPHAGFGLGFERLVQFITGMGNIRDVIPFPRFP  461



>ref|WP_009556169.1| asparaginyl-tRNA synthetase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69257.1| asparaginyl-tRNA synthetase [Oscillatoriales cyanobacterium JSC-12]
Length=462

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 269/473 (57%), Positives = 342/473 (72%), Gaps = 22/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIAD+   G PDE        + V+GWVRT R Q   +F+EVNDGS ++ +Q V++QD  
Sbjct  4     RIADLLRNGQPDE-------IVTVQGWVRTKREQKEFSFVEVNDGSSMAGLQVVINQDVP  56

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
             GY ++    I TGASV + GT+  S    Q+IELK   + + G++D  ++P+QKKR S E
Sbjct  57    GYAEMIKR-ISTGASVEVVGTLVESPAKGQRIELKADAIKVYGEADAETYPLQKKRHSFE  115

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR  AHLR RTNT GAV RVRNA A A H FFQE GF+W+ +PI++ASDCEGAGE F V
Sbjct  116   FLRDIAHLRSRTNTLGAVFRVRNAAATAIHNFFQERGFLWIHTPIISASDCEGAGEMFTV  175

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+            + ++P T+   VD+S+DFFGK A+LTVSGQL AE  A A ++VYTF
Sbjct  176   TSF----------DLTKVPLTDDKKVDYSKDFFGKQAYLTVSGQLEAEIMAMAFSNVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF +L+ DM  A A+L+++ +++L+ C EDMEFFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMVEPEMAFCNLQGDMELAEAFLKHIFKHVLETCPEDMEFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K ++    +++  +  ++TYT+AI LL K+ K FE+PV WG DLQSEHERY+ EE 
Sbjct  286   ERIDKSVLATADNIIHNEFARVTYTEAISLLEKSSKTFEYPVEWGLDLQSEHERYLAEEY  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ DYP  IKAFYMR NDD KTVAAMD+L P++GE+IGGSQREERL+ LE R+ 
Sbjct  346   FKK-PTIVTDYPATIKAFYMRLNDDEKTVAAMDVLAPKIGEIIGGSQREERLDVLENRIQ  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
              + L+   YWWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P
Sbjct  405   SVGLDPAPYWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAP  457



>ref|WP_027248929.1| asparaginyl-tRNA synthetase [Planktothrix agardhii]
Length=463

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 334/457 (73%), Gaps = 13/457 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             +L ET+ V+GWVRT R     TF+EVNDGS L+N+Q V++ D   Y  +   L  TGASV
Sbjct  14    KLNETVTVQGWVRTKRELKEFTFVEVNDGSALANLQVVLNPDLADYGNILKQLN-TGASV  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              I G +  S    Q+IELK   + + G++D  ++P+QKKR S EFLR   HLR RTNT G
Sbjct  73    EISGVLVESPAKGQRIELKASDVKVYGEADAETYPLQKKRHSFEFLREIGHLRARTNTLG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+T SDCEGAGE F VT          N  + 
Sbjct  133   AVFRVRNACASAVHQFFQERGFLWVHTPIITGSDCEGAGEMFSVT----------NFKLK  182

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             +IP TES  VD+ QDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLA
Sbjct  183   DIPLTESQQVDYDQDFFGKPAYLTVSGQLEAEIMAMAFGNVYTFGPTFRAENSNTSRHLA  242

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE DM  A  +L+Y+ + +L+ C EDMEFFN  I+K +++   +++ 
Sbjct  243   EFWMIEPEMAFCDLEGDMDLAEDFLKYIFKSVLETCPEDMEFFNERIDKSVLETAHNIIN  302

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI +L K  K+FE+PV+WG DLQSEHERY+ EE F   P ++ DYPK+IK
Sbjct  303   NEFGRITYTEAIAILEKADKQFEYPVSWGLDLQSEHERYLAEEYFKK-PTMVTDYPKEIK  361

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE++GGSQREERLE LE R+  L +N E  WWYL+LR
Sbjct  362   AFYMRLNEDGKTVRAMDVLAPKIGEIVGGSQREERLEMLENRMKTLGINPEELWWYLELR  421

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +YG+VPHAGFGLGF+R+VQF TG+ NIRD IPFPR P
Sbjct  422   KYGTVPHAGFGLGFDRVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_006631174.1| asparaginyl-tRNA synthetase [Microcoleus vaginatus]
 gb|EGK90198.1| Asparaginyl-tRNA synthetase [Microcoleus vaginatus FGP-2]
Length=463

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 344/475 (72%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIA I   G PDE       T+ V+GWVRT R      F+EVNDGS ++N+Q V++ D  
Sbjct  5     RIAAILRAGEPDE-------TVTVQGWVRTKRELKEFAFVEVNDGSAMANLQVVINSDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              ++ V   L  TGAS+ + G + +S    Q+IELK  ++ + G +DP ++P+QKKR S E
Sbjct  58    DFENVLKQLN-TGASLEVSGVLVASPAKGQRIELKASQVQVYGDADPQTYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTNT GAV RVRNA + A H+FFQE GF+WV +PI+ ASDCEGAGE F V
Sbjct  117   FLRTIAHLRPRTNTHGAVFRVRNACSAAVHQFFQERGFLWVHTPIIAASDCEGAGEMFAV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T          N  +  +P+T+S  +D+++DFFGK A+LTVSGQL AE  A A  +VYTF
Sbjct  177   T----------NFDLKNVPRTDSQEIDYAKDFFGKRAYLTVSGQLEAEVMALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWMIEPE+AF +L+ +M  A A+L+Y+ +Y+LD C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMIEPEMAFCELQGNMDLAEAFLKYIFKYVLDRCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+K ++    +++  +  ++TYT+AI LL K  KKF+FPV+WG DLQSEHERY+ E+ 
Sbjct  287   ERIDKTVLATAENIINNQFERITYTEAIALLEKADKKFDFPVSWGLDLQSEHERYLAEDL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P I+ DYP  IKAFYMR N+D KTV AMD+L P +GE+IGGSQREERL+ LE+R++
Sbjct  347   FKK-PTIVSDYPVGIKAFYMRLNEDEKTVRAMDVLAPNIGEIIGGSQREERLDVLERRME  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +NKE  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P S
Sbjct  406   AQGMNKEELWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAPLS  460



>ref|WP_011377750.1| asparaginyl-tRNA synthetase [Synechococcus elongatus]
 ref|YP_399849.1| asparaginyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
 gb|ABB56862.1| asparaginyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
 gb|AJD58610.1| asparaginyl-tRNA synthetase [Synechococcus sp. UTEX 2973]
Length=462

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 344/473 (73%), Gaps = 23/473 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI D+  +G P       G+T+VVRGW+RT R     TF+EVNDGSCL  +Q V+ Q+  
Sbjct  5     RIVDLLSQGQP-------GQTVVVRGWIRTARQLKEFTFVEVNDGSCLKGIQVVLGQELA  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGA++ ++G + +S    Q++EL+   + +VG +DP  +P+QKKR S E
Sbjct  58    DYEMLAKQLD-TGAAIAVEGQLVASPAKGQRVELQAASVEIVGGADPEQYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT AHLRPRTN+ GAV RVRNA A A H FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIAHLRPRTNSLGAVMRVRNAAATAIHDFFQERGFLWVHTPIITASDCEGAGELFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L           ++++ +++    D+ QDFFGK A+LTVSGQL AE  A A ++VYTF
Sbjct  177   TNL----------DLDKLGQSQQAP-DFEQDFFGKRAYLTVSGQLEAEIMALAFSNVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  DM  A A+L++V Q + D C ED+EFFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLGGDMDLAEAFLKFVFQRVSDRCSEDLEFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++ R   ++     +++YTDAI LL K  + F++PV WG DLQSEHERY+ EE 
Sbjct  286   QRIDSEVLNRAETILNNDFERVSYTDAIALLEKADRSFDYPVAWGIDLQSEHERYLAEEY  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P+I+ DYP++IKAFYMR NDD KTVAAMD+L P +GE+IGGSQREERL+ L++RL 
Sbjct  346   FRK-PLIVYDYPREIKAFYMRLNDDQKTVAAMDVLAPGIGEIIGGSQREERLDVLKQRLA  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             + NL +E+YWWYLDLRRYGSVPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  405   EANLPEENYWWYLDLRRYGSVPHAGFGLGFERLVQFITGMGNIRDVIPFPRTP  457



>ref|WP_015144905.1| asparaginyl-tRNA synthetase [Pleurocapsa minor]
 ref|YP_007082163.1| asparaginyl-tRNA synthetase [Pleurocapsa sp. PCC 7327]
 gb|AFY78606.1| asparaginyl-tRNA synthetase [Pleurocapsa sp. PCC 7327]
Length=463

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 269/482 (56%), Positives = 350/482 (73%), Gaps = 27/482 (6%)
 Frame = +2

Query  341   SRKIGEFRRRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNM  520
             +R+IGE  +        G PDE       ++ ++GWVRT R      FIEVNDGS ++N+
Sbjct  3     TRRIGEVLK-------NGQPDE-------SVTIQGWVRTKRELKGFAFIEVNDGSSMANL  48

Query  521   QCVMSQDAEGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFP  697
             Q +++ D   Y++    L  TGASV + G +  S G  Q+IEL+   + + G+S+P ++P
Sbjct  49    QVILNPDVPNYEESLKKLN-TGASVEVSGILVPSPGKGQRIELETSSIKIYGESEPETYP  107

Query  698   IQKKRVSREFLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDC  877
             +QKKR S EFLRT  HLR RTNT GAV RVRNA + A H+FFQE GF+WV +PI+TASDC
Sbjct  108   LQKKRHSFEFLRTIGHLRSRTNTMGAVMRVRNACSRAIHQFFQERGFLWVHTPIITASDC  167

Query  878   EGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYA  1057
             EGAGE F VT+L           +N++P+T+   +D++QDFFG+ A+LTVSGQL AE  A
Sbjct  168   EGAGELFTVTSL----------NLNDLPRTDKQEIDFAQDFFGRRAYLTVSGQLEAEVMA  217

Query  1058  TALNDVYTFGPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDN  1237
              A   VYTFGPTFRAENSNTSRHLAEFWM+EPE+AF DL+ D   A A+L+Y+ + +LDN
Sbjct  218   MAFQKVYTFGPTFRAENSNTSRHLAEFWMVEPEMAFCDLKGDRELAEAFLKYIFKSVLDN  277

Query  1238  CKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSE  1417
             C EDMEFFN  I+  ++    +++  +   +TYT+A++LL K+ ++FE+PV WG DLQSE
Sbjct  278   CPEDMEFFNQRIDNTVLATADNIINNEFACITYTEAVKLLEKSDRQFEYPVEWGVDLQSE  337

Query  1418  HERYITEEAFGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreer  1597
             HERY+ EE F   PVI+ DYP  IKAFYMR NDDGKTVAAMD+LVP+VGE+IGGSQREER
Sbjct  338   HERYLAEELFKK-PVIVTDYPTSIKAFYMRLNDDGKTVAAMDVLVPKVGEIIGGSQREER  396

Query  1598  leylekrlddlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPR  1777
             L+ LEKR+ +L + ++  WWYLDLRR+G+VPHAGFGLGFER++QF TG+ NIRD IPFPR
Sbjct  397   LDVLEKRIKELGMPEKDLWWYLDLRRFGTVPHAGFGLGFERVIQFMTGMGNIRDVIPFPR  456

Query  1778  TP  1783
             TP
Sbjct  457   TP  458



>ref|WP_023074100.1| asparaginyl-trna synthetase [Leptolyngbya sp. Heron Island J]
 gb|ESA35036.1| asparaginyl-trna synthetase [Leptolyngbya sp. Heron Island J]
Length=463

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 262/455 (58%), Positives = 341/455 (75%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + ++GWVRT R    ++F+++NDGS ++ +Q ++    +GY++     I TGASV I
Sbjct  16    GDVVTIQGWVRTKRDSKKLSFLDINDGSSMTGLQVIVDAGLDGYEESMKQ-ITTGASVTI  74

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
              GT+A S G  Q++EL+   L +VG+SD  ++P+QKKR S EFLR   HLR RTNT GAV
Sbjct  75    SGTLAESPGKGQRVELQASTLEVVGESDAETYPLQKKRHSFEFLRGLGHLRSRTNTLGAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRNA A A H+FFQ   F+W+ +PI+TASDCEGAGE F VT++           ++++
Sbjct  135   FRVRNACANAIHEFFQSREFLWIHTPILTASDCEGAGEMFTVTSM----------NLDKL  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PK + G VD+ QDFFGKP +LTVSGQL AE  A A ++VYTFGPTFRAENSNTSRHLAEF
Sbjct  185   PKGDDGKVDYGQDFFGKPTYLTVSGQLEAEIMAMAFSNVYTFGPTFRAENSNTSRHLAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AF DLE +M  A  +L++V + +L++C +DMEFFN  I++ +++   +++  +
Sbjct  245   WMMEPEMAFCDLEGNMDLAEEFLKFVFKRVLEDCADDMEFFNKRIDQTVLETADNIISNE  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYTDAI+LL K  K FE+PV+WG D+QSEHERY+ EE F   PVI+ DYP +IKAF
Sbjct  305   FERITYTDAIKLLEKCDKTFEYPVSWGLDMQSEHERYLAEEYFKK-PVIVTDYPTEIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR ND GKTVAAMD+L PR+GE+IGGSQREERL+ LE R+ +  L KE YWWYLDLRRY
Sbjct  364   YMRLNDGGKTVAAMDVLAPRIGEIIGGSQREERLDVLEARIAEAGLPKEDYWWYLDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   GTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTP  458



>ref|WP_024621111.1| asparaginyl-tRNA synthetase [[Clostridium] mangenotii]
Length=465

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 340/455 (75%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+ + V GW+RT R   +  FIE+NDGS   NMQ V  +  E +  +    +   +++ 
Sbjct  19    IGKDVTVAGWIRTSRGSKNFGFIELNDGSFFKNMQVVYDEKLENFKDISK--LAISSAIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E++  K+V+ G+SD S+P+QKK+ S E+LRT AHLRPR+NTF AV
Sbjct  77    VEGKLVSTEGAKQPVEIQAHKVVIEGESDSSYPLQKKKHSFEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              R+R+  A+A HKFFQE  FV+  SPI+T SD EGAGE F VTTL           ++ +
Sbjct  137   FRIRSMAAYAIHKFFQERNFVYAHSPIITGSDAEGAGEMFRVTTL----------DMDNV  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
              K + G VD+++DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +EF
Sbjct  187   AKNDEGKVDYTEDFFGKEAHLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++Y++ Y+L+N  E+MEFFN +I+KG+++RL+++V  +
Sbjct  247   WMIEPEIVFADLEDNMDLAEDMIKYIISYVLENAPEEMEFFNQFIDKGLLERLNNLVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT A+ELL+++  KFE+PV WGCDLQ+EHERYITE+ + G PV + DYPKDIKAF
Sbjct  307   FTRITYTKAVELLIESGHKFEYPVEWGCDLQTEHERYITEQIY-GAPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTV AMD+LVP VGE++GGSQREER + L  ++D++ LN+E YWWYL+LR++
Sbjct  366   YMRMNDDGKTVRAMDLLVPGVGEIVGGSQREEREDVLLAKIDEMGLNREDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMGNIRDVIPFPRTP  460



