BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25746_g1_i7 len=1038 path=[8397:0-116 19005:117-136 19025:137-137
19026:138-146 9080:147-155 1797:156-156 19040:157-174 19058:175-191
19075:192-196 1838:197-197 1839:198-203 1845:204-216 9936:217-266
9986:267-292 19140:293-293 19141:294-304 19152:305-308 19156:309-356
1998:357-362 2004:363-387 19220:388-399 2041:400-1032
2674:1033-1037]

Length=1038
                                                                      Score     E

emb|CBI35858.3|  unnamed protein product                                420   7e-141   
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               420   2e-140   Vitis vinifera
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             420   2e-140   
emb|CAA65580.1|  cytochrome P450                                        417   2e-139   Nicotiana tabacum [American tobacco]
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               414   6e-138   
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               407   3e-135   
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               407   4e-135   
ref|XP_009771564.1|  PREDICTED: flavonoid 3'-monooxygenase-like         406   7e-135   
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               402   2e-133   
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               399   3e-132   
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             399   4e-132   
ref|XP_010086796.1|  Cytochrome P450 71A1                               398   7e-132   
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      398   7e-132   Nicotiana tabacum [American tobacco]
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               397   1e-131   
gb|ABC69381.1|  CYP92A2v2                                               397   2e-131   Nicotiana tabacum [American tobacco]
gb|ABC69383.1|  CYP92A2v4                                               397   2e-131   Nicotiana tabacum [American tobacco]
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               397   2e-131   
gb|ABC69382.1|  CYP92A2v2                                               397   2e-131   Nicotiana tabacum [American tobacco]
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               396   4e-131   
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               396   4e-131   
emb|CAN77776.1|  hypothetical protein VITISV_021888                     394   4e-130   Vitis vinifera
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             394   6e-130   
gb|ABG74350.1|  cytochrome P450                                         393   6e-130   Capsicum chinense [bonnet pepper]
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   393   7e-130   
emb|CDP21484.1|  unnamed protein product                                392   1e-129   
emb|CDP21888.1|  unnamed protein product                                390   2e-129   
emb|CAA64635.1|  cytochrome P450                                        390   8e-129   Nicotiana tabacum [American tobacco]
gb|AED99875.1|  cytochrome P450                                         390   1e-128   
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               389   2e-128   
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               389   2e-128   
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               389   3e-128   
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               389   3e-128   
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             388   6e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010685305.1|  PREDICTED: cytochrome P450 71A1-like               388   1e-127   
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               385   8e-127   
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               385   1e-126   
gb|KHG15722.1|  Cytochrome P450                                         384   2e-126   
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               382   2e-125   
gb|ADC34701.1|  flavonoid 3' hydroxylase                                379   2e-124   
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         377   9e-124   
gb|AGT17102.1|  flavonoid 3-monooxygenase                               371   1e-123   
emb|CDP12827.1|  unnamed protein product                                377   1e-123   
ref|XP_010911364.1|  PREDICTED: cytochrome P450 750A1-like              369   5e-123   
gb|ADO16185.1|  cytochrome P450 mono-oxygenase                          375   5e-123   
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               375   9e-123   
emb|CDP17013.1|  unnamed protein product                                374   2e-122   
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         374   2e-122   
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    374   3e-122   
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          373   5e-122   Sorghum bicolor [broomcorn]
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               373   6e-122   
gb|EAZ09259.1|  hypothetical protein OsI_31532                          373   8e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         371   2e-121   
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               372   2e-121   
ref|NP_001063285.1|  Os09g0441400                                       371   2e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               371   3e-121   
emb|CDP17538.1|  unnamed protein product                                364   3e-121   
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          370   5e-121   Sorghum bicolor [broomcorn]
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         370   6e-121   
ref|XP_004148565.1|  PREDICTED: flavonoid 3'-monooxygenase-like         370   7e-121   
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               369   1e-120   
gb|AGT17103.1|  flavonoid 3-monooxygenase                               370   1e-120   
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          369   2e-120   Zea mays [maize]
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               369   2e-120   
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                369   3e-120   
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  368   4e-120   Ricinus communis
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         368   5e-120   
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    367   7e-120   
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    367   9e-120   
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             365   5e-119   
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    365   6e-119   
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               365   2e-118   
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        363   2e-118   
gb|AFK47419.1|  unknown                                                 363   3e-118   
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         363   3e-118   
gb|EMT01785.1|  Flavonoid 3'-monooxygenase                              361   2e-117   
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               361   2e-117   
ref|XP_008792895.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    352   5e-117   
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         359   9e-117   
gb|EMS57898.1|  Flavonoid 3'-monooxygenase                              360   9e-117   
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         360   2e-116   
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             358   2e-116   
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              358   2e-116   
gb|ABA01477.1|  cytochrome P450 DDWF1                                   357   4e-116   Gossypium hirsutum [American cotton]
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               358   6e-116   
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                356   2e-115   
gb|AER39771.1|  CYP92A44-1                                              356   2e-115   
gb|AER39774.1|  CYP92A44-4                                              355   5e-115   
ref|XP_003627307.1|  Flavonoid 3',5'-hydroxylase                        355   7e-115   
gb|AER39773.1|  CYP92A44-3                                              355   8e-115   
gb|KGN58496.1|  hypothetical protein Csa_3G651800                       346   3e-114   
gb|AAG44132.1|AF218296_1  cytochrome P450                               353   3e-114   Pisum sativum [garden pea]
ref|XP_010917480.1|  PREDICTED: cytochrome P450 750A1-like              346   3e-114   
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        352   4e-114   
gb|AET01782.2|  cytochrome P450 family protein                          352   7e-114   
ref|XP_008780588.1|  PREDICTED: cytochrome P450 750A1-like              344   1e-113   
emb|CCP37679.1|  cytochrome P450                                        351   2e-113   
ref|XP_006426678.1|  hypothetical protein CICLE_v10025392mg             350   4e-113   
ref|XP_007012628.1|  Cytochrome P450 superfamily protein isoform 1      349   8e-113   
gb|AER39772.1|  CYP92A44-2                                              349   1e-112   
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            346   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             345   3e-111   
ref|NP_001063284.1|  Os09g0441100                                       345   4e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784472.1|  PREDICTED: cytochrome P450 71A2-like               352   5e-111   
gb|EAZ09260.1|  hypothetical protein OsI_31533                          344   9e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_011036445.1|  PREDICTED: flavonoid 3'-monooxygenase-like         344   1e-110   
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   343   3e-110   
ref|XP_002303387.2|  hypothetical protein POPTR_0003s06510g             342   6e-110   Populus trichocarpa [western balsam poplar]
gb|KHF98584.1|  Cytochrome P450                                         340   1e-109   
gb|AJD25214.1|  cytochrome P450 CYP92A73                                339   7e-109   
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         340   7e-109   
gb|AGV54723.1|  flavonoid 3'-monooxygenase-like protein                 339   1e-108   
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              340   1e-108   
ref|XP_006465907.1|  PREDICTED: cytochrome P450 71A1-like               338   2e-108   
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         337   5e-108   
emb|CAN82000.1|  hypothetical protein VITISV_023195                     336   9e-108   Vitis vinifera
ref|XP_002278462.1|  PREDICTED: flavonoid 3'-monooxygenase              336   1e-107   Vitis vinifera
gb|KDO65006.1|  hypothetical protein CISIN_1g0386481mg                  327   2e-107   
ref|XP_011036443.1|  PREDICTED: flavonoid 3'-monooxygenase-like         335   4e-107   
ref|XP_006427726.1|  hypothetical protein CICLE_v10025388mg             335   4e-107   
ref|XP_010064025.1|  PREDICTED: flavonoid 3'-monooxygenase-like         334   5e-107   
ref|XP_007012629.1|  Cytochrome P450 superfamily protein isoform 2      335   6e-107   
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               334   1e-106   
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               333   2e-106   
ref|XP_006494828.1|  PREDICTED: cytochrome P450 71A1-like               332   4e-106   
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   332   4e-106   
ref|XP_009388239.1|  PREDICTED: flavonoid 3'-monooxygenase-like         330   6e-106   
ref|XP_006369134.1|  hypothetical protein POPTR_0001s16790g             331   1e-105   
gb|EAZ09257.1|  hypothetical protein OsI_31530                          331   2e-105   Oryza sativa Indica Group [Indian rice]
emb|CDP17539.1|  unnamed protein product                                331   2e-105   
ref|XP_010239382.1|  PREDICTED: cytochrome P450 71A1-like               331   2e-105   
ref|XP_011035731.1|  PREDICTED: cytochrome P450 71A1-like               330   2e-105   
dbj|BAJ96250.1|  predicted protein                                      330   2e-105   
ref|XP_011039208.1|  PREDICTED: cytochrome P450 71A1-like               329   5e-105   
ref|XP_002303240.1|  hypothetical protein POPTR_0003s06480g             324   5e-105   Populus trichocarpa [western balsam poplar]
ref|XP_009407098.1|  PREDICTED: cytochrome P450 71A1-like               329   1e-104   
ref|XP_006475100.1|  PREDICTED: flavonoid 3'-monooxygenase-like         327   3e-104   
ref|XP_004984305.1|  PREDICTED: cytochrome P450 71A1-like               328   3e-104   
ref|XP_009413943.1|  PREDICTED: cytochrome P450 71A1-like               325   5e-104   
ref|XP_004984304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         327   8e-104   
dbj|BAD36163.1|  putative elicitor-inducible cytochrome P450            326   1e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09261.1|  hypothetical protein OsI_31534                          326   1e-103   Oryza sativa Indica Group [Indian rice]
gb|EEC84207.1|  hypothetical protein OsI_30611                          320   5e-103   Oryza sativa Indica Group [Indian rice]
gb|EAY85957.1|  hypothetical protein OsI_07321                          322   5e-102   Oryza sativa Indica Group [Indian rice]
gb|KDO73906.1|  hypothetical protein CISIN_1g036271mg                   314   8e-102   
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               321   8e-102   
ref|NP_001062713.1|  Os09g0264400                                       320   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             319   4e-101   
ref|XP_008388825.1|  PREDICTED: flavonoid 3'-monooxygenase-like         318   1e-100   
dbj|BAD23209.1|  putative cytochrome P450 monooxygenase                 318   1e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CAN82002.1|  hypothetical protein VITISV_023197                     316   2e-100   Vitis vinifera
ref|XP_002277926.2|  PREDICTED: flavonoid 3'-monooxygenase              317   2e-100   Vitis vinifera
ref|XP_002277972.1|  PREDICTED: flavonoid 3'-monooxygenase-like         316   7e-100   Vitis vinifera
ref|XP_009337219.1|  PREDICTED: flavonoid 3'-monooxygenase-like         315   3e-99    
ref|XP_002462454.1|  hypothetical protein SORBIDRAFT_02g025830          314   7e-99    Sorghum bicolor [broomcorn]
ref|XP_008354460.1|  PREDICTED: flavonoid 3'-monooxygenase-like         312   2e-98    
gb|KCW71321.1|  hypothetical protein EUGRSUZ_F04403                     311   3e-98    
ref|XP_004956936.1|  PREDICTED: flavonoid 3'-monooxygenase-like         311   4e-98    
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         311   8e-98    
ref|XP_002444467.1|  hypothetical protein SORBIDRAFT_07g022300          311   8e-98    Sorghum bicolor [broomcorn]
ref|XP_008344040.1|  PREDICTED: flavonoid 3'-monooxygenase-like         311   9e-98    
ref|XP_008678485.1|  PREDICTED: flavonoid 3'-monooxygenase-like         311   1e-97    
emb|CDP18923.1|  unnamed protein product                                309   1e-97    
ref|XP_002467826.1|  hypothetical protein SORBIDRAFT_01g034730          310   2e-97    Sorghum bicolor [broomcorn]
ref|XP_004956935.1|  PREDICTED: flavonoid 3'-monooxygenase-like         310   2e-97    
ref|XP_008354562.1|  PREDICTED: flavonoid 3'-monooxygenase-like         310   2e-97    
gb|AFW61881.1|  putative cytochrome P450 superfamily protein            310   5e-97    
ref|XP_002516018.1|  flavonoid 3-hydroxylase, putative                  308   9e-97    Ricinus communis
gb|KDO65007.1|  hypothetical protein CISIN_1g043529mg                   301   1e-96    
ref|XP_008337887.1|  PREDICTED: flavonoid 3'-monooxygenase-like         307   3e-96    
gb|EAZ07221.1|  hypothetical protein OsI_29466                          306   6e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_008242247.1|  PREDICTED: flavonoid 3'-monooxygenase-like         306   1e-95    
ref|XP_009359731.1|  PREDICTED: flavonoid 3'-monooxygenase-like         305   1e-95    
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         305   1e-95    
ref|XP_002467827.1|  hypothetical protein SORBIDRAFT_01g034740          305   2e-95    Sorghum bicolor [broomcorn]
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             303   4e-95    
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             303   1e-94    
ref|XP_008242245.1|  PREDICTED: flavonoid 3'-monooxygenase-like         303   1e-94    
ref|NP_001061964.2|  Os08g0456200                                       303   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002310738.2|  hypothetical protein POPTR_0007s11380g             301   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_008344136.1|  PREDICTED: flavonoid 3'-monooxygenase-like         301   2e-94    
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               303   3e-94    
ref|XP_007203042.1|  hypothetical protein PRUPE_ppa022777mg             301   5e-94    
ref|NP_001148045.1|  flavonoid 3-monooxygenase                          301   8e-94    Zea mays [maize]
gb|AGI98132.1|  cytochrome P450                                         300   1e-93    
gb|ACF84248.1|  unknown                                                 300   2e-93    Zea mays [maize]
gb|EMS55696.1|  Flavonoid 3'-monooxygenase                              293   3e-93    
ref|XP_004288988.1|  PREDICTED: flavonoid 3'-monooxygenase-like         299   3e-93    
tpg|DAA45474.1|  TPA: putative cytochrome P450 superfamily protein      298   4e-93    
ref|XP_011095827.1|  PREDICTED: flavonoid 3'-monooxygenase-like         298   7e-93    
gb|KGN58498.1|  hypothetical protein Csa_3G651820                       295   8e-93    
ref|XP_007203722.1|  hypothetical protein PRUPE_ppa019048mg             298   9e-93    
dbj|BAK04187.1|  predicted protein                                      298   2e-92    
ref|XP_002445595.1|  hypothetical protein SORBIDRAFT_07g022320          296   4e-92    Sorghum bicolor [broomcorn]
ref|XP_011046010.1|  PREDICTED: flavonoid 3'-monooxygenase-like         296   5e-92    
gb|KCW71322.1|  hypothetical protein EUGRSUZ_F04404                     294   1e-91    
ref|NP_001151318.1|  flavonoid 3-monooxygenase                          295   2e-91    Zea mays [maize]
gb|AGI98131.1|  cytochrome P450 CYP92                                   294   3e-91    
gb|AGI97940.1|  flavonoid 3'-monooxygenase-like protein                 294   3e-91    
ref|XP_002467824.1|  hypothetical protein SORBIDRAFT_01g034710          295   3e-91    Sorghum bicolor [broomcorn]
gb|EMT12610.1|  Flavonoid 3'-monooxygenase                              294   3e-91    
ref|XP_011070722.1|  PREDICTED: flavonoid 3'-monooxygenase-like         293   4e-91    
dbj|BAJ96903.1|  predicted protein                                      288   4e-91    
gb|AGT17101.1|  flavonoid 3-monooxygenase                               293   4e-91    
ref|XP_002459381.1|  hypothetical protein SORBIDRAFT_02g003780          297   8e-91    Sorghum bicolor [broomcorn]
ref|XP_007202994.1|  hypothetical protein PRUPE_ppa019215mg             293   9e-91    
emb|CDP21012.1|  unnamed protein product                                292   1e-90    
ref|XP_008242249.1|  PREDICTED: flavonoid 3'-monooxygenase-like         292   2e-90    
ref|XP_006493375.1|  PREDICTED: cytochrome P450 71A1-like               290   7e-90    
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  290   1e-89    Ricinus communis
gb|EMT12612.1|  Flavonoid 3'-monooxygenase                              289   2e-89    
ref|XP_006427648.1|  hypothetical protein CICLE_v10025417mg             288   3e-89    
ref|XP_007204846.1|  hypothetical protein PRUPE_ppa026438mg             288   4e-89    
ref|XP_006493372.1|  PREDICTED: cytochrome P450 71A1-like               287   1e-88    
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             286   2e-88    
ref|XP_011095846.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    280   3e-88    
gb|ABC69418.1|  CYP92B3                                                 286   3e-88    Nicotiana tabacum [American tobacco]
ref|XP_011095838.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    286   4e-88    
ref|XP_006493374.1|  PREDICTED: cytochrome P450 71A1-like               285   1e-87    
ref|XP_004288987.1|  PREDICTED: flavonoid 3'-monooxygenase-like         284   2e-87    
gb|KDO55337.1|  hypothetical protein CISIN_1g0106252mg                  276   3e-87    
ref|XP_003581159.2|  PREDICTED: flavonoid 3'-monooxygenase-like         282   6e-86    
ref|XP_008670125.1|  PREDICTED: flavonoid 3'-monooxygenase-like         278   8e-86    
ref|XP_011095822.1|  PREDICTED: flavonoid 3'-monooxygenase-like         279   1e-85    
gb|ABK24537.1|  unknown                                                 279   2e-85    Picea sitchensis
ref|XP_009788131.1|  PREDICTED: cytochrome P450 750A1-like              271   1e-84    
ref|XP_006648650.1|  PREDICTED: flavonoid 3'-monooxygenase-like         276   2e-84    
emb|CDP20032.1|  unnamed protein product                                276   3e-84    
ref|XP_002467849.1|  hypothetical protein SORBIDRAFT_01g035150          276   3e-84    Sorghum bicolor [broomcorn]
ref|XP_004237819.1|  PREDICTED: cytochrome P450 71A1-like               275   5e-84    
ref|XP_002462453.1|  hypothetical protein SORBIDRAFT_02g025820          275   1e-83    Sorghum bicolor [broomcorn]
emb|CDP18924.1|  unnamed protein product                                267   1e-83    
ref|XP_006381618.1|  hypothetical protein POPTR_0006s14370g             274   2e-83    
ref|XP_002324180.2|  hypothetical protein POPTR_0018s05370g             273   4e-83    Populus trichocarpa [western balsam poplar]
ref|XP_011035092.1|  PREDICTED: flavonoid 3'-monooxygenase-like         273   4e-83    
ref|XP_011015794.1|  PREDICTED: flavonoid 3'-monooxygenase-like         272   5e-83    
ref|XP_009766074.1|  PREDICTED: flavonoid 3'-monooxygenase-like         270   4e-82    
ref|XP_009603956.1|  PREDICTED: flavonoid 3'-monooxygenase-like         263   6e-82    
gb|ABC69388.1|  CYP92B2v2                                               270   7e-82    Nicotiana tabacum [American tobacco]
ref|XP_009605293.1|  PREDICTED: flavonoid 3'-monooxygenase-like         269   7e-82    
gb|AAL66767.1|  cytochrome P450 monooxygenase CYP92A1                   267   5e-81    Zea mays [maize]
ref|XP_006363444.1|  PREDICTED: cytochrome P450 71A1-like               267   6e-81    
gb|ABC69387.1|  CYP92B2v3                                               266   8e-81    Nicotiana tabacum [American tobacco]
gb|EYU22742.1|  hypothetical protein MIMGU_mgv1a004987mg                266   1e-80    
ref|XP_004238495.1|  PREDICTED: cytochrome P450 71A1-like               266   1e-80    
gb|EMT08550.1|  Flavonoid 3'-monooxygenase                              266   1e-80    
ref|XP_008242317.1|  PREDICTED: flavonoid 3'-monooxygenase-like         266   2e-80    
ref|NP_001151053.1|  cytochrome P450 12                                 265   3e-80    Zea mays [maize]
gb|ABC69386.1|  CYP92B2v1                                               265   5e-80    Nicotiana tabacum [American tobacco]
ref|XP_004250647.1|  PREDICTED: flavonoid 3'-monooxygenase-like         264   9e-80    
ref|XP_006350345.1|  PREDICTED: cytochrome P450 71A1-like               264   9e-80    
ref|XP_006477116.1|  PREDICTED: flavonoid 3'-monooxygenase-like         264   1e-79    
gb|EMT17908.1|  Flavonoid 3'-monooxygenase                              259   5e-79    
ref|XP_006355423.1|  PREDICTED: flavonoid 3'-monooxygenase-like         262   5e-79    
ref|NP_001146066.1|  uncharacterized protein LOC100279597               263   5e-79    Zea mays [maize]
gb|EAZ44883.1|  hypothetical protein OsJ_29523                          261   5e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452810.1|  hypothetical protein CICLE_v10008392mg             258   2e-78    
ref|XP_004237821.1|  PREDICTED: cytochrome P450 71A1-like               258   2e-77    
ref|XP_006363443.1|  PREDICTED: cytochrome P450 71A1-like               258   2e-77    
ref|XP_009337217.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    257   2e-77    
tpg|DAA40165.1|  TPA: putative cytochrome P450 superfamily protein      258   2e-77    
ref|XP_006477121.1|  PREDICTED: flavonoid 3'-monooxygenase-like         258   3e-77    
ref|XP_006340220.1|  PREDICTED: cytochrome P450 71A1-like               257   3e-77    
gb|AJD25216.1|  cytochrome P450 CYP92B29                                257   5e-77    
gb|ACN27918.1|  unknown                                                 256   5e-77    Zea mays [maize]
ref|XP_010320112.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    256   8e-77    
ref|XP_009626729.1|  PREDICTED: flavonoid 3'-monooxygenase-like         256   9e-77    
gb|KDO39839.1|  hypothetical protein CISIN_1g048567mg                   250   2e-76    
ref|XP_009591954.1|  PREDICTED: cytochrome P450 71A1-like               254   4e-76    
ref|XP_010090165.1|  Flavonoid 3'-monooxygenase                         252   7e-76    
ref|NP_001151273.1|  flavonoid 3-monooxygenase                          253   1e-75    Zea mays [maize]
ref|XP_004237820.1|  PREDICTED: cytochrome P450 71A1-like               253   1e-75    
ref|XP_006465159.1|  PREDICTED: flavonoid 3'-monooxygenase-like         251   7e-75    
ref|XP_006363445.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    250   1e-74    
ref|XP_006492022.1|  PREDICTED: flavonoid 3'-monooxygenase-like         249   4e-74    
gb|ADD84653.1|  CYP92A46                                                248   9e-74    Scoparia dulcis [escobilla]
gb|KDO38954.1|  hypothetical protein CISIN_1g048184mg                   246   5e-73    
ref|XP_006359061.1|  PREDICTED: cytochrome P450 71A1-like               244   3e-72    
ref|XP_006367943.1|  PREDICTED: cytochrome P450 71A1-like               244   3e-72    
ref|XP_002443882.1|  hypothetical protein SORBIDRAFT_07g003720          243   1e-71    Sorghum bicolor [broomcorn]
ref|XP_007202840.1|  hypothetical protein PRUPE_ppa014596mg             239   2e-70    
gb|EMT33409.1|  Flavonoid 3'-monooxygenase                              235   1e-69    
gb|AJD25215.1|  cytochrome P450 CYP92B28                                236   2e-69    
ref|XP_007201979.1|  hypothetical protein PRUPE_ppa004832mg             235   6e-69    
ref|XP_006492016.1|  PREDICTED: cytochrome P450 71A1-like               235   2e-68    
gb|KDO46294.1|  hypothetical protein CISIN_1g015436mg                   231   2e-68    
gb|KDP33920.1|  hypothetical protein JCGZ_07491                         229   4e-67    
ref|XP_004955501.1|  PREDICTED: flavonoid 3'-monooxygenase-like         231   5e-67    
gb|AFW57306.1|  putative cytochrome P450 superfamily protein            231   7e-67    
ref|XP_004955502.1|  PREDICTED: flavonoid 3'-monooxygenase-like         230   9e-67    
gb|ADD84652.1|  CYP92A45                                                230   9e-67    
gb|ABR17846.1|  unknown                                                 231   1e-66    
emb|CDP20453.1|  unnamed protein product                                224   1e-65    
emb|CAN82001.1|  hypothetical protein VITISV_023196                     223   4e-65    
gb|ACN40130.1|  unknown                                                 226   6e-65    
ref|NP_001152903.1|  uncharacterized protein LOC100273153               222   2e-64    
gb|KDO46305.1|  hypothetical protein CISIN_1g019805mg                   218   3e-64    
gb|ABR18060.1|  unknown                                                 219   8e-63    
gb|KDO40461.1|  hypothetical protein CISIN_1g048667mg                   216   4e-62    
emb|CDP20028.1|  unnamed protein product                                215   6e-62    
gb|ABR18406.1|  unknown                                                 217   7e-62    
ref|XP_006427731.1|  hypothetical protein CICLE_v10025335mg             217   1e-61    
emb|CDP21011.1|  unnamed protein product                                210   5e-60    
gb|ABR18019.1|  unknown                                                 205   1e-59    
ref|XP_003561409.2|  PREDICTED: flavonoid 3'-monooxygenase-like         211   2e-59    
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                211   2e-59    
ref|XP_006427734.1|  hypothetical protein CICLE_v10025408mg             210   3e-59    
gb|ACN40196.1|  unknown                                                 210   4e-59    
gb|ABK24689.1|  unknown                                                 209   5e-59    
gb|ACN40859.1|  unknown                                                 208   2e-58    
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               203   3e-58    
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             206   5e-58    
gb|ABK25581.1|  unknown                                                 205   3e-57    
gb|ACN40389.1|  unknown                                                 205   3e-57    
sp|Q50EK4.1|C75A1_PINTA  RecName: Full=Cytochrome P450 750A1; Alt...    204   8e-57    
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          202   1e-56    
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         202   2e-56    
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          202   2e-56    
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              202   3e-56    
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g             199   3e-56    
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               202   4e-56    
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               201   6e-56    
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                201   6e-56    
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                201   7e-56    
gb|EYU22743.1|  hypothetical protein MIMGU_mgv1a018319mg                193   8e-56    
emb|CAN68303.1|  hypothetical protein VITISV_041731                     201   9e-56    
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               201   9e-56    
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                201   1e-55    
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           200   1e-55    
ref|XP_004148586.1|  PREDICTED: cytochrome P450 71A1-like               197   1e-55    
gb|ACN38268.1|  flavonoid 3' hydroxylase                                200   1e-55    
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                200   2e-55    
ref|XP_008652034.1|  PREDICTED: flavonoid 3'-monooxygenase-like         200   3e-55    
gb|ACG28049.1|  cytochrome P450 CYP92C5                                 200   3e-55    
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             199   3e-55    
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             199   3e-55    
ref|XP_008440669.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    193   4e-55    
ref|XP_002310015.1|  cytochrome P450 family protein                     199   4e-55    
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              199   4e-55    
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                199   4e-55    
ref|XP_004962700.1|  PREDICTED: flavonoid 3'-monooxygenase-like         199   5e-55    
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               198   5e-55    
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  199   5e-55    
gb|ABD65478.1|  cytochrome P450                                         192   6e-55    
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             198   6e-55    
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              198   7e-55    
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                198   8e-55    
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                198   9e-55    
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       198   1e-54    
ref|XP_006850107.1|  hypothetical protein AMTR_s00022p00225170          198   1e-54    
tpg|DAA42609.1|  TPA: putative cytochrome P450 superfamily protein      199   1e-54    
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          197   2e-54    
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   197   3e-54    
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    196   3e-54    
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             196   3e-54    
ref|XP_004962701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         197   4e-54    
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               196   4e-54    
ref|XP_002310014.1|  cytochrome P450 family protein                     196   4e-54    
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   196   5e-54    
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               196   5e-54    
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          196   7e-54    
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               195   7e-54    
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          195   9e-54    
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                195   9e-54    
ref|XP_002461489.1|  hypothetical protein SORBIDRAFT_02g003460          196   1e-53    
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               195   1e-53    
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          194   1e-53    
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                195   1e-53    
ref|XP_011025648.1|  PREDICTED: cytochrome P450 CYP736A12-like          189   1e-53    
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             189   2e-53    
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              194   2e-53    
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             194   2e-53    
ref|XP_002277107.2|  PREDICTED: cytochrome P450 93A3                    194   2e-53    
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                194   3e-53    
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   194   3e-53    
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          194   4e-53    
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             193   5e-53    
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            191   5e-53    
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             190   5e-53    
ref|XP_007048087.1|  Cytochrome P450                                    193   5e-53    
ref|XP_002310007.2|  cytochrome P450 family protein                     192   8e-53    
emb|CAN62275.1|  hypothetical protein VITISV_007552                     192   8e-53    
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  192   9e-53    
gb|ADE76383.1|  unknown                                                 194   9e-53    
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         192   1e-52    
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             193   1e-52    
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              192   1e-52    
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                192   2e-52    
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                192   2e-52    
emb|CAA50442.1|  P450 hydroxylase                                       190   2e-52    
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             191   2e-52    
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               191   2e-52    
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like          189   3e-52    
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          191   3e-52    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            191   3e-52    
gb|KDP24589.1|  hypothetical protein JCGZ_25505                         191   3e-52    
ref|XP_010265529.1|  PREDICTED: cytochrome P450 93A3-like               191   3e-52    
ref|NP_001050784.2|  Os03g0650200                                       192   4e-52    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            191   4e-52    
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                191   4e-52    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            191   4e-52    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            191   5e-52    
gb|ACO35755.1|  chalcone 3-hydroxylase                                  191   5e-52    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            191   5e-52    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            191   5e-52    
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              191   5e-52    
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                191   5e-52    
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                190   6e-52    
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             190   6e-52    
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    190   6e-52    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            190   8e-52    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             190   8e-52    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            190   9e-52    
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             190   9e-52    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            190   9e-52    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    190   1e-51    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            190   1e-51    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            190   1e-51    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            190   1e-51    
gb|AGI16386.1|  flavonoid 3' hydroxylase                                190   1e-51    
ref|XP_004172515.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    189   1e-51    
gb|AAX95529.1|  Putative cytochrome P450                                190   1e-51    
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             189   1e-51    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    189   1e-51    
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              190   1e-51    
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                189   1e-51    
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          189   2e-51    
ref|XP_002461490.1|  hypothetical protein SORBIDRAFT_02g003470          190   2e-51    
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            184   2e-51    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                189   2e-51    
ref|XP_004143572.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    189   2e-51    
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          189   2e-51    
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              189   2e-51    
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              189   2e-51    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             189   2e-51    
gb|ABR16325.1|  unknown                                                 189   2e-51    
ref|XP_010911520.1|  PREDICTED: cytochrome P450 71A9-like               186   2e-51    
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              189   2e-51    
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               188   3e-51    
ref|XP_006858798.1|  hypothetical protein AMTR_s00066p00165900          188   3e-51    
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                189   3e-51    
ref|XP_002513204.1|  cytochrome P450, putative                          189   3e-51    
gb|KHN29102.1|  Cytochrome P450 71A1                                    188   4e-51    
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          188   4e-51    
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               188   4e-51    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            188   4e-51    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         188   4e-51    
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   183   4e-51    
gb|AJD25256.1|  cytochrome P450 CYP736A121                              188   5e-51    
ref|XP_002442357.1|  hypothetical protein SORBIDRAFT_08g018780          189   5e-51    
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                188   5e-51    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            188   5e-51    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            188   5e-51    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            188   5e-51    
ref|XP_003630098.1|  Cytochrome P450                                    187   5e-51    
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                188   6e-51    
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                187   6e-51    
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                188   6e-51    
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   183   7e-51    
emb|CDP19009.1|  unnamed protein product                                187   7e-51    
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          187   7e-51    
emb|CDP19008.1|  unnamed protein product                                187   7e-51    
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         187   7e-51    
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                187   7e-51    
gb|KHN39623.1|  Flavonoid 3',5'-hydroxylase                             183   8e-51    
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               187   8e-51    
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                187   9e-51    
gb|ACN40749.1|  unknown                                                 187   1e-50    
ref|XP_004143569.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    187   1e-50    
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         187   1e-50    
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               186   1e-50    
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               187   1e-50    
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                187   1e-50    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           187   1e-50    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   187   2e-50    
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       186   2e-50    
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    186   2e-50    
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330          186   2e-50    
ref|XP_010094782.1|  Cytochrome P450 71A1                               186   2e-50    
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    186   2e-50    
ref|XP_009619292.1|  PREDICTED: cytochrome P450 93A3-like               186   2e-50    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        186   2e-50    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    186   2e-50    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            186   2e-50    
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              191   2e-50    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             186   2e-50    
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              186   3e-50    
ref|XP_010099912.1|  Cytochrome P450 71A1                               186   3e-50    
gb|AJD25177.1|  cytochrome P450 CYP75B79                                186   3e-50    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            186   3e-50    
gb|EAZ41670.1|  hypothetical protein OsJ_26207                          175   3e-50    
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          186   3e-50    
ref|XP_006850110.1|  hypothetical protein AMTR_s00022p00225440          186   3e-50    
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             186   3e-50    
gb|KDO40427.1|  hypothetical protein CISIN_1g042142mg                   182   4e-50    
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          185   4e-50    
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               185   5e-50    
ref|XP_010111422.1|  Cytochrome P450 93A1                               185   5e-50    
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             185   6e-50    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      185   7e-50    
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               184   7e-50    



>emb|CBI35858.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   420 bits (1080),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 226/318 (71%), Positives = 266/318 (84%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME  TW +Y  AWL+T+A+IL++ HLRRR KL+LPPGPKPWPIIGNLNLIG LPHRSIH+
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGPIMQL+FGSFPVVVGSSV MAK+FLKT D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M  ME+FSA+RL+S+E+IR  E KS+L  LY  S++  PV LKD+L  +
Sbjct  121   PYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTV  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +LNVISRM LGK YL+E+ EGSIV P EFKKMLDE+FLLSG LNIGD IPW+DFLDLQGY
Sbjct  179   SLNVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             +K+ K L+KK DRFLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP +EVK+ER G
Sbjct  239   VKRMKVLSKKFDRFLEHVLDEHNARR--KGVENYVAKDMVDVLLQFADDPTLEVKLERHG  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAFT DL+AGGTESS V
Sbjct  297   VKAFTQDLIAGGTESSAV  314