>ref|WP_035158922.1| asparaginyl-tRNA synthetase [Calothrix sp. 336/3]
 gb|KFB83558.1| asparaginyl-tRNA synthetase [Calothrix sp. 336/3]
Length=463

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 266/474 (56%), Positives = 345/474 (73%), Gaps = 20/474 (4%)
 Frame = +2

Query  374   RIADI-KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             RIA+I + G  E      E + ++GWVRT R     +FIEVNDGS L+++Q +++QD   
Sbjct  5     RIAEILRSGQAE------EVIKIQGWVRTKRESKGFSFIEVNDGSSLASLQVIINQDVPD  58

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREF  727
             Y+      I TGASV + G I  S G  Q+IELK   + + G++DP ++P+QKKR S EF
Sbjct  59    YEASLKK-INTGASVEVSGVIVPSLGKGQRIELKAQTVQVYGEADPETYPLQKKRHSFEF  117

Query  728   LRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVT  907
             LRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VT
Sbjct  118   LRTIGHLRSRTNSFGAVFRVRNACATAVHQFFQERGFMWVHTPIITASDCEGAGELFSVT  177

Query  908   TLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFG  1087
             +L           + +IP+T   ++D+SQDFF KP +LTVSGQL AE  A A ++VYTFG
Sbjct  178   SL----------NLKDIPRTPENNIDYSQDFFAKPTYLTVSGQLEAEVMAMAFSNVYTFG  227

Query  1088  PTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNT  1267
             PTFRAENSNTSRHLAEFWMIEPE+AF DL+ DM  A A+L+++ +Y+L+ C EDMEFFN 
Sbjct  228   PTFRAENSNTSRHLAEFWMIEPEMAFCDLQGDMDLAEAFLKHIFKYVLEKCPEDMEFFNQ  287

Query  1268  WIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAF  1447
              I+  ++    +++  +  ++TYT+AI+LL     +FE+PV+WG DLQSEHERY++E+ F
Sbjct  288   RIDNTVLSTAENIIHNQFERITYTEAIKLLETADVQFEYPVSWGLDLQSEHERYLSEQLF  347

Query  1448  GGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrldd  1627
                P I+ DYP  IKAFYMR N+D +TVAAMD+L P++GE+IGGSQREERL+ LE+R+  
Sbjct  348   KK-PTIVTDYPAKIKAFYMRLNEDEQTVAAMDILAPKIGEIIGGSQREERLDVLERRVIA  406

Query  1628  lNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
               +  +  +WYLDLRR+G+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  407   QGMQPQDLYWYLDLRRFGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPQS  460



>ref|WP_017311912.1| asparaginyl-tRNA synthetase [Fischerella sp. PCC 9339]
Length=463

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 269/475 (57%), Positives = 344/475 (72%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PD+  +       V+GWVRT R      FIEVNDGS L+N+Q V++QD  
Sbjct  5     RIVEILRNGQPDDSPE-------VKGWVRTKRELKGFAFIEVNDGSSLANLQVVINQDLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G + +S    Q++ELK   + + G++DP ++P+QKKR S E
Sbjct  58    DYENILKKLN-TGASVEVTGVLVASPAKGQRVELKADSVKVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+FGAV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNSFGAVFRVRNACATAIHQFFQERGFMWVHTPIITASDCEGAGELFSV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           +  IP+TE+ +VD+++DFF +P +LTVSGQL AE  A A ++VYTF
Sbjct  177   TSL----------DLKNIPRTENQTVDYTKDFFSRPTYLTVSGQLEAEIMAMAFSNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF D+  DM  A  +L+Y+ +Y+L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDIHGDMDLAEEFLKYIFKYVLEKCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI+LL K   +F++PV+WG DLQSEHERY+ E+ 
Sbjct  287   QRIDNTVLAIADNIINNQFERITYTEAIKLLEKADVQFDYPVSWGLDLQSEHERYLCEQL  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYP  IKAFYMR NDD KTVAAMD+L P++GE++GGSQREERLE LEKR+ 
Sbjct  347   FKK-PVIVNDYPAQIKAFYMRLNDDEKTVAAMDILAPKIGEIVGGSQREERLEVLEKRVL  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                +  E  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  406   AQGMKPEDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRTPES  460



>gb|KEI68793.1| AsnS [Planktothrix agardhii NIVA-CYA 126/8]
Length=463

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 334/457 (73%), Gaps = 13/457 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             +L ET+ V+GWVRT R     TF+EVNDGS L+N+Q V++ D   Y  +   L  TGASV
Sbjct  14    KLNETVTVQGWVRTKRELKEFTFVEVNDGSALANLQVVLNPDLADYGNILKQLN-TGASV  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              I G +  S    Q+IELK   + + G++D  ++P+QKKR S EFLR   HLR RTNT G
Sbjct  73    EISGVLVESPAKGQRIELKASDVKVYGEADAETYPLQKKRHSFEFLREIGHLRARTNTLG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+T SDCEGAGE F VT          N  + 
Sbjct  133   AVFRVRNACASAVHQFFQERGFLWVHTPIITGSDCEGAGEMFSVT----------NFKLK  182

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             +IP TES  VD+ QDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLA
Sbjct  183   DIPLTESQQVDYDQDFFGKPAYLTVSGQLEAEIMAMAFGNVYTFGPTFRAENSNTSRHLA  242

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE DM  A  +L+++ + +L+ C EDMEFFN  I+K +++   +++ 
Sbjct  243   EFWMIEPEMAFCDLEGDMDLAEDFLKHIFKSVLEKCPEDMEFFNERIDKSVLETAHNIIN  302

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI +L K  K+FE+PV+WG DLQSEHERY+ EE F   P I+ DYPK+IK
Sbjct  303   NEFGRITYTEAIAILEKADKQFEYPVSWGLDLQSEHERYLAEEYFKK-PTIVTDYPKEIK  361

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE++GGSQREERLE LE R+  L +N E  WWYL+LR
Sbjct  362   AFYMRLNEDGKTVRAMDVLAPKIGEIVGGSQREERLEMLENRMKTLGINPEELWWYLELR  421

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +YG+VPHAGFGLGF+R+VQF TG+ NIRD IPFPR P
Sbjct  422   KYGTVPHAGFGLGFDRVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_027702320.1| asparaginyl-tRNA synthetase [[Clostridium] mangenotii]
Length=465

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 339/455 (75%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+ + V GW+RT R   +  FIE+NDGS   NMQ V  +  E +  +    +   +++ 
Sbjct  19    IGKDVTVAGWIRTSRGSKNFGFIELNDGSFFKNMQVVYDEKLENFKDISK--LAISSAIL  76

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + S++G+KQ +E++  K+V+ G+SD S+P+QKK+ S E+LRT AHLRPR+NTF AV
Sbjct  77    VEGKLVSTEGAKQPVEIQAHKVVVEGESDSSYPLQKKKHSFEYLRTIAHLRPRSNTFSAV  136

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              R+R+  A+A HKFFQE  FV+  SPI+T SD EGAGE F VTTL           ++ +
Sbjct  137   FRIRSMAAYAIHKFFQERNFVYAHSPIITGSDAEGAGEMFRVTTL----------DMDNV  186

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
              K + G VD+++DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +EF
Sbjct  187   AKNDEGKVDYTEDFFGKEAHLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASEF  246

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+ FADLED+M  A   ++Y++ Y+L+N  E+MEFFN +I+KG+++RL+++V  +
Sbjct  247   WMIEPEIVFADLEDNMDLAEDMIKYIISYVLENAPEEMEFFNQFIDKGLLERLNNLVNSE  306

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT A+ELL+++  KFE+PV WGCDLQ+EHERYITE+ + G PV + DYPKDIKAF
Sbjct  307   FTRITYTKAVELLIESGHKFEYPVEWGCDLQTEHERYITEQIY-GAPVFVTDYPKDIKAF  365

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTV AMD+LVP VGE++GGSQREER   L  ++D++ LN+E YWWYL+LR++
Sbjct  366   YMRMNDDGKTVRAMDLLVPGVGEIVGGSQREEREGVLLAKIDEMGLNREDYWWYLELRKF  425

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G+  H+GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  426   GTATHSGFGLGFERIIMYMTGMGNIRDVIPFPRTP  460



>ref|WP_026797012.1| asparaginyl-tRNA synthetase [Planktothrix prolifica]
Length=463

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 266/457 (58%), Positives = 334/457 (73%), Gaps = 13/457 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             +L ET+ V+GWVRT R     TF+EVNDGS L+N+Q V++ D   Y  +   L  TGASV
Sbjct  14    KLNETVTVQGWVRTKRELKEFTFVEVNDGSALANLQVVLNPDLADYGNILKQLN-TGASV  72

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
              I G +  S    Q+IELK  ++ + G++D  ++P+QKKR S EFLR   HLR RTNT G
Sbjct  73    EISGVLVESPAKGQRIELKASQVTVYGEADAETYPLQKKRHSFEFLREIGHLRARTNTLG  132

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRN  A A H+FFQE GF+WV +PI+T SDCEGAGE F VT          N  + 
Sbjct  133   AVFRVRNTCASAVHQFFQERGFLWVHTPIITGSDCEGAGEMFSVT----------NFKLK  182

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             +IP TES  VD+ QDFFGKPA+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLA
Sbjct  183   DIPLTESQQVDYDQDFFGKPAYLTVSGQLEAEIMAMAFGNVYTFGPTFRAENSNTSRHLA  242

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AF DLE DM  A  +L+Y+ + +L+ C EDMEFFN  I+K +++   +++ 
Sbjct  243   EFWMIEPEMAFCDLEGDMDLAEDFLKYIFKSVLETCPEDMEFFNERIDKSVLETAHNIIN  302

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
              +  ++TYT+AI +L K  K+FE+PV+WG DLQSEHERY+ EE F   P ++ DYPK+IK
Sbjct  303   NEFGRITYTEAIAILEKADKQFEYPVSWGLDLQSEHERYLAEEYFKK-PTMVTDYPKEIK  361

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR N+DGKTV AMD+L P++GE++GGSQREERLE LE R+  L +N E  WWYL+LR
Sbjct  362   AFYMRLNEDGKTVRAMDVLAPKIGEIVGGSQREERLEMLENRMKTLGINPEELWWYLELR  421

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +YG+VPHAGFGLGF+R+VQF TG+ NIRD IPFPR P
Sbjct  422   KYGTVPHAGFGLGFDRVVQFMTGMGNIRDVIPFPRAP  458



>ref|WP_008681608.1| asparaginyl-tRNA synthetase [Clostridium sp. 7_2_43FAA]
 gb|EEH99458.1| asparaginyl-tRNA synthetase [Clostridium sp. 7_2_43FAA]
Length=464

 Score =   514 bits (1324),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 260/456 (57%), Positives = 336/456 (74%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L E + + GW+RTLRA ++  FIEVNDG+   N+Q V     + +  V    +   +S+ 
Sbjct  18    LSEEIKISGWIRTLRASNAFGFIEVNDGTFFKNVQVVFDNKLDNFKDVSK--LPISSSIT  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+ ++  +KQ  E++  ++V+ G S   +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVATPEAKQPFEIQAKEIVIEGLSQSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE GFV+  +P++T SDCEGAGE F VTTL           ++ +
Sbjct  136   FRVRSVAAYAIHKFFQERGFVYTHTPLITGSDCEGAGEMFRVTTL----------DLHNV  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G++D+ QDFFGK + LTVSGQLNAE YA A  +VYTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEEGAIDFKQDFFGKESNLTVSGQLNAECYALAFRNVYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADL+DDM  A   L+YV++Y+L  C E+M FFN +++KGI+ RL+ V+   
Sbjct  246   WMIEPEIAFADLQDDMELAEDMLKYVLEYVLAECPEEMAFFNQFVDKGILDRLNHVMTSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L K  KKFE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIKAF
Sbjct  306   FGKVTYTEAVEILKKADKKFEYPVEWGIDLQTEHERYLTEEHFKK-PVFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAA D+LVP +GELIGGSQREER++ L KR+ +L LN+E YWWYL+LR+Y
Sbjct  365   YMRLNDDGKTVAATDLLVPGIGELIGGSQREERIDILTKRMAELGLNEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMSNIRDVIPFPRTTG  460



>ref|WP_018589412.1| asparaginyl-tRNA synthetase [Terrisporobacter glycolicus]
Length=465

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 253/449 (56%), Positives = 338/449 (75%), Gaps = 13/449 (3%)
 Frame = +2

Query  437   VRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGTIA  616
             + GW+RT R   +  FIE+NDGS   NMQ V+    E + ++  G +   +SV ++G + 
Sbjct  25    IAGWIRTSRISKNFGFIELNDGSFFKNMQVVLDDKLENFKEI--GKLPISSSVLVEGKLV  82

Query  617   SSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNA  796
             +++G+KQ +E+   K+VL G+SD S+P+QKKR + E+LRT AHLRPR+N F AV RVR+ 
Sbjct  83    ATEGAKQPVEIHATKIVLEGESDNSYPLQKKRHTVEYLRTIAHLRPRSNMFSAVFRVRSV  142

Query  797   LAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTESG  976
              A+A HKFFQE  FV+  SPI+T SDCEGAGE F +TTL           ++ +PKTE G
Sbjct  143   AAYAVHKFFQERNFVYSHSPIITGSDCEGAGEMFRITTL----------DLDNVPKTEEG  192

Query  977   SVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIEPE  1156
              +D+S+DFFGK A LTVSGQLNAE  A A  +VYTFGPTFRAENS T RH +EFWMIEPE
Sbjct  193   KIDYSEDFFGKEANLTVSGQLNAEIMALAFRNVYTFGPTFRAENSYTGRHASEFWMIEPE  252

Query  1157  LAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQLTY  1336
             +AFADLED+M  A   ++Y++ Y+L++C E+MEFFN +++KG+++RL ++V    +++TY
Sbjct  253   IAFADLEDNMELAEDMVKYIINYVLEHCPEEMEFFNAFVDKGLLERLKNIVSSDFIRITY  312