>ref|XP_002273390.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=511

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/318 (71%), Positives = 266/318 (84%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME  TW +Y  AWL+T+A+IL++ HLRRR KL+LPPGPKPWPIIGNLNLIG LPHRSIH+
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGPIMQL+FGSFPVVVGSSV MAK+FLKT D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M  ME+FSA+RL+S+E+IR  E KS+L  LY  S++  PV LKD+L  +
Sbjct  121   PYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTV  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +LNVISRM LGK YL+E+ EGSIV P EFKKMLDE+FLLSG LNIGD IPW+DFLDLQGY
Sbjct  179   SLNVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             +K+ K L+KK DRFLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP +EVK+ER G
Sbjct  239   VKRMKVLSKKFDRFLEHVLDEHNARR--KGVENYVAKDMVDVLLQFADDPTLEVKLERHG  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAFT DL+AGGTESS V
Sbjct  297   VKAFTQDLIAGGTESSAV  314



>ref|XP_007215252.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
 gb|EMJ16451.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
Length=510

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 261/315 (83%), Gaps = 2/315 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME  +W+AYA AWL  + +IL+++ LR RKL+LPPGPKPWPIIGNLNLI  LPHRSIH L
Sbjct  1     MESISWVAYAAAWLGALVLILLSRRLRHRKLNLPPGPKPWPIIGNLNLISQLPHRSIHAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             +QKYGPIMQL+FGS PVVVGSSV+MAK FLKT D+ F  RPK  AGKH TYNYS++TWS 
Sbjct  61    AQKYGPIMQLKFGSHPVVVGSSVDMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSA+RL+S+E+IR  E+ ++L  L+  S+T   +LLKD+L  ++
Sbjct  121   YGPYWRQARKMCVMELFSARRLESYEYIRKEEMNALLRGLFESSNTN--ILLKDHLSTVS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK Y +ESE SIV+P EFKKMLDE+FLLSG LNIGD IPWLDFLDLQGYIK
Sbjct  179   LNVISRMVLGKKYTDESEDSIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + K L+KKLDRFLEHVLD H+++R   G+ FVAKDMVDVLLQ ADDPN+EVK+ER GVKA
Sbjct  239   RMKTLSKKLDRFLEHVLDVHIAKRKAGGEDFVAKDMVDVLLQLADDPNLEVKLERHGVKA  298

Query  994   FTLDLLAGGTESSTV  1038
             FT DL+AGGTESS V
Sbjct  299   FTQDLIAGGTESSAV  313



>emb|CAA65580.1| cytochrome P450 [Nicotiana tabacum]
Length=498

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 268/315 (85%), Gaps = 3/315 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW AYA A L+T+++ L++K LR+RKL+LPPGPKPWPI+GN NLI  L HRS+H+L
Sbjct  1     METPTWTAYAAACLATLSLFLLSKFLRQRKLNLPPGPKPWPIVGNFNLIAPLAHRSVHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQL+FGSFPVVVGSSVEMAK+FLK+MDINFVDRPK  AGK+ TYNYSN+TWS 
Sbjct  61    SLKYGPIMQLRFGSFPVVVGSSVEMAKVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSA  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+F+AKRL+S E+IRT EL+S+LH LYN+  T +P+LLKDYL  L+
Sbjct  121   YGPYWRQARKMCLMELFTAKRLESLEYIRTEELQSLLHDLYNL--TGKPILLKDYLMTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ES+ SIV P EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESKNSIVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + K L+ K DRFLE+VLDEH +RR  E + +VAKDMVDVLLQ ADDP +EVK+ER GVKA
Sbjct  239   RMKVLSNKFDRFLEYVLDEHNARRNAE-ENYVAKDMVDVLLQFADDPTLEVKLERHGVKA  297

Query  994   FTLDLLAGGTESSTV  1038
             FT DLLAGGTES+ V
Sbjct  298   FTQDLLAGGTESTAV  312



>ref|XP_004235547.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   414 bits (1063),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 226/316 (72%), Positives = 265/316 (84%), Gaps = 8/316 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG +W A    +L+T+ ++L++K+L +RKL+LPPGPKPWPIIGNLNLIG+LPHRSIHDL
Sbjct  1     MEGSSWTA---VFLATLFVLLLSKYLFQRKLNLPPGPKPWPIIGNLNLIGSLPHRSIHDL  57

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQLQFGSFPVVVGSSVEMAK+FLKTMDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  58    SVKYGPIMQLQFGSFPVVVGSSVEMAKVFLKTMDINFVGRPKTAAGKYTTYNYSDITWSP  117

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QARRM  ME+FSAKRLDS+E+IR  EL S+LH L   S   +P+LLKDYL  L+
Sbjct  118   YGSYWRQARRMCLMELFSAKRLDSYEYIRAEELHSILHNLKKTSG--KPILLKDYLTTLS  175

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGKSYL+ES+ SIV P EFKKMLDE+FLL+G LNIGD IPWLDF+DLQGY+K
Sbjct  176   LNVISRMVLGKSYLDESKNSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVK  235

Query  814   QTKALNKKLDRFLEHVLDEHMSRR-VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHVLDEH  RR  VE   +VA+DMVDVLLQ ADDP +E+K+ER GVK
Sbjct  236   RMKVVSKKFDKFLEHVLDEHNVRRNAVEN--YVAEDMVDVLLQLADDPTLEIKLERHGVK  293

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  294   AFTQDMLAGGTESSAV  309



>ref|XP_006342921.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=509

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 266/316 (84%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG TW AYA  +L+T+ ++L++K LR+RKL+LPPGPKPWPIIGNLNLIG+L HRSIHDL
Sbjct  1     MEGTTWTAYAAVFLATLFLLLLSKFLRQRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SVKYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QARRM  ME+FSAKRLDS+E+IR  EL S+LH L  +S   +P+LLKDYL  L+
Sbjct  121   YGSYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNKLSG--KPILLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGKSYL+ SE SIV P EFKKMLDE+FLL+G LNIGD IPWLDF+DLQGY+K
Sbjct  179   LNVISRMVLGKSYLDVSENSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRR-VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHVLDEH  RR  VE   +VAKDMVD+LLQ ADDP ++VK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVLDEHNVRRNAVEN--YVAKDMVDILLQLADDPTLDVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DLLAGGTESS V
Sbjct  297   AFTQDLLAGGTESSAV  312



>ref|XP_004235548.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=508

 Score =   407 bits (1045),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 266/316 (84%), Gaps = 6/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG TW A AV  L+T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNL+G+LPHRSIHDL
Sbjct  1     MEGTTWTATAVF-LATLFLLFLSKFLRKRKLNLPPGPKPWPIIGNLNLMGSLPHRSIHDL  59

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  60    SVKYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSP  119

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QARRM  ME+FSAKRLDS+E+IR  EL S+LH L    S+ +P+LLKDYL  L+
Sbjct  120   YGSYWRQARRMCLMELFSAKRLDSYEYIRAEELHSILHNLNK--SSGKPILLKDYLTTLS  177

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGKSYL+ES+ SIV P EFKKMLDE+FLL+G LNIGD IPWLDF+DLQGY+K
Sbjct  178   LNVISRMVLGKSYLDESDNSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVK  237

Query  814   QTKALNKKLDRFLEHVLDEH-MSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHVLDEH M R  VE   +VAKDMVDVLLQ ADDP ++VK+ER GVK
Sbjct  238   RMKVVSKKFDKFLEHVLDEHNMRRNAVEN--YVAKDMVDVLLQLADDPTLDVKLERHGVK  295

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DLLAGGTESS V
Sbjct  296   AFTQDLLAGGTESSAV  311



>ref|XP_009771564.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=510

 Score =   406 bits (1043),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PT+ AYA A L+T+A+  ++K+LR+RKL+LPPGPKPWPIIGN NLIG L HRS+H+L
Sbjct  1     METPTYTAYAAACLATLALFFLSKYLRQRKLNLPPGPKPWPIIGNFNLIGPLAHRSVHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPI+Q +FGS+PVVVGSSVEMAK+FLK+MDINFVDRPK  AGK+ TYNYSN+TWS 
Sbjct  61    SLKYGPILQRRFGSYPVVVGSSVEMAKVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSA  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+F+AKRL+S E+IRT EL S+LH LYN+ ST +P+LLKDYL  L+
Sbjct  121   YGPYWRQARKMCLMELFTAKRLESLEYIRTEELHSLLHDLYNL-STGKPILLKDYLMTLS  179

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ES+ SIV P EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  180   LNVISRMVLGKRYLDESKNSIVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQGYVK  239

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + K L+ K DRFLEHVLD+H +RR  E + +VAKDMVDVLLQ ADDP +EVK+ER GVKA
Sbjct  240   RMKVLSNKFDRFLEHVLDQHNARRNAE-ENYVAKDMVDVLLQFADDPTLEVKLERHGVKA  298

Query  994   FTLDLLAGGTESSTV  1038
             FT DLLAGGTESS V
Sbjct  299   FTQDLLAGGTESSAV  313



>ref|XP_009341741.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=510

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/312 (69%), Positives = 258/312 (83%), Gaps = 3/312 (1%)
 Frame = +1

Query  106   TWL-AYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             TW+ A+  AWL  +A+IL+++ LR RKL+LPPGPKPWPIIGNLNLI  LPHRS+H+L+ K
Sbjct  4     TWVVAHVAAWLGALALILLSRRLRHRKLNLPPGPKPWPIIGNLNLISHLPHRSVHELALK  63

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGS+PVVVGSSVEMAK FLKT D+ F  RPK  AGKH TYNYS++TWS YGP
Sbjct  64    YGPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPYGP  123

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M   E+FS KRL+S+E+IR  E+ ++L  LY+ S++   VLLKD+L  ++LNV
Sbjct  124   YWRQARKMCITELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--VLLKDHLSTVSLNV  181

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK Y +E++ +IV+P EFKKMLDE+FLLSG LNIGD IPWLDFLDLQGYIK+ K
Sbjct  182   ISRMVLGKKYTDETKDAIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMK  241

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L+KKLD FLEHVLDEH+++R   G  FVAKDMVDVLLQ ADDPN+EVK+ER GVKAFT 
Sbjct  242   TLSKKLDMFLEHVLDEHITKREAGGKDFVAKDMVDVLLQLADDPNLEVKLERHGVKAFTQ  301

Query  1003  DLLAGGTESSTV  1038
             DL+AGGTESS V
Sbjct  302   DLIAGGTESSAV  313



>ref|XP_009375474.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=509

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 221/311 (71%), Positives = 263/311 (85%), Gaps = 2/311 (1%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TW+AY  AWL  +A+IL+++ LRRRKL+LPPGPKPWPIIGNLNLIG LPHRS+H+LSQKY
Sbjct  4     TWVAYTAAWLGALALILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGHLPHRSVHELSQKY  63

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GPIMQL+FGS+PVVVGSSVEMAK FLKT D+ F  RPK  AGKH TYNYS++TWSQYGPY
Sbjct  64    GPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSQYGPY  123

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FS KRL+S+E+IR  E+ ++L  LY+ S++   +LLKD+L  ++LNVI
Sbjct  124   WRQARKMCIMELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--ILLKDHLSTVSLNVI  181

Query  646   SRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKA  825
             SRM LGK Y +E+E SIV+P +FKKMLDE+FLLSG LNIGD IPWLDFLDLQGYIK+ K 
Sbjct  182   SRMVLGKKYTDETEDSIVSPDDFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKT  241

Query  826   LNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLD  1005
             L+KK+DRFLEHVLDEH++RR   G  FVAKDMVDVLLQ ADDP +EVK+ER GVKAFT D
Sbjct  242   LSKKMDRFLEHVLDEHIARREASGKDFVAKDMVDVLLQLADDPGLEVKLERHGVKAFTQD  301

Query  1006  LLAGGTESSTV  1038
             L+AGGTESS V
Sbjct  302   LIAGGTESSAV  312



>ref|XP_006369135.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
 gb|ERP65704.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
Length=511

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 256/314 (82%), Gaps = 5/314 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TW++YA AWL+T+++IL+A  LRRRKL LPPGPKPWPIIGNLNLIG LPHRS+H LSQKY
Sbjct  3     TWVSYAFAWLATVSLILLASRLRRRKLKLPPGPKPWPIIGNLNLIGELPHRSLHALSQKY  62

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GPIMQ+QFGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TWS YGPY
Sbjct  63    GPIMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGPY  122

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FSAKRL+S+E+IR  ELK++L  L+   S+ +P+ LKD+L  ++LNVI
Sbjct  123   WRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHK--SSGRPINLKDHLTDVSLNVI  180

Query  646   SRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             SRM LGK Y    +E+E  IV P EFK+MLDE+FLL+G L+IGD IPW+ FLDLQGYIK+
Sbjct  181   SRMVLGKKYTVKSSENEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKR  240

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              K L+KK D+F+EHVLDEH SRR  E + +  KDMVDVLLQ A DPN+EVK+ER GVKAF
Sbjct  241   MKVLSKKFDKFMEHVLDEHESRRKTEDENWEPKDMVDVLLQLASDPNLEVKLERHGVKAF  300

Query  997   TLDLLAGGTESSTV  1038
             + DL+AGGTESS V
Sbjct  301   SQDLIAGGTESSAV  314



>ref|XP_010086796.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB23806.1| Cytochrome P450 71A1 [Morus notabilis]
Length=514

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 266/317 (84%), Gaps = 2/317 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEGPTW++YA AWL+TIA+IL+++ LRRRKL+LPPGPKPWPIIGNLNLIG LPHRSI+DL
Sbjct  1     MEGPTWVSYAAAWLATIALILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGPLPHRSIYDL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQKYGPIMQL FGSFPVVVGSSVEMAKIFLKT D+ FV RPK  AGK+ TYNYSN+TWS 
Sbjct  61    SQKYGPIMQLWFGSFPVVVGSSVEMAKIFLKTHDLTFVGRPKIAAGKYTTYNYSNITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSA+RLDS+E+IR  E++++L  L+  S T + VLLKD L  ++
Sbjct  121   YGPYWRQARKMCLMELFSARRLDSYEYIRREEMRALLKALFEFSKTEKLVLLKDQLSTVS  180

Query  634   lNVISRMALGKSYLNESE-GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             LNVISRM LGK+Y + S+  ++V+P EFKKMLDE+FLLSG LNIGD IPWLDFLDLQGYI
Sbjct  181   LNVISRMVLGKNYTDGSDPNAVVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYI  240

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFV-AKDMVDVLLQHADDPNMEVKIERQGV  987
             K+ KAL+KK DRFLEHVLDEH  RR    D    A+DMVDVLLQ ADDP +EVK+ER GV
Sbjct  241   KRMKALSKKWDRFLEHVLDEHNERRKGVKDYVPHAQDMVDVLLQLADDPTLEVKLERHGV  300

Query  988   KAFTLDLLAGGTESSTV  1038
             KAFT DL+AGGTESS V
Sbjct  301   KAFTQDLIAGGTESSAV  317



>gb|AAK62346.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 262/316 (83%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++L++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTTYAAVFLGTLFLLLLSKFLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQLQFG+FPVVVGSSVEMAK+FLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPIMQLQFGTFPVVVGSSVEMAKVFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM  ME+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLMELFSTKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE SIV P EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSIVTPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + ++AKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKFVSKKFDKFLEHVIDEHNVRR--NGVENYIAKDMVDVLLQLADDPTLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>ref|XP_009607330.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana tomentosiformis]
Length=509

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 262/316 (83%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG    AYA  +L T+ ++L++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTAYAAVFLGTLFLLLLSKFLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPIMQLQFG+FPVVVGSSVEMAK+FLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPIMQLQFGTFPVVVGSSVEMAKVFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM  ME+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLMELFSPKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE SI  P EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSIATPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + ++AKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKFVSKKFDKFLEHVIDEHNVRR--NGVENYIAKDMVDVLLQLADDPTLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>gb|ABC69381.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 259/316 (82%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTTYAAVFLDTLFLLFLSKLLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGP+MQLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPVMQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM   E+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDY   L+
Sbjct  121   YGPYWRQARRMCLTELFSTKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYSTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE S VNP EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSFVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + +VAKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVIDEHNIRR--NGVENYVAKDMVDVLLQLADDPKLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>gb|ABC69383.1| CYP92A2v4 [Nicotiana tabacum]
Length=509

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 260/316 (82%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTTYAAVFLDTLFLLFLSKLLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGP+MQLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPVMQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM   E+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLTELFSTKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE S VNP EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSFVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + +VAKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVIDEHNIRR--NGVENYVAKDMVDVLLQLADDPKLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>ref|XP_009771565.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana sylvestris]
Length=509

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 260/316 (82%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTTYAAVFLGTLFLLFLSKLLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGP+MQLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPVMQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM   E+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLTELFSTKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE S VNP EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSFVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + +VAKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVIDEHNIRR--NGVENYVAKDMVDVLLQLADDPKLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>gb|ABC69382.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 260/316 (82%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEGTNLTTYAAVFLDTLFLLFLSKLLRQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGP+MQLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPVMQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM   E+FS KRLDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLTELFSTKRLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE S VNP EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSFVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + +VAKDMVDVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVIDEHNIRR--NGVENYVAKDMVDVLLQLADDPKLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>ref|XP_010273844.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=509

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 263/316 (83%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P+W  YA+AWL ++A+++++ H RRR+ +LPPGPKPWPIIGNLNLIG LPHRSIH+L
Sbjct  1     MEAPSWAVYALAWLLSLALVILSGHFRRRRANLPPGPKPWPIIGNLNLIGPLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+KYGPIMQL+FGS P+VVGSSVEMAK FLK  DI F  RPK  AGK+ TYNYS++TWS 
Sbjct  61    SKKYGPIMQLRFGSRPIVVGSSVEMAKQFLKIHDITFASRPKMAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FS KRL+S+E+IR  EL+++L  LY  +S+ +P++LKD+L  L+
Sbjct  121   YGPYWRQARKMCLMELFSVKRLESYEYIRVEELRAVLKGLY--ASSGKPIVLKDHLSTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK Y +ESE SIV PGEFKKMLDE+FLL+G +NIGD IPW+DFLDLQGY+K
Sbjct  179   LNVISRMVLGKKYTDESETSIVTPGEFKKMLDELFLLNGVVNIGDYIPWIDFLDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRV-VEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K L+KK D+FLEHV+DEH +RR  VEG  +VAKDMVDVLLQ ADDP +EVK+ R+GVK
Sbjct  239   RMKILSKKFDKFLEHVIDEHNARRQGVEG--YVAKDMVDVLLQLADDPTLEVKLHREGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
              FT DL+AGGTESS V
Sbjct  297   GFTQDLIAGGTESSAV  312



>ref|XP_008228182.1| PREDICTED: cytochrome P450 71A1-like [Prunus mume]
Length=510

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 263/315 (83%), Gaps = 2/315 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME  +W+AYA AWL  +A+IL+++ LR RKL+LPPGPKPWPIIGNLNLI  LPHRSIH L
Sbjct  1     MESISWVAYAAAWLGALALILLSRRLRHRKLNLPPGPKPWPIIGNLNLISQLPHRSIHAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             + KYGPIMQL+FGS PVVVGSSV+MAK FLKT D+ F  RPK  AGKH TYNY+++TWS 
Sbjct  61    AHKYGPIMQLKFGSHPVVVGSSVDMAKAFLKTHDVTFAGRPKFAAGKHTTYNYTDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSAKRL+S+E+IR  E+ ++L  L+  S+T   +LLKD+L  ++
Sbjct  121   YGPYWRQARKMCVMELFSAKRLESYEYIRKEEMNALLRGLFESSNTN--ILLKDHLSTVS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK Y +ESE SIV+P EFKKMLDE+FLLSG LNIGD IPWLDFLDLQGYIK
Sbjct  179   LNVISRMVLGKKYTDESEDSIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + KAL+KKLDRFLEHVLDEH+++R   G+ FVAKDMVDVLLQ ADDP++EVK+ER GVKA
Sbjct  239   RMKALSKKLDRFLEHVLDEHIAKRKAGGEDFVAKDMVDVLLQLADDPDLEVKLERHGVKA  298

Query  994   FTLDLLAGGTESSTV  1038
             FT DL+AGGTESS V
Sbjct  299   FTQDLIAGGTESSAV  313



>emb|CAN77776.1| hypothetical protein VITISV_021888 [Vitis vinifera]
Length=500

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 217/318 (68%), Positives = 257/318 (81%), Gaps = 18/318 (6%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME  TW +Y  AWL+T+A+IL++ HLRRR KL+LPPGPKPWPIIGNLNLIG LPHRSIH+
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGPIMQL+FGSFPVVVGSSV MAK+FLKT D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M  ME+FSA+RL+S+E+IR  E KS+L  LY  S++  PV LKD+L  +
Sbjct  121   PYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTV  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +LNVISRM LGK YL+E+ EGSIV P EFKKMLDE+FLLSG LNIGD IPW+DFLDLQGY
Sbjct  179   SLNVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             +K+ K           HVLDEH +RR  +G + +VAKDMVDVLLQ A+DP +EVK+ER G
Sbjct  239   VKRMK-----------HVLDEHNARR--KGVENYVAKDMVDVLLQFAEDPTLEVKLERHG  285

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAFT DL+AGGTESS V
Sbjct  286   VKAFTQDLIAGGTESSAV  303



>ref|XP_006426680.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
 gb|ESR39920.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
Length=512

 Score =   394 bits (1011),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P+W++Y  AWL+T+A++L++  LRRRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+K
Sbjct  6     PSWVSYLTAWLATLALVLLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSEK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGSFPVVVGSSVEMAK+ LKT D+ F  RPK  AGK+ T+NYS++TWS YGP
Sbjct  66    YGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M  ME+FSAKRL+SFE+IR  ELK +L +LY +S   +P++LKD+L  L+L V
Sbjct  126   YWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLAV  183

Query  643   ISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             ISRM LGK+Y + + E  IV P EFK MLDE+FLL+G L+IGD IPWL FLDLQG IK+ 
Sbjct  184   ISRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQGNIKRM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             KAL KK D+FLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP++EVKIER GVKAF
Sbjct  244   KALAKKFDKFLEHVLDEHNARR--KGVENYVAKDMVDVLLQLADDPSLEVKIERHGVKAF  301

Query  997   TLDLLAGGTESSTV  1038
             T DL+AGGTESS V
Sbjct  302   TQDLIAGGTESSAV  315



>gb|ABG74350.1| cytochrome P450 [Capsicum chinense]
Length=509

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 223/316 (71%), Positives = 263/316 (83%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG TW AYA  +L T+ ++L++K LR++KL+LPPGPKPWPIIGNL+L+G LPHRSIH+L
Sbjct  1     MEGTTWTAYAAVFLGTLFLLLLSKFLRQKKLNLPPGPKPWPIIGNLHLMGNLPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGPI+QLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGKH TYNYS++TWS 
Sbjct  61    SVKYGPILQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKHTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QARRM   E+FSAKRLDS+E+IR  EL  +L  L  +S   +P+LLKDYL  L+
Sbjct  121   YGSYWRQARRMCLTELFSAKRLDSYEYIRAEELHLILRNLNKLSG--KPILLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ES+ SIV P EFKKMLDE+FLL+G LNIGD IPWL F+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESKNSIVTPEEFKKMLDELFLLNGVLNIGDSIPWLGFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEH-MSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K L+KK D+FLEHVLDEH + R+ VE   +VAKDMVDVLLQ ADDP++E+K+ER GVK
Sbjct  239   RMKVLSKKFDKFLEHVLDEHNVRRKAVEN--YVAKDMVDVLLQLADDPSLEIKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DLLAGGTESS V
Sbjct  297   AFTQDLLAGGTESSAV  312



>gb|KDO65002.1| hypothetical protein CISIN_1g010388mg [Citrus sinensis]
Length=512

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P+W++Y  AWL+T+A++L++  LRRRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+K
Sbjct  6     PSWVSYLTAWLATLALVLLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSEK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGSFPVVVGSSVEMAK+ LKT D+ F  RPK  AGK+ T+NYS++TWS YGP
Sbjct  66    YGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M  ME+FSAKRL+SFE+IR  ELK +L +LY +S   +P++LKD+L  L+L V
Sbjct  126   YWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLAV  183

Query  643   ISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             ISRM LGK+Y + + E  IV P EFK MLDE+FLL+G L+IGD IPWL FLDLQG IK+ 
Sbjct  184   ISRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQGNIKRM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             KAL KK D+FLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP++EVKIER GVKAF
Sbjct  244   KALAKKFDKFLEHVLDEHNARR--KGVENYVAKDMVDVLLQLADDPSLEVKIERHGVKAF  301

Query  997   TLDLLAGGTESSTV  1038
             T DL+AGGTESS V
Sbjct  302   TQDLIAGGTESSAV  315



>emb|CDP21484.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 244/312 (78%), Gaps = 19/312 (6%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             PTW AYA+AW++T+ I  ++KH  ++KL+LPPGP+ WPIIGNLNLIGTLPHRS+H LS  
Sbjct  6     PTWAAYALAWVTTVVIAHLSKHFHQQKLNLPPGPRQWPIIGNLNLIGTLPHRSLHQLSLT  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGP+M LQFGSFPVVVGSSVEMAK+FLKTMD  F  RPK  AGK+  Y+ +N+TWS YGP
Sbjct  66    YGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDGTFAGRPKTAAGKYTAYDCTNMTWSPYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR++F  E+FSAKRL+S+EHIR  E+ S+L +L+N+                  NV
Sbjct  126   YWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQLFNL------------------NV  167

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK+Y++ESE SIV P EF++M+DEVFLL+G  NIGD IPW+DFLDLQGYIK+ K
Sbjct  168   ISRMVLGKTYIDESENSIVTPEEFRQMMDEVFLLTGVFNIGDFIPWIDFLDLQGYIKRMK  227

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L+KK+DRFLEHVLDEH +RR  E D  V+KDM DVLL  ADDP +EVK+ER+GVKA TL
Sbjct  228   ILSKKVDRFLEHVLDEHNARRKDETD-CVSKDMADVLLDLADDPTLEVKLERRGVKALTL  286

Query  1003  DLLAGGTESSTV  1038
             DLLAGGTE+S  
Sbjct  287   DLLAGGTETSAT  298



>emb|CDP21888.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 256/312 (82%), Gaps = 3/312 (1%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             PTW AYA+AW++T+ I  ++KH  ++KL+LPPGP+ WPIIGNLNLIGTLPHRS+H LS  
Sbjct  6     PTWAAYALAWVATVVIAHLSKHFHQQKLNLPPGPRQWPIIGNLNLIGTLPHRSLHQLSLT  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGP+M LQFG+FPVVVGSSVEMAK+FLKTMD+ F  RPK  +GK+ +Y+ +++TWS YGP
Sbjct  66    YGPLMHLQFGTFPVVVGSSVEMAKVFLKTMDVTFAGRPKTASGKYNSYDCTDMTWSAYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR++F  E+FSAKRL+S+EHIR  E+ S+L +L+   S+ +PV+LKDYL   +LNV
Sbjct  126   YWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQLFK--SSGKPVVLKDYLSTGSLNV  183

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK+Y++ESE SIV P EF++M+DE+FLL+G  NIGD IPW+DFLDLQGYIK+ K
Sbjct  184   ISRMVLGKTYIDESENSIVTPDEFRQMMDELFLLTGVFNIGDFIPWIDFLDLQGYIKRMK  243

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L+KK DRFLEHVLDEH ++R  +    V+KD+VDVLL  ADDP +EVK+ER+GVKA TL
Sbjct  244   ILSKKFDRFLEHVLDEHNAQR-KDDTNCVSKDLVDVLLGLADDPTLEVKLERRGVKALTL  302

Query  1003  DLLAGGTESSTV  1038
             DLLAGGTE+S  
Sbjct  303   DLLAGGTETSAT  314



>emb|CAA64635.1| cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 258/316 (82%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG     YA  +L T+ ++ ++K LR+RKL+LPPGPKPWPIIGNLNLIG LP+RSIH+L
Sbjct  1     MEGTNLTTYAAVFLGTLFLLFLSKLLRQRKLNLPPGPKPWPIIGNLNLIGNLPYRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S KYGP+MQLQFGSFPVVVGSSVEMAKIFLK+MDINFV RPK  AGK+ TYNYS++TWS 
Sbjct  61    SLKYGPVMQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARRM   E+FS K LDS+E+IR  EL S+LH L  +S   +P++LKDYL  L+
Sbjct  121   YGPYWRQARRMCLTELFSTKCLDSYEYIRAEELHSLLHNLNKISG--KPIVLKDYLTTLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK YL+ESE S VNP EFKKMLDE+FLL+G LNIGD IPW+DF+DLQGY+K
Sbjct  179   LNVISRMVLGKRYLDESENSFVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             + K ++KK D+FLEHV+DEH  RR   G + +VAKDM DVLLQ ADDP +EVK+ER GVK
Sbjct  239   RMKVVSKKFDKFLEHVIDEHNIRR--NGVENYVAKDMEDVLLQLADDPKLEVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT D+LAGGTESS V
Sbjct  297   AFTQDMLAGGTESSAV  312



>gb|AED99875.1| cytochrome P450 [Panax notoginseng]
Length=512

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 261/314 (83%), Gaps = 5/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             PTW  Y+  WL+ +A+ L++K+LR  KL+ PPGPKPWPIIGNLNLIG+LPHRSIH LSQK
Sbjct  5     PTWAVYSATWLAILALFLLSKYLRP-KLNPPPGPKPWPIIGNLNLIGSLPHRSIHQLSQK  63

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGSFPVVVGSSVEMAKIFLKTMD+NFV RPK  AGKH TYNYS++TWS YG 
Sbjct  64    YGPIMQLRFGSFPVVVGSSVEMAKIFLKTMDVNFVGRPKTAAGKHTTYNYSDITWSPYGA  123

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M  ME+FSAKRLDS+E+IR  E+KSML +LY +S   Q + LKDYL  ++LNV
Sbjct  124   YWRQARKMCLMELFSAKRLDSYEYIRVEEMKSMLKQLYELSG--QKIALKDYLSTVSLNV  181

Query  643   ISRMALGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             ISRM LGK YL+ES  + ++V P EFKKMLDE+FLL+G  NIGD IPW+DFLDLQGY+K+
Sbjct  182   ISRMVLGKRYLDESVDQKAVVRPEEFKKMLDELFLLNGVFNIGDSIPWIDFLDLQGYVKR  241

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              K ++KK DRFLEHVLDEH++RR  E   +VAKDMVD+LLQ +DDP +EVK+ER GVKAF
Sbjct  242   MKVVSKKFDRFLEHVLDEHIARRETEKGDYVAKDMVDLLLQLSDDPTLEVKLERHGVKAF  301

Query  997   TLDLLAGGTESSTV  1038
             T DLLAGGTESS V
Sbjct  302   TQDLLAGGTESSAV  315



>ref|XP_006465906.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 259/313 (83%), Gaps = 6/313 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             +W +Y  AWL+T+A++L++  LRRRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+KY
Sbjct  7     SWASYLTAWLATLALVLLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSEKY  66

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GPIMQL+FGSFPVVVGSSVEMAK+ LKT D+ F  RPK  AGK+ T+NYS++TWS YGPY
Sbjct  67    GPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYGPY  126

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FSAKRL+SFE+IR  ELK +L +LY +S   +P++LKD+L  L+L VI
Sbjct  127   WRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLAVI  184

Query  646   SRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             SRM LGK+Y + + E  IV P EFK MLDE+FLL+G L+IGD IPWL FLDLQG IK+ K
Sbjct  185   SRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQGNIKRMK  244

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             AL KK D+FLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP++EVKIER GVKAFT
Sbjct  245   ALAKKFDKFLEHVLDEHNARR--KGVENYVAKDMVDVLLQLADDPSLEVKIERHGVKAFT  302

Query  1000  LDLLAGGTESSTV  1038
              DL+AGGTESS V
Sbjct  303   QDLIAGGTESSAV  315



>ref|XP_008792870.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=511

 Score =   389 bits (1000),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/316 (65%), Positives = 255/316 (81%), Gaps = 3/316 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRK-LHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+      A L++I + L +   RRR+ L+LPPGPKPWPIIGNLNLI +LPHRS+H 
Sbjct  1     MESPSVAVSLAAILASILLFLKSLFGRRRRSLNLPPGPKPWPIIGNLNLISSLPHRSLHA  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGP++ L FGSFPV+V +SV+MAK+ LK+ D++F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPLIHLYFGSFPVIVAASVDMAKLVLKSHDVSFCGRPKIAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             QYGPYW QAR+M  ME+FSA+RLDS+E+IR  E+K++L  L+  S +  PV LKD+L  +
Sbjct  121   QYGPYWRQARKMCIMELFSARRLDSYEYIRVEEVKNLLRDLFKSSGS--PVSLKDHLSNV  178

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LGK YL+ SEG+IV+P EFK MLDE+FLL+G +NIGD IPWLDFLDLQGYI
Sbjct  179   SLNVISRMVLGKKYLDRSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLDFLDLQGYI  238

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K +++K DRFLEHVLDEH  RR  EG+ FVA DMVDVLL+ ADDPN+EVK+ER+GVK
Sbjct  239   KRMKKISRKFDRFLEHVLDEHNERRRREGENFVAVDMVDVLLELADDPNLEVKLERRGVK  298

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  299   AFTQDLIAGGTESSAV  314



>ref|XP_008460308.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=508

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 260/306 (85%), Gaps = 3/306 (1%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
              VAW++T+AI+L+++ +RRRKL+LPPGPKPWP+IGNL+LIG+LPH+SIH LS+KYGPIM 
Sbjct  9     VVAWIATLAILLLSRRIRRRKLNLPPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMH  68

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGSFPVVVGSSVEMAKIFLKT D+NFV RPK  AGK+ TYNYS++TWSQYGPYW QAR
Sbjct  69    LRFGSFPVVVGSSVEMAKIFLKTQDLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQAR  128

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             +M  ME+FSA+RLDS+E+IR  E+ ++L ++Y   S  + + +KDYL  ++LNVISRM L
Sbjct  129   KMCLMELFSARRLDSYEYIRKEEMNALLREIYK--SCGEVIKIKDYLSTVSLNVISRMVL  186

Query  661   GKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKL  840
             GK Y +ESE  IV+P EFKKMLDE+FLLSG LNIGD IPW+DFLDLQGY+K+ KAL+KK 
Sbjct  187   GKKYTDESENGIVSPDEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKF  246

Query  841   DRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGG  1020
             DRFLEHVLDEH  RR    D +VAKDMVDVLLQ ADDP++EVK+ER GVKAFT DL+AGG
Sbjct  247   DRFLEHVLDEHNERRKGVED-YVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAGG  305

Query  1021  TESSTV  1038
             TESS V
Sbjct  306   TESSAV  311



>ref|XP_010917481.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=511

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 252/316 (80%), Gaps = 3/316 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKH-LRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+ +    A L++I  +L +    RRRKL+LPPGPKPWPIIGNLNLI +LPHRS+H 
Sbjct  1     MESPSLVVSLAAILASILFLLRSLFGRRRRKLNLPPGPKPWPIIGNLNLISSLPHRSLHA  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGP+M L FGSFPV+V +SV++AK+ LKT D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPLMHLYFGSFPVIVAASVDVAKLVLKTHDVTFCGRPKTAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             QYGPYW QAR+M  ME+FSAKRLDS+E+IR  E+K++L  L+N  S  + V LKD+L  +
Sbjct  121   QYGPYWRQARKMCIMELFSAKRLDSYEYIRVEEVKNLLRDLFN--SAGRSVNLKDHLSNV  178

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LGK YL +SEG+IV+P EFK MLDE+FLL+G +NIGD IPWL FLDLQGYI
Sbjct  179   SLNVISRMVLGKKYLVKSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLGFLDLQGYI  238

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K + KK DRFLEHVLDEH  RR  EG+ FVA DMVDVLLQ ADDP++EVK+ER GVK
Sbjct  239   KRMKKVGKKFDRFLEHVLDEHNERRRREGENFVAMDMVDVLLQLADDPSLEVKLERHGVK  298

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  299   AFTQDLIAGGTESSAV  314



>ref|XP_002303241.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
 gb|EEE78220.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
Length=512

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 257/318 (81%), Gaps = 6/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW++YA AWL+T+++IL+A  LRRRKL+ PPGPK WPIIGNLNLIG LPHRS+H L
Sbjct  1     METPTWMSYAFAWLATVSLILLASRLRRRKLNPPPGPKSWPIIGNLNLIGELPHRSLHAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQKYGP+MQ++FGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TWS 
Sbjct  61    SQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSAKRL+S+E+IR  EL+++L  L N SS R P+ LKD+L  ++
Sbjct  121   YGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTL-NKSSGR-PINLKDHLADVS  178

Query  634   lNVISRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
             LNVISRM LGK Y    +E+E  IV P EFK+MLDE+FLL+G L+IGD IPW+ FLDLQG
Sbjct  179   LNVISRMVLGKKYTVKSSENEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             YIK+ K L+KK D+F+EHVLDEH +RR  E   +  KDMVDVLLQ A DPN+E+K+ER G
Sbjct  239   YIKRMKTLSKKFDKFMEHVLDEHEARR-KEDKNWEPKDMVDVLLQLASDPNLEIKLERHG  297

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAF+ DL+AGGTESS V
Sbjct  298   VKAFSQDLIAGGTESSAV  315



>ref|XP_010685305.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 259/318 (81%), Gaps = 5/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME PTW AYA AWL +IA+++++ HLRRR KL+LPPGPKPWPIIGN NLIG+LPHRS+H+
Sbjct  1     MEAPTWAAYAAAWLVSIALVVLSHHLRRRRKLNLPPGPKPWPIIGNFNLIGSLPHRSLHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             L++ YGP+M L+FGS PV+VGSSV+MAK+FL+T D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LTKTYGPLMMLKFGSVPVLVGSSVKMAKLFLRTYDVAFAGRPKTSAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             QYGPYW QAR+M  ME+FS KRL+SFE+IR  EL S+L  ++N +   +P++LKD+L  L
Sbjct  121   QYGPYWRQARKMCLMELFSVKRLESFEYIRVEELNSVLRAIFNTNG--EPMMLKDHLSTL  178

Query  631   nlNVISRMALGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
             +LNVISRM  GK YL+E+  E  IV P EFKKMLDE+FLL+G  N+GD IP L +LD+QG
Sbjct  179   SLNVISRMVFGKRYLDETNDEKPIVTPDEFKKMLDELFLLNGVFNLGDWIPCLKYLDVQG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             Y+K+ K L KK DRF+EHVLDEH +R+V E + +V KDMVDVLLQ ADDPN+EVK+ER G
Sbjct  239   YVKRMKVLAKKFDRFMEHVLDEHNARKVKEKEDWVPKDMVDVLLQLADDPNLEVKLERIG  298

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAF+ DL+AGGTESS V
Sbjct  299   VKAFSQDLIAGGTESSAV  316



>ref|XP_010932407.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=513

 Score =   385 bits (990),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR---RRKLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME P+W +Y    L++I ++L    LR    RK +LPPGPKPWP+IGNLNLIG+LPHRS+
Sbjct  1     MELPSWASYLATVLASILLLLQPLFLRRRRHRKPNLPPGPKPWPVIGNLNLIGSLPHRSL  60

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS KYGP+M L FGSFPV+V SSV+MAK+ LKT D+ F  RPK  AG++ TYNYSN+T
Sbjct  61    HALSHKYGPLMHLYFGSFPVIVASSVDMAKLILKTHDVTFCGRPKTAAGRYTTYNYSNIT  120

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf  624
             WSQYG YW QAR+M  ME+FSA+RLDS+E+IR  E K++L  L+N  S+ +PV LKD+L 
Sbjct  121   WSQYGAYWRQARKMCVMELFSARRLDSYEYIRVEEAKNLLRDLFN--SSGRPVNLKDHLS  178

Query  625   llnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
              ++LNVISRM LGK YL+ESE ++V+P EFK MLDE+FLL+G +NIGD +PWLDFLDLQG
Sbjct  179   NVSLNVISRMVLGKKYLDESEDAVVSPEEFKAMLDELFLLNGVMNIGDSMPWLDFLDLQG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             YI++ K L KK DRFLEHV+DEH  RR  EG+KFVA+DMVDVLLQ ADDP +EVK+ER+G
Sbjct  239   YIRRMKKLGKKFDRFLEHVVDEHNERRRREGEKFVARDMVDVLLQLADDPTLEVKLERRG  298

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAFT D++AGGTESS +
Sbjct  299   VKAFTQDMIAGGTESSAM  316



>ref|XP_008342571.1| PREDICTED: cytochrome P450 71A1-like [Malus domestica]
Length=511

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 215/316 (68%), Positives = 257/316 (81%), Gaps = 3/316 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME     AY  AWL  +A+IL+++   R  KL+LPPGPKPWPIIGNLNLI  LPHRS+H+
Sbjct  1     MEATYVGAYVAAWLGVLALILLSRRRLRHPKLNLPPGPKPWPIIGNLNLISHLPHRSVHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             L+ KYGPIMQL+FGS+PVVVGSSVEMAK FLKT D+ F  RPK  AGKH TYNYS++TWS
Sbjct  61    LALKYGPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M   E+FS KRL+S+E+IR  E+ ++L  LY+ S++   VLLKD+L  +
Sbjct  121   PYGPYWRQARKMCITELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--VLLKDHLSTV  178

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LGK Y +E++ +IV+P EFKKMLDE+FLLSG LNIGD IPWLDFLDLQGYI
Sbjct  179   SLNVISRMVLGKKYTDETKDAIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYI  238

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K L+KKLDRFLEHVLDEH+++R V G  FVAKDMVDVLLQ ADDPN+EVK+ER GVK
Sbjct  239   KRMKTLSKKLDRFLEHVLDEHITKREVGGKDFVAKDMVDVLLQLADDPNLEVKLERHGVK  298

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  299   AFTQDLIAGGTESSAV  314



>gb|KHG15722.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 255/317 (80%), Gaps = 5/317 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR-RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+W++Y +AWL+T+A+IL++   R RRKL+LPPGPKPWP+IGNL+LIG+LPHRSIH 
Sbjct  1     MESPSWVSYLIAWLATLALILLSLRFRPRRKLNLPPGPKPWPVIGNLDLIGSLPHRSIHS  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGP+MQL+FGSFPVVV SSVEMAK FLKT D+ F  RPK  AG++ TYNYS++TWS
Sbjct  61    LSQKYGPLMQLKFGSFPVVVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M   E+FSAKRL+S+E+IR  E+K +L   Y  S    P++LKD+L  L
Sbjct  121   PYGPYWRQARKMCMTELFSAKRLESYEYIRREEMKLLLKGFYESSGV--PIVLKDHLSDL  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +LNVISRM  GK Y   + E  IV P EFK+MLDE+FLL+G L+IGD IPWL FLDLQG 
Sbjct  179   SLNVISRMVFGKKYTEGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQGN  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             IK+ KAL+KK D+FLEHVLDEH +RR    D ++AKDMVDVLLQ ADDPN++VK+ER GV
Sbjct  239   IKRMKALSKKFDKFLEHVLDEHNARRRDVKD-YIAKDMVDVLLQLADDPNLDVKLERHGV  297

Query  988   KAFTLDLLAGGTESSTV  1038
             KAF+ DL+AGGTESS V
Sbjct  298   KAFSQDLIAGGTESSAV  314



>ref|XP_009401319.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/316 (66%), Positives = 255/316 (81%), Gaps = 5/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P W+  +   L  + + L A   RRRKL+LPPGP+ WPIIGNLNLIG+LPHRS+H L
Sbjct  1     MELPPWVMCSTIIL--VIVFLRALAGRRRKLNLPPGPRAWPIIGNLNLIGSLPHRSLHAL  58

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQKYGPIM L+FGSFPVVVGSSVEMAK FLKT D++FV RPK  AGK+ TYNYS++TWS 
Sbjct  59    SQKYGPIMYLRFGSFPVVVGSSVEMAKFFLKTHDVSFVSRPKTAAGKYTTYNYSDITWSP  118

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  +E+FSAKRL+S+E+IR  E++++L  L+   S+   VLLKD+L  ++
Sbjct  119   YGPYWRQARKMCLLELFSAKRLESYEYIRVEEVRALLRDLFR--SSGGIVLLKDHLSTVS  176

Query  634   lNVISRMALGKSYLNESE-GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             LNVISRM LGK YL+ +E  +IV+P EFK+MLDE+FLL+G +NIGD IPWLD LDLQGYI
Sbjct  177   LNVISRMVLGKKYLDRTEVAAIVSPEEFKEMLDELFLLNGVMNIGDSIPWLDGLDLQGYI  236

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             ++ K L+KK DRFLEHVLDEH  RR  EG+ FVA+DMVDVLLQ ADDPN++VK+ER GVK
Sbjct  237   RRMKKLSKKFDRFLEHVLDEHNERRQREGEGFVARDMVDVLLQLADDPNLDVKLERHGVK  296

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  297   AFTQDLIAGGTESSAV  312



>gb|ADC34701.1| flavonoid 3' hydroxylase [Actinidia chinensis]
Length=511

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 259/316 (82%), Gaps = 3/316 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+W AYAVAWL+T +++L++ HLRRR KL+LPPGPKPWPIIGNLNLIG+LPHRS+HD
Sbjct  1     METPSWAAYAVAWLATASLLLLSAHLRRRRKLNLPPGPKPWPIIGNLNLIGSLPHRSLHD  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQ+YGPIM L+FGSFPVVVGSSV  AK FLKTMD+ F  RPK  AGKH TYNYS++TWS
Sbjct  61    LSQQYGPIMHLRFGSFPVVVGSSVAAAKTFLKTMDVTFASRPKTAAGKHTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YG YW QAR+M   E+FS KRL+S+E+IR  E++S++ ++Y  + T  P+++KD L  +
Sbjct  121   PYGAYWRQARKMCLTELFSTKRLESYEYIRIEEMRSLIKEIYQSAGT--PIMIKDNLSTV  178

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LG+ YL+ SE S+V P +FKKMLDE+FLL+G  NIGD IPW+DFLDLQG +
Sbjct  179   SLNVISRMVLGRRYLDASESSVVTPEDFKKMLDELFLLNGVFNIGDSIPWIDFLDLQGNV  238

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K + KK D+FLEHVLDEH  +R  EG  FVAKDMVDVLLQ ADDPN+++K+ER GVK
Sbjct  239   KRMKVVAKKFDKFLEHVLDEHNEKRREEGVGFVAKDMVDVLLQLADDPNLDIKLERHGVK  298

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DLLAGGTESS V
Sbjct  299   AFTQDLLAGGTESSAV  314



>ref|XP_004303698.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   377 bits (969),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 237/284 (83%), Gaps = 4/284 (1%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWPIIGNLNLIG LPH SIH LSQKYGPIMQL+FGSFPVVVGSSVEMAK FLK
Sbjct  33    NLPPGPKPWPIIGNLNLIGHLPHLSIHTLSQKYGPIMQLKFGSFPVVVGSSVEMAKAFLK  92

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D+ F  RPK  AGKH TYNYS++TWS YGPYW QAR+M  ME+FS KRL+S+E+IR  
Sbjct  93    THDVTFAGRPKFAAGKHTTYNYSDITWSPYGPYWRQARKMCIMELFSNKRLESYEYIRRE  152

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKML  726
             E+ ++L  LY  S+T   VLLKD+L  ++LNVISRM LGK Y ++SE +IV+P EFKKML
Sbjct  153   EMGALLRGLYESSNTN--VLLKDHLSTVSLNVISRMVLGKKYTDDSEDAIVSPDEFKKML  210

Query  727   DEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKF  906
             DE+FLLSG LNIGD IPWLDFLDLQGYIK+ KAL+KKLDRFLEHVLDEH+  +  +G  F
Sbjct  211   DELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKALSKKLDRFLEHVLDEHIENKKAKG--F  268

Query  907   VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VA DMVDVLLQ ADDPN+EVK+ER GVKAFT DL+AGGTESS V
Sbjct  269   VATDMVDVLLQLADDPNLEVKLERHGVKAFTQDLIAGGTESSAV  312



>gb|AGT17102.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=341

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 252/321 (79%), Gaps = 6/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW ++    L+T+ ++      RRR  +LPPGPKPWPIIGNLNL+G LPHRSIH+L
Sbjct  1     MELPTWASFLGVVLATVMLLKAILGRRRRVYNLPPGPKPWPIIGNLNLMGALPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+KYGP+MQL+FGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TWS 
Sbjct  61    SRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L++ S + + V+LKD+L  ++
Sbjct  121   YGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDHLSTVS  180

Query  634   lNVISRMALGKSYLNESE----GSI--VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LNVI+RM LGK YL++ E    GS+    P EFK MLDE+FLL+G LNIGD IPWLD++D
Sbjct  181   LNVITRMVLGKKYLDKDEVASAGSVTMTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  240

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L+K  DRFLEHV++EH  RR+ EG  FVAKDMVDVL+Q ADDP +EV+++
Sbjct  241   LQGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKDFVAKDMVDVLMQIADDPTLEVELD  300

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+ VKAFT DL+AGGTESS V
Sbjct  301   RESVKAFTQDLIAGGTESSAV  321



>emb|CDP12827.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 252/314 (80%), Gaps = 4/314 (1%)
 Frame = +1

Query  100   GPTWLAYAVAWLSTIAIIL-IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLS  276
              P W A A+ W++T+ II  ++KH  ++KL+LPPGP+ WPIIGNLNLIGTLPHRS+H LS
Sbjct  5     SPNWAACALVWVATVVIITQLSKHFHQKKLNLPPGPRQWPIIGNLNLIGTLPHRSLHHLS  64

Query  277   QKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQY  456
               YGP+M LQFGSFPVVVGSSVEMAK+FLKTMD+ F  RPK  AGK++TYNYS++ WS Y
Sbjct  65    LTYGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDLTFAGRPKTAAGKYITYNYSDLLWSPY  124

Query  457   GPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnl  636
             GPY  QAR++F  E+FSAKRL+S+EHI+  E+ S+L +L+   S+ +PV+LKDYL   +L
Sbjct  125   GPYCCQARKIFLTELFSAKRLESYEHIQVEEMNSLLLQLFK--SSGKPVVLKDYLSTGSL  182

Query  637   NVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             NVISRM LGK+Y++ESE SIV P EF++M+DE FLL+G  NIGD IPW+DFLDLQGYIK+
Sbjct  183   NVISRMVLGKTYIDESENSIVTPEEFRQMMDEFFLLTGVFNIGDFIPWIDFLDLQGYIKR  242

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              K L+KK DRFLEHVLDEH ++R  E +  V+KD+VDVLL  ADDP +EVK+ER+ VKA 
Sbjct  243   MKILSKKFDRFLEHVLDEHNAQRKDETN-CVSKDLVDVLLGLADDPTLEVKLERREVKAL  301

Query  997   TLDLLAGGTESSTV  1038
             TLDLL  GTE+S +
Sbjct  302   TLDLLTAGTETSAI  315



>ref|XP_010911364.1| PREDICTED: cytochrome P450 750A1-like [Elaeis guineensis]
Length=318

 Score =   369 bits (946),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 244/305 (80%), Gaps = 5/305 (2%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAIILIAKHLR---RRKLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
            ME P+W +Y    L++I ++L    LR    RK +LPPGPKPWP+IGNLNLIG+LPHRS+
Sbjct  1    MELPSWASYLATVLASILLLLQPLFLRRRRHRKPNLPPGPKPWPVIGNLNLIGSLPHRSL  60

Query  265  HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
            H LS KYGP+M L FGSFPV+V SSV+MAK+ LKT D+ F  RPK  AG++ TYNYSN+T
Sbjct  61   HALSHKYGPLMHLYFGSFPVIVASSVDMAKLILKTHDVTFCGRPKTAAGRYTTYNYSNIT  120

Query  445  WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf  624
            WSQYG YW QAR+M  ME+FSA+RLDS+E+IR  E K++L  L+N  S+ +PV LKD+L 
Sbjct  121  WSQYGAYWRQARKMCVMELFSARRLDSYEYIRVEEAKNLLRDLFN--SSGRPVNLKDHLS  178

Query  625  llnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
             ++LNVISRM LGK YL+ESE ++V+P EFK MLDE+FLL+G +NIGD +PWLDFLDLQG
Sbjct  179  NVSLNVISRMVLGKKYLDESEDAVVSPEEFKAMLDELFLLNGVMNIGDSMPWLDFLDLQG  238

Query  805  YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
            YI++ K L KK DRFLEHV+DEH  RR  EG+KFVA+DMVDVLLQ ADDP +EVK+ER+G
Sbjct  239  YIRRMKKLGKKFDRFLEHVVDEHNERRRREGEKFVARDMVDVLLQLADDPTLEVKLERRG  298

Query  985  VKAFT  999
            VKAFT
Sbjct  299  VKAFT  303



>gb|ADO16185.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=513

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 251/312 (80%), Gaps = 3/312 (1%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRR-RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             ++  Y VAWL+T+A+++I++  RR RKL+ PPGPKPWPIIGNLNLIGTLPHRSIHDLSQK
Sbjct  7     SYTYYTVAWLATVALLIISRRTRRQRKLNPPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  66

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YG IMQL+F SF V+V SS E AKI LKT D++F  RPK  AGK+ TYNYSN+TWS YG 
Sbjct  67    YGDIMQLKFRSFNVLVASSAEAAKIILKTQDVSFACRPKTAAGKYSTYNYSNITWSPYGA  126

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR++  ME+FSAKRL+S+E+IR  E  S+L K+Y  SS  + +LLKD L  ++LNV
Sbjct  127   YWRQARKICLMELFSAKRLESYEYIRVEETNSLLKKIY--SSVGEEILLKDMLSDVSLNV  184

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK YL+ESE S V+P EFKKMLDE+ LL+G  NIGD IPW+DFLDLQGY+K+ K
Sbjct  185   ISRMVLGKKYLDESEDSKVSPNEFKKMLDELLLLNGVFNIGDSIPWIDFLDLQGYVKRMK  244

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L KK DRFLEHVLDEH  RR  EG+KFVA DMVDVLLQ A+DP+++VK+ER GVKAF  
Sbjct  245   ILGKKFDRFLEHVLDEHNERRKAEGEKFVATDMVDVLLQLAEDPDLDVKLERHGVKAFIQ  304

Query  1003  DLLAGGTESSTV  1038
             D+L GGTE+STV
Sbjct  305   DMLGGGTETSTV  316



>ref|XP_008463991.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=514

 Score =   375 bits (963),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 240/286 (84%), Gaps = 6/286 (2%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWP+IGNL+LIG+LPH+SIH LS+KYGPIM L+FGSFPVVVGSSVEMAKIFLK
Sbjct  35    NLPPGPKPWPVIGNLHLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLK  94

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D+NFV RPK  AGK+ TYNYS++TWSQYGPYW QAR+M  ME+FSA+RLDS+E+IR  
Sbjct  95    TQDLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKE  154

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE-SEGSIVNPGEFKKM  723
             E+  ++ ++Y   S  + + +KDYL  ++LNVISRM LGK Y +E SE  IV+P EFKKM
Sbjct  155   EMNGLVREIYK--SCGEVIKVKDYLSTVSLNVISRMVLGKKYTDESSENGIVSPDEFKKM  212

Query  724   LDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-D  900
             LDE+FLLSG LNIGD IPW+DFLDLQGY+K+ KAL+KK DRFLEHVLDEH  RR  +G  
Sbjct  213   LDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLEHVLDEHNERR--KGVQ  270

Query  901   KFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              +VAKDMVDVLLQ ADDPN+EVK+ER GVKAFT DL+AGGTESS V
Sbjct  271   NYVAKDMVDVLLQLADDPNLEVKLERHGVKAFTQDLIAGGTESSAV  316



>emb|CDP17013.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 245/310 (79%), Gaps = 4/310 (1%)
 Frame = +1

Query  115   AYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPI  294
             AYA  WL+T+ I L+ +   ++KL+LPPGPKPWPI+GNLNLIGTLPHRSIH LS  YGP+
Sbjct  13    AYAATWLATMVIALLCRRFHQKKLNLPPGPKPWPIVGNLNLIGTLPHRSIHQLSLTYGPL  72

Query  295   MQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQ  474
             M L+FGSFPVVVGSSVEMAK+FLKTMD  F DRPK +AGK+  YNYSN+ WS YGPYW Q
Sbjct  73    MHLRFGSFPVVVGSSVEMAKVFLKTMDATFADRPKTIAGKYTGYNYSNILWSPYGPYWRQ  132

Query  475   ARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRM  654
              R+M  ME+FSAKRL+S+EHIR  E+ S+L  L+   S  +PVLLKD+L  + LNVISRM
Sbjct  133   VRKMCLMELFSAKRLESYEHIRVEEMNSLLLGLFQ--SLGKPVLLKDHLTTMTLNVISRM  190

Query  655   ALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALN  831
              LGK YL++S + SIV P EF KM+DE+ LL+G  NIGD IPWL+FLDLQGYIK+ KAL+
Sbjct  191   VLGKRYLDQSDQNSIVTPEEFVKMMDELLLLNGVFNIGDSIPWLNFLDLQGYIKRLKALS  250

Query  832   KKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDL  1008
             KK D FLEHVLDEH + R+   ++  V+KDMVDVLL  A+D  +EVK+ER GVKAFTLDL
Sbjct  251   KKFDWFLEHVLDEHNAARMANDEQNRVSKDMVDVLLDLAEDQTLEVKLERHGVKAFTLDL  310

Query  1009  LAGGTESSTV  1038
             L GGTESS +
Sbjct  311   LVGGTESSAM  320



>ref|XP_004303697.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 257/315 (82%), Gaps = 4/315 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             MEG  W++YA AWL  +A +L+A  LRRRKL+LPPGPKPWPIIGNLNL+G LPHRS+H+L
Sbjct  1     MEGTAWVSYAAAWLGALAFLLLALRLRRRKLNLPPGPKPWPIIGNLNLMGHLPHRSLHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQKYGPIMQL+FGSFPVVVGSS EMAK FLKT D+   DRPK  AGK+ TYNYSN+TWS 
Sbjct  61    SQKYGPIMQLRFGSFPVVVGSSAEMAKAFLKTHDVAVADRPKIAAGKYTTYNYSNITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSAKRL+S+E+IR  E+ ++L  LY  S+T   +LLK +L  L+
Sbjct  121   YGPYWRQARKMCLMELFSAKRLESYEYIRKEEMNALLRGLYKSSNTN--ILLKAHLSDLS  178

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LNVISRM LGK Y +ESE +IV P EFKKMLDE+FLL+G LNIGD IPWL+FLDLQGYIK
Sbjct  179   LNVISRMVLGKKYTDESENAIVRPDEFKKMLDELFLLTGVLNIGDSIPWLNFLDLQGYIK  238

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + KAL+KK DRFLEHVLDEH+S    +   FVA DMVDVLLQ A DPN+EVK+ER GVKA
Sbjct  239   RMKALSKKFDRFLEHVLDEHISNS--KAPDFVATDMVDVLLQLAADPNLEVKLERHGVKA  296

Query  994   FTLDLLAGGTESSTV  1038
             F+ DLLAGGTESS +
Sbjct  297   FSQDLLAGGTESSAM  311



>ref|XP_004168558.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=508

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 257/307 (84%), Gaps = 5/307 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
               AW++T+AI+L+++ LRRRKL+LPPGPKPWP+IGNL+LIG+LPH+SIH LS+KYGPIM 
Sbjct  9     VAAWIATLAILLLSRRLRRRKLNLPPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMH  68

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGSFPVVVGSSVEMAKIFLKT D+NFV RPK  AGK+ TY+YSN+TWSQYGPYW QAR
Sbjct  69    LRFGSFPVVVGSSVEMAKIFLKTQDLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQAR  128

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             +M  ME+FSAKRLDS+E+IR  E+  +L ++Y   S  + + +KDYL  ++LNVISRM  
Sbjct  129   KMCLMELFSAKRLDSYEYIRKEEMNGLLGEIYK--SCGEVIKVKDYLSTVSLNVISRMVX  186

Query  661   GKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKL  840
             GK Y + SE  IV+P EFKKMLDE+FLLSG LNIGD IPW+DFLDLQGY+K+ KAL+KK 
Sbjct  187   GKKYTDGSENGIVSPDEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKF  246

Query  841   DRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAG  1017
             DRFLE VLDEH  RR  +G + +VAKDMVDVLLQ ADDP++EVK+ER GVKAFT DL+AG
Sbjct  247   DRFLERVLDEHNERR--KGVENYVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAG  304

Query  1018  GTESSTV  1038
             GTESS V
Sbjct  305   GTESSAV  311



>ref|XP_002462455.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
 gb|EER98976.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
Length=517

 Score =   373 bits (958),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 250/319 (78%), Gaps = 4/319 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII-LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME PTW ++    L+T+ ++  I     RR  +LPPGPKPWPIIGNLNL+G LPHRSIH+
Sbjct  1     MELPTWASFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLNLMGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LS+KYGP+MQLQFGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TWS
Sbjct  61    LSRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L++ S + + V+LKDYL  +
Sbjct  121   PYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDYLSTV  180

Query  631   nlNVISRMALGKSYLNESE---GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQ  801
             +LNVI+RM LGK YL++ E   GS+  P EFK MLDE+FLL+G LNIGD IPWLD++DLQ
Sbjct  181   SLNVITRMVLGKKYLDKEEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQ  240

Query  802   GYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             GYIK+ K L K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV++ R+
Sbjct  241   GYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELNRE  300

Query  982   GVKAFTLDLLAGGTESSTV  1038
              VKAFT DL+AGGTESS V
Sbjct  301   SVKAFTQDLIAGGTESSAV  319



>ref|XP_004956938.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   373 bits (958),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 250/321 (78%), Gaps = 6/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME P W ++    L+T+ ++  ++ +H RRR  +LPPGPKPWPIIGNL+L+G LPHRSIH
Sbjct  1     MELPPWASFLGVVLATVMLLKAIVGRHRRRRAYNLPPGPKPWPIIGNLDLVGALPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
             +LS+KYGP+MQLQFGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TW
Sbjct  61    ELSRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L+ VS +   V+LKDYL  
Sbjct  121   SPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGCAVMLKDYLST  180

Query  628   lnlNVISRMALGKSYLNE----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             ++LNVI+RM LGK YL++       S+  P EFK MLDE+FLL+G LNIGD IPWLD++D
Sbjct  181   VSLNVITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  240

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV++ 
Sbjct  241   LQGYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELN  300

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+ VKAFT DL+AGGTESS V
Sbjct  301   RESVKAFTQDLIAGGTESSAV  321



>gb|EAZ09259.1| hypothetical protein OsI_31532 [Oryza sativa Indica Group]
Length=514

 Score =   373 bits (957),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 246/313 (79%), Gaps = 3/313 (1%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P W ++    L+T+  +       RR  +LPPGPKPWP+IGNLNL+GTLPHRSIH+LS+K
Sbjct  6     PPWASFVAVVLATVLFLKTVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGP+M L+FGSFPVVVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++TWS YG 
Sbjct  66    YGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGA  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L+  +     V+LKDYL  ++LNV
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGV--VVLKDYLSTVSLNV  183

Query  643   ISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             I+RM LGK YL+ ++ GS+  P EFK MLDE+FLL+G LNIGD IPWLD+LDLQGYIK+ 
Sbjct  184   ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             K L K  DRFLEHV+DEH  RR  EG+ FVAKDMVDVLLQ AD+PN+EVK++R+GVKAFT
Sbjct  244   KKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREGVKAFT  303

Query  1000  LDLLAGGTESSTV  1038
              DL+AGGTESS V
Sbjct  304   QDLIAGGTESSAV  316



>ref|XP_004144428.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=503

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/283 (70%), Positives = 238/283 (84%), Gaps = 5/283 (2%)
 Frame = +1

Query  193   PPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTM  372
             PPGPKPWP+IGNL+LIG+LPH+SIH LS+KYGPIM L+FGSFPVVVGSSVEMAKIFLKT 
Sbjct  28    PPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  87

Query  373   DINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHEL  552
             D+NFV RPK  AGK+ TY+YSN+TWSQYGPYW QAR+M  ME+FSA+RLDS+E+IR  E+
Sbjct  88    DLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKEEM  147

Query  553   KSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDE  732
               ++ ++Y   S  + + +KDYLF ++LNVISRM LGK Y + SE  IV+P EFKKMLDE
Sbjct  148   NGLIREIYK--SCGEVIKVKDYLFAVSLNVISRMVLGKKYTDGSENGIVSPDEFKKMLDE  205

Query  733   VFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFV  909
             +FLLSG LNIGD IPW+DFLDLQGY+K+ KAL+KK DRFLE VLDEH  RR  +G + +V
Sbjct  206   LFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLERVLDEHNERR--KGVENYV  263

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             AKDMVDVLLQ ADDP++EVK+ER G+KAFT DL+AGGTESS V
Sbjct  264   AKDMVDVLLQLADDPDLEVKLERHGIKAFTQDLIAGGTESSAV  306



>ref|XP_006665048.1| PREDICTED: cytochrome P450 71A1-like [Oryza brachyantha]
Length=517

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 246/316 (78%), Gaps = 6/316 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P W ++    L+T+ ++       RR  +LPPGPKPWP+IGNLNL+GTLPHRSIH+LS++
Sbjct  6     PPWASFVGVVLATVLLLKAVFGRGRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHELSKR  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIM L+FGSFPVVVGSSVEMAK FLKT D+ F DRPK  AGK+ TYNYS++TWS YG 
Sbjct  66    YGPIMSLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKYTTYNYSDITWSSYGA  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M   E+FSAKRL+S+E+IR  E+ ++L  L+  +     V+LKDYL  ++LNV
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRAEEVSALLRDLHGAAGGV--VMLKDYLSTVSLNV  183

Query  643   ISRMALGKSYLNES----EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             I+RM LGK YL++      GS+  P EFK MLDE+FLL+G LNIGD IPWLD+LDLQGYI
Sbjct  184   ITRMVLGKKYLDKETTAQNGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYI  243

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K L+K  DRFLEHV+DEH  RR +EG  FVAKDMVDVLLQ ADDPN+EVK++R+GVK
Sbjct  244   KRMKKLSKMFDRFLEHVVDEHNERRRLEGQSFVAKDMVDVLLQFADDPNLEVKLKREGVK  303

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  304   AFTQDLIAGGTESSAV  319



>ref|NP_001063285.1| Os09g0441400 [Oryza sativa Japonica Group]
 dbj|BAD36161.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38066.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF25199.1| Os09g0441400 [Oryza sativa Japonica Group]
Length=514

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 246/313 (79%), Gaps = 3/313 (1%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P W ++    L+T+  +       RR  +LPPGPKPWP+IGNLNL+GTLPHRSIH+LS+K
Sbjct  6     PPWASFVGVVLATVLFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGP+M L+FGSFPVVVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++TWS YG 
Sbjct  66    YGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGA  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L+  +     V+LKDYL  ++LNV
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGV--VVLKDYLSTVSLNV  183

Query  643   ISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             I+RM LGK YL+ ++ GS+  P EFK MLDE+FLL+G LNIGD IPWLD+LDLQGYIK+ 
Sbjct  184   ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             K L K  DRFLEHV+DEH  RR  EG+ FVAKDMVDVLLQ AD+PN+EVK++R+GVKAFT
Sbjct  244   KKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREGVKAFT  303

Query  1000  LDLLAGGTESSTV  1038
              DL+AGGTESS V
Sbjct  304   QDLIAGGTESSAV  316



>ref|XP_010033730.1| PREDICTED: cytochrome P450 71A1-like [Eucalyptus grandis]
 gb|KCW53529.1| hypothetical protein EUGRSUZ_J02808 [Eucalyptus grandis]
Length=509

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 238/284 (84%), Gaps = 3/284 (1%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWPIIGNLNLIG+LPHRS+H+L++ YGP+MQ+QFGSFPVVVGSSVEMA+ FLK
Sbjct  32    NLPPGPKPWPIIGNLNLIGSLPHRSLHELTKTYGPLMQVQFGSFPVVVGSSVEMARAFLK  91

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D+ F  RPK  AGK+ TYNYS++TWS YGPYW QAR++  ME+FSAKRL+S+E+IRT 
Sbjct  92    THDVTFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKLCIMELFSAKRLESYEYIRTE  151

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKML  726
             EL S+L  LY VS   Q + LKD+L  L+LNVISRM LGK Y  E+E SIV P EFKKML
Sbjct  152   ELMSLLGSLY-VSRGAQ-LTLKDHLTDLSLNVISRMVLGKKYTEETENSIVKPDEFKKML  209

Query  727   DEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKF  906
             DE+FLL+GALNIGD IPWLDFLDLQGYIK+ KAL+KK DRFLEHVLDEH  RR    + +
Sbjct  210   DELFLLNGALNIGDSIPWLDFLDLQGYIKRMKALSKKFDRFLEHVLDEHDERRRGVPN-Y  268

Query  907   VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VAKDMVDVLLQ ADDPN++VK+ER+GVK FT DL+AGGTESS V
Sbjct  269   VAKDMVDVLLQFADDPNLDVKLERKGVKGFTQDLIAGGTESSAV  312



>emb|CDP17538.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 242/301 (80%), Gaps = 4/301 (1%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             +W AYAVAWL+T+ I L+ +   ++KL+LPPGPKPWPI+GNLNLIGTLPHRS+H LS  Y
Sbjct  10    SWAAYAVAWLATMVIALLCRRFHQKKLNLPPGPKPWPIVGNLNLIGTLPHRSLHQLSLTY  69