Query  1337  TDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMREND  1516
             T A+ELLL+  +KFE+PV WG DLQ+EHERYITE+ +   PV + DYPKDIKAFYMR N+
Sbjct  313   TKAVELLLECGEKFEYPVEWGIDLQTEHERYITEQIY-KAPVFVTDYPKDIKAFYMRLNE  371

Query  1517  DGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVPHA  1696
             DGKTV AMD+LVP VGE+IGGSQREER + L +R+D+  LN+E YWWYL+LR++G+  H+
Sbjct  372   DGKTVRAMDLLVPGVGEIIGGSQREERHDVLLERIDEFELNREDYWWYLELRKFGTATHS  431

Query  1697  GFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             GFGLGFER++ + TG+ NIRD IPFPRTP
Sbjct  432   GFGLGFERMIMYLTGVSNIRDVIPFPRTP  460



>ref|WP_027098532.1| asparaginyl-tRNA synthetase [Clostridium paraputrificum]
Length=464

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 334/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + + + GW+RTLRA ++  FIEVNDGS   N+Q V     E + +V    +   +S+ 
Sbjct  18    LSKDITISGWIRTLRASNAFGFIEVNDGSFFKNIQVVFDNKLENFKEVSK--LPISSSIT  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+  +  +KQ  E+   ++++ G SD  +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVETPEAKQPFEIHAKEVIVEGLSDSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQE GFV+ ++PI+T SDCEGAGE F VTTL           ++ I
Sbjct  136   FRVRSVAAYAIHKFFQEQGFVYTNTPILTGSDCEGAGEMFRVTTL----------DLHNI  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G++D+ +DFFGK   LTVSGQLNAET+A A  +VYTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEEGAIDFKEDFFGKETNLTVSGQLNAETFALAFRNVYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AFADL+DDM  A   L+YV++Y++D C E+M FFN +++KG+++RL+ VV   
Sbjct  246   WMVEPEIAFADLQDDMELAEDMLKYVIKYVMDECPEEMAFFNQFVDKGLLERLNHVVSSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L    K FE+ V WG DLQ+EHERY+TEE F   PV + DYPKDIKAF
Sbjct  306   FGKVTYTEAVEILKSCGKAFEYDVEWGIDLQTEHERYLTEEYFKK-PVFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAA D LVP +GE+IGGSQREERL+ L+ R+ +L L +E YWWYL+LR+Y
Sbjct  365   YMRLNDDGKTVAATDCLVPGIGEIIGGSQREERLDVLKSRMAELGLKEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMSNIRDVIPFPRTTG  460



>ref|WP_035161618.1| asparaginyl-tRNA synthetase [Caloranaerobacter azorensis]
 gb|KGG81294.1| asparaginyl-tRNA synthetase [Caloranaerobacter azorensis H53214]
Length=463

 Score =   514 bits (1323),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 335/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             + E +VV GWVRT+R+  S  FIE+NDGS   N+Q V   + + + ++    I T  ++ 
Sbjct  17    IDENVVVSGWVRTIRSSKSFGFIELNDGSFFKNIQIVFEDNLDNFKEISKLPIST--AIK  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             ++G + ++  +KQ  E+K   + +  +SD  +P+QKKR + E+LRT AHLRPR+NTF AV
Sbjct  75    VEGLLVATPNNKQPFEIKAKSITIEAESDKDYPLQKKRHTFEYLRTIAHLRPRSNTFSAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+ +A+A HKFFQE GFV+V +PI+T SDCEGAGE F VTTL            + +
Sbjct  135   FRVRSLVAYAIHKFFQERGFVYVHTPIITGSDCEGAGEMFRVTTL----------DFDNL  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P  E+G VD+ +DFFGK   LTVSGQLN E YA A  +VYTFGPTFRAENSNT+RH AEF
Sbjct  185   PLDENGKVDFKKDFFGKETNLTVSGQLNVEAYALAFRNVYTFGPTFRAENSNTARHAAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADL+DDM  A   L+Y++ ++L+N  E+MEFFN +I+KG+++RL+++V   
Sbjct  245   WMIEPEIAFADLKDDMELAEEMLKYIINFVLENAPEEMEFFNKFIDKGLLERLNNIVNSD  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+AI++L K+ K F++PV WG DLQ+EHERYITEE F   PV + DYPKDIKAF
Sbjct  305   FERITYTEAIDILKKSNKDFQYPVEWGNDLQTEHERYITEEVFNK-PVFVTDYPKDIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAAMD+LVP VGE+IGGSQREER + L  R+ ++ L +E YWWYL+LRRY
Sbjct  364   YMRLNDDEKTVAAMDLLVPGVGEIIGGSQREERHDILVNRMKEMGLKQEDYWWYLELRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G V HAG+GLGFER + + TG+ NIRD IP+PRTP
Sbjct  424   GGVKHAGYGLGFERAIMYLTGMTNIRDVIPYPRTP  458



>ref|WP_013388444.1| asparaginyl-tRNA synthetase [Ilyobacter polytropus]
 ref|YP_003968130.1| asparaginyl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
 gb|ADO83782.1| asparaginyl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
Length=463

 Score =   514 bits (1323),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 255/457 (56%), Positives = 337/457 (74%), Gaps = 13/457 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             +G+ +V+ GWV+ +R+Q    FIE+NDGS    +Q V   + + ++++    +   +++ 
Sbjct  17    IGKEVVISGWVKKIRSQKKFGFIEINDGSFFKGIQVVFESELDNFEEISK--VSISSTLV  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             I+G +  SQG  Q IE+   ++ +  K+D  FP+Q KR S EFLRT AHLRPRTNTF AV
Sbjct  75    IKGKLVESQGKGQSIEILASEVEIFQKADLDFPLQNKRHSFEFLRTIAHLRPRTNTFSAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+ LA+A HKFFQEN FV+V +PI+T +DCEGAGE F VTTL           ++ +
Sbjct  135   FRVRSVLAYAIHKFFQENDFVYVHTPIITGADCEGAGEMFRVTTL----------DLDNV  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE GS+D ++DFFGK   LTVSGQLN ETY  A  +VYTFGPTFRAENSNTSRH +EF
Sbjct  185   PKTEEGSIDEAKDFFGKETNLTVSGQLNVETYCAAFRNVYTFGPTFRAENSNTSRHASEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AF DL  +M  A A ++YV++Y++D C E+MEFFN++IEKG+ ++L++V+   
Sbjct  245   WMIEPEVAFGDLGVNMELAEAMVKYVIKYVMDECPEEMEFFNSFIEKGLFEKLNNVLNND  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+AIE+L    KKF+FPV WG DLQSEHERY+ EE F   P+ + DYPKDIKAF
Sbjct  305   FGRVTYTEAIEILENCGKKFDFPVEWGIDLQSEHERYLAEEHFKK-PIFVTDYPKDIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YM+ N+D KTV AMD+L P +GE+IGGSQRE+ L  LEKR++++NLNKE Y +Y DLRRY
Sbjct  364   YMKMNEDDKTVRAMDLLAPGIGEIIGGSQREDDLPLLEKRMEEMNLNKEDYTFYTDLRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             GS PH+GFGLGFER++ + TG+ NIRD IPFPRTP S
Sbjct  424   GSFPHSGFGLGFERMMMYITGMTNIRDVIPFPRTPKS  460



>ref|WP_039312574.1| asparaginyl-tRNA synthetase [Clostridium baratii]
 gb|AIY83326.1| asparagine--tRNA ligase [Clostridium baratii str. Sullivan]
Length=464

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 338/456 (74%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + + + GW+RTLRA ++  FIE+NDGS   N+Q V   +   + ++    I   +S+ 
Sbjct  18    LNKEVSITGWIRTLRASNAFGFIEINDGSFFKNIQVVFDNNLSNFKEISKLPI--SSSLK  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+  +  +KQ  E++  ++++ G SD  +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VVGTLVETPNAKQPFEIQAKEVIIEGMSDSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQ+ GFV+ ++P++T SDCEGAGE F VTT            ++ +
Sbjct  136   FRVRSVAAYAIHKFFQDKGFVYTNTPLLTGSDCEGAGEMFRVTTF----------DLDNV  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P TE G++D+S+DFFGK   LTVSGQLNAET+A A  DVYTFGPTFRAENSNT+RH AEF
Sbjct  186   PMTEEGAIDYSKDFFGKETNLTVSGQLNAETFALAFRDVYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE++FADL DDM  A   L YV++Y++  C E++EFFN +I+KG+++RL+ V   +
Sbjct  246   WMVEPEISFADLNDDMKLAEEMLTYVIKYVMKECPEEIEFFNKFIDKGLVERLNHVANSE  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L    KKFE+PV WG DLQ+EHERY+TEE F   P+ + DYPKDIKAF
Sbjct  306   FAKVTYTEAVEILKACDKKFEYPVEWGIDLQTEHERYLTEEHFKR-PLFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDD KTVAAMD+LVP +GE+IGGSQREERL+ L+KR+ +LNLN+E YWWYL+LR+Y
Sbjct  365   YMRMNDDNKTVAAMDLLVPGIGEIIGGSQREERLDVLKKRMAELNLNEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMTNIRDVIPFPRTTG  460



>ref|WP_016206869.1| asparaginyl-tRNA ligase [Clostridium sartagoforme]
 gb|EOR26667.1| asparaginyl-tRNA ligase [Clostridium sartagoforme AAU1]
Length=464

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 259/456 (57%), Positives = 337/456 (74%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + + + GW+RTLRA ++  FIEVNDGS   N+Q V S +   + ++    +   +S+ 
Sbjct  18    LSKEIKISGWIRTLRASNAFGFIEVNDGSFFKNIQVVFSNELSNFTEISK--LPISSSIS  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+ ++  +KQ  E++  ++++ G S+  +P+QKKR S E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVATPEAKQPFEIQAKEVIVEGMSNSDYPLQKKRHSYEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  AFA HKFFQE GFV+  +P++T SD EGAGE F VTTL           ++ +
Sbjct  136   FRVRSVAAFAIHKFFQERGFVYTHTPLITGSDAEGAGEMFKVTTL----------DLHNV  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G++D+SQDFFGK + LTVSGQLN E YA A  ++YTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEEGTIDFSQDFFGKESNLTVSGQLNGECYALAFRNIYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADL+DDM  A   L+YV++Y+L  C E+M FFN +++KGI+ RL+ V+   
Sbjct  246   WMIEPEIAFADLQDDMELAEDMLKYVLEYVLAECPEEMAFFNQFVDKGILDRLTHVMTSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L K  KKFE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIKAF
Sbjct  306   FGKVTYTEAVEILKKANKKFEYPVEWGIDLQTEHERYLTEEHF-KRPVFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAA D+LVP +GELIGGSQREERL+ L KR+ +L L +E YWWYL+LR+Y
Sbjct  365   YMRLNDDGKTVAATDLLVPGIGELIGGSQREERLDILTKRMAELGLKEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMPNIRDVIPFPRTTG  460



>ref|WP_034103977.1| asparaginyl-tRNA synthetase [Desulfotomaculum sp. BIC-A1/1_c6]
Length=463

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 262/455 (58%), Positives = 338/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             LG+ + + GWVRT+R+  +  FIE+NDGS   ++Q V  ++   + +V    +ITG+++ 
Sbjct  17    LGQRIQINGWVRTVRSSKAFGFIEINDGSFFGSVQVVYDENLANFKEVSK--LITGSAIR  74

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + G +  S G+KQ  ELK   + + G S P +P+QKKR + EFLRT AHLRPRTNTF AV
Sbjct  75    VAGELVESPGAKQPFELKADNIEIEGHSAPDYPLQKKRHTFEFLRTIAHLRPRTNTFSAV  134

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+A A+A HKFFQE GFV+V +PI+T SD EGAGE F VTTL            ++ 
Sbjct  135   FRVRSAAAYAIHKFFQERGFVYVHTPIITGSDAEGAGEMFRVTTL----------EFDKT  184

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             P+ E G+VD+++DFFGK   LTVSGQL AE YA A   VYTFGPTFRAENSNT RH AEF
Sbjct  185   PRDEKGAVDFARDFFGKETNLTVSGQLEAENYAMAFGKVYTFGPTFRAENSNTPRHAAEF  244

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFA+L+DDM  A   L+YV+ Y+ +N  E+M+FFN++I+K + +RL +VV+ +
Sbjct  245   WMIEPEMAFAELQDDMDLAEEMLKYVISYVRENTPEEMQFFNSFIDKSLFERLDNVVKSE  304

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
                +TY++AI++L K+ ++FE+PV WG DLQ+EHERYITE+ F   PV + DYPK+IKAF
Sbjct  305   FGHITYSEAIDILKKSGEQFEYPVEWGVDLQTEHERYITEKHF-NKPVFVTDYPKEIKAF  363

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAAMD+L P VGE+IGGSQREERL+ LEKR+D+L LNKE YWWY D+RRY
Sbjct  364   YMRMNDDGKTVAAMDLLAPGVGEIIGGSQREERLDSLEKRMDELALNKEDYWWYFDIRRY  423

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             G   HAGFGLGFERL+ + TG+ NIRD I FPRTP
Sbjct  424   GGTKHAGFGLGFERLIMYLTGMTNIRDVISFPRTP  458



>ref|WP_024125488.1| asparaginyl-tRNA synthetase AsnC [Thermosynechococcus sp. NK55a]
 ref|YP_008900616.1| asparaginyl-tRNA synthetase AsnC [Thermosynechococcus sp. NK55a]
 gb|AHB89103.1| asparaginyl-tRNA synthetase AsnC [Thermosynechococcus sp. NK55a]
Length=462

 Score =   513 bits (1322),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 266/459 (58%), Positives = 329/459 (72%), Gaps = 13/459 (3%)
 Frame = +2

Query  416   RLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASV  595
             ++G+ + V+GWVRT R     TF+ +NDGS L+ +Q V+             L  TGA+ 
Sbjct  13    QVGDRVTVKGWVRTKRELKECTFVNLNDGSTLAGLQVVIPNTLAAATPTIKDLT-TGAAA  71

Query  596   WIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFG  772
                G +  S G  Q IEL   ++ L G +DP ++P+QKKR S EFLRT  HLRPRTNT G
Sbjct  72    EFTGELMRSPGKNQAIELHAQEIHLWGSADPETYPLQKKRHSFEFLRTIGHLRPRTNTLG  131

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             AV RVRNA A A H+FFQE GF+WV +PI+TASDCEGAGE F VTTL           + 
Sbjct  132   AVMRVRNACATAIHQFFQERGFLWVHTPIITASDCEGAGELFTVTTL----------DLT  181

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
             + PKT  G +D+SQDFFG+ A+LTVSGQL AE  ATA  +VYTFGPTFRAENSNTSRHLA
Sbjct  182   QPPKTPEGKIDFSQDFFGRRAYLTVSGQLEAEIMATAFTNVYTFGPTFRAENSNTSRHLA  241