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GP+M L+FGSFPVVVGSS+EMAK+FLKTMD+ F DRPK  AGK+ +YN+S++ WS YGPY
Sbjct  70    GPLMHLRFGSFPVVVGSSMEMAKVFLKTMDVTFADRPKTAAGKYTSYNFSDIIWSPYGPY  129

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FSAKRL+S+EHIR  E+ S+L  L+   S  +PVLLKDYL  + LNVI
Sbjct  130   WRQARKMCLMELFSAKRLESYEHIRVEEMNSLLLGLFQ--SLGKPVLLKDYLTTMTLNVI  187

Query  646   SRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             SRM LGK YL+ES + SI+ P EF KM+DE+ LL+G LNIGD IPWL+FLDLQGYIK+ K
Sbjct  188   SRMVLGKRYLDESDQNSIITPKEFVKMMDELLLLNGVLNIGDSIPWLNFLDLQGYIKRLK  247

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             AL+KK D FLEHVLDEH + R+   ++  V+KDMVDVLL  A++  +EVK+ER GVKAFT
Sbjct  248   ALSKKFDWFLEHVLDEHNAARMRNDEQNHVSKDMVDVLLDLAENQTLEVKLERHGVKAFT  307

Query  1000  L  1002
             L
Sbjct  308   L  308



>ref|XP_002460274.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
 gb|EER96795.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
Length=518

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 249/320 (78%), Gaps = 5/320 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME P W ++    L+T+ ++  +I +   RR  +LPPGPKPWPIIGNLNL+G LPHRSIH
Sbjct  1     MELPPWASFLGVVLATVMLLKAIIGRRRSRRVYNLPPGPKPWPIIGNLNLVGALPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
             +LS+KYGP+MQL+FGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TW
Sbjct  61    ELSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR+M   E+FS KRL+S+E+IR  E++++L  L + S + + V+LKDYL  
Sbjct  121   SPYGAYWRQARKMCLTELFSVKRLESYEYIRAAEVRALLRDLNSASGSGRAVMLKDYLST  180

Query  628   lnlNVISRMALGKSYLNESE---GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDL  798
             ++LNVI+RM LGK YL+  E   GS+  P EFK MLDE+FLL+G LNIGD IPWLD++DL
Sbjct  181   VSLNVITRMVLGKKYLDREEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDL  240

Query  799   QGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIER  978
             QGYIK+ K L K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV+++R
Sbjct  241   QGYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELDR  300

Query  979   QGVKAFTLDLLAGGTESSTV  1038
             + VKAFT DL+AGGTESS V
Sbjct  301   ESVKAFTQDLIAGGTESSAV  320



>ref|XP_011071969.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=507

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 246/309 (80%), Gaps = 10/309 (3%)
 Frame = +1

Query  130   WLSTIAIIL----IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
             W S +++I+    + K LRR KL+LPPGP+PWP+IGNLNLIG LPHRSIH+L+QKYGP++
Sbjct  6     WFSCLSLIVFVYVLTKVLRREKLNLPPGPRPWPVIGNLNLIGPLPHRSIHELAQKYGPLI  65

Query  298   QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
              L+FGS  VVVGS+VEMAK+FLKTMD+NF  RP   AGK+  YNY+++TW+ YGPYW QA
Sbjct  66    HLKFGSASVVVGSNVEMAKVFLKTMDVNFASRPVTAAGKYTGYNYTDITWAPYGPYWRQA  125

Query  478   RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMA  657
             RRM  ME+FSAKRL+S+E+IR  E+ S+L  ++      QP+L+KDYL  + LNVISRM 
Sbjct  126   RRMCLMELFSAKRLESYEYIRIEEMNSLLKNMFKCCG--QPILVKDYLSTVTLNVISRMV  183

Query  658   LGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             LGK YL++  E  +V P EFKKMLDE+FLL+G +N+GDLIPW+ FLDLQGY+K+ K ++K
Sbjct  184   LGKRYLDKDIENPVVAPQEFKKMLDELFLLNGVINVGDLIPWISFLDLQGYVKRMKIVHK  243

Query  835   KLDRFLEHVLDEHMS-RRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLL  1011
             K D+FLEHVLDEH   RR +EG  +V++DMVDVLL+ A+DP +EVK+ER GVK   LDLL
Sbjct  244   KFDKFLEHVLDEHQERRRSIEG--YVSRDMVDVLLELAEDPTLEVKLERHGVKGHILDLL  301

Query  1012  AGGTESSTV  1038
             AGGTESSTV
Sbjct  302   AGGTESSTV  310



>ref|XP_004148565.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004165405.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=513

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 262/314 (83%), Gaps = 6/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P+ L+Y   W++T+AI+L+++ LRRRKL+LPPGPKPWP+IGNL+LIG+LPH+SIH LS+K
Sbjct  5     PSCLSYITPWIATLAILLLSRRLRRRKLNLPPGPKPWPVIGNLDLIGSLPHQSIHQLSKK  64

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIM L+FGSFP+VVGSSVEMAK+FLKT D+NF  RPK  AGK+ TYN+SN+TWSQYGP
Sbjct  65    YGPIMHLRFGSFPIVVGSSVEMAKLFLKTQDLNFASRPKTTAGKYTTYNHSNITWSQYGP  124

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW Q R+M  ME+FSA+RLDS+E+IR  E+  ++ ++Y   S  + + +KDYLF ++LNV
Sbjct  125   YWGQLRKMCLMELFSARRLDSYEYIRKEEMNGLIREIYK--SCGEVIKVKDYLFAVSLNV  182

Query  643   ISRMALGKSYLNE-SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             ISRM LGK Y +E SE  IV+P EF+KM+DE+FLL+G LNIGD IPW+DFLDLQGY+K+ 
Sbjct  183   ISRMVLGKKYTDEPSESGIVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRM  242

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             K L+KKLDRFLEHVLDEH  RR  +G + +VAKDMVDVLLQ ADDP++EVK+ER GVKAF
Sbjct  243   KGLSKKLDRFLEHVLDEHKERR--KGVENYVAKDMVDVLLQLADDPDLEVKLERHGVKAF  300

Query  997   TLDLLAGGTESSTV  1038
             T DLL GG ESSTV
Sbjct  301   TQDLLGGGIESSTV  314



>ref|XP_011079634.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=507

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 255/316 (81%), Gaps = 7/316 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P W A  +     + + L+AK +RRRKL+LPPGPKPWP+IGNLNLIG LPHRS+H L
Sbjct  1     METPIWSACLLL---LVFLYLLAKTIRRRKLNLPPGPKPWPVIGNLNLIGPLPHRSLHQL  57

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQKYGP++ LQFGSFPVVVGSSVEMAK+FLKTMD+ F  RPK  AGK+ TYNYS++TWS 
Sbjct  58    SQKYGPLLHLQFGSFPVVVGSSVEMAKVFLKTMDVTFASRPKTAAGKYTTYNYSDITWSP  117

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSAKRL+S+E+IR  E+ S+L  L+   S+ Q VLLKDYL  ++
Sbjct  118   YGPYWRQARKMCLMELFSAKRLESYEYIRVEEMNSLLKSLFK--SSGQSVLLKDYLSTVS  175

Query  634   lNVISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             LNVISRM LGK YL+ ++E ++V+P EFKKMLDE+FLL+G +N+GDLIPW+ FLDLQGY+
Sbjct  176   LNVISRMVLGKRYLDKDNENAVVSPEEFKKMLDELFLLNGVINVGDLIPWISFLDLQGYV  235

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K ++KK DRFLEHVLDEH  RR      +V++DMVDVLL+ A+DP +EVK+ER GVK
Sbjct  236   KRMKIVSKKFDRFLEHVLDEHEERRRRVEG-YVSRDMVDVLLELAEDPTLEVKLERHGVK  294

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DLLAGGTESS V
Sbjct  295   AFTQDLLAGGTESSAV  310



>gb|AGT17103.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=519

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 251/321 (78%), Gaps = 6/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW ++    L+T+ ++      RRR  +LPPGPKPWPIIGNLNL+G LPHRSIH+L
Sbjct  1     MELPTWASFLGVVLATVMLLKAILGRRRRVYNLPPGPKPWPIIGNLNLMGALPHRSIHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+KYGP+MQL+FGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TWS 
Sbjct  61    SRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L++ S + + V+LKD+L  ++
Sbjct  121   YGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDHLSTVS  180

Query  634   lNVISRMALGKSYLNESE----GSI--VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LNVI+RM LGK YL++ E    GS+    P EFK MLDE+FLL+G LNIGD IPWLD++D
Sbjct  181   LNVITRMVLGKKYLDKDEVASAGSVTMTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  240

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L+K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV++ 
Sbjct  241   LQGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKDFVAKDMVDVLLQIADDPTLEVELN  300

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+ VKAFT DL+AGGTESS V
Sbjct  301   RESVKAFTQDLIAGGTESSAV  321



>ref|NP_001147572.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG27961.1| flavonoid 3-monooxygenase [Zea mays]
 tpg|DAA40166.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 252/321 (79%), Gaps = 6/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLH-LPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P W ++    L+T+ ++      R R+++ LPPGPKPWPIIGNL+L+G LPHRSIH+
Sbjct  1     MELPPWASFLGIVLATVMLLKALTGRRSRRMYNLPPGPKPWPIIGNLDLVGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LS+KYGP+MQL+FGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TWS
Sbjct  61    LSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L+  SS+ + V+LKDYL  +
Sbjct  121   PYGAYWRQARKMCLTELFSAKRLESYEYIRADEVRALLRDLHAASSSGRAVMLKDYLSTV  180

Query  631   nlNVISRMALGKSYLNESE-----GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             +LNVI+RM LGK YL++ E     GS+  P EFK MLDE+FLL+G LNIGD IPWLD++D
Sbjct  181   SLNVITRMVLGKKYLDKEEAAAAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  240

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L+K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV+++
Sbjct  241   LQGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELD  300

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+ VKAFT DL+AGGTESS V
Sbjct  301   RESVKAFTQDLIAGGTESSAV  321



>ref|XP_008652774.1| PREDICTED: cytochrome P450 71A1-like [Zea mays]
 tpg|DAA61659.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 250/319 (78%), Gaps = 4/319 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII-LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME PTW ++    L+T+ ++  I     RR  +LPPGPKPWPIIGNL+L+G LPHRSIH+
Sbjct  1     MELPTWASFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLDLVGALPHRSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LS+KYGP+MQL+FGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TWS
Sbjct  61    LSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YG YW QAR+M   E+FSAKRL+S+E+IR  E++ +L  L++ S + + V+LKDYL  +
Sbjct  121   PYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRVLLRDLHSASGSGRAVMLKDYLSTV  180

Query  631   nlNVISRMALGKSYLNESE---GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQ  801
             +LNVI+RM LGK YL+  E   G++  P EFK MLDE+FLL+G LNIGD IPWLD++DLQ
Sbjct  181   SLNVITRMVLGKKYLDREEAAAGAVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQ  240

Query  802   GYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             GYIK+ K L+K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV+++R+
Sbjct  241   GYIKRMKKLSKMFDRFLEHVVEEHHQRRLSEGKGFVAKDMVDVLLQIADDPTLEVELDRE  300

Query  982   GVKAFTLDLLAGGTESSTV  1038
              VKAFT DL+AGGTESS V
Sbjct  301   SVKAFTQDLIAGGTESSAV  319



>ref|XP_007024645.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY27267.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=511

 Score =   369 bits (946),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 254/317 (80%), Gaps = 5/317 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHL-PPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+W +Y  AWL+TIA++L++  LRRR+    PPGPKPWPIIGNLNLIG+LPHRSIH 
Sbjct  1     METPSWASYLAAWLATIALVLLSLRLRRRRKLNLPPGPKPWPIIGNLNLIGSLPHRSIHA  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGPIMQL+FGSFPV+VGSSVEMAK  L+T D+ F  RPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPIMQLRFGSFPVIVGSSVEMAKAILRTHDVAFAGRPKIAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M   E+FSAKRL+S+E+IR  E+  +L  L N+S +  P+ LKD+L  L
Sbjct  121   PYGPYWRQARKMCLTELFSAKRLESYEYIRREEMNLLLKGLCNLSGS--PICLKDHLSSL  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +LNVISRM LGK Y   + E  IV P EFK+MLDE+FLL+G L+IGD IPWL FLDLQGY
Sbjct  179   SLNVISRMVLGKKYTEGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLSFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             IK+ KAL+KK DRFLEHVLDEH +RR    D +VAKDMVDVLLQ ADDP+++VK+ER GV
Sbjct  239   IKRMKALSKKFDRFLEHVLDEHNARRKGVKD-YVAKDMVDVLLQLADDPHLDVKLERHGV  297

Query  988   KAFTLDLLAGGTESSTV  1038
             KAF+ DL+AGGTESS V
Sbjct  298   KAFSQDLIAGGTESSAV  314



>ref|XP_002521317.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF40985.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 254/317 (80%), Gaps = 5/317 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW+AYA  WL+T+A+IL+++ LRRRKL+LPPGPKPWPIIGNLNLIG LPHRS+H L
Sbjct  1     METPTWVAYASVWLATVALILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGALPHRSLHSL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQ YGPIMQL+FGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TWS 
Sbjct  61    SQTYGPIMQLKFGSFPVVVGSSVEMAKAILKTHDVAFAGRPKIAAGKYTTYNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QAR+M  ME+FSAKRL+S+E+IR  EL+ +L  ++   S+  P+ LKD+L  L+
Sbjct  121   YGAYWRQARKMCVMELFSAKRLESYEYIRIEELRLLLKSMF--LSSGNPINLKDHLTDLS  178

Query  634   lNVISRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             LNVISRM LGK Y  +SE    IV P EFK+MLDE+FLL+G L+IGD I WL FLDLQGY
Sbjct  179   LNVISRMVLGKKYTVKSENVDEIVTPEEFKEMLDELFLLNGVLDIGDSISWLAFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             IK+ K ++KK DRFLEHVLDEH +RR    D  VAKDMVDVLLQ ADDPN+E+K+ER GV
Sbjct  239   IKRMKTVSKKFDRFLEHVLDEHDARR-KRVDNHVAKDMVDVLLQLADDPNLEIKLERNGV  297

Query  988   KAFTLDLLAGGTESSTV  1038
             K FT DL+AGGTESS V
Sbjct  298   KGFTQDLIAGGTESSAV  314



>gb|KDP40690.1| hypothetical protein JCGZ_24689 [Jatropha curcas]
Length=511

 Score =   368 bits (945),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 261/318 (82%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME PTW+A++ AW++ +A++L+++ LRRRKLHLPPGPK WPIIGNLNLIG+LPHRS+H L
Sbjct  1     METPTWVAFSTAWVAILALLLLSRRLRRRKLHLPPGPKSWPIIGNLNLIGSLPHRSLHSL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+KYGPIMQL+FGSFPVVVGSSVEMAK  LKT D+NF  RPK  AGK+ T+NYS++TWS 
Sbjct  61    SEKYGPIMQLKFGSFPVVVGSSVEMAKTILKTHDVNFAGRPKTAAGKYTTFNYSDITWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QAR+M  ME+FSAKRL+S+E+IR  EL+S+L  L+   S+   + +KD+L  L+
Sbjct  121   YGPYWRQARKMCVMELFSAKRLESYEYIRVEELRSLLKTLF--LSSGNAINVKDHLSDLS  178

Query  634   lNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             LNVISRM LGK Y   NE+E  IV P EFK+MLDE+FLL+G L+IGD IPWL FLDLQG 
Sbjct  179   LNVISRMVLGKKYTVKNENENEIVTPEEFKEMLDELFLLNGVLDIGDSIPWLAFLDLQGN  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             IK+ K L+KK +RFLEHVLDEH SRR  +G + +VAKDMVD+LLQ A+DPN+EVK+ER G
Sbjct  239   IKRMKVLSKKFNRFLEHVLDEHESRR--KGVENYVAKDMVDILLQLAEDPNLEVKLERNG  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             VK FT D++AGGTESS V
Sbjct  297   VKGFTQDMIAGGTESSAV  314



>ref|XP_011035728.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Populus euphratica]
Length=511

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 255/314 (81%), Gaps = 5/314 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TW++YA AWL+T+++IL+A  LRRRKL+ PPGPKPWPIIGNLNLIG LPHRS+H LSQKY
Sbjct  3     TWVSYAFAWLATVSLILLASRLRRRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQKY  62

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GP+MQ+QFGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TWS YGPY
Sbjct  63    GPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGPY  122

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FSAKRL+S+E+IR  ELK++L  L N SS R P+ LKD+L  ++LNVI
Sbjct  123   WRQARKMCLMELFSAKRLESYEYIRVEELKALLKTL-NKSSGR-PINLKDHLADVSLNVI  180

Query  646   SRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             SRM LGK Y    +E+E  IV P EFK+MLDE+FLL+G L+IGD IPW+ FLDLQGYIK+
Sbjct  181   SRMVLGKKYTVKSSENEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKR  240

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              K L+KK D+F+EHVLDEH SRR  E   +  KDMVDVLLQ A DPN+EVK+ER GVKAF
Sbjct  241   MKTLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLEVKLERHGVKAF  300

Query  997   TLDLLAGGTESSTV  1038
             + DL+AGGTESS V
Sbjct  301   SQDLIAGGTESSAV  314



>ref|XP_011071968.1| PREDICTED: cytochrome P450 71A1 [Sesamum indicum]
Length=507

 Score =   367 bits (942),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 250/318 (79%), Gaps = 11/318 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII-LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME   W     A LS +  + ++AK LRRRKL+LPPGPKPWP+IGNLNLIG+LPH+S+H+
Sbjct  1     MEAKIW----SACLSLLVFVYVLAKILRRRKLNLPPGPKPWPVIGNLNLIGSLPHKSLHE  56

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGP+M LQFGS PVVVGSSVEMAK+ LKTMD+NF  RP+  AGK+ TYNYS++TWS
Sbjct  57    LSQKYGPLMHLQFGSCPVVVGSSVEMAKVILKTMDVNFSSRPRTAAGKYTTYNYSDITWS  116

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPY  QAR+M   E+FS KRL+S+E+IR  E+ SML  LY   S+ QP+ LKDYL  +
Sbjct  117   PYGPYLKQARKMCLTELFSNKRLESYEYIRVEEINSMLKSLYK--SSGQPIFLKDYLSTV  174

Query  631   nlNVISRMALGKSYLN-ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
              L+VISRM LGK YL+ ++E ++V+  EFKKMLDE+  L+G +N+GD+IPWL F DLQGY
Sbjct  175   TLSVISRMVLGKKYLDKDNENAVVSLDEFKKMLDELIYLNGVINVGDVIPWLSFFDLQGY  234

Query  808   IKQTKALNKKLDRFLEHVLDEHMS-RRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             +K+ K ++KKLDRFLEHVLDEH   RR VEG  +V++DMVDVLL+ A+DP +EVK+ER  
Sbjct  235   VKRMKIVSKKLDRFLEHVLDEHQERRRKVEG--YVSRDMVDVLLEQAEDPTLEVKMERHN  292

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKA T DLLAGGTESS V
Sbjct  293   VKALTQDLLAGGTESSAV  310



>gb|KHF98582.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   365 bits (938),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 253/317 (80%), Gaps = 5/317 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRR-RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME  +W+AY  AWL+T+A+IL++ HLRR RKL+LPPGPKPWPIIGNLNLIG+LPH+SIH 
Sbjct  1     METTSWIAYLTAWLATLALILLSLHLRRCRKLNLPPGPKPWPIIGNLNLIGSLPHQSIHA  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGPIMQL+FGSFP+VV SSVEMAK  LKT D  F DRPK  AGK+ TYNYS++TWS
Sbjct  61    LSQKYGPIMQLKFGSFPIVVASSVEMAKAILKTNDAIFSDRPKTAAGKYTTYNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR+M   E+FSAKRL+S+E+IR  E   +L +LY  S T+  ++LK++L  L
Sbjct  121   SYGPYWRQARKMCLTELFSAKRLESYEYIRKEERNLLLKRLYESSGTQ--IVLKEHLLSL  178

Query  631   nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             NLNVISRM  GK Y   + +  IV P EF +ML+E+F L+G L+IGD IPWL FLDLQGY
Sbjct  179   NLNVISRMVFGKKYTEGTGKNEIVTPNEFNEMLNELFFLNGVLDIGDSIPWLSFLDLQGY  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             IK+ KAL+KK DRFLEHVLDEH +RR    D +VAKDMVDVLLQ +++PN+EVK+ER GV
Sbjct  239   IKRMKALSKKFDRFLEHVLDEHNARRKRVKD-YVAKDMVDVLLQLSEEPNLEVKLERHGV  297

Query  988   KAFTLDLLAGGTESSTV  1038
             KAF+ D++A GT+SS V
Sbjct  298   KAFSQDIIAAGTDSSAV  314



>ref|XP_011035730.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Populus euphratica]
Length=511

 Score =   365 bits (937),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 255/314 (81%), Gaps = 5/314 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TW++YA AWL+T+++IL+A  LRRRKL+ PPGPKPWPIIGNLNLIG LPHRS+H LSQKY
Sbjct  3     TWVSYAFAWLATVSLILLASRLRRRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQKY  62

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GP+MQ+QFGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TWS YGPY
Sbjct  63    GPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGPY  122

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+M  ME+FSAKRL+S+E+IR  ELK++L  L+   S+ +P+ LKD+L  ++LNVI
Sbjct  123   WRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHK--SSGRPINLKDHLADVSLNVI  180

Query  646   SRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             SRM LGK Y    +E+E  IV P EFK+MLDE+FLL+G L+IGD IPW+ FLDLQG+IK+
Sbjct  181   SRMVLGKKYTVKSSENEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWVAFLDLQGHIKR  240

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              K L+KK D+F+EHVLDEH SRR  E   +  KDMVDVLLQ A DPN+EVK+ER GVKAF
Sbjct  241   MKVLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLEVKLERHGVKAF  300

Query  997   TLDLLAGGTESSTV  1038
             + DL+AGGTESS V
Sbjct  301   SQDLIAGGTESSAV  314



>ref|XP_011036442.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=532

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 259/320 (81%), Gaps = 6/320 (2%)
 Frame = +1

Query  88    ASMEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             + ME PTW++YA AWL+T+++IL+A  LRRRKL+ PPGPKPWPIIGNLNLIG LPHRS+H
Sbjct  19    SKMETPTWMSYAFAWLATVSLILLASRLRRRKLNPPPGPKPWPIIGNLNLIGELPHRSLH  78

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LSQKYGP+MQ++FGSFPVVVGSSVEMAK  LKT D+ F  RPK  AGK+ TYNYS++TW
Sbjct  79    ALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITW  138

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YGPYW QAR+M  ME+FSAKRL+S+E+IR  EL+++L  L N SS R P+ LKD+L  
Sbjct  139   SPYGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTL-NKSSGR-PINLKDHLAD  196

Query  628   lnlNVISRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDL  798
             ++LNVISRM LGK Y    +E+E  IV P EFK+MLDE+FLL+G L+IGD IPW+ FLDL
Sbjct  197   VSLNVISRMVLGKKYTVKSSENEKEIVTPVEFKEMLDELFLLNGVLDIGDSIPWIAFLDL  256

Query  799   QGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIER  978
             QGYIK+ K L+KK D+F+EHVLDEH +RR  E   +  KDMVDVLLQ A DPN+E+K+ER
Sbjct  257   QGYIKRMKTLSKKFDKFMEHVLDEHEARR-REDKNWEPKDMVDVLLQLASDPNLEIKLER  315

Query  979   QGVKAFTLDLLAGGTESSTV  1038
              GVKAF+ DL+AGGTESS V
Sbjct  316   HGVKAFSQDLIAGGTESSAV  335



>ref|XP_003627305.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|ABC59081.1| cytochrome P450 monooxygenase CYP92A29 [Medicago truncatula]
 gb|AET01781.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=512

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRR----RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             P  L    +W++  A  +I     R     K +LPPGPKPWPIIGNLNLIG+LPH+S+H 
Sbjct  3     PVQLLELPSWVTLFATFVILLLFSRRLRRHKYNLPPGPKPWPIIGNLNLIGSLPHQSLHG  62

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             L+QKYGPIM L FGS PV+VG++VE+AK FLKT D     RPK  AGK+ TYNYS++TWS
Sbjct  63    LTQKYGPIMHLYFGSKPVIVGATVELAKSFLKTHDATLAGRPKLSAGKYTTYNYSDITWS  122

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             QYGPYW QARRM  +E+FSAKRL+S+E+IR  E+   LHKL+N  S  + +L+KD+L  L
Sbjct  123   QYGPYWRQARRMCLLELFSAKRLESYEYIRKQEMHDFLHKLFN--SKNKTILVKDHLSTL  180

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LGK YL +++ ++++P EFKKMLDE+FLL+G LNIGD IPW+ FLDLQGY+
Sbjct  181   SLNVISRMVLGKKYLEKTDNAVISPDEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYV  240

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K L+KK DRF+EHVL+EH+ RR    D +VAKDMVDVLLQ A+DPN+EVK+ER GVK
Sbjct  241   KRMKTLSKKFDRFMEHVLEEHIERRKNVKD-YVAKDMVDVLLQLAEDPNLEVKLERHGVK  299

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  300   AFTQDLIAGGTESSAV  315



>gb|AFK47419.1| unknown [Medicago truncatula]
Length=512

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRR----RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             P  L    +W++  A  +I     R     K +LPPGPKPWPIIGNLNLIG+LPH+S+H 
Sbjct  3     PVQLLELPSWVTLFATFVILLLFSRRLRRHKYNLPPGPKPWPIIGNLNLIGSLPHQSLHG  62

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             L+QKYGPIM L FGS PV+VG++VE+AK FLKT D     RPK  AGK+ TYNYS++TWS
Sbjct  63    LTQKYGPIMHLYFGSKPVIVGATVELAKSFLKTHDATLAGRPKLSAGKYTTYNYSDITWS  122

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             QYGPYW QARRM  +E+FSAKRL+S+E+IR  E+   LHKL+N  S  + +L+KD+L  L
Sbjct  123   QYGPYWRQARRMCLLELFSAKRLESYEYIRKQEMHDFLHKLFN--SKNKTILVKDHLSTL  180

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             +LNVISRM LGK YL +++ ++++P EFKKMLDE+FLL+G LNIGD IPW+ FLDLQGY+
Sbjct  181   SLNVISRMVLGKKYLEKTDNAVISPDEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYV  240

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K L+KK DRF+EHVL+EH+ RR    D +VAKDMVDVLLQ A+DPN+EVK+ER GVK
Sbjct  241   KRMKTLSKKFDRFMEHVLEEHIERRKNVKD-YVAKDMVDVLLQLAEDPNLEVKLERHGVK  299

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+AGGTESS V
Sbjct  300   AFTQDLIAGGTESSAV  315



>ref|XP_004165407.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=516

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 262/315 (83%), Gaps = 7/315 (2%)
 Frame = +1

Query  103   PTWLAY-AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
             P+ L+Y   + ++T+A++L+++ LRRRKL+LPPGPKPWPIIGNL+LIG+LPH+SIH LS+
Sbjct  7     PSCLSYVTTSIIATLALLLLSRCLRRRKLNLPPGPKPWPIIGNLDLIGSLPHQSIHQLSK  66

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGPIM L+FGSFPVVVGSSVEMAKI LKT D+NFV RPK  AGK+ TYNYSN+TWSQYG
Sbjct  67    KYGPIMHLRFGSFPVVVGSSVEMAKIVLKTQDLNFVWRPKTAAGKYTTYNYSNITWSQYG  126

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PYW Q R+M  ME+FSA+RLDS+E+IR  E+  ++ ++Y   S  + + +KDYLF L+LN
Sbjct  127   PYWRQLRKMCLMELFSARRLDSYEYIRKEEMNGLIREIYK--SCGEVIKVKDYLFALSLN  184

Query  640   VISRMALGKSYLNE-SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             VISRM LGK Y +E SE  IV+P EF+KM+DE+FLL+G LNIGD IPW+DFLDLQGY+K+
Sbjct  185   VISRMVLGKRYTDESSESGIVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKR  244

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
              K L+KKLDRFLEHVLDEH  RR  +G + +VAKDMVDVLLQ AD P++EVK+ER GVKA
Sbjct  245   MKGLSKKLDRFLEHVLDEHKERR--KGVENYVAKDMVDVLLQLADHPDLEVKLERHGVKA  302

Query  994   FTLDLLAGGTESSTV  1038
             FT DLL GGTE+ST+
Sbjct  303   FTQDLLGGGTETSTI  317



>gb|EMT01785.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=503

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 244/321 (76%), Gaps = 7/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P  LA  +   S   + L A   RRR+ +LPPGPKPWPIIGNLNLIGTLPHRSIH L
Sbjct  1     MELPQ-LASFLGVCSPPVLFLKAVLRRRRQYNLPPGPKPWPIIGNLNLIGTLPHRSIHAL  59

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+KYGP+MQLQFGSFPVVVGSSVEMAK FLKT D+ F DRPK  AG++ TYNYS++TWS 
Sbjct  60    SKKYGPLMQLQFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGRYTTYNYSDITWSP  119

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLY-NVSSTRQPVllkdylfll  630
             YG YW QAR+M   E+FSAKRL+S+E+IR  E+ ++L  LY   +   + V+LKDYL  +
Sbjct  120   YGAYWRQARKMCLTELFSAKRLESYEYIRREEVLALLGDLYRGGAGASRVVVLKDYLSTV  179

Query  631   nlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             +LNVI+RM +GK YL     +E+   I  P EFK M+DE+FLL+G LNIGD IPWLD++D
Sbjct  180   SLNVITRMVMGKKYLEKEVRDEAGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWLDWMD  239

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L+K  DRFLEHV+DEH  RR  +G+ FV KDMVDVLLQ A DP +EVK+ 
Sbjct  240   LQGYIKRMKKLSKMFDRFLEHVVDEHSERRRRQGESFVVKDMVDVLLQFASDPGLEVKLN  299

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+GVKAFT DL+AGGTESS V
Sbjct  300   REGVKAFTQDLIAGGTESSAV  320



>ref|XP_004956937.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 250/321 (78%), Gaps = 6/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME P W ++    L+T+ ++  ++ +  RRR  +LPPGPKPWPIIGNL+L+G LPHRSIH
Sbjct  1     MELPPWASFLGVVLATVMLLKAIVGRRRRRRAYNLPPGPKPWPIIGNLDLMGALPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
             +LS+KYGP+MQLQFGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGK+ TYNY ++TW
Sbjct  61    ELSRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR+M   E+FSAKRL+S+E+IR  E++++L  L+ VS + + V+LKDYL  
Sbjct  121   SPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGRAVMLKDYLST  180

Query  628   lnlNVISRMALGKSYLNE----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             ++LNVI+RM LGK YL++       S+  P EFK MLDE+FLL+G LNIGD IPWLD++D
Sbjct  181   VSLNVITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  240

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L K  DRFLEHV++EH  RR+ EG  FVAKDMVDVLLQ ADDP +EV++ 
Sbjct  241   LQGYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELN  300

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+ VKAFT DL+AGGTESS V
Sbjct  301   RESVKAFTQDLIAGGTESSAV  321



>ref|XP_008792895.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 750A1-like, partial 
[Phoenix dactylifera]
Length=297

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 239/305 (78%), Gaps = 12/305 (4%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAIILIAKHL---RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
            ME   W   A++  + +A IL+ K L    RR+L+LPPGPKPWPIIGNLNLIG LPHRSI
Sbjct  1    MEAIPW---AISLATILASILLLKTLLRSHRRRLNLPPGPKPWPIIGNLNLIGALPHRSI  57

Query  265  HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
            H L+QKYGPI+QL+FGS PVVVGSSV+M K+FLKT D+NF  RPK  AGK+ TY+YS++T
Sbjct  58   HALAQKYGPIVQLRFGSVPVVVGSSVDMVKLFLKTHDLNFASRPKLAAGKYTTYDYSDIT  117

Query  445  WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf  624
            WS YGPYW QAR++  ME+FSAKRLDS+E++R  E++ +L  LY  S   + + LKDYL 
Sbjct  118  WSPYGPYWRQARKICLMELFSAKRLDSYEYVRVEEMRLLLRDLYQASG--RTITLKDYLS  175

Query  625  llnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
             ++L VISRM LG+ YL++SE +     EF+KM++E+FLL+G +N GD IPWLDFLDLQG
Sbjct  176  TVSLAVISRMVLGRXYLDDSESA----EEFRKMIEELFLLNGVVNTGDYIPWLDFLDLQG  231

Query  805  YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
            YIK+ K L+KK D FLEHVLDEH  RR+ EG+ FVAKDMVDVLLQ A+DP++EVKIER G
Sbjct  232  YIKRMKELSKKFDIFLEHVLDEHNERRLREGEGFVAKDMVDVLLQQAEDPSLEVKIERHG  291

Query  985  VKAFT  999
            VKAFT
Sbjct  292  VKAFT  296



>ref|XP_004510480.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=511

 Score =   359 bits (922),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 233/286 (81%), Gaps = 3/286 (1%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K +LPPGPKPWPIIGN NLIG LPH+SIH L+QKYGP+M L+FGS PV+VGS+V++A+ F
Sbjct  32    KYNLPPGPKPWPIIGNFNLIGPLPHQSIHGLTQKYGPMMYLRFGSKPVIVGSTVKIAQAF  91

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D     RP   AGK+ TYNYS++TWSQYGPYW QARRM  +E+FSAKRL+S+E+IR
Sbjct  92    LKTHDAALAGRPNLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIR  151

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKK  720
               EL+ +LH L+N  S  + +LLKD+L  L+LNVISRM LGK YL E+E +I++P EFKK
Sbjct  152   KQELRVLLHGLFN--SKNKTILLKDHLTTLSLNVISRMVLGKKYLEETENAIISPDEFKK  209

Query  721   MLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGD  900
             MLDE+FLL+G LNIGD IPW+ FLDLQGY+K+ K L KK DRF+EHVL+EH+ RR    D
Sbjct  210   MLDELFLLNGVLNIGDFIPWIHFLDLQGYVKRMKTLGKKFDRFMEHVLEEHIERRKNVKD  269

Query  901   KFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              FVAKDMVDVLLQ ADDP++EVK+ER GVKAFT DL+AGGTESS V
Sbjct  270   -FVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAGGTESSAV  314