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWM+EPE+AF DL  DM  A A+LQ++ +Y+LD+C EDM FF   I+  +I     +  
Sbjct  242   EFWMVEPEMAFCDLRGDMELAEAFLQFIFRYVLDHCPEDMAFFQERIDNSVIATAEQMAT  301

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
             +   +L+Y++AI++L K+ + FEFPV WG DLQSEHERY+ EE +   PVI+ DYP  IK
Sbjct  302   QPFARLSYSEAIQVLEKSGRAFEFPVAWGLDLQSEHERYLAEE-YCRRPVIVYDYPAAIK  360

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDDGKTVAAMD+L P++GE+IGGSQREER + L++R+    L+   YWWYLDLR
Sbjct  361   AFYMRLNDDGKTVAAMDVLAPKIGEIIGGSQREERFDVLQERIVTQGLDPAPYWWYLDLR  420

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             RYGSVPHAGFGLGFERLVQF TG+DNIRD IPFPRTPG+
Sbjct  421   RYGSVPHAGFGLGFERLVQFMTGMDNIRDVIPFPRTPGN  459



>ref|WP_015225265.1| asparaginyl-tRNA synthetase [Halothece sp. PCC 7418]
 ref|YP_007167602.1| asparaginyl-tRNA synthetase [Halothece sp. PCC 7418]
 gb|AFZ43388.1| asparaginyl-tRNA synthetase [Halothece sp. PCC 7418]
Length=462

 Score =   513 bits (1322),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 336/454 (74%), Gaps = 14/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             ET+ ++GWVRT R      FIEVNDGS L+N+Q ++    E Y+Q+ + L  TGASV I+
Sbjct  17    ETVTIQGWVRTKRESKKFAFIEVNDGSALANLQVILEPTLENYEQILSQLN-TGASVEIK  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +A S G  Q+IEL+   + + G++DP ++P+QKKR S EFLR+  H+R RTNT GAV 
Sbjct  76    GGLAESPGKGQRIELQADAVTVYGEADPETYPLQKKRHSFEFLRSLGHIRTRTNTLGAVM  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRN  A A H+FFQ+ GF+WV +PI+T +DCEGAGE F VT+L           +N +P
Sbjct  136   RVRNTCANAVHQFFQQQGFLWVHTPIITTNDCEGAGELFNVTSL----------DLNHVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             K E+G VD++QDFFG+ A+LTVSGQL AE  A   + VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   K-ENGKVDYNQDFFGRRAYLTVSGQLEAEAMALTFDRVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AF DL+ DM  A+A+L+++ Q +LD C EDMEFFN  I+  ++     ++ +  
Sbjct  245   MIEPEMAFCDLQGDMDLASAFLKHIFQAVLDQCPEDMEFFNKRIDDSVLATAEHIINEGF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT AI LL K +KKFE+PV WG DLQSEHERY+ EE F   PVI+ DYP  IKAFY
Sbjct  305   ERITYTSAIALLEKAEKKFEYPVEWGVDLQSEHERYLCEEYFQK-PVIVTDYPSSIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTV+AMD+LVP++GE+IGGSQREER + LEKR+ +  +  E  WWYLDLRR+G
Sbjct  364   MRLNDDQKTVSAMDVLVPKIGEIIGGSQREERFDVLEKRIKEAGMEPEQLWWYLDLRRFG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  424   TVPHAGFGLGFERLVQFMTGMKNIRDVIPFPRTP  457



>ref|WP_022490246.1| asparagine--tRNA ligase [Clostridium sp. CAG:567]
 emb|CDE96552.1| asparagine--tRNA ligase [Clostridium sp. CAG:567]
Length=464

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 330/454 (73%), Gaps = 13/454 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+T+ V GWVRT+R   S  FIE+NDGS   N+Q V       +D V+   +   +S+ +
Sbjct  19    GQTVTVSGWVRTIRDSKSFGFIELNDGSFFKNVQVVFDTGLNNFDDVKK--LSISSSIVV  76

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
              G +  ++ +KQ  E+K   + ++  +D  +P+QKK+ S E+LRT +HLRPRTNTF AV 
Sbjct  77    TGEVVKTENAKQPFEIKASNVEVLNVADLDYPLQKKKHSFEYLRTVSHLRPRTNTFNAVF  136

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVR+ L+FA HKFFQE GFV+V +PI+T SDCEGAGE F VTTL           + ++P
Sbjct  137   RVRSVLSFAIHKFFQERGFVYVHTPIITGSDCEGAGEMFGVTTL----------DMEKLP  186

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             KTE G VD+SQDFFGK + LTVSGQL+ ETYA A  +VYTFGPTFRAENSNT +H AEFW
Sbjct  187   KTEDGKVDYSQDFFGKESHLTVSGQLDVETYAHAFRNVYTFGPTFRAENSNTVKHAAEFW  246

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+ FADL DDM  A   ++Y++ Y+L+N  E+M FFN +I+ G++ RL +V+  + 
Sbjct  247   MIEPEICFADLHDDMDLAEDMIKYIISYVLENAPEEMAFFNQFIDTGLLDRLHNVLNSEF  306

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYTDAI+ L K    FE+PV+WG D+Q+EHERY++E+ FG  PV + DYPK+IKAFY
Sbjct  307   GRITYTDAIKELEKNNDNFEYPVSWGVDIQTEHERYLSEKIFGR-PVFVTDYPKEIKAFY  365

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ N DGKTVAA D+LVP +GE+IGGSQRE+  E L  R+++L L KE YWWYLDLRRYG
Sbjct  366   MKLNPDGKTVAATDLLVPGIGEIIGGSQREDDFEKLSARINELGLRKEDYWWYLDLRRYG  425

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
               PHAGFGLGFER++ + TG+ NIRD +PFPRTP
Sbjct  426   GCPHAGFGLGFERMMMYLTGMQNIRDVLPFPRTP  459



>ref|WP_027843410.1| asparaginyl-tRNA synthetase [Mastigocoleus testarum]
Length=463

 Score =   513 bits (1321),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 333/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             E L   GWVRT R      FIEVNDGS L+ +Q V+ ++   Y+ V   L  TGASV + 
Sbjct  17    EKLTACGWVRTKRELKGFAFIEVNDGSSLAGLQVVLDENTLDYEAVLKKLN-TGASVEVT  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  SQG  Q+IELK   + + G++DP ++P+QKKR S EFLRT  HLR RTN+ GAV 
Sbjct  76    GVLVPSQGKGQRIELKAQTIKVYGEADPETYPLQKKRHSFEFLRTIGHLRNRTNSLGAVL  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQE  F+WV +PI+TASDCEGAGE F VT L           +  +P
Sbjct  136   RVRNACATAIHQFFQEREFLWVHTPIITASDCEGAGELFNVTNL----------DLKNVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
              T+   VD+S+DFF KP +LTVSGQL AE  A + ++VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   LTDKKEVDYSKDFFAKPTYLTVSGQLEAEVMAMSFSNVYTFGPTFRAENSNTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DL  DM  A  +L+Y+ QY+L +C EDMEFFN  I+K +++  +++++ K 
Sbjct  246   MVEPEMAFCDLNGDMDLAEEFLKYIFQYVLKHCSEDMEFFNLRIDKTVLETANNIIDNKF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT+AI+LL K K KFE+PV+WG DLQSEHERY+ E+ F   P I+ DYP +IKAFY
Sbjct  306   ERVTYTEAIKLLEKAKVKFEYPVSWGLDLQSEHERYLCEKLFKK-PTIVTDYPTEIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTVAAMD+L P++GE+IGGSQREERL+ LE+R+    L  E  WWY+DLRRYG
Sbjct  365   MRLNDDEKTVAAMDILAPKIGEIIGGSQREERLDVLERRVKAQGLEPEDLWWYMDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPRTP S
Sbjct  425   TVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTPQS  460



>gb|AIE74372.1| Asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6714]
Length=462

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 268/454 (59%), Positives = 337/454 (74%), Gaps = 14/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + ++V+GW+RT R     +F+EVNDGS L+N+Q V+++    YD++   L  TGA+V I+
Sbjct  17    DQVMVQGWLRTKRTLKDFSFVEVNDGSSLANLQVVLARSLPDYDRLLTQLQ-TGAAVAIE  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  S G  Q++EL   KL L+G +DPS +P+QKKR S EFLRT  HLRPRTNT GAV 
Sbjct  76    GKLTPSPGKGQRVELNACKLELLGGADPSSYPLQKKRHSFEFLRTIGHLRPRTNTIGAVM  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQE GF+WV +PI+TASDCEGAG+ F VTTL           + ++P
Sbjct  136   RVRNACATAIHQFFQERGFLWVHTPIITASDCEGAGDLFNVTTL----------DLQKVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             K   G +D+SQDFFGK A+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   KNGEG-IDYSQDFFGKQAYLTVSGQLEAEVMALAFQNVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DLE D   A  +L+Y+ +++L+ C EDMEFF+  I+  ++    +++  + 
Sbjct  245   MVEPEMAFCDLEGDRQWAEEFLKYIFKFVLEKCPEDMEFFDQRIDNTVLATADNIINNEF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
               LTYT+AI+LL K  +KFE+PV WG DLQSEHERY+ E  F   P I+ DYPKDIKAFY
Sbjct  305   AWLTYTEAIQLLEKADQKFEYPVTWGVDLQSEHERYLAETVFKR-PTIVTDYPKDIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDDGKTVAAMD+L P++GE+IGGSQREERL+ L +RL +  + +   WWYLDLRRYG
Sbjct  364   MRLNDDGKTVAAMDILAPKIGEIIGGSQREERLDVLTQRLQEQGIPESDLWWYLDLRRYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             SVPHAGFGLGFER+VQF TG+ NIRD IPFPRTP
Sbjct  424   SVPHAGFGLGFERIVQFMTGMANIRDVIPFPRTP  457



>ref|WP_032116919.1| asparaginyl-tRNA synthetase [Clostridium sp. CL-2]
Length=464

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/456 (56%), Positives = 334/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + +V+ GW+RTLRA ++  FIEVNDGS   N+Q V   + E +  V    +   +S+ 
Sbjct  18    LSKDIVISGWIRTLRASNAFGFIEVNDGSFFKNVQVVFDNNLENFKDVSK--LPISSSIK  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+ ++  +KQ  E++  ++V+ G S   +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVATPDAKQPFEIQAKEIVIEGMSSSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQ+ GFV+ ++PI+T SDCEGAGE F VTTL           ++  
Sbjct  136   FRVRSVAAYAIHKFFQDQGFVYTNTPILTGSDCEGAGEMFRVTTL----------DLHNT  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G++D+ +DFFGK   LTVSGQLNAE YA A  +VYTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEEGNIDYKEDFFGKETNLTVSGQLNAECYALAFRNVYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AFADL+DDM  A   L+YV++Y++D C E+M FFN +IEKG++ +L+ +V   
Sbjct  246   WMVEPEIAFADLQDDMELAEGMLKYVIKYVMDECPEEMAFFNQFIEKGLLDKLNHIVTSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+E+L    K FE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIKAF
Sbjct  306   FGKVTYTEAVEMLKNCGKTFEYPVEWGIDLQTEHERYLTEEIFKK-PVFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAA D LVP +GE+IGGSQREERL+ L+ R+ +L L +E YWWYL+LR+Y
Sbjct  365   YMRLNDDGKTVAATDCLVPGIGEIIGGSQREERLDVLKARMAELELKEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMSNIRDVIPFPRTTG  460



>ref|WP_003430261.1| asparagine--tRNA ligase [Clostridium butyricum]
 gb|EMU53009.1| asparagine--tRNA ligase [Clostridium butyricum DKU-01]
Length=464

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 342/459 (75%), Gaps = 13/459 (3%)
 Frame = +2

Query  413   DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGAS  592
             D L + + + GW+RTLRA ++  FIE+NDGS   N+Q V  +  + + ++    I   +S
Sbjct  16    DFLSKDVTISGWIRTLRASNAFGFIEINDGSFFKNIQIVFDEKLDNFKEISKLPI--SSS  73

Query  593   VWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFG  772
             + I GT+ ++  +KQ  E++  ++++ G S+  +P+QKKR + E+LR+ AHLRPR+N F 
Sbjct  74    LTITGTLVATPDAKQPFEVQAKEIIIEGMSNSDYPLQKKRHTFEYLRSIAHLRPRSNAFS  133

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             A  RVR+  A+A HKFFQE  FV+  +PI+T SDCEGAGE F VTTL P + E       
Sbjct  134   ATFRVRSVAAYAIHKFFQEQNFVYTHTPIITGSDCEGAGEMFRVTTLDPKTPE-------  186

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
                 T+ G+VD+++DFFGK   LTVSGQLNAE +A A  ++YTFGPTFRAENSNT+RH A
Sbjct  187   ---LTKEGNVDYTKDFFGKETNLTVSGQLNAECFALAFRNIYTFGPTFRAENSNTTRHAA  243

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AFADL+DDM  A A L+YV+QY++D C E+M+FFN++++KG+++RL+ VV 
Sbjct  244   EFWMIEPEIAFADLQDDMELAEAMLKYVIQYVIDECPEEMQFFNSFVDKGLLERLNHVVS  303

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
                 ++TYT+A+E+L K  K+F++PV+WG DLQ+EHERY+TEE F   P+ + DYPKDIK
Sbjct  304   SDFARVTYTEAVEILEKCGKEFDYPVSWGIDLQTEHERYLTEEHFKK-PLFVTDYPKDIK  362

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDD KTVAA D+LVP +GE+IGGSQREERL+ LE R+ +L L KE YWWYL+LR
Sbjct  363   AFYMRMNDDNKTVAATDLLVPGIGEIIGGSQREERLDVLETRMAELGLAKEDYWWYLELR  422

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +YG   HAGFGLGFERL+ + TG+ NIRD IPFPRTPG+
Sbjct  423   KYGETKHAGFGLGFERLIMYITGMTNIRDVIPFPRTPGT  461



>ref|WP_014271840.1| asparaginyl-tRNA synthetase [Sphaerochaeta pleomorpha]
 ref|YP_005064011.1| asparaginyl-tRNA synthetase [Sphaerochaeta pleomorpha str. Grapes]
 gb|AEV31001.1| asparaginyl-tRNA synthetase [Sphaerochaeta pleomorpha str. Grapes]
Length=462

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/454 (56%), Positives = 336/454 (74%), Gaps = 13/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             E +   GWVRT R   +V F+E+NDGSCL  +Q V+ + +   D + +  I TG+SV  +
Sbjct  16    EIITAEGWVRTKRDSKTVCFLELNDGSCLKGLQVVIDKVSLNNDALLSS-ITTGSSVTCR  74

Query  605   GTIASSQGSKQKIElkvvklvlvgkSD-PSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G I  S G  Q++E+    + L+G+    ++P+QKKR S E+LR  +HLRPRTN FGAVA
Sbjct  75    GPIVESAGGNQEVEMASTDVTLIGECPVDTYPLQKKRHSVEYLREISHLRPRTNMFGAVA  134

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRN L+FA H++FQENGFV+V++P+++ASDCEGAGE F VTTL            +++P
Sbjct  135   RVRNTLSFAVHQYFQENGFVYVNTPLISASDCEGAGEMFQVTTL----------DFDKVP  184

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +TE G VD+S+DFFGK +FLTVSGQL  ETYATAL ++YTFGPTFRAENSNT RHLAEFW
Sbjct  185   RTEEGQVDYSKDFFGKKSFLTVSGQLEGETYATALKNIYTFGPTFRAENSNTKRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF D+  DM  A ++L+Y+ + +L+ C EDM FF+ ++E G+ K L  VV+   
Sbjct  245   MVEPEMAFCDVTGDMEIAESFLKYLFKSVLEKCPEDMAFFSKFVEAGVDKTLQHVVDTPF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
               LTYT+A+++L K   KF++ V+WG DLQSEHE+++T E     PVI+ DYPK+IKAFY
Sbjct  305   AHLTYTEAVKILEKYNDKFDYSVSWGSDLQSEHEKFLT-EVVCKSPVIVTDYPKEIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ NDDGKTV  MD+LVPR+GE+IGGS+RE  ++ L  R+ +LNLN + YWWYLDLRRYG
Sbjct  364   MKLNDDGKTVRGMDVLVPRLGEIIGGSERESNIDVLTARMKELNLNPQDYWWYLDLRRYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             SVPHAGFGLGFER VQ+ TG+ NIRD IP+PR P
Sbjct  424   SVPHAGFGLGFERAVQYVTGMANIRDVIPYPRAP  457



>ref|WP_003412169.1| asparaginyl-tRNA synthetase [Clostridium butyricum]
 gb|EDT73661.1| asparaginyl-tRNA synthetase [Clostridium butyricum 5521]
 gb|EEP52575.1| asparagine--tRNA ligase [Clostridium butyricum E4 str. BoNT E 
BL5262]
Length=464

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 342/459 (75%), Gaps = 13/459 (3%)
 Frame = +2

Query  413   DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGAS  592
             D L + + + GW+RTLRA ++  FIE+NDGS   N+Q V  +  + + ++    I   +S
Sbjct  16    DFLSKDVTISGWIRTLRASNAFGFIEINDGSFFKNIQIVFDEKLDNFKEISKLPI--SSS  73

Query  593   VWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFG  772
             + I GT+ ++  +KQ  E++  ++++ G S+  +P+QKKR + E+LR+ AHLRPR+N F 
Sbjct  74    LTITGTLVATPDAKQPFEVQAKEIIIEGMSNSDYPLQKKRHTFEYLRSIAHLRPRSNAFS  133

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             A  RVR+  A+A HKFFQE  FV+  +PI+T SDCEGAGE F VTTL P + E       
Sbjct  134   ATFRVRSVAAYAIHKFFQEQNFVYTHTPIITGSDCEGAGEMFRVTTLDPKTPE-------  186

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
                 T+ G+VD+++DFFGK   LTVSGQLNAE +A A  ++YTFGPTFRAENSNT+RH A
Sbjct  187   ---LTKEGNVDYTKDFFGKETNLTVSGQLNAECFALAFRNIYTFGPTFRAENSNTTRHAA  243

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AFADL+DDM  A A L+YV+QY++D C E+M+FFN++++KG+++RL+ VV 
Sbjct  244   EFWMIEPEIAFADLQDDMELAEAMLKYVIQYVIDECPEEMQFFNSFVDKGLLERLNHVVS  303

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
                 ++TYT+A+E+L K  K+F++PV+WG DLQ+EHERY+TEE F   P+ + DYPKDIK
Sbjct  304   SDFARVTYTEAVEILEKCGKEFDYPVSWGIDLQTEHERYLTEEHFKK-PLFVTDYPKDIK  362

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDD KTVAA D+LVP +GE+IGGSQREERL+ LE R+ +L L KE YWWYL+LR
Sbjct  363   AFYMRMNDDNKTVAATDLLVPGIGEIIGGSQREERLDVLEARMAELGLAKEDYWWYLELR  422

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +YG   HAGFGLGFERL+ + TG+ NIRD IPFPRTPG+
Sbjct  423   KYGETKHAGFGLGFERLIMYITGMTNIRDVIPFPRTPGT  461



>ref|WP_015125670.1| asparaginyl-tRNA synthetase [Synechococcus sp. PCC 6312]
 ref|YP_007062671.1| asparaginyl-tRNA synthetase [Synechococcus sp. PCC 6312]
 gb|AFY62128.1| asparaginyl-tRNA synthetase [Synechococcus sp. PCC 6312]
Length=467

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 261/457 (57%), Positives = 337/457 (74%), Gaps = 13/457 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + V GWVRT R      F+EVNDGS LS +Q V++     Y+ +    + TGA+V  
Sbjct  20    GDAVCVEGWVRTKRELKDFAFLEVNDGSSLSGLQVVLTPTLPNYEALIKQ-VNTGAAVSC  78

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPS-FPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             +G + +SQG  Q+IEL+   L L G++DP+ +P+QKKR S EFLRT  HLR RTNT GA+
Sbjct  79    EGVLVASQGKNQRIELQAQALTLWGEADPTTYPLQKKRHSFEFLRTLGHLRGRTNTLGAM  138

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVRNA A A H+FFQ  GF+WV +PI+TASDCEGAGE F VT+L           +  +
Sbjct  139   FRVRNACATAIHQFFQARGFLWVHTPIITASDCEGAGEMFAVTSL----------NLQNL  188

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PK  SG++D+SQDFF +PA+LTVSGQL AE  A A ++VYTFGPTFRAENSNTSRHLAEF
Sbjct  189   PKLPSGNIDFSQDFFERPAYLTVSGQLEAEIMAMAFSNVYTFGPTFRAENSNTSRHLAEF  248

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WM+EPE+AF DL+ DM  A  +L+++ +Y+LD+C EDM+FF   I+K +++    ++  +
Sbjct  249   WMVEPEMAFCDLDGDMDLAEDFLKFIFRYVLDHCPEDMQFFQDRIDKTVLETADQIINNE  308

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+ LL K  + FEFPV WG DLQSEHERY+ E+ F   PVI+ DYP  IKAF
Sbjct  309   FARITYTEAVALLEKCGRVFEFPVEWGLDLQSEHERYLAEDYFKK-PVIVTDYPAKIKAF  367

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR ++DG+TV AMD+L P++GE+IGGSQREERL+ L +R+    L+ ++YWWYLDLRRY
Sbjct  368   YMRLSEDGQTVRAMDILAPKIGEIIGGSQREERLDILTQRIQAQGLDPQTYWWYLDLRRY  427

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             G+VPHAGFGLGFERLVQF TG+DNIRD IPFPR PGS
Sbjct  428   GTVPHAGFGLGFERLVQFMTGMDNIRDVIPFPRFPGS  464



>ref|WP_027309089.1| asparaginyl-tRNA synthetase [Caloramator sp. ALD01]
Length=463

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 257/473 (54%), Positives = 347/473 (73%), Gaps = 13/473 (3%)
 Frame = +2

Query  371   LRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEG  550
             ++  ++K    E    L + + V GWVRT+R+  +  FIE+NDG+   N+Q V  +  E 
Sbjct  1     MQTVEVKQLYRESEKYLNQDVRVSGWVRTVRSSKAFGFIELNDGTFFKNLQIVFDEKLEN  60

Query  551   YDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFL  730
             + +VE   +   +S+ ++G +  + G+KQ  E++  K+++ G S   +P+QKKR + E+L
Sbjct  61    FKEVEK--LPISSSITVEGKLVETPGAKQPFEVQATKIIIEGMSSSDYPLQKKRHTFEYL  118

Query  731   RTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTT  910
             RT AHLRPR+NTF AV RVR+  AFA HKFFQE GFV+V++PI+T SDCEGAGE F VTT
Sbjct  119   RTIAHLRPRSNTFSAVFRVRSVAAFAIHKFFQERGFVYVNTPIITGSDCEGAGEMFRVTT  178

Query  911   LIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGP  1090
             L           +N IP+ E GS+D+S+DFFG+ A LTVSGQL AE +A A   VYTFGP
Sbjct  179   L----------DLNNIPRKEDGSIDFSEDFFGREANLTVSGQLEAEIFALAYKKVYTFGP  228

Query  1091  TFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTW  1270
             TFRAENSNT+RH +EFWMIEPE+AFADL D M  A   ++Y++ Y+L+N  E+MEFFN +
Sbjct  229   TFRAENSNTARHASEFWMIEPEMAFADLNDYMDTAEDMVKYIISYVLENAPEEMEFFNNF  288

Query  1271  IEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFG  1450
             I+  ++ RL++V+  +  ++TYT+AI+LL K+ K+F++PV WGCDLQ+EHERYITEE F 
Sbjct  289   IDNTLLDRLNNVLNSEFARITYTEAIDLLKKSGKEFQYPVEWGCDLQTEHERYITEEIFK  348

Query  1451  GCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddl  1630
               PV + +YPKDIKAFYMR NDDGKTVAA D+LVP VGE+IGGSQREER + L +R+++L
Sbjct  349   K-PVFVTNYPKDIKAFYMRLNDDGKTVAAADLLVPGVGEIIGGSQREERYDVLVRRIEEL  407

Query  1631  NLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
              + KE YWWYL+LR+YG   HAG+GLGFER++ + TG+ NIRD IPFPRTPG+
Sbjct  408   GMRKEDYWWYLELRKYGETKHAGYGLGFERMIMYLTGMGNIRDVIPFPRTPGN  460



>ref|WP_017413274.1| asparaginyl-tRNA synthetase [Clostridium tunisiense]
Length=463

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 260/453 (57%), Positives = 334/453 (74%), Gaps = 13/453 (3%)
 Frame = +2

Query  431   LVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQGT  610
             + + GW+RTLR+  +  FIEVNDGS   N+Q V  +  E + +VE   I   +S+ + G 
Sbjct  21    VAISGWIRTLRSSKAFGFIEVNDGSFFKNVQVVFEEALENFKEVEKLSI--SSSITVIGN  78

Query  611   IASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVARVR  790
             +  +  +KQ  E+K  K+V+ G+S   +P+QKKR S E+LRT AHLRPR+N F AV RVR
Sbjct  79    VVLTPEAKQPFEIKATKIVVEGESSSDYPLQKKRHSFEYLRTIAHLRPRSNAFSAVFRVR  138

Query  791   NALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPKTE  970
             +  AFA HKFFQE GFV+  +PI+T SDCEGAGE F VTT+           +N IPK E
Sbjct  139   SLTAFAIHKFFQERGFVYTHTPIITGSDCEGAGEMFKVTTM----------DLNSIPKIE  188

Query  971   SGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWMIE  1150
              G +D+ QDFFGK   LTVSGQL AE YA A  +VYTFGPTFRAENSNT RH AEFWMIE
Sbjct  189   EGKIDYKQDFFGKETNLTVSGQLAAEAYALAFRNVYTFGPTFRAENSNTPRHAAEFWMIE  248

Query  1151  PELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVVQL  1330
             PE++FADL DDM  A   ++Y++ Y+++N  E+MEFFN++++KG+I+RL++V   +  ++
Sbjct  249   PEISFADLNDDMELAEDMVKYIINYVMENAPEEMEFFNSFVDKGLIERLTNVANSEFGKI  308

Query  1331  TYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYMRE  1510
             TYT+A+ELL K  K+F++PV WGCDLQ+EHERYITEE +   PV + DYPKDIKAFYMR 
Sbjct  309   TYTEAVELLKKADKEFQYPVEWGCDLQTEHERYITEEIYKK-PVFVTDYPKDIKAFYMRM  367

Query  1511  NDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGSVP  1690
             NDD KTVAA D+LVP VGELIGGSQREERL+ L KR+++L L+ E YWWYL+LR+YG   
Sbjct  368   NDDNKTVAATDLLVPGVGELIGGSQREERLDLLIKRIEELGLHTEDYWWYLELRKYGGTK  427

Query  1691  HAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             HAGFGLGFER++ + TG+ NIRD IPFPRT G+
Sbjct  428   HAGFGLGFERMIMYLTGMSNIRDVIPFPRTTGT  460



>ref|WP_022211377.1| asparagine--tRNA ligase [Clostridium sp. CAG:265]
 emb|CDB74040.1| asparagine--tRNA ligase [Clostridium sp. CAG:265]
Length=464

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 255/456 (56%), Positives = 334/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  419   LGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVW  598
             L + + + GW+RTLRA ++  FIEVNDGS   N+Q V   +   + ++    +   +S+ 
Sbjct  18    LTKEIAISGWIRTLRASNAFGFIEVNDGSFFKNIQVVFDNNLSNFKEISK--LPISSSIK  75

Query  599   IQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAV  778
             + GT+  +  +KQ  E++  ++V+ G SD  +P+QKKR + E+LRT AHLRPR+N F AV
Sbjct  76    VIGTLVETPEAKQPFEIQAKEVVIEGMSDSDYPLQKKRHTFEYLRTIAHLRPRSNAFSAV  135

Query  779   ARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEI  958
              RVR+  A+A HKFFQ+ GFV+  +PI+T SDCEGAGE F VTTL           +N I
Sbjct  136   FRVRSVAAYAIHKFFQDQGFVYTHTPILTGSDCEGAGEMFKVTTL----------DLNNI  185

Query  959   PKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEF  1138
             PKTE G +D+ +DFFGK   LTVSGQLN E+YA A  ++YTFGPTFRAENSNT+RH AEF
Sbjct  186   PKTEDGKIDYKEDFFGKETNLTVSGQLNGESYALAFRNIYTFGPTFRAENSNTARHAAEF  245

Query  1139  WMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKK  1318
             WMIEPE+AFADL+D++  A   L+YV++Y++D C E+M FFN +IEKG++ +L+ +V   
Sbjct  246   WMIEPEIAFADLDDNIELAENMLKYVIKYVMDECPEEMAFFNQFIEKGLLDKLNHIVTSD  305

Query  1319  VVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAF  1498
               ++TYT+A+ELL    K FE+PV WG DLQ+EHERY+TEE F   PV + DYPKDIKAF
Sbjct  306   FGKVTYTEAVELLKNCGKDFEYPVEWGIDLQTEHERYLTEEIFKK-PVFVTDYPKDIKAF  364