>gb|EMS57898.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=515

 Score =   360 bits (923),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 243/321 (76%), Gaps = 7/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P   ++    L+T+  +     LRRR+ +LPPGPKPWPIIGNLNLIGTLPHRSIH L
Sbjct  1     MELPQLASFLGVVLATVLFLKAVLRLRRRQHNLPPGPKPWPIIGNLNLIGTLPHRSIHAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYN-YSNVTWS  450
             S++YGP+MQLQFGSFPVVVGSSVEMAK FLKT D+ F DRPK  AG+  TYN YS++TWS
Sbjct  61    SKQYGPLMQLQFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGRDTTYNNYSDITWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YG YW QAR+M   E+FSAKRL+S+E+IR  E+ ++L  LY   + R  V+LKDYL  +
Sbjct  121   PYGAYWRQARKMCLTELFSAKRLESYEYIRREEVLALLGDLYRGGAGRV-VVLKDYLSTV  179

Query  631   nlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             +LNVI+RM +GK YL     +E+   I  P EFK M+DE+FLL+G LNIGD IPWLD++D
Sbjct  180   SLNVITRMVMGKKYLEKEVRDEAGAVITTPEEFKWMIDELFLLNGVLNIGDSIPWLDWMD  239

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYIK+ K L+K  DRFLEHV+DEH  RR  EG+ FV  DMVDVLLQ A DP +EVK+ 
Sbjct  240   LQGYIKRMKKLSKMFDRFLEHVVDEHSERRRCEGESFVVNDMVDVLLQFASDPGLEVKLN  299

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R+GVKAFT DL+AGGTESS V
Sbjct  300   REGVKAFTQDLIAGGTESSAV  320



>ref|XP_003547756.2| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=536

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 257/340 (76%), Gaps = 9/340 (3%)
 Frame = +1

Query  37    HHTKTSSSY----RLPKTKYFASMEGPTWL--AYAVAWLSTIAIILIAKHLRRRKLHLPP  198
             HH  TS ++     LP +K    +  P W+  A A        ++ + + LRRRK +LPP
Sbjct  3     HHHDTSLAFFFTSNLPISKMAIELASPNWVPTAAACLAALAALLLFLLRGLRRRKYNLPP  62

Query  199   GPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDI  378
             GPKPWPIIGNLNLIG+LPH+SIH LS+ YGPIM + FGS PVVVGSSV+MAK  LKT D 
Sbjct  63    GPKPWPIIGNLNLIGSLPHQSIHALSKTYGPIMHVWFGSNPVVVGSSVDMAKAILKTHDA  122

Query  379   NFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKS  558
                 RPK  AGK+ TYNYS++TWSQYGPYW QARRM  ME+FSAKRL+ +E+IR  EL+ 
Sbjct  123   TLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLEEYEYIRKQELRG  182

Query  559   MLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVF  738
             +L++L+N  S  + +LLKD+L  L+LNVISRM LGK YL ESE ++V+P +FKKMLDE+F
Sbjct  183   LLNELFN--SANKTILLKDHLSNLSLNVISRMVLGKKYLEESENAVVSPDDFKKMLDELF  240

Query  739   LLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKD  918
             LL+G  NIGD IPW+DFLDLQGYIK+ KAL+KK D F+EHVLDEH+ R+    D +VAKD
Sbjct  241   LLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHIERKKGVED-YVAKD  299

Query  919   MVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             MVDVLLQ A+DP +EVK+ER GVKAFT DL+AGGTESS V
Sbjct  300   MVDVLLQLAEDPTLEVKLERHGVKAFTQDLIAGGTESSAV  339



>ref|XP_007135432.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
 gb|ESW07426.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
Length=512

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/284 (68%), Positives = 235/284 (83%), Gaps = 3/284 (1%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWPIIGNLNLIG LPHRSIH+LS+KYGPI+ + FGS PVVVGSSV+MAK FLK
Sbjct  35    NLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIVHVWFGSNPVVVGSSVDMAKAFLK  94

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D     RPK  AGK+ TYNY+++TWSQYGPYW QARRM  +E+FS KRL+ +E+IR  
Sbjct  95    THDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRKQ  154

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKML  726
             EL+S+L+KL++  S  + +LLKD+L  L+LNVI RM LGK+YL ESE ++V+P EFK+M+
Sbjct  155   ELRSLLNKLFH--SADKTILLKDHLSNLSLNVICRMVLGKNYLEESENAVVSPEEFKRMI  212

Query  727   DEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKF  906
             DE+FLL+G LNIGD IPW++FLDLQGYIK+ K+  KK DRFLEHVLDEH+ R+    D +
Sbjct  213   DELFLLNGVLNIGDFIPWINFLDLQGYIKRMKSCGKKFDRFLEHVLDEHIERKKGVKD-Y  271

Query  907   VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VAKDMVDVLLQ A+DP +EVK+ERQGVKAFT DL+AGGTESS V
Sbjct  272   VAKDMVDVLLQLAEDPTLEVKLERQGVKAFTQDLIAGGTESSAV  315



>ref|XP_003528553.1| PREDICTED: flavonoid 3'-monooxygenase [Glycine max]
Length=516

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 230/284 (81%), Gaps = 3/284 (1%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWPIIGNLNLIG+LPHRSIH LS+KYGPIM + FGS  VVVGSSVE+AK  LK
Sbjct  39    NLPPGPKPWPIIGNLNLIGSLPHRSIHTLSKKYGPIMHVWFGSSSVVVGSSVEIAKAVLK  98

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D     RPK  AGK+ TYNYS++TWSQYGPYW QARRM  ME+FSAKRL  +E+IR  
Sbjct  99    THDATLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLQEYEYIRKQ  158

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKML  726
             EL+ +L++L+N  S  + +LLKD+L  L+LNVISRM LGK YL ES+ ++V+P EFKKML
Sbjct  159   ELRCLLNELFN--SANKTILLKDHLSSLSLNVISRMVLGKKYLEESQNAVVSPDEFKKML  216

Query  727   DEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKF  906
             DE+FLL+G  NIGD IPW+DFLDLQGYIK+ K L+KK D F+EHVLDEH+ R+    D +
Sbjct  217   DELFLLNGVYNIGDFIPWIDFLDLQGYIKRMKTLSKKFDMFMEHVLDEHIERKKGIKD-Y  275

Query  907   VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VAKDMVDVLLQ A+DP +EVK+ER GVKAFT DL+AGGTESS V
Sbjct  276   VAKDMVDVLLQLAEDPTLEVKLERHGVKAFTQDLIAGGTESSAV  319



>gb|ABA01477.1| cytochrome P450 DDWF1 [Gossypium hirsutum]
Length=497

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 198/299 (66%), Positives = 236/299 (79%), Gaps = 4/299 (1%)
 Frame = +1

Query  145   AIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpv  324
             AI+L  +   RRKL+ PPGPKPWP+IGNL+LIG+LPHRSIH LSQKYGP+MQL+FGSFPV
Sbjct  5     AILLSLRFRPRRKLNFPPGPKPWPVIGNLDLIGSLPHRSIHALSQKYGPLMQLKFGSFPV  64

Query  325   vvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVF  504
             VV SSVEMAK FLKT D+ F  RPK  AG++ TYNYS++TWS YGPYW QAR+M   E+F
Sbjct  65    VVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDITWSPYGPYWRQARKMCMTELF  124

Query  505   SAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES  684
             SAKRL+S+E+IR  E+K +L  LY  S    P++LKD L  L+LNVISRM  GK Y   +
Sbjct  125   SAKRLESYEYIRREEMKLLLKGLYESSGV--PIVLKDRLSDLSLNVISRMVFGKKYTEGT  182

Query  685   -EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
              E  IV P EFK+MLDE+FLL+G L+IGD IPWL FLDLQG IK+ KAL+KK D+FLEHV
Sbjct  183   GENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQGNIKRMKALSKKFDKFLEHV  242

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             LDEH +RR    D + AKDMVDVLLQ ADDPN++VK+ER GVKAF+ DL+AGGTESS V
Sbjct  243   LDEHNARRRDVKD-YAAKDMVDVLLQLADDPNLDVKLERHGVKAFSQDLIAGGTESSAV  300



>ref|XP_003578185.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=521

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 199/326 (61%), Positives = 247/326 (76%), Gaps = 15/326 (5%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR------KLHLPPGPKPWPIIGNLNLIGTLPH  255
             ME P W ++    L+T+  + +   LRRR        +LPPGPKPWPIIGNLNLIGTLPH
Sbjct  1     MELPQWASFLGVVLATV--VFLKAVLRRRGGSPKRTYNLPPGPKPWPIIGNLNLIGTLPH  58

Query  256   RSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYS  435
             RSIH LS++YGP+MQLQFGSFPVVVGSSV+MAK FLKT D+ F DRPK  AGKH TY+YS
Sbjct  59    RSIHALSKQYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKHTTYDYS  118

Query  436   NVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkd  615
             ++TWS YG YW QAR++   E+FSAKRL+S+E+IR  E+ ++L  L+  S   + V+LKD
Sbjct  119   DITWSPYGAYWRQARKICLTELFSAKRLESYEYIRGEEVLALLRDLHGASG--RVVVLKD  176

Query  616   ylfllnlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPW  780
             +L  ++LNVI+RM +GK YL     +E+   I  P EFK MLDE+FLL+G LNIGD IPW
Sbjct  177   FLSTVSLNVITRMVMGKKYLEKEVKDEAGAVITTPDEFKWMLDELFLLNGVLNIGDSIPW  236

Query  781   LDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNM  960
             LD++DLQGYIK+ K L+K  DRFLEHV+DEH  R   EG+ FVAKDMVDVLLQ A DP++
Sbjct  237   LDWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERCRREGEGFVAKDMVDVLLQVASDPDL  296

Query  961   EVKIERQGVKAFTLDLLAGGTESSTV  1038
             EVK+ R+GVKAFT D++AGGTESS V
Sbjct  297   EVKLNREGVKAFTQDMIAGGTESSAV  322



>gb|EYU21317.1| hypothetical protein MIMGU_mgv1a004638mg [Erythranthe guttata]
Length=517

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 239/303 (79%), Gaps = 12/303 (4%)
 Frame = +1

Query  154   LIAKHLRRRK-LHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvv  330
              +AK  RR K L LPPGPKPWP+IGNLNLIG LPHRS+H LSQKYGP+M L+FGS P+VV
Sbjct  22    FLAKLFRRPKNLRLPPGPKPWPVIGNLNLIGELPHRSLHHLSQKYGPLMHLRFGSCPIVV  81

Query  331   gssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSA  510
             GSSV+ AKIFLKTMD  F  RPK  AGK+ TYNYS++TWS YGPYW QAR+M  ME+FSA
Sbjct  82    GSSVDTAKIFLKTMDATFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSA  141

Query  511   KRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE-SE  687
             KRL+S+E+IR  E+ S++ ++Y  +   +P  LKD+L  ++LNVISRM LGK YL+E +E
Sbjct  142   KRLESYEYIRLEEMNSLIKEVYKTAG--KPFPLKDFLSTVSLNVISRMVLGKRYLDEGNE  199

Query  688   GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLD  867
              ++V+P EFKKM+DE+FLL+G LN+GDLIPWL FLDLQGY+K+ K +++K DRFLEHVLD
Sbjct  200   NAVVSPEEFKKMIDELFLLNGVLNVGDLIPWLGFLDLQGYVKRMKIVSRKFDRFLEHVLD  259

Query  868   EHMSRRVVEGDKFVAK------DMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTES  1029
             EH  RR   G K  A+      DMVD+LL+ A+DP +EVK+ER GVKAFT DLLAGGTES
Sbjct  260   EHEERR--RGRKTAAEDCGGGGDMVDLLLELAEDPTLEVKLERHGVKAFTQDLLAGGTES  317

Query  1030  STV  1038
             S V
Sbjct  318   SAV  320



>gb|AER39771.1| CYP92A44-1 [Festuca rubra subsp. commutata]
Length=516

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 247/325 (76%), Gaps = 12/325 (4%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR---KLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME P W ++ V  L+T+  + +   LRRR   K +LPPGPK WPIIGNLNLIGTLPHRSI
Sbjct  1     MEFPQWASFLVVVLATV--LFLKAVLRRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSI  58

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS++YGP++QLQFGSFP VVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++T
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDIT  118

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSS--TRQPVllkdy  618
             WS YG YW QAR+M   E+FSA+RL S+E+IR+ E+ ++L  L+  ++    + ++LKDY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDY  178

Query  619   lfllnlNVISRMALGKSYLNE-----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWL  783
             L  ++LNVI+RM +GK YL +     S   I  P EFK M+DE+FLL+G LNIGD IPWL
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWL  238

Query  784   DFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNME  963
             D++DLQGYIK+ K L+K  DRFLEHV+DEH  RR  E + FVAKDMVDVLLQ A +P++E
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLE  298

Query  964   VKIERQGVKAFTLDLLAGGTESSTV  1038
             VK+ R+GVKAFT DL+AGGTESS V
Sbjct  299   VKLNREGVKAFTQDLIAGGTESSAV  323



>gb|AER39774.1| CYP92A44-4 [Festuca rubra subsp. commutata]
Length=516

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 246/325 (76%), Gaps = 12/325 (4%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR---KLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME P W ++    L+T+  + +   LRRR   K +LPPGPK WPIIGNLNL+GTLPHRSI
Sbjct  1     MEFPQWASFLGVVLATV--LFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSI  58

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS++YGP++QLQFGSFP VVGSSVEMAK FLKT D++F DRPK  +GKH TYNYS++T
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDIT  118

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYN--VSSTRQPVllkdy  618
             WS YG YW QAR+M   E+FSA+RL S+E+IR+ E+ +++  L+    +   + ++LKDY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDY  178

Query  619   lfllnlNVISRMALGKSYLNE-----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWL  783
             L  ++LNVI+RM +GK YL +     S   I  P EFK M+DE+FLL+G LNIGD IPWL
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWL  238

Query  784   DFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNME  963
             D++DLQGYIK+ K L+K  DRFLEHV+DEH  RR  +G+ FVAKDMVDVLLQ A DPN+E
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRRDGESFVAKDMVDVLLQFASDPNLE  298

Query  964   VKIERQGVKAFTLDLLAGGTESSTV  1038
             VK+ R GVKAFT DL+AGGTESS V
Sbjct  299   VKLNRDGVKAFTQDLIAGGTESSAV  323



>ref|XP_003627307.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|AET01783.1| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 243/315 (77%), Gaps = 10/315 (3%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKH---LRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             P W+ +     +T  I+L+  H   L RRK +LPPGPKPWPIIGN+NLIG+LPH+SIH L
Sbjct  9     PNWVTFC----TTFVILLLFIHRLRLHRRKYNLPPGPKPWPIIGNMNLIGSLPHQSIHGL  64

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             ++KYGPIM+L FGS  V+VGSS ++AK FLKT DI  V RPK   GK+ TYNYSN+TW+ 
Sbjct  65    TKKYGPIMRLWFGSKLVIVGSSPDIAKAFLKTNDIVLVGRPKFACGKYTTYNYSNITWNP  124

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPY+ QAR+MF  E+FS K L+S+E++R  EL   LHKL+N  S  + +LLKD+L   +
Sbjct  125   YGPYFQQARKMFQRELFSVKSLESYEYMRKEELHIFLHKLFN--SKNKTILLKDHLSTFS  182

Query  634   lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             LN+ISRM LGK YL +SE  I++P EFK+MLDE+FLL+G  NIGD IPW+ FLDLQGY+K
Sbjct  183   LNIISRMVLGKKYLEKSENVIISPEEFKEMLDELFLLNGVFNIGDFIPWIQFLDLQGYVK  242

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + KA  K+ +RF+EHVL+EH+ RR    D +VAKDMVDVLLQ A++PN+EVKI+R GVKA
Sbjct  243   RMKACGKRFNRFMEHVLEEHIERRKDVKD-YVAKDMVDVLLQLAENPNLEVKIKRNGVKA  301

Query  994   FTLDLLAGGTESSTV  1038
             FT DL+AGGT++S+V
Sbjct  302   FTQDLIAGGTDTSSV  316



>gb|AER39773.1| CYP92A44-3 [Festuca rubra subsp. commutata]
Length=516

 Score =   355 bits (910),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 247/324 (76%), Gaps = 10/324 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRR--RKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME P W ++    L+T+ + L+A   RR  RK +LPPGPK WPIIGNLNLIGTLPHRSIH
Sbjct  1     MEFPQWASFLGVVLATV-LFLMAVLQRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSIH  59

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LS++YGP++QLQFGSFP VVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++TW
Sbjct  60    ALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDITW  119

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSS--TRQPVllkdyl  621
             S YG YW QAR+M   E+FSA+RL S+E+IR+ E+ ++L  L+  ++    + ++LKDYL
Sbjct  120   SPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDYL  179

Query  622   fllnlNVISRMALGKSYLNE-----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLD  786
               ++LNVI+RM +GK YL +     S   I  P EFK M+DE+FLL+G LNIGD IPWLD
Sbjct  180   STVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWLD  239

Query  787   FLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEV  966
             ++DLQGYIK+ K L+K  DRFLEHV+DEH  RR  E + FVAKDMVDVLLQ A +P++EV
Sbjct  240   WMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLEV  299

Query  967   KIERQGVKAFTLDLLAGGTESSTV  1038
             K+ R+GVKAFT DL+AGGTESS V
Sbjct  300   KLNREGVKAFTQDLIAGGTESSAV  323



>gb|KGN58496.1| hypothetical protein Csa_3G651800 [Cucumis sativus]
Length=306

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 251/302 (83%), Gaps = 7/302 (2%)
 Frame = +1

Query  103  PTWLAY-AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
            P+ L+Y   + ++T+A++L+++ LRRRKL+LPPGPKPWPIIGNL+LIG+LPH+SIH LS+
Sbjct  7    PSCLSYVTTSIIATLALLLLSRCLRRRKLNLPPGPKPWPIIGNLDLIGSLPHQSIHQLSK  66

Query  280  KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
            KYGPIM L+FGSFPVVVGSSVEMAKI LKT D+NFV RPK  AGK+ TYNYSN+TWSQYG
Sbjct  67   KYGPIMHLRFGSFPVVVGSSVEMAKIVLKTQDLNFVWRPKTAAGKYTTYNYSNITWSQYG  126

Query  460  PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
            PYW Q R+M  ME+FSA+RLDS+E+IR  E+  ++ ++Y   S  + + +KDYLF L+LN
Sbjct  127  PYWRQLRKMCLMELFSARRLDSYEYIRKEEMNGLIREIYK--SCGEVIKVKDYLFALSLN  184

Query  640  VISRMALGKSYLNE-SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
            VISRM LGK Y +E SE  IV+P EF+KM+DE+FLL+G LNIGD IPW+DFLDLQGY+K+
Sbjct  185  VISRMVLGKKYTDEPSESGIVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKR  244

Query  817  TKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             K L+KKLDRFLEHVLDEH  RR  +G + +VAKDMVDVLLQ AD P++EVK+ER GVKA
Sbjct  245  MKGLSKKLDRFLEHVLDEHKERR--KGVENYVAKDMVDVLLQLADHPDLEVKLERHGVKA  302

Query  994  FT  999
            FT
Sbjct  303  FT  304



>gb|AAG44132.1|AF218296_1 cytochrome P450 [Pisum sativum]
Length=495

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 242/313 (77%), Gaps = 8/313 (3%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRR-KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
             P+W    V   +T AI+L+     RR + +LPPGPKPWPIIGN NLIGTLPH+S+H L+Q
Sbjct  9     PSW----VTLFTTFAILLLFSRRLRRRQYNLPPGPKPWPIIGNFNLIGTLPHQSLHGLTQ  64

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGPIM L FGS  VVVGS+VEMAK FLKT D     RPK  AGK+ TYNYS++TWSQYG
Sbjct  65    KYGPIMHLWFGSKRVVVGSTVEMAKAFLKTHDATLAGRPKFSAGKYTTYNYSDITWSQYG  124

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PYW QARRM  +E+FSAKRL+S+E+IR  EL   LH+L++  S  + +LLKD+L  L+LN
Sbjct  125   PYWRQARRMCLLELFSAKRLESYEYIRKQELHVFLHELFD--SRNKTILLKDHLSSLSLN  182

Query  640   VISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             VISRM LG+ YL + E SI++P EFK MLDE+FLL+G LNIGD IPW+ FLD QGY+K+ 
Sbjct  183   VISRMVLGRKYLEKVENSIISPDEFKNMLDELFLLNGILNIGDFIPWIHFLDFQGYVKRM  242

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             K L+KK D F+EHVL+EH+ RR    D +VAKDMVDVLLQ A+DP++EVK+ER GVKAFT
Sbjct  243   KVLSKKFDGFMEHVLEEHIERRKGVKD-YVAKDMVDVLLQLAEDPDLEVKLERHGVKAFT  301

Query  1000  LDLLAGGTESSTV  1038
              DL+AGGTESS V
Sbjct  302   QDLIAGGTESSAV  314



>ref|XP_010917480.1| PREDICTED: cytochrome P450 750A1-like [Elaeis guineensis]
Length=315

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 232/302 (77%), Gaps = 4/302 (1%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
            ME   W  Y    L++I ++       R +L LPPGPKPWPIIGNLNLIG LPHRSIH L
Sbjct  1    METIPWATYLATILASILLLKTLLRSHRPRLTLPPGPKPWPIIGNLNLIGALPHRSIHAL  60

Query  274  SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
            +QKYGPIMQL+FGS P+VV SSV+M K+FLKT D+NF  RPK  AGK+ T+NYS++TWS 
Sbjct  61   AQKYGPIMQLRFGSVPIVVASSVDMVKLFLKTHDLNFASRPKLAAGKYTTFNYSDITWSP  120

Query  454  YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
            YGPYW QAR+M  ME+FSAKRLDS+E+IR  E++ +L  L+  S   + + LKDYL  ++
Sbjct  121  YGPYWRQARKMCIMELFSAKRLDSYEYIRAEEMRLLLRGLHQASG--RTITLKDYLSTVS  178

Query  634  lNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
            L+VISRM LGK YL+ESE       EF+KM++E+FLL+G +NIGD IPWLDFLDLQGYIK
Sbjct  179  LDVISRMVLGKKYLDESESESAE--EFRKMIEELFLLNGVVNIGDYIPWLDFLDLQGYIK  236

Query  814  QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
            + K L+KK D FLEHVLDEH  R + EG+ FVAKDMVDVLLQ A+DP++EVKIER GVKA
Sbjct  237  RMKELSKKFDNFLEHVLDEHKERMLREGEGFVAKDMVDVLLQQAEDPSLEVKIERHGVKA  296

Query  994  FT  999
            FT
Sbjct  297  FT  298



>ref|XP_003627306.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
Length=505

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 243/312 (78%), Gaps = 3/312 (1%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P W+ +   ++  +        L RRK +LPPGPK WPIIGNLNLIG+LPH+S+H L++K
Sbjct  9     PNWVTFFTTFIILLLFTRRRLRLHRRKYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKK  68

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIM L FGS PV+VGSS E+AK+FLKT D     RPK  AGK+ TYNYSN+TWSQYGP
Sbjct  69    YGPIMHLWFGSKPVIVGSSPEIAKVFLKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGP  128

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M  +E+FS KRL+S+E++R  EL + LH+L+N  S  + +LLKD+L  L+LNV
Sbjct  129   YWQQARKMCLLELFSVKRLESYEYMRKQELHAFLHELFN--SKNKTILLKDHLSTLSLNV  186

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK YL +SE +I++P EFKKMLDE+FLL+G LN+GD IPW+ FLDLQGY+K+ K
Sbjct  187   ISRMVLGKKYLEKSENAIISPEEFKKMLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMK  246

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L KK D F+EHVL+EH+ RR    D +VAKDMVDVLL+ A++P++EVK+ER GVKAFT 
Sbjct  247   TLGKKFDWFMEHVLEEHIERRKCVND-YVAKDMVDVLLKLAENPSLEVKLERHGVKAFTQ  305

Query  1003  DLLAGGTESSTV  1038
             DL+AGGT++STV
Sbjct  306   DLIAGGTDTSTV  317



>gb|AET01782.2| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 243/312 (78%), Gaps = 3/312 (1%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P W+ +   ++  +        L RRK +LPPGPK WPIIGNLNLIG+LPH+S+H L++K
Sbjct  9     PNWVTFFTTFIILLLFTRRRLRLHRRKYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKK  68

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIM L FGS PV+VGSS E+AK+FLKT D     RPK  AGK+ TYNYSN+TWSQYGP
Sbjct  69    YGPIMHLWFGSKPVIVGSSPEIAKVFLKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGP  128

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR+M  +E+FS KRL+S+E++R  EL + LH+L+N  S  + +LLKD+L  L+LNV
Sbjct  129   YWQQARKMCLLELFSVKRLESYEYMRKQELHAFLHELFN--SKNKTILLKDHLSTLSLNV  186

Query  643   ISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             ISRM LGK YL +SE +I++P EFKKMLDE+FLL+G LN+GD IPW+ FLDLQGY+K+ K
Sbjct  187   ISRMVLGKKYLEKSENAIISPEEFKKMLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMK  246

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L KK D F+EHVL+EH+ RR    D +VAKDMVDVLL+ A++P++EVK+ER GVKAFT 
Sbjct  247   TLGKKFDWFMEHVLEEHIERRKCVND-YVAKDMVDVLLKLAENPSLEVKLERHGVKAFTQ  305

Query  1003  DLLAGGTESSTV  1038
             DL+AGGT++STV
Sbjct  306   DLIAGGTDTSTV  317



>ref|XP_008780588.1| PREDICTED: cytochrome P450 750A1-like, partial [Phoenix dactylifera]
Length=294

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 233/298 (78%), Gaps = 10/298 (3%)
 Frame = +1

Query  118  YAVAWLSTIAIILIAKHL---RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYG  288
            +A++  + +A IL+ K L    RR+L+LPPGPKPWPIIGNLNLIG LPHRSIH L+QKYG
Sbjct  2    WAISLATILASILLLKTLLRSHRRRLNLPPGPKPWPIIGNLNLIGALPHRSIHALAQKYG  61

Query  289  PIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYW  468
            PI+QL+ GS PVVVGSSV+M K+FLKT D+NF  RPK  AGK+ TYNYS++TWS YGPYW
Sbjct  62   PIVQLRLGSVPVVVGSSVDMVKLFLKTHDLNFASRPKLAAGKYTTYNYSDITWSPYGPYW  121

Query  469  HQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVIS  648
             QAR+M  ME+FSAKRLDS E+IR  E++ +L  LY  S   + + LKDYL  ++L+VIS
Sbjct  122  RQARKMCLMELFSAKRLDSCEYIRVEEMRLLLRNLYQASG--RTITLKDYLSTVSLDVIS  179

Query  649  RMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSG-ALNIGDLIPWLDFLDLQGYIKQTKA  825
            RM LG+ Y ++ E +     EF+KM +E FLL+G  +NIGD IPWLDFLDLQGYIK+ K 
Sbjct  180  RMVLGRKYFDDLESA----EEFRKMTEEWFLLNGVVVNIGDYIPWLDFLDLQGYIKRMKE  235

Query  826  LNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
            L+KK D FLEHVLDEH  +R+ EG+ FVAKDMVDVLLQ A+DP++EVKIER GVKAFT
Sbjct  236  LSKKFDIFLEHVLDEHKEKRLREGEGFVAKDMVDVLLQQAEDPSLEVKIERHGVKAFT  293



>emb|CCP37679.1| cytochrome P450 [Lolium sp. CD-2012]
Length=519

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/326 (60%), Positives = 245/326 (75%), Gaps = 13/326 (4%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR---KLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME P W ++    L+T+  I +   LRRR   K +LPPGPK WPIIGNLNLIG LPHRSI
Sbjct  1     MELPQWASFLAVVLATV--IFLKAVLRRRSSCKYNLPPGPKAWPIIGNLNLIGALPHRSI  58

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS+ YGP+MQLQFGSFP VVGSSV+MAK FLKT D+ F DRPK  AGKH TYNYS++T
Sbjct  59    HALSKHYGPLMQLQFGSFPCVVGSSVDMAKFFLKTHDVVFTDRPKFAAGKHTTYNYSDIT  118

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYN---VSSTRQPVllkd  615
             WS YG YW QAR+M   E+FSA+RL S+E+IR+ E+ ++L  L+N    +   + +++KD
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHNGATAAGAGRTLVIKD  178

Query  616   ylfllnlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPW  780
             YL  ++LNVI+RM +GK YL     +ES   I  P EFK M+DE+FLL+G LNIGD IP 
Sbjct  179   YLSTVSLNVITRMVMGKKYLEKEVRDESGALITTPDEFKWMIDELFLLNGVLNIGDSIPC  238

Query  781   LDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNM  960
             LD++DLQGY+K+ K L+K  DRFLEHV+DEH  +R  +G+ FVAKDMVDVLLQ A +P++
Sbjct  239   LDWMDLQGYMKRMKKLSKMFDRFLEHVVDEHSEQRRRDGESFVAKDMVDVLLQFASNPDL  298

Query  961   EVKIERQGVKAFTLDLLAGGTESSTV  1038
             EVK+ R+GVKAFT DL+AGGTESS V
Sbjct  299   EVKLNREGVKAFTQDLIAGGTESSAV  324



>ref|XP_006426678.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
 gb|ESR39918.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
Length=512

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 252/314 (80%), Gaps = 6/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P+W +Y VAWL+T+A++L++  LRRRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+K
Sbjct  6     PSWASYLVAWLATLALVLLSLRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSLHALSEK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGSFPVVVGSS EMAK+ LKT D  F  RPK  AGK+ T+NYS++TWS YGP
Sbjct  66    YGPIMQLKFGSFPVVVGSSAEMAKVILKTQDALFSGRPKTAAGKYTTFNYSDITWSPYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR++ +ME+FS KRL+SFE+IR  EL   L++LY   S  +P +LKD+L  L+L +
Sbjct  126   YWRQARKICSMELFSVKRLESFEYIRVQELNLFLNRLYE--SFGKPTILKDHLSDLSLAI  183

Query  643   ISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             ISRM LGK Y ++  E  +V P EF  M+DE+F+L+G L++GD IPWL FLDLQG IK+ 
Sbjct  184   ISRMVLGKKYTDKQLENEVVTPQEFTAMVDELFMLNGVLDVGDSIPWLGFLDLQGNIKKM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             KAL K+ D+FLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP +EVKIER GVK F
Sbjct  244   KALAKRFDKFLEHVLDEHDARR--KGVENYVAKDMVDVLLQLADDPTLEVKIERHGVKGF  301

Query  997   TLDLLAGGTESSTV  1038
             T DL+AGGTESS V
Sbjct  302   TQDLIAGGTESSAV  315



>ref|XP_007012628.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY30247.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=512

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 183/317 (58%), Positives = 239/317 (75%), Gaps = 7/317 (2%)
 Frame = +1

Query  100   GPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
              P+W   A+ WL+++A +      RR +L LPPGPKPWPIIGNLNLI +LPH+S+H LSQ
Sbjct  2     APSWFVVAITWLASLAFLSRIFTSRRNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQ  61

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGP+MQL+FGS+PVVV SS +MAK FLK  D NF  RP+  AGKH TYNY N+TW+ YG
Sbjct  62    KYGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYG  121

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PYW Q R+++  E+FS+KRL+SFE+IR  E+++ + +LY  S   +PV+LK++L    L+
Sbjct  122   PYWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLS  179

Query  640   VISRMALGKSYLNES----EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             VISR+ LGK Y +ES    E SIV   EF+++LDE+FLL+G LNIGD IPWLDFLDLQGY
Sbjct  180   VISRIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGY  239

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             +K+ KAL KKLDRF EHV +EH S++  E   FV +DMVD+LLQ ADDP+++VK+   GV
Sbjct  240   LKRMKALKKKLDRFHEHVFNEHKSKK-KELKDFVPQDMVDLLLQLADDPDIDVKLSYDGV  298

Query  988   KAFTLDLLAGGTESSTV  1038
             + FT DL+AGGT++S  
Sbjct  299   RGFTQDLVAGGTDTSAT  315



>gb|AER39772.1| CYP92A44-2 [Festuca rubra subsp. commutata]
Length=516

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 247/325 (76%), Gaps = 12/325 (4%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR---KLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME P W ++    L+T+  + +   LRRR   K +LPPGPK WPIIGNLNL+GTLPHRSI
Sbjct  1     MEFPQWASFLGVVLATV--LFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSI  58

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS++YGP++QLQFGSFP VVGSSVEMAK FLKT D++F DRPK  +GKH TYNYS++T
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDIT  118

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYN--VSSTRQPVllkdy  618
             WS YG YW QAR+M   E+FSA+RL S+E+IR+ E+ +++  L+    +   + ++LKDY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDY  178

Query  619   lfllnlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWL  783
             L  ++LNVI+RM +GK YL     +ES   I  P EFK M+DE+FLL+G LNIGD IP L
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDESGAVITTPDEFKWMIDELFLLNGVLNIGDSIPCL  238

Query  784   DFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNME  963
             D++DLQGYIK+ K L+K  DRFLEHV++EH  RR  +G+ FVAKDMVDVLLQ A +P++E
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVEEHSERRRRDGESFVAKDMVDVLLQFASNPDLE  298

Query  964   VKIERQGVKAFTLDLLAGGTESSTV  1038
             VK+ R+GVKAFT DL+AGGTESS V
Sbjct  299   VKLNREGVKAFTQDLIAGGTESSAV  323



>dbj|BAD36162.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38067.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
Length=518

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 240/320 (75%), Gaps = 8/320 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME   W++Y    L+TI + L    LR  RR  +LPPGPKPWPIIGNLNL+G+LPHRSIH
Sbjct  1     MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LS+KYGP+M L+FGSFPVVVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++TW
Sbjct  61    SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR++   E+FSAKR++S+EHIR  E++++L  L+  S   + V LKDYL  
Sbjct  121   SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSA  178

Query  628   lnlNVISRMALGKSYLNES---EGSIV-NPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
              +LNVISRM LGK YL      EG +V  P  F+ M+DE+FLL+G L+IGD IPWL +LD
Sbjct  179   ASLNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYI++ K L+K  D+FLE+VLDEH +R   EG+ FVAKDMVDVLL  A DP++EVK  
Sbjct  239   LQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLEVKFS  298

Query  976   RQGVKAFTLDLLAGGTESST  1035
             R  VKAFT DL+AGGTESS+
Sbjct  299   RDSVKAFTQDLIAGGTESSS  318



>ref|XP_006436412.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
 gb|ESR49652.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
Length=512

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 226/297 (76%), Gaps = 3/297 (1%)
 Frame = +1

Query  148   IILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvv  327
             ++ I     RR L+LPPGP PWPIIGNLNL+G+LPHRSIH LSQKYGPIMQL+FGSFPVV
Sbjct  22    LLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVV  81

Query  328   vgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFS  507
             VGSSVEMAK+FLKT D NF  RP+  AGK+ TYNYS++ W+ YGPYW QAR++F +E+FS
Sbjct  82    VGSSVEMAKLFLKTHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFS  141

Query  508   AKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE  687
              KRL+SFE IR  E+K  L  LY   S+ +PV LKD+L  L+LNVISRM LGK+Y  E+E
Sbjct  142   PKRLESFEFIRVQEIKKFLFGLYK--SSAKPVHLKDHLSKLSLNVISRMVLGKNYTEETE  199

Query  688   GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLD  867
                V P E+ +ML E+F L+G L IGD IPWL FLDLQG+IK+ KAL KKLDRF E VL 
Sbjct  200   QDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLH  259

Query  868   EHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EH ++R      FVA DMVDVLLQ ADDP +E K+ER  VKA   DLLAGGTESSTV
Sbjct  260   EHNAKR-KSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKALIQDLLAGGTESSTV  315



>ref|NP_001063284.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAD36157.1| putative cytochrome P450 monooxygenase CYP92A1 [Oryza sativa 
Japonica Group]
 dbj|BAF25198.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAG98103.1| unnamed protein product [Oryza sativa Japonica Group]
Length=525

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 238/329 (72%), Gaps = 18/329 (5%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME P+W A  +  +    + L+A  LR  RR   LPPGP PWPIIGNLNLIG LPHRSIH
Sbjct  3     MELPSW-ASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIH  61

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
             +LS++YGP+MQL+FGSFPVVVGSS EMA+ FLK+ DI F DRP+  AGKH TYNY+++ W
Sbjct  62    ELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILW  121

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR+M   E+FSA+RL+SFEHIR  E++++L  L+  ++   PVLL+DYL  
Sbjct  122   SPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAA---PVLLRDYLST  178

Query  628   lnlNVISRMALGKSYLN------------ESEGSIVNPGEFKKMLDEVFLLSGALNIGDL  771
               L VISRM LGK Y+             E       P EFK M+DE+FLLSG LNIGD 
Sbjct  179   ATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGDF  238

Query  772   IPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADD  951
             IPWLD+LDLQGYI++ K + KKLDRF+EHVLDEH   R  +GD+F A+D+VDVLLQ ADD
Sbjct  239   IPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLADD  298

Query  952   PNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             PN+EV++ R  VKA T DL+AGGT++S +
Sbjct  299   PNLEVQLRRDNVKALTQDLIAGGTDTSAI  327



>ref|XP_008784472.1| PREDICTED: cytochrome P450 71A2-like [Phoenix dactylifera]
Length=776

 Score =   352 bits (904),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 232/308 (75%), Gaps = 8/308 (3%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAII------LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPH  255
            ME P+W  Y     ++I ++      L  +  R  KL+LPPGPKP P+IGNLNLI +LPH
Sbjct  1    MELPSWATYLATLPASILLLLLLLKSLFCRRRRLCKLNLPPGPKPLPVIGNLNLISSLPH  60

Query  256  RSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYS  435
            RS+H LSQKYGP+M L FGSFPV+V SSV+ AK+ LKT D+ F  RPK  AGK   YNYS
Sbjct  61   RSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGRPKTAAGKWTAYNYS  120

Query  436  NVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkd  615
            N+ WSQYGPYW QAR+M   E+FSA+RLDS+++IR  E+K++L  L+N  S+ +PV L D
Sbjct  121  NIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDLFN--SSGRPVNLSD  178

Query  616  ylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
            +L   +L++ISRM LGK YL++SE S+V+P EFK MLDE  LL+G +NIGD IPWLDFLD
Sbjct  179  HLSNASLSIISRMVLGKKYLDKSESSVVSPVEFKAMLDEFMLLNGVMNIGDSIPWLDFLD  238

Query  796  LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
            LQGYIK+ K + KK DRFLEHVLDEH  RR  EG+KFV KDMVDVLL  ADDPN+EVK+E
Sbjct  239  LQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTKDMVDVLLLLADDPNLEVKLE  298

Query  976  RQGVKAFT  999
            R+GVK FT
Sbjct  299  RRGVKGFT  306


 Score =   340 bits (871),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 218/275 (79%), Gaps = 2/275 (1%)
 Frame = +1

Query  214   PIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDR  393
             P+IGNLNLI +LPHRS+H LSQKYGP+M L FGSFPV+V SSV+ AK+ LKT D+ F  R
Sbjct  307   PVIGNLNLISSLPHRSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGR  366

Query  394   PKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKL  573
             PK  AGK   YNYSN+ WSQYGPYW QAR+M   E+FSA+RLDS+++IR  E+K++L  L
Sbjct  367   PKTAAGKWTAYNYSNIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDL  426

Query  574   YNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGA  753
             +N  S+ +PV L D+L   +L++ISRM LGK YL++SE S+V+P EFK MLDE  LL+G 
Sbjct  427   FN--SSGRPVNLSDHLSNASLSIISRMVLGKKYLDKSESSVVSPVEFKAMLDEFMLLNGV  484

Query  754   LNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVL  933
             +NIGD IPWLDFLDLQGYIK+ K + KK DRFLEHVLDEH  RR  EG+KFV KDMVDVL
Sbjct  485   MNIGDSIPWLDFLDLQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTKDMVDVL  544

Query  934   LQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             L  ADDPN+EVK+ER+GVK FT DL+AGGT++  V
Sbjct  545   LLLADDPNLEVKLERRGVKGFTQDLIAGGTDTYAV  579



>gb|EAZ09260.1| hypothetical protein OsI_31533 [Oryza sativa Indica Group]
Length=518

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 239/320 (75%), Gaps = 8/320 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME   W++Y    L+TI + L    LR  RR  +LPPGPKPWPIIGNLNL+G+LPHRSIH
Sbjct  1     MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LS+KYGP+M L+FGSFPVVVGSSVEMAK FLKT D+ F DRPK  AGKH TYNYS++TW
Sbjct  61    SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YG YW QAR++   E+FSAKR++S+EHIR  E++++L  L+  S   + V LKDYL  
Sbjct  121   SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSA  178

Query  628   lnlNVISRMALGKSYLNES---EGSIV-NPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
              +LNVISRM LGK YL      EG +V  P  F+ M+DE+FLL+G L+IGD IPWL +LD
Sbjct  179   ASLNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGYI++ K L+K  D+FLE+VLDEH +R   EG+ FVAKDMVD LL  A DP++EVK  
Sbjct  239   LQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDALLNVASDPSLEVKFS  298

Query  976   RQGVKAFTLDLLAGGTESST  1035
             R  VKAFT DL+AGGTESS+
Sbjct  299   RDSVKAFTQDLIAGGTESSS  318



>ref|XP_011036445.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 239/311 (77%), Gaps = 6/311 (2%)
 Frame = +1

Query  115   AYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQKYGP  291
              +A   L+T+A+I + +HL R KL+LPPGPKPWPIIGNLNL+ G LPHR++H L QKYGP
Sbjct  5     TFAALLLATVAVITLFRHLTRPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHALVQKYGP  64

Query  292   IMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWH  471
             IMQL+FGSFPVVVGSSVEMA+  LKT D+   DRPK  AGK+ TYNYSN+TWSQYGPYW 
Sbjct  65    IMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWR  124

Query  472   QARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISR  651
             QAR++  ME+FS KRLD FE +R  EL ++L KL+   S  +P+  +D    L+L+VISR
Sbjct  125   QARKICLMEIFSPKRLDQFETVRVQELHALLRKLF--VSAGKPINARDNFSDLSLSVISR  182

Query  652   MALGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKA  825
             + LGK+Y  ++  +   ++P EFK+M+DE+FLL+G L+IGD IPWL FLDLQGYIK+ KA
Sbjct  183   LVLGKNYTVKTGNQKEYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKA  242

Query  826   LNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLD  1005
             + +  D FLEH L+EH  RR    D +V +DM+D+LLQ +DDPN+EV+++R  VKAFT+D
Sbjct  243   VGRLFDGFLEHTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTMD  301

Query  1006  LLAGGTESSTV  1038
             L+AGGTESS V
Sbjct  302   LIAGGTESSAV  312



>gb|KDO48981.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=512

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 225/297 (76%), Gaps = 3/297 (1%)
 Frame = +1

Query  148   IILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvv  327
             ++ I     RR L+LPPGP PWPIIGNLNL+G+LPHRSIH LSQKYGPIMQL+FGSFPVV
Sbjct  22    LLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVV  81

Query  328   vgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFS  507
             VGSSVEMAK+FLK  D NF  RP+  AGK+ TYNYS++ W+ YGPYW QAR++F +E+FS
Sbjct  82    VGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFS  141

Query  508   AKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE  687
              KRL+SFE IR  E+K  L  LY   S+ +PV LKD+L  L+LNVISRM LGK+Y  E+E
Sbjct  142   PKRLESFEFIRVQEIKKFLFGLYK--SSAKPVHLKDHLSKLSLNVISRMVLGKNYTEETE  199

Query  688   GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLD  867
                V P E+ +ML E+F L+G L IGD IPWL FLDLQG+IK+ KAL KKLDRF E VL 
Sbjct  200   QDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLH  259

Query  868   EHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EH ++R      FVA DMVDVLLQ ADDP +E K+ER  VKA   DLLAGGTESSTV
Sbjct  260   EHNAKR-KSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKALIQDLLAGGTESSTV  315



>ref|XP_002303387.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
 gb|ABK96148.1| unknown [Populus trichocarpa]
 gb|EEE78366.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
Length=509

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 239/311 (77%), Gaps = 6/311 (2%)
 Frame = +1

Query  115   AYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQKYGP  291
              +A   L+T+A+I + +HL R KL+LPPGPKPWPIIGNLNL+ G LPHR++H L QKYGP
Sbjct  5     TFAALLLATVAVITLFRHLTRPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHALVQKYGP  64

Query  292   IMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWH  471
             IMQL+FGSFPVVVGSSVEMA+  LKT D+   DRPK  AGK+ TYNYSN+TWSQYGPYW 
Sbjct  65    IMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWR  124

Query  472   QARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISR  651
             QAR++  ME+FS KRLD FE +R  EL ++L KL+   S  +P+  +D    L+L+VISR
Sbjct  125   QARKICLMEIFSPKRLDQFETVRVQELHALLRKLF--VSAGKPINARDEFSDLSLSVISR  182

Query  652   MALGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKA  825
             + LGK+Y  ++  +   ++P EFK+M+DE+FLL+G L+IGD IPWL FLDLQGYIK+ KA
Sbjct  183   LVLGKNYTVKTGNQKQYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKA  242

Query  826   LNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLD  1005
             + +  D FLE+ L+EH  RR    D +V +DM+D+LLQ +DDPN+EV+++R  VKAFT+D
Sbjct  243   VGQLFDGFLEYTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTMD  301

Query  1006  LLAGGTESSTV  1038
             L+AGGTESS V
Sbjct  302   LIAGGTESSAV  312



>gb|KHF98584.1| Cytochrome P450 [Gossypium arboreum]
Length=480

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 241/305 (79%), Gaps = 7/305 (2%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHL-PPGPKPWPIIGNLNLIGTLPHRSIHD  270
            M  P+W +Y   WL+T+A+IL++  L RR+    PPGPKPWPIIGNLNL+G+LPH+SIH 
Sbjct  1    MATPSWFSYLTPWLATLALILLSLRLCRRRKLNLPPGPKPWPIIGNLNLVGSLPHQSIHA  60

Query  271  LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
            LS+KYGPIMQL+FGSFPVVV SSVEMAK  LKT D+ F DRPKN AGK+ TYNYS++TWS
Sbjct  61   LSRKYGPIMQLKFGSFPVVVASSVEMAKAVLKTNDVIFTDRPKNAAGKYTTYNYSDITWS  120

Query  451  QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
             YGPYW QAR++   E+F+AKRL+S+++IR  E+   L +LY  S T+  ++LKD+L  L
Sbjct  121  PYGPYWRQARKICLTELFNAKRLESYQYIRREEMNLFLKRLYESSGTQ--IVLKDHLSSL  178

Query  631  nlNVISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
            +LNVISRM  GK Y   S E  IV P EFK+MLDE+FLL+G L+IGD IPWL FLDLQGY
Sbjct  179  SLNVISRMVFGKKYTEGSGENEIVTPNEFKEMLDELFLLNGVLDIGDSIPWLTFLDLQGY  238

Query  808  IKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQG  984
            IK+ KAL+KK DRFLEHVLDEH +RR  EG + +VAKDMVDVLLQ ++DPN+EVK+ER  
Sbjct  239  IKRMKALSKKFDRFLEHVLDEHNARR--EGAEDYVAKDMVDVLLQLSEDPNLEVKLERHS  296

Query  985  VKAFT  999
            VKAFT
Sbjct  297  VKAFT  301



>gb|AJD25214.1| cytochrome P450 CYP92A73 [Salvia miltiorrhiza]
Length=509

 Score =   339 bits (870),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 246/305 (81%), Gaps = 4/305 (1%)
 Frame = +1

Query  124   VAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQL  303
             V  L+ +++ ++ K L+ +KL+ PPGPKPWP+IGNLNLIG+LPH S+H LSQKYGPIM L
Sbjct  11    VLTLTFLSLHILKKILQNKKLNPPPGPKPWPVIGNLNLIGSLPHHSLHSLSQKYGPIMLL  70

Query  304   QfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARR  483
             +FGS PVVVGSSV  AKIFLKTMD+ F  RPK  AGK  TYNYS++TWS YGPYW QAR+
Sbjct  71    KFGSAPVVVGSSVAAAKIFLKTMDLTFASRPKTSAGKITTYNYSDITWSPYGPYWRQARK  130

Query  484   MFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALG  663
             M  ME+FSA+RL+S+E+IR  E+ S+L +L+  S   +P LLKD L  ++LNVISRM LG
Sbjct  131   MCLMELFSARRLESYEYIRAEEMSSLLKELFGFSG--RPFLLKDCLSTVSLNVISRMVLG  188

Query  664   KSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLD  843
             + YL+  E ++V+P EFKKMLDE+FLL+G LNIGDLIP+++FLDLQGY+K+ K ++KK D
Sbjct  189   RRYLDGDENAVVSPEEFKKMLDELFLLNGVLNIGDLIPYINFLDLQGYVKRMKVVSKKFD  248

Query  844   RFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGT  1023
             RFLEHVLDEH +RR     ++V++DMVDVLL+ A+DP +EVK+ER GVKAFT DLLAGGT
Sbjct  249   RFLEHVLDEHEARR--RTTEYVSRDMVDVLLELAEDPTLEVKLERHGVKAFTQDLLAGGT  306

Query  1024  ESSTV  1038
             ESS V
Sbjct  307   ESSAV  311



>ref|XP_006468115.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=536

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 224/297 (75%), Gaps = 3/297 (1%)
 Frame = +1

Query  148   IILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvv  327
             ++ I     RR L+LPPGP PWPIIGNLNL+G+LPHRSIH LSQKYGPIMQL+FGSFPVV
Sbjct  22    LLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVV  81

Query  328   vgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFS  507
             VGSSVEMAK+FLK  D NF  RP+  AGK+ TYNYS++ W+ YGPYW QAR++F +E+FS
Sbjct  82    VGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFS  141

Query  508   AKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE  687
              KRL+SFE IR  E+K  L  LY   S+ +PV LKD+L  L+LNVISRM LGK+Y  E+E
Sbjct  142   PKRLESFEFIRVQEIKKFLFGLYK--SSAKPVHLKDHLSKLSLNVISRMVLGKNYTEETE  199

Query  688   GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLD  867
                V P E+ +ML E+F L+G L IGD IPWL FLDLQG+IK+  AL KKLDRF E VL 
Sbjct  200   QDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIKRMIALMKKLDRFYELVLH  259

Query  868   EHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EH ++R      FVA DMVDVLLQ ADDP +E K+ER  VKA   DLLAGGTESSTV
Sbjct  260   EHNAKR-KSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKALIQDLLAGGTESSTV  315



>gb|AGV54723.1| flavonoid 3'-monooxygenase-like protein [Phaseolus vulgaris]
Length=511

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 228/284 (80%), Gaps = 4/284 (1%)
 Frame = +1

Query  187   HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLK  366
             +LPPGPKPWPIIGNLNLIG LPHRSIH+LS+KYGPIM + FGS PVVVGSSV+MAK FLK
Sbjct  35    NLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIMHVWFGSNPVVVGSSVDMAKAFLK  94

Query  367   TMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTH  546
             T D     RPK  AGK+ TYNY+++TWSQYGPYW QARRM  +E+FS KRL+ +E+IR  
Sbjct  95    THDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRKQ  154

Query  547   ELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKML  726
             EL+ +L+KL++  S  + +LLKD+L  L+LNV+ R   GK+YL +S+ +  +P EFK+M+
Sbjct  155   ELRCLLNKLFH--SADKTILLKDHLSNLSLNVLCRKVFGKNYLEKSK-TPGSPEEFKRMI  211

Query  727   DEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKF  906
             DE+FLL+G  NIGD IPW+DFLDLQGYIK+ KAL+KK D F+EHVLDEH  R+    D +
Sbjct  212   DELFLLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHFERKKGVKD-Y  270

Query  907   VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VAKDMVDV LQ A+DP +EVK+ERQGVKAFT DL+AGGTESS V
Sbjct  271   VAKDMVDVFLQLAEDPTLEVKLERQGVKAFTQDLIAGGTESSAV  314



>gb|EMT12959.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=549

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 241/321 (75%), Gaps = 8/321 (2%)
 Frame = +1

Query  91    SMEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             SME P W  +    L+TI + L A   R+   +LPPGPKPWPIIGNLNLIGTLPHRSIH 
Sbjct  33    SMELPPWAPFLAVVLATI-LFLKAVFRRKGTCNLPPGPKPWPIIGNLNLIGTLPHRSIHA  91

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LS++YGP+MQL+FGSFPVVVG+S EMAK+FLKT D+ F DRP+  AGK+  Y+ S +TWS
Sbjct  92    LSRQYGPLMQLRFGSFPVVVGASAEMAKLFLKTHDVVFTDRPRTAAGKYTGYDNSTITWS  151

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              Y  +W QARR+   E+FSAKRL+S+ +IR  E+ ++L  L+  S   + VLLKD+L  L
Sbjct  152   PYNAHWRQARRVCLAELFSAKRLESYAYIRREEMCALLCGLHETSG--RVVLLKDHLSTL  209

Query  631   nlNVISRMALGKSYL-----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             +LNVISRM LG+ YL      E   +I+ P EFK M+DE+F L+G LNIGD IPWLD++D
Sbjct  210   SLNVISRMVLGRKYLEKQAVGEDGPAIMAPEEFKCMIDELFFLNGVLNIGDSIPWLDWMD  269

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGY+++ K L+KK D+FLEHVLD+H  RR ++G+ FV++DMVDVLL+ A DPN+EVK+ 
Sbjct  270   LQGYVRRMKKLSKKFDQFLEHVLDDHNERRRLQGESFVSRDMVDVLLEIASDPNLEVKLH  329

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R GVKAF  DL+AGGTE++ +
Sbjct  330   RNGVKAFIQDLIAGGTETTAI  350



>ref|XP_006465907.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 251/314 (80%), Gaps = 6/314 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P+W +Y  AWL+T+A++L++  LRRRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+K
Sbjct  6     PSWASYLAAWLATLALVLLSLRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSLHALSEK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQL+FGSFPVVVGSS EMAK+ LKT D  F  RPK  AGK+ T+NYS++TWS YGP
Sbjct  66    YGPIMQLKFGSFPVVVGSSAEMAKVILKTQDALFSGRPKTAAGKYTTFNYSDITWSPYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW QAR++ +ME+FS KRL+SFE+IR  EL   L++LY   S  +P +LKD+L  L+L +
Sbjct  126   YWRQARKICSMELFSVKRLESFEYIRVQELNLFLNRLYE--SFGKPTILKDHLSDLSLAI  183

Query  643   ISRMALGKSYLNES-EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             ISRM LGK Y ++  E  +V P EF  M+DE+F+L+G L++GD IPWL FLDLQG IK+ 
Sbjct  184   ISRMVLGKKYTDKQLENEVVTPQEFTAMVDELFMLNGVLDVGDSIPWLGFLDLQGNIKKM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             KAL KK D+FLEHVLDEH +RR  +G + +VAKDMVDVLLQ ADDP +EVKIER GVK F
Sbjct  244   KALAKKFDKFLEHVLDEHDARR--KGVENYVAKDMVDVLLQLADDPTLEVKIERHGVKGF  301

Query  997   TLDLLAGGTESSTV  1038
             T DL+AGGTESS V
Sbjct  302   TQDLIAGGTESSAV  315



>ref|XP_006665049.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=525

 Score =   337 bits (865),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 240/327 (73%), Gaps = 12/327 (4%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIIL-IAKHLRRR-----KLHLPPGPKPWPIIGNLNLIGTLPH  255
             ME P W +  +    T+A IL +A  L RR       +LPPGP+PWPIIGNL+L+G LPH
Sbjct  1     MELPPWASLLLLTGVTLATILFLAATLSRRGGRRASYNLPPGPRPWPIIGNLHLVGALPH  60

Query  256   RSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYS  435
             RSIH LS++YGP+M L+FGS  VVVGSS E+A+ FLKT D  F DRP+  AGK+ TYNYS
Sbjct  61    RSIHALSERYGPLMHLRFGSQHVVVGSSAELARFFLKTHDAVFADRPRTAAGKYTTYNYS  120

Query  436   NVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKL-YNVSSTRQPVllk  612
             ++TWS YG YW QAR++   E+FSA+R+DS+EHIR+ E +++L  L    +S R+ V LK
Sbjct  121   DMTWSPYGAYWRQARKICLTELFSARRIDSYEHIRSDETRALLRGLNAAAASGRRAVRLK  180

Query  613   dylfllnlNVISRMALGKSYLNESE----GSIV-NPGEFKKMLDEVFLLSGALNIGDLIP  777
             ++L   +LN+ISRM LG+ YL   E    G +V  P +F+ M+DE+FLL+G LNIGD IP
Sbjct  181   EHLSTASLNLISRMVLGRKYLEGGEVVHRGEVVTTPEQFRWMIDELFLLNGVLNIGDSIP  240

Query  778   WLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPN  957
             WL+FLDLQGYI++ K L+K  DRFLEHVLDEH +RR  EG+ FVA+D+VDVLL+ ADDP 
Sbjct  241   WLNFLDLQGYIRRMKKLSKMFDRFLEHVLDEHETRRHHEGEAFVARDLVDVLLKVADDPC  300

Query  958   MEVKIERQGVKAFTLDLLAGGTESSTV  1038
             ++V+  R  VKAFT DL+AGGTESS +
Sbjct  301   LQVEFTRDSVKAFTQDLIAGGTESSAM  327



>emb|CAN82000.1| hypothetical protein VITISV_023195 [Vitis vinifera]
Length=509

 Score =   336 bits (862),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 238/318 (75%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRR-RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+W+  A+AWL+++A++      R   K +LPPGP PWPIIGNLNLIG LPHRS+H 
Sbjct  1     MEAPSWVVLALAWLASVALLSKVFSFRPPHKQNLPPGPTPWPIIGNLNLIGHLPHRSLHK  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYG IM+L+FGSFPVVV SS EMAK FLKT D  F  RP   AGK++TYNYSN+TW+
Sbjct  61    LSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPXTAAGKYITYNYSNITWA  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW Q R++F  E+FS+KRL S+E+IR  E ++ + +LY +S   +PV+LK++L  +
Sbjct  121   PYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLSRV  178

Query  631   nlNVISRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
              L VISR+ LG+ Y +E E   S++   E +KML E+FLL+G LNIGD IPW+ FLDLQG
Sbjct  179   TLGVISRIVLGEKYFSEFESGRSMLTVEECQKMLGELFLLNGVLNIGDWIPWIAFLDLQG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             Y+K+ KAL  K DRF +HVL++H +RR  E + FVAKDMVD+LL+ ADDP++EVK+   G
Sbjct  239   YVKRMKALRDKFDRFYDHVLEKHRARR--EAEDFVAKDMVDMLLRLADDPDVEVKLTTDG  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             +K FT DL+AGGT++S  
Sbjct  297   IKGFTQDLIAGGTDTSAT  314



>ref|XP_002278462.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=509

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 238/318 (75%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRR-RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME P+W+  A+AWL+++A++      R   K +LPPGP PWPIIGNLNLIG LPHRS+H 
Sbjct  1     MEAPSWVVLALAWLASVALLSKVFSFRPPHKQNLPPGPTPWPIIGNLNLIGHLPHRSLHK  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYG IM+L+FGSFPVVV SS EMAK FLKT D  F  RP   AGK++TYNYSN+TW+
Sbjct  61    LSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPHTAAGKYITYNYSNITWA  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW Q R++F  E+FS+KRL S+E+IR  E ++ + +LY +S   +PV+LK++L  +
Sbjct  121   PYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLSRV  178

Query  631   nlNVISRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
              L VISR+ LG+ Y +E E   S++   E +KML E+FLL+G LNIGD IPW+ FLDLQG
Sbjct  179   TLGVISRIVLGEKYFSEFESGRSMLTVEECQKMLGELFLLNGVLNIGDWIPWIAFLDLQG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQG  984
             Y+K+ KAL  K DRF +HVL++H +RR  E + FVAKDMVD+LL+ ADDP++EVK+   G
Sbjct  239   YVKRMKALRDKFDRFYDHVLEKHRARR--EAEDFVAKDMVDMLLRLADDPDVEVKLTTDG  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             +K FT DL+AGGT++S  
Sbjct  297   IKGFTQDLIAGGTDTSAT  314



>gb|KDO65006.1| hypothetical protein CISIN_1g0386481mg, partial [Citrus sinensis]
Length=274

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/277 (65%), Positives = 221/277 (80%), Gaps = 6/277 (2%)
 Frame = +1

Query  175  RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAK  354
            RRKL+LPPGPKPWPIIGNL+LIG+LPHRS+H LS+KYGPIMQL+FGSFPVVVGSS EMAK
Sbjct  1    RRKLNLPPGPKPWPIIGNLHLIGSLPHRSLHALSEKYGPIMQLKFGSFPVVVGSSAEMAK  60

Query  355  IFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEH  534
            + LKT D  F  RPK  AGK+ T+NYS++TWS YGPYW QAR++ +ME+FS KRL+SFE+
Sbjct  61   VILKTQDALFSGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKICSMELFSVKRLESFEY  120

Query  535  IRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES-EGSIVNPGE  711
            IR  EL   L++LY   S  +P +LKD+L  L+L +ISRM LGK Y ++  E  +V P E
Sbjct  121  IRVQELNLFLNRLYE--SFGKPTILKDHLSDLSLAIISRMVLGKKYTDKQLENEVVTPQE  178

Query  712  FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
            F  M+DE+F+L+G L++GD IPWL FLDLQG IK+ KAL K+ D+FLEHVLDEH +RR  
Sbjct  179  FTAMVDELFMLNGVLDVGDSIPWLGFLDLQGNIKKMKALAKRFDKFLEHVLDEHDARR--  236

Query  892  EG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
            +G + +VAKDMVDVLLQ ADDP +EVKIER GVK FT
Sbjct  237  KGVENYVAKDMVDVLLQLADDPTLEVKIERHGVKGFT  273



>ref|XP_011036443.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
 ref|XP_011036444.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 181/300 (60%), Positives = 232/300 (77%), Gaps = 6/300 (2%)
 Frame = +1

Query  148   IILIAKHLRRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQKYGPIMQLQfgsfpv  324
             +I + +HL R KL+LPPGPKPWPIIGNLNL+ G LPHR++H L QKYGPIMQL+FGSFPV
Sbjct  16    VITLFRHLTRPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHALVQKYGPIMQLKFGSFPV  75

Query  325   vvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVF  504
             VVGSSVEMA+  LKT D+   DRPK  AGK+ TYNYSN+TWSQYGPYW QAR++  ME+F
Sbjct  76    VVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWRQARKICLMEIF  135

Query  505   SAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES  684
             S KRLD FE +R  EL ++L KL+   S  +P+  +D    L+L+VISR+ LGK+Y  ++
Sbjct  136   SPKRLDQFETVRVQELHALLRKLF--VSAGKPINARDNFSDLSLSVISRLVLGKNYTVKT  193

Query  685   --EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEH  858
               +   ++P EFK+M+DE+FLL+G L+IGD IPWL FLDLQGYIK+ KA+ +  D FLEH
Sbjct  194   GNQKEYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKAVGRLFDGFLEH  253

Query  859   VLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              L+EH  RR    D +V +DM+D+LLQ +DDPN+EV+++R  VKAFT+DL+AGGTESS V
Sbjct  254   TLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTMDLIAGGTESSAV  312



>ref|XP_006427726.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
 gb|ESR40966.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
Length=513

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 241/315 (77%), Gaps = 8/315 (3%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHL-RRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQ  279
             +W++   AWL+T+A+ILI  HL RRRKL+LPPGPK WPIIGNLNLI G  PHRS+  L +
Sbjct  7     SWVSCWAAWLATLAVILIPLHLLRRRKLNLPPGPKSWPIIGNLNLIMGPAPHRSVDALCK  66

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGPI+QL+FGSFPVVV SSVEMAK  LK+ D  F  RPK  AGK+  YN+SN+TWS YG
Sbjct  67    KYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNITWSPYG  126

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PY++QAR++ TME+F+AKRL S+E+IR  EL  +L  LY   S+ +P+ LKD+L  ++LN
Sbjct  127   PYFNQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLY--ESSGKPIALKDHLADVSLN  184

Query  640   VISRMALGKSYLNESEGSI-VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             VISR+ LGK Y NE +  I +   E K+M+DE+ LL+G  +IGD IPWL FLDLQG IK+
Sbjct  185   VISRVVLGKKYSNERQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDLQGNIKR  244

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
              KA+ KK DRFLE V+DEH +RR  +G D +VAKDMVDVLL  ADDP +EV+++R  VK 
Sbjct  245   MKAVAKKFDRFLEQVVDEHNARR--KGIDNYVAKDMVDVLLLLADDPTLEVRLDRHSVKG  302

Query  994   FTLDLLAGGTESSTV  1038
             FTLDL+AG TE+ST+
Sbjct  303   FTLDLIAGATETSTL  317



>ref|XP_010064025.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW71323.1| hypothetical protein EUGRSUZ_F04405 [Eucalyptus grandis]
Length=510

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 236/319 (74%), Gaps = 8/319 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILI--AKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             M+ P+W+AY +A L+   ++L+  + HLRRR+L LPPGPKPWPIIGNLNLIG LPHRSIH
Sbjct  1     MDAPSWVAYGIACLAAAFLLLLLLSGHLRRRQLKLPPGPKPWPIIGNLNLIGPLPHRSIH  60

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
             DLS+ YGP+M+LQFG + VVVG S +MAK  L+T    F  RP   AGK+  YNYS+V W
Sbjct  61    DLSRTYGPLMKLQFGYYDVVVGCSADMAKALLQTHGTVFAYRPNLAAGKYTAYNYSDVLW  120

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             S YGPY  QAR++F   +FSA RL SFE+IR  E + +   ++      QPV LKD+L  
Sbjct  121   SPYGPYLRQARKIFLTHLFSAARLQSFEYIRVEETRVLTRNMF--EGKGQPVNLKDHLSD  178

Query  628   lnlNVISRMALGKSYLNESEGS-IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
             L LNVISRM LGK Y ++ E S IV P EFKKM+ E F+L+G +NIGD  PWL+FLDL+G
Sbjct  179   LTLNVISRMVLGKKYTDKFESSDIVLPEEFKKMIAEWFMLNGVVNIGDFAPWLNFLDLRG  238

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRV-VEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             YIK+ KAL+KK DRFLEHV+DEH +RRV ++G +  AKDMVDVLLQH DDPN+EVKIER 
Sbjct  239   YIKRMKALSKKFDRFLEHVVDEHEARRVGLKGHE--AKDMVDVLLQHVDDPNVEVKIERH  296

Query  982   GVKAFTLDLLAGGTESSTV  1038
             GVKA   DL+ GGT +S +
Sbjct  297   GVKALIQDLIVGGTGTSAM  315



>ref|XP_007012629.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY30248.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=539

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 239/344 (69%), Gaps = 34/344 (10%)
 Frame = +1

Query  100   GPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
              P+W   A+ WL+++A +      RR +L LPPGPKPWPIIGNLNLI +LPH+S+H LSQ
Sbjct  2     APSWFVVAITWLASLAFLSRIFTSRRNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQ  61

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGP+MQL+FGS+PVVV SS +MAK FLK  D NF  RP+  AGKH TYNY N+TW+ YG
Sbjct  62    KYGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYG  121

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PYW Q R+++  E+FS+KRL+SFE+IR  E+++ + +LY  S   +PV+LK++L    L+
Sbjct  122   PYWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLS  179

Query  640   VISRMALGKSYLNES----EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             VISR+ LGK Y +ES    E SIV   EF+++LDE+FLL+G LNIGD IPWLDFLDLQGY
Sbjct  180   VISRIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGY  239

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
             +K+ KAL KKLDRF EHV +EH S++  E   FV +DMVD+LLQ ADDP+++VK+   GV
Sbjct  240   LKRMKALKKKLDRFHEHVFNEHKSKK-KELKDFVPQDMVDLLLQLADDPDIDVKLSYDGV  298

Query  988   KAFT---------------------------LDLLAGGTESSTV  1038
             + FT                            DL+AGGT++S  
Sbjct  299   RGFTQKKEKKRAFCFAPLLLDDNFSCFVNRDQDLVAGGTDTSAT  342



>ref|XP_009413866.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 241/321 (75%), Gaps = 8/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P+   Y    L    +  + +  RR KL+LPPGP+PWP+IGNLNLIG LP+RS+  L
Sbjct  1     MEIPSSAIYLALVLVFTLLTGLYRGRRRHKLNLPPGPRPWPVIGNLNLIGPLPYRSLAAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQK+GP+M L+FGSFPVVVGSSV+MAK FLKT D++FV RPK VAGK+  YN+SN++WS 
Sbjct  61    SQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKTVAGKYTFYNHSNISWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARR+  ME+ + KRLDS+++IR  E++ +L  L+   ST  PVLL DY+F +N
Sbjct  121   YGPYWRQARRILIMELLTPKRLDSYQYIRVEEVRGLLRDLFR--STETPVLLNDYIFTVN  178