Query  1499  YMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRY  1678
             YMR NDDGKTVAA D LVP +GE+IGGSQREERL+ L+ R+ +L+LN+E YWWYL+LR+Y
Sbjct  365   YMRLNDDGKTVAATDCLVPGIGEIIGGSQREERLDVLKTRMAELDLNEEDYWWYLELRKY  424

Query  1679  GSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
             G   HAGFGLGFERL+ + TG+ NIRD IPFPRT G
Sbjct  425   GETKHAGFGLGFERLIMYITGMSNIRDVIPFPRTTG  460



>ref|WP_002583001.1| asparaginyl-tRNA synthetase [Clostridium butyricum]
 gb|ENZ29613.1| asparaginyl-tRNA synthetase [Clostridium butyricum 60E.3]
Length=464

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 254/459 (55%), Positives = 342/459 (75%), Gaps = 13/459 (3%)
 Frame = +2

Query  413   DRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGAS  592
             D L + + + GW+RTLRA ++  FIE+NDGS   N+Q V  +  + + ++    I   +S
Sbjct  16    DFLSKDVTISGWIRTLRASNAFGFIEINDGSFFKNIQIVFDEKLDNFKEISKLPI--SSS  73

Query  593   VWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFG  772
             + I GT+ ++  +KQ  E++  ++++ G S+  +P+QKKR + E+LR+ AHLRPR+N F 
Sbjct  74    LTITGTLVATPDAKQPFEVQAKEIIIEGMSNSDYPLQKKRHTFEYLRSIAHLRPRSNAFS  133

Query  773   AVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVN  952
             A  RVR+  A+A HKFFQE  FV+  +PI+T SDCEGAGE F VTTL P + E       
Sbjct  134   ATFRVRSIAAYAIHKFFQEQNFVYTHTPIITGSDCEGAGEMFRVTTLDPKTPE-------  186

Query  953   EIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLA  1132
                 T+ G+VD+++DFFGK   LTVSGQLNAE +A A  ++YTFGPTFRAENSNT+RH A
Sbjct  187   ---LTKEGNVDYTKDFFGKETNLTVSGQLNAECFALAFRNIYTFGPTFRAENSNTTRHAA  243

Query  1133  EFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVE  1312
             EFWMIEPE+AFADL+DDM  A A L+YV+QY++D C E+M+FFN++++KG+++RL+ VV 
Sbjct  244   EFWMIEPEIAFADLQDDMELAEAMLKYVIQYVIDECPEEMQFFNSFVDKGLLERLNHVVS  303

Query  1313  KKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIK  1492
                 ++TYT+A+E+L K  K+F++PV+WG DLQ+EHERY+TEE F   P+ + DYPKDIK
Sbjct  304   SDFARVTYTEAVEILEKCGKEFDYPVSWGIDLQTEHERYLTEEHFKK-PLFVTDYPKDIK  362

Query  1493  AFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLR  1672
             AFYMR NDD KTVAA D+LVP +GE+IGGSQREERL+ LE R+ +L L KE YWWYL+LR
Sbjct  363   AFYMRMNDDNKTVAATDLLVPGIGEIIGGSQREERLDVLEARMAELGLAKEDYWWYLELR  422

Query  1673  RYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +YG   HAGFGLGFERL+ + TG+ NIRD IPFPRTPG+
Sbjct  423   KYGETKHAGFGLGFERLIMYITGMTNIRDVIPFPRTPGT  461



>ref|WP_010874068.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
 ref|NP_442773.2| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
 ref|YP_005384642.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005387811.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005410518.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005652834.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
 sp|P52276.2|SYN_SYNY3 RecName: Full=Asparagine--tRNA ligase; AltName: Full=Asparaginyl-tRNA 
synthetase; Short=AsnRS [Synechocystis sp. PCC 6803 
substr. Kazusa]
 dbj|BAK51629.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
 dbj|BAL30627.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL33796.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36965.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM53558.1| asparaginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
Length=462

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 267/454 (59%), Positives = 338/454 (74%), Gaps = 14/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + ++V+GW+RT R     +F+EVNDGS L+N+Q V+      YD++ + L  TGA++ ++
Sbjct  17    DQVMVQGWLRTKRTLKDFSFVEVNDGSSLANLQVVLDGSLADYDRLLSQLQ-TGAALVVE  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +A S G  Q++ELK  KL L+G +DP S+P+QKKR S EFLRT  HLRPRTNT GAV 
Sbjct  76    GKLAPSPGKGQRVELKATKLELLGGADPGSYPLQKKRHSFEFLRTIGHLRPRTNTIGAVM  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQE GF+WV +PI+TASDCEGAG+ F VTTL           +  +P
Sbjct  136   RVRNACATAIHQFFQERGFLWVHTPIITASDCEGAGDLFKVTTL----------DLQRVP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             K   G +D+SQDFFGK A+LTVSGQL AE  A A  +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   KNGEG-IDYSQDFFGKQAYLTVSGQLEAEVMALAFQNVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DLE D   A  +L+Y+ +++L+ C EDMEFF+  I+  ++    +++  + 
Sbjct  245   MVEPEMAFCDLEGDRQWAEEFLKYIFKFVLEKCPEDMEFFDQRIDNTVLATADNIINNEF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
               LTY++AI+LL K  +KFE+PV WG DLQSEHERY+ E  F   P I+ DYPKDIKAFY
Sbjct  305   AWLTYSEAIKLLEKADQKFEYPVAWGVDLQSEHERYLAETVFKR-PTIVTDYPKDIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDDGKTVAAMD+L P++GE+IGGSQREERL+ L +R+ +  + +E  WWYLDLRRYG
Sbjct  364   MRLNDDGKTVAAMDILAPKIGEIIGGSQREERLDILTQRMQEQGVPEEDLWWYLDLRRYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             SVPHAGFGLGFER+VQF TG+ NIRD IPFPRTP
Sbjct  424   SVPHAGFGLGFERIVQFMTGMANIRDVIPFPRTP  457



>ref|WP_021657518.1| asparagine--tRNA ligase [Clostridiales bacterium oral taxon 876]
 gb|ERI90008.1| asparagine--tRNA ligase [Clostridiales bacterium oral taxon 876 
str. F0540]
Length=463

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 261/456 (57%), Positives = 336/456 (74%), Gaps = 13/456 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + + GW+RT+RA ++  FIE+NDGS   N+Q V   + + Y  V    I   +S+ +
Sbjct  18    GQMVSISGWIRTVRASNAFGFIELNDGSFFKNVQIVFESELDNYKDVSKLPI--SSSITV  75

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             +G I  +  SKQ  E+K  K+++ G S   FP+QKKR S E+LRT AHLRPR+NTF AV 
Sbjct  76    EGIIELTPESKQPFEIKAKKIIIEGLSHSDFPLQKKRHSYEYLRTIAHLRPRSNTFSAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVR+  AFA HKFFQE GFV+V +PI+T SDCEGAGE F VTT+           +N IP
Sbjct  136   RVRSLAAFAIHKFFQERGFVYVHTPIITGSDCEGAGEMFRVTTM----------DLNNIP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             KTE G +D S+DFFGK   LTVSGQLN ET+A A  +VYTFGPTFRAENSNT++H AEFW
Sbjct  186   KTEDGKIDTSKDFFGKETNLTVSGQLNVETFALAFRNVYTFGPTFRAENSNTTKHAAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AFADL+DDM  A   ++Y++ Y+++N  E+MEFFN +I+  +  RL++VV    
Sbjct  246   MIEPEMAFADLKDDMEVAEDMVKYIINYVMENAPEEMEFFNKFIDNTLFDRLNNVVSSDF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT+AIE+L K  +KFE+PV WG DLQ+EHERY+TE+ F   PV + DYPKDIKAFY
Sbjct  306   GRITYTEAIEILEKCGEKFEYPVKWGVDLQTEHERYLTEKHFKK-PVFVTDYPKDIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             M+ NDDGKTVAA D+LVP +GE+IGGSQREERL  LE R+++L L KE YWWYL+LR+YG
Sbjct  365   MKLNDDGKTVAATDLLVPGIGEIIGGSQREERLSVLEARMEELGLKKEDYWWYLELRKYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                H+GFGLGFER++ + TG+ NIRD IPFPRTPG+
Sbjct  425   ETVHSGFGLGFERILMYLTGMANIRDVIPFPRTPGT  460



>ref|WP_015116753.1| asparaginyl-tRNA synthetase [Rivularia sp. PCC 7116]
 ref|YP_007053722.1| asparaginyl-tRNA synthetase [Rivularia sp. PCC 7116]
 gb|AFY53175.1| asparaginyl-tRNA synthetase [Rivularia sp. PCC 7116]
Length=463

 Score =   511 bits (1317),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 262/454 (58%), Positives = 330/454 (73%), Gaps = 13/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             E++ V+GWVRT R      FIEVNDGS L+++Q V+ QD   Y+ +   L  TGASV   
Sbjct  17    ESVKVQGWVRTKRELKGFAFIEVNDGSSLASLQVVLDQDLPEYENILKQLN-TGASVEAS  75

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  SQG  Q+IELK   L + G++DP ++P+QKKR S EFLRT  HLR RTN+ GAV 
Sbjct  76    GVLVESQGKGQRIELKAEMLKVYGEADPETYPLQKKRHSFEFLRTIGHLRSRTNSLGAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H FFQ+ GF+WV +PI+TASDCEGAGE F VT L           +  IP
Sbjct  136   RVRNACAAAIHDFFQQRGFLWVHTPIITASDCEGAGELFSVTNL----------DLKNIP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +TE   VD+SQDFFG+P +LTVSGQL AE  A    +VYTFGPTFRAENSNTSRHLAEFW
Sbjct  186   QTEDKKVDYSQDFFGRPTYLTVSGQLEAEIMAMTFGNVYTFGPTFRAENSNTSRHLAEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF  L +DM  A  +L+YV +Y++D C EDM+FFN  ++K +++   +++  + 
Sbjct  246   MVEPEMAFCQLSEDMDLAEEFLRYVFKYVMDKCPEDMDFFNLRVDKTVLETAENIINNQF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT+A++LL K   KFE+PV+WG DLQSEHERY+ E+ F   PVI+ DYP +IKAFY
Sbjct  306   ERITYTEAVKLLEKADTKFEYPVSWGLDLQSEHERYLCEKLFKK-PVIVSDYPTEIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR +DD KTVAAMD+L P++GE+IGGSQREER + LE R+    +  E  WWY+DLRRYG
Sbjct  365   MRLSDDEKTVAAMDVLAPKIGEIIGGSQREERYDVLENRIKAQGMKPEDLWWYMDLRRYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTP  1783
             +V HAGFGLGFERLVQF TG+ NIRD IPFPRTP
Sbjct  425   TVAHAGFGLGFERLVQFMTGMANIRDVIPFPRTP  458



>ref|WP_008794728.1| asparaginyl-tRNA synthetase [Fusobacterium periodonticum]
 gb|KGE61715.1| asparaginyl-tRNA synthetase [Fusobacterium periodonticum 2_1_31]
Length=462

 Score =   511 bits (1317),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 339/461 (74%), Gaps = 13/461 (3%)
 Frame = +2

Query  407   GLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITG  586
             G + L + + + GWVR +R Q    FIE+NDGS    +Q V  +  E +D+V    +   
Sbjct  12    GEEYLNKEIELFGWVRKIRDQKKFGFIELNDGSFFKGVQIVFEEGLENFDEVSR--LSIA  69

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             +++ ++GT+  S+GS Q +E+K  ++ +  K+D  +P+Q KR + E+LRTKAHLRPRTNT
Sbjct  70    STIKVKGTLVKSEGSGQDLEVKAKEIEVFQKADLEYPLQNKRHTFEYLRTKAHLRPRTNT  129

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             F AV RVR+ LA+A HKFFQEN FV+V +PI+T SD EGAGE F +TT            
Sbjct  130   FSAVFRVRSVLAYAIHKFFQENNFVYVHTPIITGSDAEGAGEMFRITTF----------D  179

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             +N++PK E+G +D+S+DFFGK   LTVSGQLN ETY  A  +VYTFGPTFRAE SNT+RH
Sbjct  180   LNKVPKKENGEIDFSKDFFGKSTNLTVSGQLNVETYCAAFRNVYTFGPTFRAEYSNTARH  239

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
              +EFWMIEPE+AF DL  +M  A A ++Y+++Y++DNC E+MEFFN++IEKG+  +L++V
Sbjct  240   ASEFWMIEPEIAFGDLGANMELAEAMVKYIIKYVMDNCPEEMEFFNSFIEKGLFDKLNNV  299

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             +     ++TYT+AIE+L K+ KKFEFPV WG DLQSEHERY+ EE F   PV + DYPKD
Sbjct  300   LNNDFARVTYTEAIEILEKSGKKFEFPVKWGIDLQSEHERYLAEEYFKK-PVFVTDYPKD  358

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYM+ NDD KTV AMD+L P +GE+IGGSQRE+  + L KR+D+L LNKE Y +YLD
Sbjct  359   IKAFYMKLNDDNKTVRAMDLLAPGIGEIIGGSQREDNYDLLVKRMDELGLNKEDYEFYLD  418

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LRR+GS PH+G+GLGFER++ + TG+ NIRD IPFPRTP +
Sbjct  419   LRRFGSFPHSGYGLGFERMMMYLTGMQNIRDVIPFPRTPNN  459



>ref|WP_015152391.1| asparaginyl-tRNA synthetase [Chroococcidiopsis thermalis]
 ref|YP_007089709.1| asparaginyl-tRNA synthetase [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY85840.1| asparaginyl-tRNA synthetase [Chroococcidiopsis thermalis PCC 
7203]
Length=462

 Score =   511 bits (1317),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 263/456 (58%), Positives = 332/456 (73%), Gaps = 13/456 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             E++ V+GWVRT R      F+EVNDGS L+++Q V+  +   Y+      I TGASV I 
Sbjct  16    ESVTVQGWVRTKRDLKGFAFVEVNDGSSLASLQAVLKAEMPDYEATLKQ-INTGASVEIS  74

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             G +  SQG  Q+IEL+   + + G +DP ++P+QKKR S EFLRT  HLR RTN+ GAV 
Sbjct  75    GVLVPSQGKGQRIELQAETVKVFGDADPETYPLQKKRHSFEFLRTIGHLRSRTNSLGAVF  134

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVRNA A A H+FFQE  F+WV +P++T +DCEGAGE F VT+L           + +IP
Sbjct  135   RVRNACATAIHQFFQERSFLWVHTPVITRNDCEGAGELFTVTSL----------DLKKIP  184