Query  634   lNVISRMALGKSYLNE------SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LN+ISR+ LG+ Y  E      +  +IV   EFK+M++E+ LL+G +N+GDLIPWL+FLD
Sbjct  179   LNIISRIVLGRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLNFLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGY+K+ K + K+ DRFLEHVLDEH  RR  EG  FV +D+VDVLL+ ADD ++EVK+E
Sbjct  239   LQGYVKRMKMVGKRFDRFLEHVLDEHNERRRREGKAFVPRDLVDVLLELADDHSLEVKLE  298

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R  +KAF LD+ AGGT++STV
Sbjct  299   RHCLKAFILDMFAGGTDTSTV  319



>ref|XP_008463992.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=507

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 240/319 (75%), Gaps = 11/319 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR---RRKLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             ME   W++Y  A+++   + L+        R KL+L PGPKPWP+IGNLNL+G LPH+SI
Sbjct  1     MEPDLWVSYTTAYIAIATLALLLLSRWFLLRPKLNLLPGPKPWPLIGNLNLMGPLPHQSI  60

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS+KYGPIMQL+FGSFPVVVGSSVEMAK+F KT D  F+ RP+  AGKHL+YNYS + 
Sbjct  61    HQLSKKYGPIMQLRFGSFPVVVGSSVEMAKLFFKTHDSLFLSRPRITAGKHLSYNYSGIL  120

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf  624
             WS YGPYW QAR++ + E+FSAKRLDSFE++R  E+ SM+  ++N  S  +P+ LK++L 
Sbjct  121   WSPYGPYWLQARKICSTELFSAKRLDSFEYMRKEEVNSMIKAIHN--SIGKPIQLKNHLS  178

Query  625   llnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
              ++LNVI RM LGK Y    E + V P EFKKMLDE FLLSG LNIGD IP + FLDLQG
Sbjct  179   TMSLNVICRMVLGKKY---EENTSVPPNEFKKMLDEFFLLSGVLNIGDYIPLISFLDLQG  235

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRRV-VEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             Y+K+ KAL+KK DR LE+VLDEH  RR  VEG  +VAKD+VDVLLQ AD+ N+EVK+ER 
Sbjct  236   YVKRMKALSKKFDRLLENVLDEHNERRKGVEG--YVAKDVVDVLLQLADNSNLEVKLERN  293

Query  982   GVKAFTLDLLAGGTESSTV  1038
             GVKA   D++ GGT+SS +
Sbjct  294   GVKAIVQDIIIGGTQSSAI  312



>ref|XP_006494828.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=513

 Score =   332 bits (852),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 239/315 (76%), Gaps = 8/315 (3%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHL-RRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQ  279
             +W++   AWL+T+A+ILI  HL RRRKL+LPPGPK WPIIGNLNL  G  PHRS+  L +
Sbjct  7     SWVSCWGAWLATLAVILIPLHLLRRRKLNLPPGPKSWPIIGNLNLFTGPAPHRSVDALCK  66

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYGPI+QL+FGSFPVVV SSVEMAK  LK+ D  F  RPK  AGK+  YN+SN+TWS YG
Sbjct  67    KYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNITWSPYG  126

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             PY+ QAR++ TME+F+AKRL S+E+IR  EL  +L  LY   S+ +P+ LKD+L  ++LN
Sbjct  127   PYFSQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLY--ESSGKPIALKDHLADVSLN  184

Query  640   VISRMALGKSYLNESEGSI-VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             VISR+ LGK Y NE +  I +   E K+M+DE+ LL+G  +IGD IPWL FLDLQG IK+
Sbjct  185   VISRVVLGKKYSNERQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDLQGNIKR  244

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
              KA+ KK DRFLE V+DEH +RR  +G D +VAKDMVDVLL  ADDP +EVK++R  VK 
Sbjct  245   MKAVAKKFDRFLEQVVDEHNARR--KGIDNYVAKDMVDVLLLLADDPTLEVKLDRHSVKG  302

Query  994   FTLDLLAGGTESSTV  1038
             FTLDL+AG TE+ST+
Sbjct  303   FTLDLIAGATETSTL  317



>gb|KDO48980.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=506

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 222/297 (75%), Gaps = 9/297 (3%)
 Frame = +1

Query  148   IILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvv  327
             ++ I     RR L+LPPGP PWPIIGNLNL+G+LPHRSIH LSQKYGPIMQL+FGSFPVV
Sbjct  22    LLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVV  81

Query  328   vgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFS  507
             VGSSVEMAK+FLK  D NF  RP+  AGK+ TYNYS++ W+ YGPYW QAR++F +E+FS
Sbjct  82    VGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFS  141

Query  508   AKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE  687
              KRL+SFE IR  E+K  L  LY   S+ +PV LKD+L  L+LNVISRM LGK+Y  E+E
Sbjct  142   PKRLESFEFIRVQEIKKFLFGLYK--SSAKPVHLKDHLSKLSLNVISRMVLGKNYTEETE  199

Query  688   GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLD  867
                V P E+ +ML E+F L+G L IGD IPWL FLDLQG+IK+ KAL KKLDRF E VL 
Sbjct  200   QDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLH  259

Query  868   EHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EH ++R      FVA DMVDVLLQ ADDP +E K+ER        DLLAGGTESSTV
Sbjct  260   EHNAKR-KSSTGFVASDMVDVLLQLADDPTLEFKLERDQ------DLLAGGTESSTV  309



>ref|XP_009388239.1| PREDICTED: flavonoid 3'-monooxygenase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   330 bits (846),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 237/321 (74%), Gaps = 8/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P+   Y    L    +  + +  RR KL+LPPGP+PWP+IGNLNLIG LP+RS+  +
Sbjct  1     MEIPSSAIYLALVLVFTLLAGLYRGGRRHKLNLPPGPRPWPVIGNLNLIGPLPYRSLAAI  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQK+GP+M L+FGSFPVVVGSSV+MAK FLKT D++FV RPK VAGK+   NYSN+ WS 
Sbjct  61    SQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKTVAGKYTANNYSNINWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARR+F ME+F+ KRLDS+++IR  E++ +L  L+   ST  P++LKD +F +N
Sbjct  121   YGPYWRQARRIFIMELFTPKRLDSYQYIRVEEVRGLLRDLFR--STETPIVLKDRIFTVN  178

Query  634   lNVISRMALGKSYLNE------SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LN+ISR+ LG+ Y  E      +  +IV   EFK+M+ E+ LL+G +N+GDLIPWL+FLD
Sbjct  179   LNIISRIVLGRKYTQEQSVSSGAPAAIVPQEEFKEMMGELMLLNGVINVGDLIPWLNFLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGY+K+ K + K+ DRFLEHVLDEH  RR  EG  FV +D+VDVLL+ ADD  +EVK+E
Sbjct  239   LQGYVKRMKMVGKRFDRFLEHVLDEHNERRRREGKAFVPRDLVDVLLELADDHGLEVKLE  298

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R  +KAF LD+ AG T++ TV
Sbjct  299   RHCLKAFILDMFAGSTDTVTV  319



>ref|XP_006369134.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
 gb|ERP65703.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
Length=513

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P  + Y  A L+T+ +IL+++ L  RKL LPPGPKPWPIIGN NLIG LPHRS+H+L++K
Sbjct  6     PPAITYTAAGLATVVLILLSRRLFSRKLKLPPGPKPWPIIGNFNLIGPLPHRSLHELAKK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQ++FGS PVVVGSS E+A+  LKT DI+  DRPK  AGK+ TYNYS++TWSQYGP
Sbjct  66    YGPIMQIKFGSIPVVVGSSAEVAEAILKTHDISLADRPKIAAGKYTTYNYSDITWSQYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW   R+   ME+FS KRLD ++H+R  EL S+L  LY  S T  P   ++    L+L+V
Sbjct  126   YWSHLRKFCNMEIFSPKRLDFYQHVRVEELHSLLKSLYKTSGT--PFKTREKFSDLSLSV  183

Query  643   ISRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             ISR+ LG++Y  ESE    +  P EFKK+LDE+F+L+G L IGD IPWL + DLQG IK+
Sbjct  184   ISRLVLGRNYTLESEKGKGVYTPHEFKKILDELFVLNGVLEIGDWIPWLSYFDLQGNIKK  243

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
              KA+ KK+DRF+EH L+EH +RR   G K +VAKDM+D+LLQ +DDP+++V+  R GVKA
Sbjct  244   MKAVAKKVDRFIEHELEEHDARR--NGVKNYVAKDMMDILLQLSDDPSLDVEFGRTGVKA  301

Query  994   FTLDLLAGGTESSTV  1038
              TLDL+AGGTES+ V
Sbjct  302   LTLDLIAGGTESTAV  316



>gb|EAZ09257.1| hypothetical protein OsI_31530 [Oryza sativa Indica Group]
Length=530

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 227/316 (72%), Gaps = 18/316 (6%)
 Frame = +1

Query  94   MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
            ME P+W A  +  +    + L+A  LR  RR   LPPGP PWPIIGNLNLIG LPHRSIH
Sbjct  3    MELPSW-ASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIH  61

Query  268  DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
            +LS++YGP+MQL+FGSFPVVVGSS EMA+ FLK+ DI F DRP+  AGKH TYNY+++ W
Sbjct  62   ELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILW  121

Query  448  SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
            S YG YW QAR+M   E+FSA+RL+SFEHIR  E++++L  L+  ++   PVLL+DYL  
Sbjct  122  SPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAA---PVLLRDYLST  178

Query  628  lnlNVISRMALGKSYLN------------ESEGSIVNPGEFKKMLDEVFLLSGALNIGDL  771
              L VISRM LGK Y+             E       P EFK M+DE+FLLSG LNIGD 
Sbjct  179  ATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGDF  238

Query  772  IPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADD  951
            IPWLD+LDLQGYI++ K + KKLDRF+EHVLDEH   R  +GD+F A+D+VDVLLQ ADD
Sbjct  239  IPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLADD  298

Query  952  PNMEVKIERQGVKAFT  999
            PN+EV++ R  VKA T
Sbjct  299  PNLEVQLRRDNVKALT  314



>emb|CDP17539.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 226/289 (78%), Gaps = 4/289 (1%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +KL+LPPGPKPWPI+GNLNLIG+L HRS+H LS  YGP+M L+FGSFPVVVGSS+ MAK+
Sbjct  40    KKLNLPPGPKPWPIVGNLNLIGSLSHRSLHQLSLTYGPLMHLRFGSFPVVVGSSMMMAKV  99

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             FLKTMD+ F DRPK  AGK+ +YN S++ WS YG YW QAR+M  ME+FSAKRL+S+EHI
Sbjct  100   FLKTMDVTFADRPKTAAGKYTSYNCSDIMWSPYGAYWRQARKMCLMELFSAKRLESYEHI  159

Query  538   RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES-EGSIVNPGEF  714
             R  E+ S+L  L+   S  +PVLLKDYL  ++LNVISRM LGK YL+ES + SI+ P EF
Sbjct  160   RVEEMNSLLLGLFQ--SLGKPVLLKDYLTTMSLNVISRMVLGKRYLDESDQNSIITPEEF  217

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
              KM+DE+ LL+G  NIGD IPWL+FLDLQGYIK+ K L+KK D FLEHVLDEH   R+  
Sbjct  218   VKMMDELLLLNGVFNIGDSIPWLNFLDLQGYIKRMKILSKKFDWFLEHVLDEHNVARMRN  277

Query  895   GDKF-VAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              ++  V+KDMVDVLL  A+    EVK+ER GVKAFT DLL GGTESS +
Sbjct  278   DEQNQVSKDMVDVLLDLAEHQTSEVKLERHGVKAFTQDLLVGGTESSAL  326



>ref|XP_010239382.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=522

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 225/300 (75%), Gaps = 9/300 (3%)
 Frame = +1

Query  166   HLRRR----KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvg  333
             H RRR      +LPPGPKPWPIIGNLNLIGTLPH SIH L+++YGP+MQL+FGSFPVVVG
Sbjct  25    HRRRRGNQRTYNLPPGPKPWPIIGNLNLIGTLPHHSIHALAKQYGPLMQLRFGSFPVVVG  84

Query  334   ssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAK  513
             SSV+MAK FLKT D  F+DRPK  AGKH  YNYS++TWS YG YW QAR+M   E+FSAK
Sbjct  85    SSVDMAKFFLKTHDAVFIDRPKTAAGKHTGYNYSDITWSPYGAYWRQARKMCLTELFSAK  144

Query  514   RLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--  687
             RL+S+E+IR+ E++++L  L+  S   + V LKDYL  L+LNVI+RM +GK Y  ++E  
Sbjct  145   RLESYEYIRSEEMRALLCGLHEASGLGRVVKLKDYLSTLSLNVITRMVMGKRYQQDNEVA  204

Query  688   ---GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEH  858
                GS+    E K MLDE+FLL G L IGD IPWL +LDLQGYIK+ K L+K  DRFLEH
Sbjct  205   DQGGSVTTLEELKSMLDELFLLEGVLVIGDSIPWLRWLDLQGYIKRMKKLSKVFDRFLEH  264

Query  859   VLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             V+DEH  RR++EG  F A DMVDVLL+ A DPN+EVK+ R GVKA T DL+AG   S+T 
Sbjct  265   VVDEHNERRLLEGQSFKATDMVDVLLEVASDPNLEVKLNRYGVKAITQDLMAGPETSATT  324



>ref|XP_011035731.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=513

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +1

Query  103   PTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             P  + Y  A L+T+ +IL+++ L  RKL LPPGPKPWPIIGN NLIG LPHRS+H+L++K
Sbjct  6     PPAITYTAAGLATVVLILLSRRLFGRKLKLPPGPKPWPIIGNFNLIGPLPHRSLHELAKK  65

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YGPIMQ++FGS PVVVGSS E+A+  LKT DI+  DRPK  AGK+ TYNYS++TWSQYGP
Sbjct  66    YGPIMQIKFGSIPVVVGSSSEVAEAILKTHDISLADRPKIAAGKYTTYNYSDITWSQYGP  125

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             YW   R+   ME+FS KRLD ++H+R  EL S+L  LY  S T  P   ++    L+L+V
Sbjct  126   YWSHLRKFCNMEIFSPKRLDFYQHVRVEELHSLLKSLYKTSGT--PFKTREKFSDLSLSV  183

Query  643   ISRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQ  816
             ISR+ LG++Y  ESE    +  P EFKK+LDE+F+L+G L IGD IPWL + DLQG IK+
Sbjct  184   ISRLVLGRNYTLESEKGKGVYTPHEFKKILDELFVLNGVLEIGDWIPWLSYFDLQGNIKK  243

Query  817   TKALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
              KA+ KK+DRF+EH L+EH +RR   G K +VAKDM+D+LLQ +DDP+++V+  R GVKA
Sbjct  244   MKAVAKKVDRFIEHELEEHDARR--NGVKNYVAKDMMDILLQLSDDPSLDVEFGRTGVKA  301

Query  994   FTLDLLAGGTESSTV  1038
              TLDL+AGGTES+ V
Sbjct  302   LTLDLIAGGTESTAV  316



>dbj|BAJ96250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 234/305 (77%), Gaps = 11/305 (4%)
 Frame = +1

Query  151   ILIAKHLRRRKLH---LPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
             +L  K + RR  H   LPPGPKPWPIIGNLNL+G LPHRSIHDLS++YGPIM L+FGSFP
Sbjct  1     MLFLKCVFRRSRHAHNLPPGPKPWPIIGNLNLMGALPHRSIHDLSKRYGPIMYLRFGSFP  60

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             VVVGSSVEMAK FLKT D+ F+DRPK  AGKH TYNYSN+ W+ YG YW QAR++   E+
Sbjct  61    VVVGSSVEMAKFFLKTHDVVFIDRPKMAAGKHTTYNYSNIIWAPYGAYWRQARKVCLTEL  120

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             FSAKRL+S+E+IR+ E++++L  L+  S   + V+LKDYL  L+LNVI+RM LGK YL+ 
Sbjct  121   FSAKRLESYEYIRSEEMRALLRDLHEASG--RVVVLKDYLSTLSLNVITRMMLGKKYLHR  178

Query  682   ------SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLD  843
                     GS     EFK M+DE FLL+G LNIGD IPWLD++DLQGYIK+ K L+   D
Sbjct  179   PMEGTDGGGSTTTMEEFKWMIDEWFLLNGVLNIGDPIPWLDWMDLQGYIKRMKKLSMMFD  238

Query  844   RFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGT  1023
             RFLEHV+DEH  RR +EG+ FV++DMVDVLL+ A DP++EV+I+R  VKAF  DL+ GGT
Sbjct  239   RFLEHVVDEHNDRRRLEGESFVSRDMVDVLLEIASDPDLEVQIDRDSVKAFIQDLIVGGT  298

Query  1024  ESSTV  1038
             E+S++
Sbjct  299   ETSSI  303



>ref|XP_011039208.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=512

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 239/313 (76%), Gaps = 5/313 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TW++YA   L+TI +IL+ + +RRRKLHLPPGPKPWPIIGNL+L+G LPHRS+  LS+KY
Sbjct  6     TWVSYAAPLLATITLILLGRLIRRRKLHLPPGPKPWPIIGNLDLMGELPHRSLEALSKKY  65

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             G +MQ++FGS PVVVGSSVEMA+  LKT D++   RPK  +GK+ TYNY N+TW+QYGPY
Sbjct  66    GSLMQVKFGSHPVVVGSSVEMARAILKTHDLSLAGRPKTASGKYTTYNYQNITWAQYGPY  125

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR++  ME+FS KRLD FE+IR  E    L+ L+      +PV ++D+   L+ +VI
Sbjct  126   WRQARKLCLMELFSPKRLDQFEYIRVEENLKFLNTLFQKRG--KPVSVRDHFSDLSFSVI  183

Query  646   SRMALGKSYLNESEGS--IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             SR+ LG+ Y+ ESE    +++  EFK++LDE+FLL+G L IGD IPWL FLDLQGYIK+ 
Sbjct  184   SRLVLGRKYMAESEDEKDMLSLKEFKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRM  243

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             KA+ KK+D F+EH L+EH +RR    D +  +DM+D+LLQ ADDPN+EVK++R GVKAFT
Sbjct  244   KAVAKKMDMFMEHALEEHHARRKGLKD-YEPRDMLDILLQVADDPNLEVKLDRIGVKAFT  302

Query  1000  LDLLAGGTESSTV  1038
              DL+ GGTESS V
Sbjct  303   QDLINGGTESSAV  315



>ref|XP_002303240.1| hypothetical protein POPTR_0003s06480g [Populus trichocarpa]
 gb|EEE78219.1| hypothetical protein POPTR_0003s06480g [Populus trichocarpa]
Length=360

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 228/299 (76%), Gaps = 6/299 (2%)
 Frame = +1

Query  115   AYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQKYGP  291
              +A   L+T+A+I + +HL R KL+LPPGPKPWPIIGNLNL+ G LPHR++H L QKYGP
Sbjct  37    TFAALLLATVAVITLFRHLTRPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHALVQKYGP  96

Query  292   IMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWH  471
             IMQL+FGSFPVVVGSSVEMA+  LKT D+   DRPK  AGK+ TYNYSN+TWSQYGPYW 
Sbjct  97    IMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWR  156

Query  472   QARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISR  651
             QAR++  ME+FS KRLD FE +R  EL ++L KL+   S  +P+  +D    L+L+VISR
Sbjct  157   QARKICLMEIFSPKRLDQFETVRVQELHALLRKLF--VSAGKPINARDEFSDLSLSVISR  214

Query  652   MALGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKA  825
             + LGK+Y  ++  +   ++P EFK+M+DE+FLL+G L+IGD IPWL FLDLQGYIK+ KA
Sbjct  215   LVLGKNYTVKTGNQKQYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKA  274

Query  826   LNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
             + +  D FLE+ L+EH  RR    D +V +DM+D+LLQ +DDPN+EV+++R  VKAFT+
Sbjct  275   VGQLFDGFLEYTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTM  332



>ref|XP_009407098.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=539

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 235/321 (73%), Gaps = 8/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P    Y    L    +  +A   RRRKL+LPPGP+PWP+IGNLNLIG LP+RS+  L
Sbjct  1     MEIPLSAIYLAIVLVFTLLTALAGGRRRRKLNLPPGPRPWPVIGNLNLIGRLPYRSLAAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             +QK+GP+M L+FGSFPVVVGSSV+MAK FLKT D++FV R K  AGK+  YNYS++ WS 
Sbjct  61    AQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRRKTAAGKYTFYNYSDIGWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARR+  ME+F+ KRLDS+++IR  E++ +L  L+  + T  PVLLKD+LF +N
Sbjct  121   YGPYWRQARRICIMELFTTKRLDSYQYIRVEEVRCLLQDLFRSAET--PVLLKDHLFTIN  178

Query  634   lNVISRMALGKSYLNESEGSIVNPG------EFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LN++SRM LG+ Y  E   S V P       EFK+M++E+ LL+G +N+GDLIPWL+FLD
Sbjct  179   LNIMSRMVLGRKYTQEQSLSSVAPTAIVPQEEFKEMVEELLLLNGVINVGDLIPWLNFLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGY+K+ K L K+ DRFLEHVLDEH  RR  EG  FV +DM DVLL+ ADD  +EVK+E
Sbjct  239   LQGYVKRMKMLGKRFDRFLEHVLDEHNERRRREGKAFVPRDMADVLLELADDDGLEVKLE  298

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R  +KAF LD+   GT++ST+
Sbjct  299   RHCLKAFILDMFVAGTDTSTI  319



>ref|XP_006475100.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=509

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/292 (59%), Positives = 220/292 (75%), Gaps = 4/292 (1%)
 Frame = +1

Query  169   LRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEM  348
              RRR L  P GPKPWPIIGNLNLIG LPH+S+H LSQKYG IMQL+FGSFPVVV +S EM
Sbjct  24    FRRRALKFPAGPKPWPIIGNLNLIGPLPHQSLHKLSQKYGQIMQLKFGSFPVVVAASAEM  83

Query  349   AKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSF  528
             AK FL+T D  F  RP+  AGKH TYNY N+TW+ YGPYW Q R+++  E+FS+KRL+S+
Sbjct  84    AKQFLQTHDHIFSSRPQTAAGKHTTYNYLNLTWAPYGPYWRQGRKLYLSELFSSKRLESY  143

Query  529   EHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES--EGSIVN  702
             ++IR  E ++ + +LY +S   +P++LK++L  + L++ISR  LGK Y +ES  E SIV 
Sbjct  144   QYIRVEEYRAFISRLYALSG--KPIVLKEHLSRVTLSIISRTVLGKKYFSESKAEDSIVT  201

Query  703   PGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSR  882
               EF++MLDE+FLL+G LNIGD IPWLDFLDLQGY+K+ KAL KK DRF +HV DEH + 
Sbjct  202   LEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRMKALKKKFDRFHDHVFDEHKAN  261

Query  883   RVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             R      FV KDMVD+LLQ ADDPN++VK+    V+ FT DL+AGGT++S  
Sbjct  262   RKGNLKDFVPKDMVDLLLQMADDPNLDVKLNYDSVRGFTQDLIAGGTDTSAT  313



>ref|XP_004984305.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=536

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 226/287 (79%), Gaps = 1/287 (0%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K +LPPGP+PWP+IGNLNLIG+LPHRSIH+LS ++GP+M L+FGS PVVVG+SV+ A+  
Sbjct  43    KYNLPPGPRPWPVIGNLNLIGSLPHRSIHELSARHGPLMSLRFGSVPVVVGASVDAARFI  102

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D+ F+DRPK  +G++  YN+S++ WS YG YW QAR+++  ++FSA++L S EH+R
Sbjct  103   LKTHDVAFIDRPKMASGRYTAYNFSDIVWSPYGAYWRQARKLWQTKLFSARQLRSQEHVR  162

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE-SEGSIVNPGEFK  717
               E++ +L  L+ ++  R  V LK++L +LNLNVISRMALG+ Y+ E + GS V+P EF+
Sbjct  163   LEEVRDLLRGLHGLAEGRVAVALKEHLLMLNLNVISRMALGRKYVGEGTAGSPVSPAEFR  222

Query  718   KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
              M+DE+F+L+G  +IGD IPWL+ LDLQGYI + K L K  DRFLEHV+DEH  RR  EG
Sbjct  223   WMVDELFVLNGVFSIGDFIPWLNCLDLQGYIARMKRLGKMFDRFLEHVVDEHNERRRREG  282

Query  898   DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             + FVAKDMVD+LL+ ADDP++EV IER GVK F LDL+AGGT++S V
Sbjct  283   EGFVAKDMVDLLLELADDPSLEVPIERDGVKGFALDLIAGGTDTSAV  329



>ref|XP_009413943.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 238/321 (74%), Gaps = 8/321 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P+   Y    L    +  +    RR+KL+LPPGP+PWP+IGNLNLIG LP+RS+  L
Sbjct  1     MEIPSSAIYLALVLVFTLLTGLYGGRRRQKLNLPPGPRPWPVIGNLNLIGPLPYRSLAAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQK+GP+M L+FGSFPVVVGSSV+MAK FLKT D++FV RPK+VAG++  YNYS++ WS 
Sbjct  61    SQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKSVAGEYTFYNYSSIGWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPYW QARR+  ME+ + KRLDS+++IR  E++ +L  L+   ST  PVLLKD++F + 
Sbjct  121   YGPYWRQARRILIMELLTPKRLDSYQYIRVEEVRGLLRDLFR--STGTPVLLKDHIFTVI  178

Query  634   lNVISRMALGKSYLNE------SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
             LN+ISR+ LG+ Y  E      +  +IV   EFK+M++E+ LL+G +N+GDLIPWL+FLD
Sbjct  179   LNIISRIVLGRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLNFLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
             LQGY+K+ K + K+ DRFLE VLD+H  RR  EG  FV +D+VDVLL+ ADD  +EVK+E
Sbjct  239   LQGYVKRMKMVGKRFDRFLERVLDKHNERRRREGKAFVPRDLVDVLLELADDHGLEVKLE  298

Query  976   RQGVKAFTLDLLAGGTESSTV  1038
             R  VKAF LD+ AGGT++ TV
Sbjct  299   RHCVKAFILDIFAGGTDTYTV  319



>ref|XP_004984304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=523

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 226/313 (72%), Gaps = 7/313 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLR-RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
             AV   + + ++ I +  R  RK +LPPGP+PWP+IGNLNLIG LPH SIHDLS +YGP+M
Sbjct  12    AVVLAAALFLVAILRQRRPTRKYNLPPGPRPWPVIGNLNLIGPLPHHSIHDLSARYGPLM  71

Query  298   QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
              L+FGS PVVVGSSVE A+ FLKT D+ F+DRP+  AGKH TYNYS + WS +G YW Q 
Sbjct  72    SLRFGSSPVVVGSSVETARFFLKTHDLAFIDRPRTAAGKHTTYNYSGLFWSPHGAYWRQG  131

Query  478   RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf------llnlN  639
             RR++  E+F+A+RL S EH+R  E++SML+ L   ++          +       ++NLN
Sbjct  132   RRLWQAELFNARRLASLEHVRGEEVRSMLNDLRASAAAAAAGGQHAAVALREHLYMVNLN  191

Query  640   VISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             VISRM LG+ Y+ +  GS V P EF++M+DE F L+GALN+GD+IPWL +LD QGY+++ 
Sbjct  192   VISRMVLGRKYVVDGAGSPVTPEEFRRMIDEHFSLNGALNVGDMIPWLSWLDPQGYVRRM  251

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             K   K  DRFLE+VLDEH  RR  EG +F+A DMVDVLL+ ADDPN+EV I R GVK FT
Sbjct  252   KRSAKMFDRFLEYVLDEHNERRRREGKEFIATDMVDVLLELADDPNLEVPIGRDGVKGFT  311

Query  1000  LDLLAGGTESSTV  1038
             LDL+ GGT++S+V
Sbjct  312   LDLIGGGTDTSSV  324



>dbj|BAD36163.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38068.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ44888.1| hypothetical protein OsJ_29529 [Oryza sativa Japonica Group]
Length=522

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 240/321 (75%), Gaps = 16/321 (5%)
 Frame = +1

Query  112   LAYAVAWLSTIAIIL--IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
              A  VA L T  + L  I+   RRRK +LPPGPKPWPIIGNLNL+G LPHRSIH+LS++Y
Sbjct  6     CASFVAILLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRY  65

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GP++ L+FGSFPVVVGSSVEMA+ FLKT D  F+DRP+  AGKH  YNY ++TWS    Y
Sbjct  66    GPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAY  125

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSST--RQPVllkdylfllnlN  639
             W QARR+   E+FSA+R++S+EHIR  E+ ++L  L+  SS+  R+ +++KDYL   +LN
Sbjct  126   WRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTASLN  185

Query  640   VISRMALGKSYLNESEGSIVN--PG-------EFKKMLDEVFLLSGALNIGDLIPWLDFL  792
             +I+RM +GK Y+   +G +V+  PG       +FK++L+E+F L+G  N+GD IPWL++L
Sbjct  186   MITRMVMGKRYV---QGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWL  242

Query  793   DLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKI  972
             DLQGY+K+ K ++K LD+ LEHV+DEH  RR  EG+ FVA DMVDVLL+ ADD ++EVK+
Sbjct  243   DLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEVKL  302

Query  973   ERQGVKAFTLDLLAGGTESST  1035
              R  +KAFT DL+AGGTESS+
Sbjct  303   SRDSIKAFTQDLIAGGTESSS  323



>gb|EAZ09261.1| hypothetical protein OsI_31534 [Oryza sativa Indica Group]
Length=522

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 240/321 (75%), Gaps = 16/321 (5%)
 Frame = +1

Query  112   LAYAVAWLSTIAIIL--IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
              A  VA L T  + L  I+   RRRK +LPPGPKPWPIIGNLNL+G LPHRSIH+LS++Y
Sbjct  6     CASFVAILLTTMLFLRAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRY  65

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             GP++ L+FGSFPVVVGSSVEMA+ FLKT D  F+DRP+  AGKH  YNY ++TWS    Y
Sbjct  66    GPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAY  125

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSST--RQPVllkdylfllnlN  639
             W QARR+   E+FSA+R++S+EHIR  E+ ++L  L+  SS+  R+ +++KDYL   +LN
Sbjct  126   WRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTASLN  185

Query  640   VISRMALGKSYLNESEGSIVN--PG-------EFKKMLDEVFLLSGALNIGDLIPWLDFL  792
             +I+RM +GK Y+   +G +V+  PG       +FK++L+E+F L+G  N+GD IPWL++L
Sbjct  186   MITRMVMGKRYV---QGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWL  242

Query  793   DLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKI  972
             DLQGY+K+ K ++K LD+ LEHV+DEH  RR  EG+ FVA DMVDVLL+ ADD ++EVK+
Sbjct  243   DLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEVKL  302

Query  973   ERQGVKAFTLDLLAGGTESST  1035
              R  +KAFT DL+AGGTESS+
Sbjct  303   SRDSIKAFTQDLIAGGTESSS  323



>gb|EEC84207.1| hypothetical protein OsI_30611 [Oryza sativa Indica Group]
Length=392

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 219/287 (76%), Gaps = 4/287 (1%)
 Frame = +1

Query  190   LPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKT  369
             LPPGPKPWPIIGNLNLI +LPHRSIH++S+++GPI+QL FGS PVVVGSSVEMAK+FL+T
Sbjct  35    LPPGPKPWPIIGNLNLISSLPHRSIHEISKRHGPIVQLWFGSCPVVVGSSVEMAKLFLQT  94

Query  370   MDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHE  549
              D  F DRP+  AGK+  Y+ +++TWS YG YW QAR+M   E+FSA+RL+S EHI   E
Sbjct  95    NDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWRQARKMCAAELFSARRLESLEHIHHEE  154

Query  550   LKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE----GSIVNPGEFK  717
             ++++L +L+   +    V L+D+L +  L VISRM LGK Y+ +       ++  P EFK
Sbjct  155   VRALLRELHGSGAAGNAVQLRDHLSMAALGVISRMVLGKKYVEKQPAGGGAAMTTPEEFK  214

Query  718   KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
              ML+E+FL++G LNIGD IPWLD+LDLQGYI++ K +N+ + RFL+ VLDEH  RR ++G
Sbjct  215   WMLEELFLMNGVLNIGDFIPWLDWLDLQGYIRRMKNVNRLIHRFLDRVLDEHDERRRLQG  274

Query  898   DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D FVA+DMVD+LLQ ADDPN++VK+ R G+K  T DL+ GG ++STV
Sbjct  275   DGFVARDMVDILLQLADDPNLDVKLTRNGIKGITQDLVTGGADTSTV  321



>gb|EAY85957.1| hypothetical protein OsI_07321 [Oryza sativa Indica Group]
Length=537

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 227/312 (73%), Gaps = 2/312 (1%)
 Frame = +1

Query  109   WLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYG  288
             +L   +A L  +A  L  +   RRK ++PPGP+PWP+IGNLNLIG LPHRSI DLSQ+YG
Sbjct  17    FLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPHRSIRDLSQRYG  76

Query  289   PIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYW  468
             P+M L+FGSFPVVVGSSV+MA+ FL+  D+ F+DRP+  AG++  YNY+ V WS YG YW
Sbjct  77    PLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYW  136

Query  469   HQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVIS  648
              QARR++  E+ SA+RL S EH+R  E+++ML  L   +     V+LK+++ ++ LNVIS
Sbjct  137   RQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVIS  196

Query  649   RMALGKSYL-NESEGSI-VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             RM  GK Y+  E EGS      EF+ M++E+F L+G  NIGD++PWL +LD QGYI + K
Sbjct  197   RMVFGKKYIVEEGEGSSPTTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMK  256

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L    DRFLEH+LDEH+ RR  EGD F A+DMVD+LLQ ADDP+++V I+R GVKAF L
Sbjct  257   RLGGMFDRFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFIL  316

Query  1003  DLLAGGTESSTV  1038
             +L+ G T++++V
Sbjct  317   ELITGSTDTTSV  328



>gb|KDO73906.1| hypothetical protein CISIN_1g036271mg, partial [Citrus sinensis]
Length=301

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 167/279 (60%), Positives = 210/279 (75%), Gaps = 4/279 (1%)
 Frame = +1

Query  169  LRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEM  348
             RRR L  P GPKPWPIIGNLNLIG LPH+S+H LSQKYG IMQL+FGSFPVVV +S EM
Sbjct  24   FRRRALKFPAGPKPWPIIGNLNLIGPLPHQSLHKLSQKYGQIMQLKFGSFPVVVAASAEM  83