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +TE+G +D+SQDFFG  AFLTVSGQL AE  A A ++VYTFGPTFRAENSNTSRHLAEFW
Sbjct  185   QTENGKIDYSQDFFGGQAFLTVSGQLEAEVMAMAFSNVYTFGPTFRAENSNTSRHLAEFW  244

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AF DL  +M  A A+L+++ +Y+L+ C EDM+FFN  I+  ++    +++  + 
Sbjct  245   MVEPEMAFCDLVGNMDLAEAFLKHIFKYVLETCPEDMKFFNQRIDDSVLATADNIINNQF  304

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              ++TYT+AI  L K  K FE+PV WG DLQSEHERY+ EE F   PVI+ DYPK IKAFY
Sbjct  305   ERITYTEAIAQLEKATKTFEYPVEWGLDLQSEHERYLAEELFKK-PVIVTDYPKQIKAFY  363

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTV AMD+L P++GE+IGGSQREERLE LEKR+   ++N +  WWYLDLRRYG
Sbjct  364   MRVNDDDKTVRAMDVLAPKIGEIIGGSQREERLEVLEKRMQAQDINPDDLWWYLDLRRYG  423

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             +VPHAGFGLGFERLVQF TG+ NIRD IPFPR P S
Sbjct  424   TVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAPLS  459



>ref|WP_039221439.1| MULTISPECIES: asparaginyl-tRNA synthetase [Clostridium]
 gb|KEI12903.1| asparaginyl-tRNA synthetase [Clostridium novyi B str. ATCC 27606]
 gb|KEI13500.1| asparaginyl-tRNA synthetase [Clostridium novyi B str. NCTC 9691]
 gb|KEI16356.1| asparaginyl-tRNA synthetase [Clostridium haemolyticum NCTC 9693]
 gb|KGN04681.1| asparaginyl-tRNA synthetase [Clostridium haemolyticum NCTC 8350]
Length=463

 Score =   511 bits (1317),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 338/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + + GWVRTLRA +   FIEVNDGS   N+Q V   + E + ++    I   +S+ +
Sbjct  18    GKEVKISGWVRTLRASNKFGFIEVNDGSFFKNIQVVFGAELENFKEISKYAI--SSSISV  75

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             +G +  ++G+KQ  E+   K+VL GKSD  +P+QKKR + E+LR+ AHLRPR+N F AV 
Sbjct  76    EGEVVITEGAKQPFEIHAKKVVLEGKSDADYPLQKKRHTFEYLRSIAHLRPRSNAFSAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVR+  A+A HKFFQ+ GFV+V +PI+T SDCEGAGE F VTTL           ++ +P
Sbjct  136   RVRSLAAYAIHKFFQDQGFVYVHTPIITGSDCEGAGEMFRVTTL----------DMDNLP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             K E G++D+ +DFFGK + LTVSGQL AE YA A  +VYTFGPTFRAENSNT+RH +EFW
Sbjct  186   KDEQGNIDYKEDFFGKQSNLTVSGQLEAEIYALAFRNVYTFGPTFRAENSNTARHASEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AFA+L+D M  A   ++Y++ Y+ +N  E+MEFFN +I+KG+++RL +VV    
Sbjct  246   MIEPEMAFAELKDYMDVAEEMVKYIINYVRENAPEEMEFFNKFIDKGLLERLDNVVNSNF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +++YT+A+E+L K+  KFE+PV WG DLQ+EHERY+TEE +   PV + DYPKDIKAFY
Sbjct  306   ARISYTEAVEMLQKSGAKFEYPVQWGIDLQTEHERYLTEEIYKK-PVFVTDYPKDIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTVAA D+LVP +GE+IGGSQREERL+ LE R+ +L LNKE YWWYL+LR+YG
Sbjct  365   MRMNDDNKTVAAADLLVPGIGEIIGGSQREERLDLLEARMAELGLNKEDYWWYLELRKYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
                HAG+GLGFER++ + TG+ NIRD +PFPRTPG
Sbjct  425   ETKHAGYGLGFERMIMYLTGMSNIRDVLPFPRTPG  459



>ref|WP_039714962.1| asparaginyl-tRNA synthetase [Scytonema millei]
 gb|KIF17399.1| asparaginyl-tRNA synthetase [Scytonema millei VB511283]
Length=462

 Score =   511 bits (1316),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 340/475 (72%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RI +I   G PDE       ++ V+GWVRT R      F+EVNDGS L+++Q V+  +  
Sbjct  4     RIIEILRNGQPDE-------SVTVQGWVRTKRDLKGFAFVEVNDGSSLASLQAVLKAEMP  56

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+      I TGASV I G +  SQG  Q+IEL+   + + G +DP ++P+QKKR S E
Sbjct  57    DYEATLKQ-INTGASVEISGVLVPSQGKGQRIELQAETVKVFGDADPETYPLQKKRHSFE  115

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTN+ GAV RVRNA A A H+FFQE GF+WV +P++T +DCEGAGE F V
Sbjct  116   FLRTIGHLRSRTNSLGAVFRVRNACATAIHQFFQERGFLWVHTPVITRNDCEGAGELFTV  175

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T+L           + +IP+T++G +D+SQDFFG  AFLTVSGQL AE  A A ++VYTF
Sbjct  176   TSL----------DLKKIPQTDNGKIDYSQDFFGGQAFLTVSGQLEAEVMAMAFSNVYTF  225

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DL  +M  A A+L+++ +Y+L+ C EDM+FFN
Sbjct  226   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLVGNMDLAEAFLKHIFKYVLETCPEDMDFFN  285

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  ++    +++  +  ++TYT+AI  L K  K F++PV WG DLQSEHERY+ EE 
Sbjct  286   QRIDNSVLATADNIINNQFERITYTEAIAQLEKATKTFDYPVEWGLDLQSEHERYLAEEL  345

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   PVI+ DYPK IKAFYMR NDD KTV AMD+L P++GE+IGGSQREERLE LEKR+ 
Sbjct  346   FKK-PVIVTDYPKQIKAFYMRVNDDDKTVRAMDVLAPKIGEIIGGSQREERLEVLEKRMQ  404

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
               ++N +  WWYLDLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR P S
Sbjct  405   AQDINPDDLWWYLDLRRYGTVPHAGFGLGFERLVQFMTGMGNIRDVIPFPRAPLS  459



>ref|WP_035468026.1| asparaginyl-tRNA synthetase [Fusobacterium periodonticum]
Length=461

 Score =   511 bits (1316),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 339/461 (74%), Gaps = 13/461 (3%)
 Frame = +2

Query  407   GLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITG  586
             G + L + + + GWVR +R Q    FIE+NDGS    +Q V  +  E +D+V    +   
Sbjct  11    GEEYLNKEIELFGWVRKIRDQKKFGFIELNDGSFFKGVQIVFEEGLENFDEVSR--LSIA  68

Query  587   ASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNT  766
             +++ ++GT+  S+GS Q +E+K  ++ +  K+D  +P+Q KR + E+LRTKAHLRPRTNT
Sbjct  69    STIKVKGTLVKSEGSGQDLEVKAKEIEVFQKADLEYPLQNKRHTFEYLRTKAHLRPRTNT  128

Query  767   FGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSP  946
             F AV RVR+ LA+A HKFFQEN FV+V +PI+T SD EGAGE F +TT            
Sbjct  129   FSAVFRVRSVLAYAIHKFFQENNFVYVHTPIITGSDAEGAGEMFRITTF----------D  178

Query  947   VNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRH  1126
             +N++PK E+G +D+S+DFFGK   LTVSGQLN ETY  A  +VYTFGPTFRAE SNT+RH
Sbjct  179   LNKVPKKENGEIDFSKDFFGKSTNLTVSGQLNVETYCAAFRNVYTFGPTFRAEYSNTARH  238

Query  1127  LAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDV  1306
              +EFWMIEPE+AF DL  +M  A A ++Y+++Y++DNC E+MEFFN++IEKG+  +L++V
Sbjct  239   ASEFWMIEPEIAFGDLGANMELAEAMVKYIIKYVMDNCPEEMEFFNSFIEKGLFDKLNNV  298

Query  1307  VEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKD  1486
             +     ++TYT+AIE+L K+ KKFEFPV WG DLQSEHERY+ EE F   PV + DYPKD
Sbjct  299   LNNDFARVTYTEAIEILEKSGKKFEFPVKWGIDLQSEHERYLAEEYFKK-PVFVTDYPKD  357

Query  1487  IKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLD  1666
             IKAFYM+ NDD KTV AMD+L P +GE+IGGSQRE+  + L KR+D+L LNKE Y +YLD
Sbjct  358   IKAFYMKLNDDNKTVRAMDLLAPGIGEIIGGSQREDNYDLLVKRMDELGLNKEDYEFYLD  417

Query  1667  LRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             LRR+GS PH+G+GLGFER++ + TG+ NIRD IPFPRTP +
Sbjct  418   LRRFGSFPHSGYGLGFERMMMYLTGMQNIRDVIPFPRTPNN  458



>ref|WP_006001136.1| asparaginyl-tRNA synthetase [Desulfuromonas acetoxidans]
 gb|EAT15217.1| asparaginyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684]
Length=457

 Score =   511 bits (1315),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 258/454 (57%), Positives = 341/454 (75%), Gaps = 14/454 (3%)
 Frame = +2

Query  425   ETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWIQ  604
             + + VRGWVRTLRA   V FIE+NDGSC +++Q V  +  + + ++ +  I TGA +   
Sbjct  14    QNVEVRGWVRTLRASKEVCFIELNDGSCFASLQLVADRTVDNFAELAH--IGTGACIKAS  71

Query  605   GTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVAR  784
             G +  S    Q+ EL V +L ++G +DPS+P+QKKR + E+LR+ AHLRPR+NTFGAV R
Sbjct  72    GNLVDSPAKGQRWELHVSELTVIGNADPSYPLQKKRHTFEYLRSIAHLRPRSNTFGAVFR  131

Query  785   VRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIPK  964
             +RNAL++A H+FFQ+  F++V +PI+TASDCEGAGE F VTTL     +P N P N    
Sbjct  132   LRNALSYAVHQFFQQRDFLYVHTPIITASDCEGAGELFRVTTL-----DPANPPKN----  182

Query  965   TESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFWM  1144
               +G +DW +DFFG    LTVSGQL  E +ATA +D+YTFGPTFRAENSNTSRH +EFWM
Sbjct  183   --NGRIDWQKDFFGARTGLTVSGQLQGELFATAFSDIYTFGPTFRAENSNTSRHASEFWM  240

Query  1145  IEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKVV  1324
             IEPE+AFA+L DD   A  +L+Y+V+Y L++C ED++FFN  IEKG++ +L+ + +    
Sbjct  241   IEPEIAFANLADDCQLAEDFLRYLVKYALEHCAEDLQFFNDRIEKGLLDKLTALADATFS  300

Query  1325  QLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFYM  1504
              +TYT+AIE L  + + FEFPV WG DLQSEHERY+ E+   G P+ + DYPK+IKAFYM
Sbjct  301   TMTYTEAIEQLKNSGQNFEFPVEWGLDLQSEHERYLCEQVVNG-PLFVTDYPKEIKAFYM  359

Query  1505  RENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYGS  1684
             R N+DGKTVAAMD+LVPRVGE+IGGSQREERL+ L  R+++L++  ES  WYLD+RR+GS
Sbjct  360   RANEDGKTVAAMDLLVPRVGEIIGGSQREERLDVLTARMEELDMAPESLDWYLDIRRWGS  419

Query  1685  VPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
              PHAGFGLGFERL+ + +G++NIRD IPFPRTPG
Sbjct  420   CPHAGFGLGFERLIMYLSGMENIRDVIPFPRTPG  453



>ref|WP_011098467.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 ref|NP_780858.1| asparaginyl-tRNA synthetase [Clostridium tetani E88]
 sp|Q899M9.1|SYN_CLOTE RecName: Full=Asparagine--tRNA ligase; AltName: Full=Asparaginyl-tRNA 
synthetase; Short=AsnRS [Clostridium tetani E88]
 gb|AAO34795.1| asparaginyl-tRNA synthetase [Clostridium tetani E88]
 gb|KGI36488.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 gb|KGI38832.1| asparaginyl-tRNA synthetase [Clostridium tetani ATCC 9441]
 gb|KGI42568.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 gb|KGI43476.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 gb|KHO38686.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 gb|KIG19822.1| asparaginyl-tRNA synthetase [Clostridium tetani]
Length=463

 Score =   511 bits (1315),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 351/475 (74%), Gaps = 16/475 (3%)
 Frame = +2

Query  365   RRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             +++ I  +   P++ +++    +VV GW+RT R   +  FIE+NDGS   N+Q ++  + 
Sbjct  2     KKISIKQLYREPEKFINK---DIVVAGWIRTERTSKNFGFIELNDGSFFKNLQIIIDTNL  58

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSRE  724
             + +D+V    I   +S+ ++G + ++  +KQ  E++  K+ + G S   +P+QKKR S E
Sbjct  59    DNFDKVSKLPI--SSSIVVEGKLVATPSAKQPFEVQASKVTVEGTSLQDYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPR+NTF AV R+R+  A+A HKFFQE  FV+V +PI+TASDCEGAGE F V
Sbjct  117   FLRSIAHLRPRSNTFSAVFRIRSLAAYAVHKFFQEKNFVYVHTPIITASDCEGAGEMFRV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL           +N IPK + G +D+SQDFF K A LTVSGQL+AE+YA A  +VYTF
Sbjct  177   TTL----------DLNNIPKNDEGKIDFSQDFFDKDAKLTVSGQLSAESYALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNT+RH +EFWMIEPE+AFADL D M  A   ++Y++ Y+L+N  E+M FFN
Sbjct  227   GPTFRAENSNTARHASEFWMIEPEMAFADLTDYMDVAEEMVKYIINYVLENAPEEMNFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
             ++I+K + KRL +VV  +  ++TYT+A++LL K+ +KF++PV WG DLQ+EHERYITE+ 
Sbjct  287   SFIDKDLFKRLDNVVNSEFKRITYTEAVDLLQKSGEKFQYPVEWGIDLQTEHERYITEKI  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PV + DYPKDIKAFYMR N+D KTVAA D+LVP VGE+IGGSQREERL+ LE+R+ 
Sbjct  347   FGK-PVFVTDYPKDIKAFYMRLNEDNKTVAAADLLVPGVGEIIGGSQREERLDVLEERMK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             + +LN++ YWWYL+LR+YGS  H+GFGLGFER++ + TGI NIRD IPFPRTPGS
Sbjct  406   EFDLNEKDYWWYLELRKYGSAKHSGFGLGFERILMYMTGISNIRDVIPFPRTPGS  460



>ref|WP_015173755.1| asparaginyl-tRNA synthetase [Geitlerinema sp. PCC 7407]
 ref|YP_007111243.1| asparaginyl-tRNA synthetase [Geitlerinema sp. PCC 7407]
 gb|AFY68191.1| asparaginyl-tRNA synthetase [Geitlerinema sp. PCC 7407]
Length=463

 Score =   511 bits (1315),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 270/475 (57%), Positives = 345/475 (73%), Gaps = 22/475 (5%)
 Frame = +2

Query  374   RIADI--KGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAE  547
             RIAD+   G PD+       ++ ++GWVRT R      F+EVNDGS + ++Q VM Q   
Sbjct  5     RIADVLRDGQPDD-------SVTLQGWVRTKRELKDFAFMEVNDGSAMKSVQVVMDQSLP  57

Query  548   GYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDP-SFPIQKKRVSRE  724
              Y+ +   L  TGASV + G +  S G  Q+IE+K   + + G++DP ++P+QKKR S E
Sbjct  58    DYETLVKRLN-TGASVEVTGVLVPSLGKGQRIEVKAASVTVYGEADPETYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLRT  HLR RTNT GAV RVRNA A A H+FFQE GF+WV +P++TASDCEGAGE F V
Sbjct  117   FLRTIGHLRSRTNTLGAVFRVRNACAQAIHEFFQERGFLWVHTPMITASDCEGAGEMFTV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             T L  + ++P        P+ +  ++D+SQDFFG+ AFLTVSGQL AE  A A  +VYTF
Sbjct  177   TAL--DLEKP--------PRNDQNAIDFSQDFFGRRAFLTVSGQLEAEIMAMAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNTSRHLAEFWM+EPE+AF DLE DM  A A+L++V + +L+ C EDMEFFN
Sbjct  227   GPTFRAENSNTSRHLAEFWMVEPEMAFCDLEGDMDLAEAFLKHVFRVVLERCPEDMEFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
               I+  +++    ++  +  +LTYT+AI +L KT ++FE+PV+WG DLQSEHERY+ EE 
Sbjct  287   ERIDNSVLETADKIINSEFGRLTYTEAIAILEKTDRQFEYPVHWGLDLQSEHERYLAEEY  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             F   P+I+ DYP +IKAFYMR +DDGKTV AMD+L P+VGE+IGGSQREERL+ LE+R+ 
Sbjct  347   FKK-PIIVTDYPTEIKAFYMRLSDDGKTVRAMDVLAPKVGEIIGGSQREERLDVLEQRIQ  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                LN + YWWY DLRRYG+VPHAGFGLGFERLVQF TG+ NIRD IPFPR+P S
Sbjct  406   AQGLNLDDYWWYRDLRRYGTVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRSPLS  460



>ref|WP_003375192.1| MULTISPECIES: asparaginyl-tRNA synthetase [Clostridium]
 gb|EES90689.1| asparagine--tRNA ligase [Clostridium botulinum D str. 1873]
 gb|EGO88837.1| asparaginyl-tRNA synthetase [Clostridium botulinum C str. Stockholm]
 gb|KEI09792.1| asparaginyl-tRNA synthetase [Clostridium sp. K25]
Length=463

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 253/455 (56%), Positives = 338/455 (74%), Gaps = 13/455 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+ + + GWVRTLRA +   FIEVNDGS   N+Q V   + E + ++    I   +S+ +
Sbjct  18    GKEVKISGWVRTLRASNKFGFIEVNDGSFFKNIQVVFGAELENFKEISKYAI--SSSISV  75

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             +G +  ++G+KQ  E+   K+VL GKSD  +P+QKKR + E+LR+ AHLRPR+N F AV 
Sbjct  76    EGEVVITEGAKQPFEIHAKKVVLEGKSDADYPLQKKRHTFEYLRSIAHLRPRSNAFSAVF  135

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVR+  A+A HKFFQ+ GFV+V +PI+T SDCEGAGE F VTTL           ++ +P
Sbjct  136   RVRSLAAYAIHKFFQDQGFVYVHTPIITGSDCEGAGEMFRVTTL----------DMDNLP  185

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             K E G++D+ +DFFGK + LTVSGQL AE YA A  +VYTFGPTFRAENSNT+RH +EFW
Sbjct  186   KDEQGNIDYKEDFFGKQSNLTVSGQLEAEIYALAFRNVYTFGPTFRAENSNTARHASEFW  245

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             MIEPE+AFA+L+D M  A   ++Y++ Y+ +N  E+MEFFN +I+KG+++RL +VV    
Sbjct  246   MIEPEMAFAELKDYMDVAEEMVKYIINYVRENAPEEMEFFNKFIDKGLLERLDNVVNSDF  305

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              +++YT+A+E+L K+  +FE+PV WG DLQ+EHERY+TEE +   PV + DYPKDIKAFY
Sbjct  306   ARISYTEAVEMLQKSGAQFEYPVEWGIDLQTEHERYLTEEIYKK-PVFVTDYPKDIKAFY  364

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDD KTVAA D+LVP +GE+IGGSQREERL+ LE R+ +L LNKE YWWYL+LR+YG
Sbjct  365   MRMNDDNKTVAAADLLVPGIGEIIGGSQREERLDLLEARMAELGLNKEDYWWYLELRKYG  424

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPG  1786
                HAG+GLGFER++ + TG+ NIRD +PFPRTPG
Sbjct  425   ETKHAGYGLGFERMIMYLTGMSNIRDVLPFPRTPG  459



>ref|WP_039260465.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 gb|KHO40451.1| asparaginyl-tRNA synthetase [Clostridium tetani]
Length=463

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 259/475 (55%), Positives = 350/475 (74%), Gaps = 16/475 (3%)
 Frame = +2

Query  365   RRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             +++ I  +   P++ +++    +VV GW+RT R   +  FIE+NDGS   N+Q V+  + 
Sbjct  2     KKISIKQLYREPEKFINK---DIVVAGWIRTERTSKNFGFIELNDGSFFKNLQIVIDTNL  58

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSRE  724
             E +++V    I   +S+ ++G +  +  +KQ  E++  K+ + G S   +P+QKKR S E
Sbjct  59    ENFNKVSKLPI--SSSIVVEGKLVETPSAKQPFEVQASKVTIEGTSLQDYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPR+NTF AV R+R+  A+A HKFFQE  FV+V +PI+TASDCEGAGE F V
Sbjct  117   FLRSIAHLRPRSNTFSAVFRIRSLAAYAVHKFFQEKNFVYVHTPIITASDCEGAGEMFRV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL           +N IPK + G +D+SQDFF K A LTVSGQL+AE+YA A  +VYTF
Sbjct  177   TTL----------DLNNIPKNDEGKIDFSQDFFDKDAKLTVSGQLSAESYALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNT+RH +EFWMIEPE+AFADL D M  A   ++Y++ Y+L+N  E+M FFN
Sbjct  227   GPTFRAENSNTARHASEFWMIEPEMAFADLTDYMDVAEEMVKYIINYVLENAPEEMNFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
             ++I+K + KRL +VV  +  ++TYT+A++LL K+ +KF++PV WG DLQ+EHERYITE+ 
Sbjct  287   SFIDKDLFKRLDNVVNSEFKRITYTEAVDLLQKSGEKFQYPVEWGIDLQTEHERYITEKI  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PV + DYPKDIKAFYMR N+D KTVAA D+LVP VGE+IGGSQREERL+ LE+R+ 
Sbjct  347   FGK-PVFVTDYPKDIKAFYMRLNEDNKTVAAADLLVPGVGEIIGGSQREERLDVLEERMK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             + +LN++ YWWYL+LR+YGS  H+GFGLGFER++ + TGI NIRD IPFPRTPGS
Sbjct  406   EFDLNEKDYWWYLELRKYGSAKHSGFGLGFERILMYMTGISNIRDVIPFPRTPGS  460



>ref|WP_023436956.1| asparaginyl-tRNA synthetase [Clostridium tetani]
 ref|YP_008772221.1| asparaginyl-tRNA synthetase [Clostridium tetani 12124569]
 emb|CDI48184.1| asparaginyl-tRNA synthetase [Clostridium tetani 12124569]
Length=463

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 259/475 (55%), Positives = 350/475 (74%), Gaps = 16/475 (3%)
 Frame = +2

Query  365   RRLRIADIKGGPDEGLDRLGETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDA  544
             +++ I  +   P++ +++    +VV GW+RT R   +  FIE+NDGS   N+Q V+  + 
Sbjct  2     KKISIKQLYREPEKFINK---DIVVAGWIRTERTSKNFGFIELNDGSFFKNLQIVIDTNL  58

Query  545   EGYDQVENGLIITGASVWIQGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSRE  724
             E +++V    I   +S+ ++G +  +  +KQ  E++  K+ + G S   +P+QKKR S E
Sbjct  59    ENFNKVSKLPI--SSSIVVEGKLVETPSAKQPFEVQTSKVTIEGTSLQDYPLQKKRHSFE  116

Query  725   FLRTKAHLRPRTNTFGAVARVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCV  904
             FLR+ AHLRPR+NTF AV R+R+  A+A HKFFQE  FV+V +PI+TASDCEGAGE F V
Sbjct  117   FLRSIAHLRPRSNTFSAVFRIRSLAAYAVHKFFQEKNFVYVHTPIITASDCEGAGEMFRV  176

Query  905   TTLIPNSKEPTNSPVNEIPKTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTF  1084
             TTL           +N IPK + G +D+SQDFF K A LTVSGQL+AE+YA A  +VYTF
Sbjct  177   TTL----------DLNNIPKNDEGKIDFSQDFFDKDAKLTVSGQLSAESYALAFGNVYTF  226

Query  1085  GPTFRAENSNTSRHLAEFWMIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFN  1264
             GPTFRAENSNT+RH +EFWMIEPE+AFADL D M  A   ++Y++ Y+L+N  E+M FFN
Sbjct  227   GPTFRAENSNTARHASEFWMIEPEMAFADLTDYMDVAEEMVKYIINYVLENAPEEMNFFN  286

Query  1265  TWIEKGIIKRLSDVVEKKVVQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEA  1444
             ++I+K + KRL +VV  +  ++TYT+A++LL K+ +KF++PV WG DLQ+EHERYITE+ 
Sbjct  287   SFIDKDLFKRLDNVVNSEFKRITYTEAVDLLQKSGEKFQYPVEWGIDLQTEHERYITEKI  346

Query  1445  FGGCPVIIRDYPKDIKAFYMRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrld  1624
             FG  PV + DYPKDIKAFYMR N+D KTVAA D+LVP VGE+IGGSQREERL+ LE+R+ 
Sbjct  347   FGK-PVFVTDYPKDIKAFYMRLNEDNKTVAAADLLVPGVGEIIGGSQREERLDVLEERMK  405

Query  1625  dlNLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
             + +LN++ YWWYL+LR+YGS  H+GFGLGFER++ + TGI NIRD IPFPRTPGS
Sbjct  406   EFDLNEKDYWWYLELRKYGSAKHSGFGLGFERILMYMTGISNIRDVIPFPRTPGS  460



>ref|WP_021659081.1| asparagine--tRNA ligase [Clostridium sp. ATCC 29733]
 gb|ERJ00501.1| asparagine--tRNA ligase [Clostridium sp. ATCC 29733]
Length=464

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 261/456 (57%), Positives = 332/456 (73%), Gaps = 12/456 (3%)
 Frame = +2

Query  422   GETLVVRGWVRTLRAQSSVTFIEVNDGSCLSNMQCVMSQDAEGYDQVENGLIITGASVWI  601
             G+T+ V GW+RTLR+  ++ FIE+NDGSC  N+Q V  QD +  +  E   +  G ++ +
Sbjct  18    GKTVTVCGWIRTLRSSKALGFIELNDGSCFKNLQVVF-QDGQVGNFKEITKLNVGTALSV  76

Query  602   QGTIASSQGSKQKIElkvvklvlvgkSDPSFPIQKKRVSREFLRTKAHLRPRTNTFGAVA  781
             +G +  +  +KQ +E+    + + G S P +P+QKKR S E+LRT AHLRPR NTF A  
Sbjct  77    EGEVVLTPEAKQPLEIHAASISVEGTSSPEYPLQKKRHSMEYLRTIAHLRPRANTFNAAF  136

Query  782   RVRNALAFATHKFFQENGFVWVSSPIVTASDCEGAGEQFCVTTLIPNSKEPTNSPVNEIP  961
             RVR+  AFA H+FF ENGFV+  +PI+T SDCEGAGE F +TTL  +++ P        P
Sbjct  137   RVRSVAAFALHRFFNENGFVYAHTPIITGSDCEGAGEMFHITTL--DAENP--------P  186

Query  962   KTESGSVDWSQDFFGKPAFLTVSGQLNAETYATALNDVYTFGPTFRAENSNTSRHLAEFW  1141
             +TE G VD+S+DFFGK   LTVSGQLNAE+ A A   VYTFGPTFRAENSNT RH AEFW
Sbjct  187   RTEDGQVDYSKDFFGKKTSLTVSGQLNAESMALAFGKVYTFGPTFRAENSNTPRHAAEFW  246

Query  1142  MIEPELAFADLEDDMSCAAAYLQYVVQYILDNCKEDMEFFNTWIEKGIIKRLSDVVEKKV  1321
             M+EPE+AFADL D+M  A A L+Y ++Y+LDNC ++M FFN + +KG+I+RL  V     
Sbjct  247   MLEPEIAFADLNDNMDLAEAMLKYAIRYVLDNCPDEMAFFNNFFDKGLIERLEGVASADF  306

Query  1322  VQLTYTDAIElllktkkkFEFPVNWGCDLQSEHERYITEEAFGGCPVIIRDYPKDIKAFY  1501
              + TYT+AIELL K K +FEFPV WGCDLQ+EHERY+TE+ F   PV + DYPK+IKAFY
Sbjct  307   ARCTYTEAIELLEKNKDQFEFPVFWGCDLQTEHERYLTEKVFQK-PVFVTDYPKEIKAFY  365

Query  1502  MRENDDGKTVAAMDMLVPRVGELIGGSQreerleylekrlddlNLNKESYWWYLDLRRYG  1681
             MR NDDGKTVAA D+LVP +GE+IGGSQREERL+ L  R+ +L L +E Y WYLDLRR+G
Sbjct  366   MRINDDGKTVAACDLLVPGIGEIIGGSQREERLDVLTARMAELGLAEEDYEWYLDLRRFG  425

Query  1682  SVPHAGFGLGFERLVQFATGIDNIRDAIPFPRTPGS  1789
                HAG+GLGFERL+ + TGI NIRD +PFPRT GS
Sbjct  426   GTKHAGYGLGFERLIMYITGIPNIRDVLPFPRTAGS  461



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5203707872428