Query  349  AKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSF  528
            AK FL+T D  F  RP+  AGKH TYNY N+TW+ YGPYW Q R+++  E+FS+KRL+S+
Sbjct  84   AKQFLQTHDHIFASRPQTAAGKHTTYNYLNLTWAPYGPYWRQGRKLYLSELFSSKRLESY  143

Query  529  EHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES--EGSIVN  702
            ++IR  E ++ + +LY +S   +PV+LK++L  + L++ISR  LGK Y +ES  E SIV 
Sbjct  144  QYIRVEEYRAFISRLYALSG--KPVVLKEHLSRVTLSIISRTVLGKKYFSESKAEDSIVT  201

Query  703  PGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSR  882
              EF++MLDE+FLL+G LNIGD IPWLDFLDLQGY+K+ KAL KK DRF +HV DEH + 
Sbjct  202  LEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRMKALKKKFDRFHDHVFDEHKAN  261

Query  883  RVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
            R      FV KDMVD+LLQ ADDPN++VK+    V+ FT
Sbjct  262  RKGNLKDFVPKDMVDLLLQMADDPNLDVKLNYDSVRGFT  300



>ref|XP_006465908.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=511

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 218/283 (77%), Gaps = 9/283 (3%)
 Frame = +1

Query  193   PPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTM  372
             PPGPKPWPIIGNLNLIG LP+RSIH LS+KYGPIMQL+FGSFPVVVGSSVEMA+ FLKT 
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  373   DINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHEL  552
             D  F  RPK  AGK+ T+NYSN+TWSQYGPYW Q R++  ME+F+AKRL+S+E+IR  E 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  553   KSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDE  732
                L  LY   S+ +P++LKD L  LNL V+SRM LGK Y NE    IV   EFK+M DE
Sbjct  160   MLFLRNLYE--SSGKPIILKDNLLDLNLEVMSRMVLGKKYTNE----IVARHEFKEMADE  213

Query  733   VFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFV  909
             +F+L G L+IGD+IPWL FLDLQGYIK+ K L KK DR  E+ LDEH +RR  +G D + 
Sbjct  214   LFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDEHNARR--KGVDNYE  271

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             AKDM+DVLLQ ADDP +EVK+ER  +KA T DLLAGGTESS V
Sbjct  272   AKDMMDVLLQLADDPTLEVKLERHSLKAVTQDLLAGGTESSAV  314



>ref|NP_001062713.1| Os09g0264400 [Oryza sativa Japonica Group]
 dbj|BAD38500.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF24627.1| Os09g0264400 [Oryza sativa Japonica Group]
 gb|EAZ43968.1| hypothetical protein OsJ_28589 [Oryza sativa Japonica Group]
 dbj|BAG94869.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 220/287 (77%), Gaps = 4/287 (1%)
 Frame = +1

Query  190   LPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKT  369
             LPPGPKPWPIIGNLNLI +LPHRSIH++S+++GPI+QL FGS PVVVGSSVEMAK+FL+T
Sbjct  35    LPPGPKPWPIIGNLNLISSLPHRSIHEISKRHGPIVQLWFGSCPVVVGSSVEMAKLFLQT  94

Query  370   MDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHE  549
              D  F DRP+  AGK+  Y+ +++TWS YG YW QAR+M   E+FSA+RL+S EHIR  E
Sbjct  95    NDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWRQARKMCAAELFSARRLESLEHIRHEE  154

Query  550   LKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE----GSIVNPGEFK  717
             ++++L +L+   +    V L+D+L +  L VISRM LGK Y+ +       ++  P EFK
Sbjct  155   VRALLRELHGSGAAGNAVQLRDHLSMAALGVISRMVLGKKYVEKQPAGGGAAMTTPEEFK  214

Query  718   KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
              ML+E+FL++G LNIGD IPWLD+LDLQGYI++ K +N+ + RFL+ VLDEH  RR ++G
Sbjct  215   WMLEELFLMNGVLNIGDFIPWLDWLDLQGYIRRMKNVNRLIHRFLDRVLDEHDERRRLQG  274

Query  898   DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D FVA+DMVD+LLQ ADDPN++V++ R G+K  T DL+ GG ++STV
Sbjct  275   DGFVARDMVDILLQLADDPNLDVQLTRNGIKGITQDLVTGGADTSTV  321



>ref|XP_006426677.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
 gb|ESR39917.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
Length=511

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 184/283 (65%), Positives = 218/283 (77%), Gaps = 9/283 (3%)
 Frame = +1

Query  193   PPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTM  372
             PPGPKPWPIIGNLNLIG LP+RSIH LS+KYGPIMQL+FGSFPVVVGSSVEMA+ FLKT 
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  373   DINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHEL  552
             D  F  RPK  AGK+ T+NYSN+TWSQYGPYW Q R++  ME+F+AKRL+S+E+IR  E 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  553   KSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDE  732
                L  LY   S+ +P++LKD L  LNL V+SRM LGK Y NE    IV   EFK+M DE
Sbjct  160   MLFLRNLYE--SSGKPIILKDNLLDLNLEVMSRMVLGKKYTNE----IVARHEFKEMADE  213

Query  733   VFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFV  909
             +F+L G L+IGD+IPWL FLDLQGYIK+ K L KK DR  E+ LD+H +RR  +G D + 
Sbjct  214   LFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDDHNARR--KGVDNYE  271

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             AKDM+DVLLQ ADDP +EVK+ER  +KA T DLLAGGTESS V
Sbjct  272   AKDMMDVLLQLADDPTLEVKLERHSLKAVTQDLLAGGTESSAV  314



>ref|XP_008388825.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 231/308 (75%), Gaps = 6/308 (2%)
 Frame = +1

Query  127   AWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQ  306
             A L+T+A++      + +K   PPGPKPWPIIGNLNLIG LPH+S+H LSQ YGPIMQL+
Sbjct  13    ACLATLALVSKTLFPQLKKRKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQTYGPIMQLR  72

Query  307   fgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRM  486
             FGS PVVV +S EMAK FLKT D  F  RP+  AGK+LTY+Y NVTWS YGPYW Q R++
Sbjct  73    FGSRPVVVATSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGRKI  132

Query  487   FTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGK  666
             F  E+FS+KRL+SFE+IR  E+++   +L  ++ +  P++LK++L  LNL+++SR  LGK
Sbjct  133   FLYELFSSKRLESFEYIRADEIRAFTSRLCAIAKSGNPIVLKEHLSRLNLSIMSRTVLGK  192

Query  667   SYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKL  840
              Y +  E EGSI++  EF+ M+DE+F+LSG  NIGD IPWL+FLDLQGYIK+ KA+ KK+
Sbjct  193   DYFSVAEYEGSIMSLKEFQDMIDELFVLSGVFNIGDWIPWLNFLDLQGYIKRMKAIKKKV  252

Query  841   DRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLA  1014
             DRF + VL+EH +++  EG ++FV KDMVD+LLQ  D  N +EVK+    +KAFT DL+A
Sbjct  253   DRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDLIA  310

Query  1015  GGTESSTV  1038
             GGT++S  
Sbjct  311   GGTDTSAT  318



>dbj|BAD23209.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD22905.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=537

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 227/312 (73%), Gaps = 2/312 (1%)
 Frame = +1

Query  109   WLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYG  288
             +L   +A L  +A  L  +   RRK ++PPGP+PWP+IGNLNLIG LP+RSI DLS++YG
Sbjct  17    FLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDLSRRYG  76

Query  289   PIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYW  468
             P+M L+FGSFPVVVGSSV+MA+ FL+  D+ F+DRP+  AG++  YNY+ V WS YG YW
Sbjct  77    PLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYW  136

Query  469   HQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVIS  648
              QARR++  E+ SA+RL S EH+R  E+++ML  L   +     V+LK+++ ++ LNVIS
Sbjct  137   RQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVIS  196

Query  649   RMALGKSYL-NESEGSI-VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             RM  GK Y+  E EGS      EF+ M++E+F L+G  NIGD++PWL +LD QGYI + K
Sbjct  197   RMVFGKKYIVEEGEGSSPTTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMK  256

Query  823   ALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
              L    DRFLEH+LDEH+ RR  EGD F A+DMVD+LLQ ADDP+++V I+R GVKAF L
Sbjct  257   RLGGMFDRFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFIL  316

Query  1003  DLLAGGTESSTV  1038
             +L+ G T++++V
Sbjct  317   ELITGSTDTTSV  328



>emb|CAN82002.1| hypothetical protein VITISV_023197 [Vitis vinifera]
Length=461

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 218/288 (76%), Gaps = 6/288 (2%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K +LPPGPKPW IIGNLNLIG LPH S+H LSQKYG IMQLQFGSFPVVV SS EMA+ F
Sbjct  31    KQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMARQF  90

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D  F  RP+  AGK+  YNYSN+TW+ YGP W Q R++F  E+FS KRL+S E+IR
Sbjct  91    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESCEYIR  150

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG--SIVNPGEF  714
               E ++ + +LY +S   +PV+LKD+L  + L+VISR+ LG+ Y NESE   SIV   EF
Sbjct  151   VEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNESESGRSIVTVEEF  208

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
             ++MLDE+FLL+G LNIGD IPW+ FLDLQGY+K+ KAL  K DR  +HV+++H +RR  E
Sbjct  209   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEKHRARR--E  266

Query  895   GDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
                FVAKDMVD+LL+ ADDP++EVK+   GVK  TLDLLAGGT++S  
Sbjct  267   AADFVAKDMVDMLLRLADDPDLEVKLGTDGVKGLTLDLLAGGTDTSAT  314



>ref|XP_002277926.2| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=508

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 222/288 (77%), Gaps = 6/288 (2%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K +LPPGPKPWPIIGNLNLIG LPH S+H LSQKYG IMQLQFGSFPVVV SS EMAK F
Sbjct  30    KQNLPPGPKPWPIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMAKQF  89

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D  F  RP+  AGK+  YNYSN+TW+ YGPYW Q R+++  E+FS KRL+S+E+I+
Sbjct  90    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPYWRQGRKIYHTELFSWKRLESYEYIQ  149

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG--SIVNPGEF  714
               E ++ + +LY +S   +PV+LK++L  + L+VISR+ LG+ Y NESE   SIV   EF
Sbjct  150   VEERRAFISRLYALSG--KPVMLKEHLSRVTLSVISRIVLGEKYFNESESGRSIVTVKEF  207

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
             ++MLDE+FLL+G LNIGD IPW+ FLDLQGY+K+ K L  K DRF +HVL++H +RR V 
Sbjct  208   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKVLRDKFDRFHDHVLEKHRARREV-  266

Query  895   GDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             GD FV KDMVD+LL+ ADDP+++VK+   G+K FT DL+AGGT++S  
Sbjct  267   GD-FVVKDMVDMLLRLADDPDLQVKLTTDGIKGFTQDLIAGGTDTSAT  313



>ref|XP_002277972.1| PREDICTED: flavonoid 3'-monooxygenase-like [Vitis vinifera]
Length=509

 Score =   316 bits (809),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 218/288 (76%), Gaps = 6/288 (2%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K +LPPGPKPW IIGNLNLIG LPH S+H LSQKYG IMQLQFGSFPVVV SS EMA+ F
Sbjct  31    KQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMARQF  90

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D  F  RP+  AGK+  YNYSN+TW+ YGP W Q R++F  E+FS KRL+S E+IR
Sbjct  91    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESCEYIR  150

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG--SIVNPGEF  714
               E ++ + +LY +S   +PV+LKD+L  + L+VISR+ LG+ Y NESE   SIV   EF
Sbjct  151   VEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNESESGRSIVTVEEF  208

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
             ++MLDE+FLL+G LNIGD IPW+ FLDLQGY+K+ KAL  K DR  +HV+++H +RR  E
Sbjct  209   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEKHRARR--E  266

Query  895   GDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
                FVAKDMVD+LL+ ADDP++EVK+   GVK  TLDLLAGGT++S  
Sbjct  267   AADFVAKDMVDMLLRLADDPDLEVKLGTDGVKGLTLDLLAGGTDTSAT  314



>ref|XP_009337219.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=514

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 230/310 (74%), Gaps = 6/310 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
              +A L+T+A++      + +K   PPGPKPWPIIGNLNLIG LPH+S+H LSQ YGPIMQ
Sbjct  11    TLACLATLALVSKTLFPQLKKQKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQTYGPIMQ  70

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGS PVVV SS EMAK FLKT D  F  RP   AGK+LTY+Y NVTWS YGPYW Q R
Sbjct  71    LRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPPTAAGKYLTYDYQNVTWSPYGPYWRQGR  130

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             ++F  E+FS+KRL+SFE+IR  E ++   +LY ++ +  P++LK++L  LNL+++SR  L
Sbjct  131   KIFLYELFSSKRLESFEYIRVDENRAFTSRLYAIAKSGNPIVLKEHLSRLNLSIMSRTVL  190

Query  661   GKSYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             GK Y +  E EGSI++  EF+ M+DE+F+LSG  NIGD IPWL+FLDLQGYIK+ KA+ K
Sbjct  191   GKDYFSVAEYEGSIMSLEEFQDMIDELFVLSGVFNIGDWIPWLNFLDLQGYIKRMKAIQK  250

Query  835   KLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHAD-DPNMEVKIERQGVKAFTLDL  1008
             K++RF + VL+EH +R+  EG ++FV KDMVD+LLQ  D   ++EVK+    +KAF  DL
Sbjct  251   KINRFYDFVLNEHKARK--EGVEEFVPKDMVDLLLQLVDGSSDLEVKLNYDSIKAFIQDL  308

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  309   IAGGTDTSAT  318



>ref|XP_002462454.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
 gb|EER98975.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
Length=521

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 235/324 (73%), Gaps = 10/324 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKL----HLPPGPKPWPIIGNLNLIGTLPHRS  261
             ME   W + +   LST+  ++ A H RRR+     +  PGPKPWP+IGN NL+G LPHRS
Sbjct  1     MELSAWASLSAVVLSTVLFLIGAIHARRRRRPSISNSLPGPKPWPVIGNFNLLGALPHRS  60

Query  262   IHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNV  441
             +  LS+ +GP+M++QFGSFPVV+ SSV+MA+ FLKT D  F+DRPK  AGK+ TYNYSN+
Sbjct  61    LDALSKLHGPLMRVQFGSFPVVIASSVDMARFFLKTHDSAFIDRPKMAAGKYTTYNYSNI  120

Query  442   TWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl  621
              WS YG YW QAR++   E+FSA+RL+S EH+R  E+ ++L  L+  ++  Q V LK+ L
Sbjct  121   AWSPYGAYWRQARKICADELFSARRLESLEHVRREEVHALLRDLHG-TAPGQVVQLKERL  179

Query  622   fllnlNVISRMALGKSYL-NE----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLD  786
               ++LN+I+RM LG+  + NE      GS+    EF+ MLDE+FLL+G LN+GD IPW+ 
Sbjct  180   STMSLNIIARMVLGRKCVENEVVTSGGGSVTTWREFRWMLDELFLLNGVLNVGDWIPWVS  239

Query  787   FLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEV  966
             +LDLQGY+++ K + +  DRF+E+V++EH  RR+ EGD+FV +DMVD LLQ ADDP+++V
Sbjct  240   WLDLQGYVRRMKRVGRMFDRFMENVVEEHNERRLREGDEFVPQDMVDRLLQLADDPSLDV  299

Query  967   KIERQGVKAFTLDLLAGGTESSTV  1038
             K+ R  VKAFT DL+AGGTES+ V
Sbjct  300   KLTRDSVKAFTQDLVAGGTESAAV  323



>ref|XP_008354460.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 233/310 (75%), Gaps = 10/310 (3%)
 Frame = +1

Query  127   AWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
             A L+T+A++   +   L++RK   PPGPKPWPIIGNLNLIG LPH+S+H LSQ YGPIMQ
Sbjct  13    ACLATLALVSKTLFPQLKKRKF--PPGPKPWPIIGNLNLIGPLPHQSLHKLSQXYGPIMQ  70

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGS PVVV +S EMAK FLKT D  F  RP+  AGK+LTY+Y NVTWS YGPYW Q R
Sbjct  71    LRFGSRPVVVATSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGR  130

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             ++F  E+FS+KRL+SFE+IR  E ++   +L  ++ +  P++LK++L  LNL+++SR  L
Sbjct  131   KIFLYELFSSKRLESFEYIRADEXRAFTSRLXAIAKSGNPIVLKEHLSRLNLSIMSRTVL  190

Query  661   GKSYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             GK Y +  E EGSI++  EF+ M+DE+F+L+G  NIGD +PWL+FLDLQGYIK+ KA+ K
Sbjct  191   GKDYFSVAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIKRMKAMQK  250

Query  835   KLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDL  1008
             K++RF + VL+EH +++  EG ++FV KDMVD+LLQ  D  N +EVK+    +KAFT DL
Sbjct  251   KINRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDL  308

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  309   IAGGTDTSAT  318



>gb|KCW71321.1| hypothetical protein EUGRSUZ_F04403, partial [Eucalyptus grandis]
Length=501

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 223/299 (75%), Gaps = 6/299 (2%)
 Frame = +1

Query  145   AIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpv  324
             + +L++ HLRRRKL LPPGPKPWPIIGNLNLI  L HRS+H+LS+ YGPIM+LQ GS  V
Sbjct  13    SFLLLSGHLRRRKLKLPPGPKPWPIIGNLNLISPLLHRSLHELSRIYGPIMKLQLGSCNV  72

Query  325   vvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVF  504
             VV SS +MAK  LKT D  F  RP+N AGK+  YNYS +TWS YGPY+ Q R++F  ++F
Sbjct  73    VVCSSADMAKAILKTHDAVFAYRPRNAAGKYTAYNYSGMTWSPYGPYFQQVRKIFLAQLF  132

Query  505   SAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES  684
             SA RL S E+IR  E++ +   L+      Q + LKD+L  LNLNV+ RM LGK Y ++S
Sbjct  133   SAARLQSSEYIRVEEMRVLTRNLFEAKG--QSINLKDHLSDLNLNVVCRMVLGKKYTDKS  190

Query  685   EGS-IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
             E S IV+  EF+KM+DE+FLL+G LN+GD +P LDFLDLQGYIK+ KA+NKK DRFLEHV
Sbjct  191   ENSNIVSAEEFRKMVDELFLLTGVLNLGDFLPLLDFLDLQGYIKRMKAVNKKFDRFLEHV  250

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             L EH +RRV   + + AKD VDVLLQH DDPN+ VKIER GVKA T +L+AGGTE S  
Sbjct  251   LGEHEARRV---EGYEAKDKVDVLLQHVDDPNLGVKIERHGVKALTQELIAGGTEGSAA  306



>ref|XP_004956936.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=516

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 228/320 (71%), Gaps = 7/320 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME P W +     L+T+  +      RRR     PGPKPWP+IGN NL+G LPHRS+  L
Sbjct  1     MELPAWASVLAVVLATVLFLRAVSGRRRRPCSSLPGPKPWPVIGNFNLLGALPHRSLDAL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             ++++GP+M++QFGSFPVV+ SSV+MAK FLKT D  F+DRPK  AGK+ TYNYSN+ WS 
Sbjct  61    AKRHGPLMRVQFGSFPVVIASSVDMAKFFLKTHDSAFIDRPKMAAGKYTTYNYSNIAWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YG YW QAR++   E+FSA+RL+S EH+R  E++++L  L+  +   Q V LK+ L  ++
Sbjct  121   YGAYWRQARKICADELFSARRLESSEHVRREEVRALLRDLHGAAG--QVVPLKERLSTMS  178

Query  634   lNVISRMALGKSYLNE-----SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDL  798
             LN+I+RM LG+  ++        GS+    EF+ MLDE+FLL+G LNIGD IPWL +LDL
Sbjct  179   LNMIARMVLGRKAVDREVVASGGGSVTTWKEFRWMLDELFLLNGVLNIGDWIPWLSWLDL  238

Query  799   QGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIER  978
             QGY+++ K + K  DRF+E+V++EH  RR  EGD FVAKDMVD LLQ ADDPN+EVK  R
Sbjct  239   QGYVRRMKRVGKMFDRFMENVVEEHNERRRREGDAFVAKDMVDRLLQLADDPNLEVKFTR  298

Query  979   QGVKAFTLDLLAGGTESSTV  1038
               VKAFT DL+AGGTES+ V
Sbjct  299   DSVKAFTQDLVAGGTESAAV  318



>ref|XP_004288989.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 177/322 (55%), Positives = 231/322 (72%), Gaps = 11/322 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHL--RRRKLHL--PPGPKPWPIIGNLNLIGTLPHRS  261
             ME  +W    +A +    +  ++K L  +  KL+L  PPGPKPWPIIGNLNLIG LPH+S
Sbjct  1     MESLSWAISTLAVVIFATLTFLSKTLFPKSHKLNLKFPPGPKPWPIIGNLNLIGPLPHQS  60

Query  262   IHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNV  441
             +H LSQ YGPIMQL+FGS+PVV+ SS EMAK   KT D  F  RP+  AGK+ TYNY N+
Sbjct  61    LHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQISKTHDHVFASRPQTAAGKYTTYNYLNI  120

Query  442   TWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl  621
             TW+ +GPYW Q R+ +  E+F++KRLDSFE+IR  E ++ L +L  +S   +PV LK++L
Sbjct  121   TWAPHGPYWRQGRKFYLSELFNSKRLDSFEYIRVEENRAFLSRLCALSG--KPVTLKEHL  178

Query  622   fllnlNVISRMALGKSY--LNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
               L L++ISR+ LGK Y  ++ESE SIV   EF++MLDE+FLL+G LNIGD IPWL+  D
Sbjct  179   SRLTLSIISRIVLGKKYFSVSESETSIVTLNEFQEMLDELFLLNGVLNIGDWIPWLELFD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKI  972
             LQGY+K+ KAL KK DRF +HV  EH + +  EG K +V KD+VDVLL+ ADDPN+EVK+
Sbjct  239   LQGYVKRMKALKKKFDRFHDHVFGEHRANK--EGVKEYVPKDLVDVLLKLADDPNIEVKL  296

Query  973   ERQGVKAFTLDLLAGGTESSTV  1038
                 VK FT DL+AGGT++S  
Sbjct  297   NYDSVKGFTQDLIAGGTDTSAT  318



>ref|XP_002444467.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
 gb|EES13962.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
Length=512

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 224/316 (71%), Gaps = 16/316 (5%)
 Frame = +1

Query  139   TIAIILIAKHLR---RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQf  309
              +AI+++ + L+   RR   LPPGP+PWPIIGN NLIG LPHRSIH+LS+KYG +M L+F
Sbjct  16    VLAIVILRRTLKGKPRRVYRLPPGPRPWPIIGNFNLIGALPHRSIHELSKKYGELMHLRF  75

Query  310   gsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMF  489
             GS+ VVVGSS +MAK+FLKT D+ F+DRPK  AGKH TYNY ++TWS YG YW  ARR+ 
Sbjct  76    GSYSVVVGSSADMAKLFLKTHDLLFLDRPKTAAGKHTTYNYGDITWSPYGAYWRHARRIC  135

Query  490   TMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdy-----lfllnlNVISRM  654
               ++FS  RL SFEHIR  E++S++  L+  S++              L+ L++NVI+RM
Sbjct  136   ATQLFSPGRLASFEHIRADEVRSLVRGLFAASASASGSGCAVRLNKDHLYTLSMNVITRM  195

Query  655   ALGKSYLNE--------SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
              LGK   +         +EG + +  +FK M+DE+ L++G LNIGD IPWLD+LDLQGY+
Sbjct  196   VLGKRLFDGGGDDDDDVAEGPVSSLADFKWMMDELLLVNGVLNIGDWIPWLDWLDLQGYM  255

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             ++ K + K+   F++++LDEH  RR  EG+ FVA+DMVDVL+Q ADDP  +V+I R GVK
Sbjct  256   RRMKRIGKRFSEFIDYILDEHDDRRRREGESFVARDMVDVLMQLADDPTFDVQIGRVGVK  315

Query  991   AFTLDLLAGGTESSTV  1038
             AFT DL+ GG+ES+ V
Sbjct  316   AFTQDLIVGGSESTAV  331



>ref|XP_008344040.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   311 bits (796),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 231/310 (75%), Gaps = 6/310 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
              +A L+T+A++      + +K    PGPKPWPIIGNLNLIG LPH+S+H LSQ YGPIMQ
Sbjct  11    TLACLATLALVSKTLFPQLKKQKFXPGPKPWPIIGNLNLIGPLPHQSLHKLSQIYGPIMQ  70

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGS PVVV SS EMAK FLKT D  F  RP+  AGK+LTY+Y NVTWS YGPYW Q R
Sbjct  71    LRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGR  130

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             ++F  E+FS+KRL+SFE+IR  E ++   +LY ++ +  P++LK++L  LNL+++SR  L
Sbjct  131   KIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLSRLNLSIMSRTVL  190

Query  661   GKSYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             GK Y +  E EGSI++  EF+ M+DE+F+L+G  NIGD +PWL+FLDLQGYIK+ KA+ K
Sbjct  191   GKDYFSVAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIKRMKAMQK  250

Query  835   KLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDL  1008
             K++RF + VL+EH +++  EG ++FV KDMVD+LLQ  D  N +EVK+    +KAFT DL
Sbjct  251   KINRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDL  308

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  309   IAGGTDTSAT  318



>ref|XP_008678485.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
Length=533

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 217/311 (70%), Gaps = 14/311 (5%)
 Frame = +1

Query  148   IILIAKHL----RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgs  315
             +ILI + L    RRR   LPPGP+PWP+IGNLNL+G LPHRSIH+LS KYG +M L+FGS
Sbjct  29    VILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHRSIHELSNKYGELMHLRFGS  88

Query  316   fpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTM  495
             + VVV SS EMA++FLK  D+ F+DRP+  AGKH TYNY+++TWS YG YW  ARR+   
Sbjct  89    YSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYADITWSPYGAYWRHARRICAT  148

Query  496   EVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdy-lfllnlNVISRMALGKSY  672
             ++FS  RL SFE +R  E++ ++  L+  S  R+ V L    L   ++NVI+RM LGK +
Sbjct  149   QLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKDHLSTFSMNVITRMVLGKRF  208

Query  673   LN-------ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALN  831
              +        +EG + +  EF  M+DE+ LL+G LNIGD IPWLD LDLQGY+++ K + 
Sbjct  209   FDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDCLDLQGYVRRMKRVA  268

Query  832   KKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLL  1011
              + D FLEHVLD H  +R  EG+ F A+DMVDVL+Q ADDP  EV+I R GVKAFT DL+
Sbjct  269   ARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDPTSEVQIGRVGVKAFTQDLI  328

Query  1012  AGGTE--SSTV  1038
              GGTE  S+TV
Sbjct  329   VGGTEPVSATV  339



>emb|CDP18923.1| unnamed protein product, partial [Coffea canephora]
Length=483

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 222/313 (71%), Gaps = 5/313 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             TWL  A+A +  +A +      +R KL+ PPGPKPWPIIGNLNL+G++PH+S+H LSQKY
Sbjct  4     TWLLLALAGIVALAFLSKPSTHKRLKLNHPPGPKPWPIIGNLNLLGSIPHQSLHLLSQKY  63

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             G IMQL+FGS PVVV SS EMAK FL+T D+NF  RP   AGK+ +YN S++TW+ YGP+
Sbjct  64    GAIMQLKFGSSPVVVASSPEMAKEFLQTHDVNFASRPATAAGKYTSYNCSDMTWAPYGPF  123

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QAR+++  ++F+ KRLD FE IR  E ++ + +LY +S   +PV+++D+L  L L+  
Sbjct  124   WRQARKLYLTQIFNPKRLDFFESIRIEERRAFISRLYALSG--KPVVMRDHLMRLTLSSA  181

Query  646   SRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
              +M L   Y  +SE  GS+V   EF++M+D  F L G  NIGD IPWLD  DLQGYIKQ 
Sbjct  182   CQMVLSNKYFAQSEGDGSLVTFEEFQEMIDTWFWLGGVFNIGDWIPWLDRFDLQGYIKQM  241

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             K L KK DRF  HVLD+H +RR  E D F+ KDMVD+LLQ+A+DP+++VK+ R  +K   
Sbjct  242   KELYKKFDRFHNHVLDDHQARRKTEKD-FIPKDMVDILLQYAEDPDLQVKLTRDQIKGLI  300

Query  1000  LDLLAGGTESSTV  1038
              DLLAGGT++S  
Sbjct  301   QDLLAGGTDTSAT  313



>ref|XP_002467826.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
 gb|EER94824.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
Length=529

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 226/326 (69%), Gaps = 18/326 (6%)
 Frame = +1

Query  112   LAYAVAWLSTIAIILIAKHLRRRKL---------HLPPGPKPWPIIGNLNLIGTLPHRSI  264
             L + V  +   A++++A  LR RK           LPPGP+PWPIIGNLNLIG LPHRSI
Sbjct  6     LPFLVGVVLATALLVVAA-LRHRKRSSTSTSKHRRLPPGPRPWPIIGNLNLIGALPHRSI  64

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LS +YGP M L+FGS PVVVGSSV+ A+ FLKT D +F+DRPK  +GKH  Y+YS++ 
Sbjct  65    HALSARYGPFMSLRFGSVPVVVGSSVDAARFFLKTNDASFIDRPKMASGKHTAYDYSDIV  124

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKS---MLHKLYNVSSTRQPVllkd  615
             WS YG YW QAR+++   +FS ++L S EH+R+ EL++    L    + ++ R  V++  
Sbjct  125   WSPYGAYWRQARKLWKAHLFSDRQLRSQEHVRSEELRALLRDLSLSSSAAAGRGGVVVVL  184

Query  616   yl--fllnlNVISRMALGKSYLNES---EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPW  780
                  + +LNVISRMALG  Y+ E     GS ++P EF+ M+DE+FLL+G   +GD IPW
Sbjct  185   KEHLLMFSLNVISRMALGGKYVGEGGTDAGSPISPAEFRWMVDELFLLNGVFCVGDFIPW  244

Query  781   LDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNM  960
             L +LD+QGY+ + K L K  DRFLEHV++EH  RR  EGDKFVA DMVD+LL+ ADDP +
Sbjct  245   LSWLDIQGYVGRMKRLGKMFDRFLEHVVEEHSQRRRREGDKFVAADMVDLLLELADDPKL  304

Query  961   EVKIERQGVKAFTLDLLAGGTESSTV  1038
             EV I+R GVK F LDL+AGGT+SS V
Sbjct  305   EVPIKRDGVKGFALDLIAGGTDSSAV  330



>ref|XP_004956935.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=518

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 222/321 (69%), Gaps = 9/321 (3%)
 Frame = +1

Query  94    MEGPTWLAY-AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             ME PT  A+ A+     + +  +  H RRR  +LPPGPKPWPIIGN+NL+G LPH SIH+
Sbjct  1     MELPTLAAFLAIVLGLALFLGTLLLHRRRRAYNLPPGPKPWPIIGNMNLMGELPHSSIHE  60

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LS++YGP+MQL+FGS PVV+ +S EMAK  LK  D  F DRP+   GK++ Y+ S++ WS
Sbjct  61    LSKRYGPLMQLRFGSLPVVIAASAEMAKHILKINDAAFSDRPRFAVGKYIAYDCSDILWS  120

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPY  Q RR+   E+FS KRL SF+HIR  E++ ML  L   S   + V L+D L +L
Sbjct  121   PYGPYLRQTRRICAAELFSTKRLQSFDHIRDEEVRVMLRDLRRASG--RTVRLRDTLQML  178

Query  631   nlNVISRMALGKSYLNE---SEGS---IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFL  792
              L VISR+ LG+ Y+ E    EG+   ++ P  +++M+DE F+L GA NIGD IPWLD+L
Sbjct  179   TLGVISRVVLGRKYVEEEAAGEGASPPVITPAGYREMVDEFFVLHGAFNIGDFIPWLDWL  238

Query  793   DLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKI  972
             DLQGY+++ K L+   DRFLEHVLD H  RR +EG++F AKDMVDVL   ADDPN+EV++
Sbjct  239   DLQGYVRRMKKLSAMFDRFLEHVLDVHNERRRLEGERFAAKDMVDVLQDLADDPNLEVQL  298

Query  973   ERQGVKAFTLDLLAGGTESST  1035
              R  VKA T DL+ G T++S 
Sbjct  299   SRDNVKAITQDLIIGATDTSA  319



>ref|XP_008354562.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 231/310 (75%), Gaps = 6/310 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
              +A L+T+A++      + +K    PGPKPWPIIGNLNLIG LPH+S+H LSQ YGPIMQ
Sbjct  11    TLACLATLALVSKTLFPQLKKQKFLPGPKPWPIIGNLNLIGPLPHQSLHKLSQIYGPIMQ  70

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FGS PVVV SS EMAK FLKT D  F  RP+  AGK+LTY+Y NVTWS YGPYW Q R
Sbjct  71    LRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGR  130

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             ++F  E+FS+KRL+SFE+IR  E ++   +LY ++ +  P++LK++L  LNL+++SR  L
Sbjct  131   KIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLSRLNLSIMSRTVL  190

Query  661   GKSYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             GK Y +  E EGSI++  EF+ M+DE+F+L+G  NIGD +PWL+FLDLQGYIK+ KA+ K
Sbjct  191   GKDYFSVAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIKRMKAMQK  250

Query  835   KLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDL  1008
             K++RF + VL+EH +++  EG ++FV KDMVD+LLQ  D  N +EVK+    +KAFT DL
Sbjct  251   KINRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDL  308

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  309   IAGGTDTSAT  318



>gb|AFW61881.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=557

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 217/311 (70%), Gaps = 14/311 (5%)
 Frame = +1

Query  148   IILIAKHL----RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgs  315
             +ILI + L    RRR   LPPGP+PWP+IGNLNL+G LPHRSIH+LS KYG +M L+FGS
Sbjct  53    VILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHRSIHELSNKYGELMHLRFGS  112

Query  316   fpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTM  495
             + VVV SS EMA++FLK  D+ F+DRP+  AGKH TYNY+++TWS YG YW  ARR+   
Sbjct  113   YSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYADITWSPYGAYWRHARRICAT  172

Query  496   EVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdy-lfllnlNVISRMALGKSY  672
             ++FS  RL SFE +R  E++ ++  L+  S  R+ V L    L   ++NVI+RM LGK +
Sbjct  173   QLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKDHLSTFSMNVITRMVLGKRF  232

Query  673   LN-------ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALN  831
              +        +EG + +  EF  M+DE+ LL+G LNIGD IPWLD LDLQGY+++ K + 
Sbjct  233   FDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDCLDLQGYVRRMKRVA  292

Query  832   KKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLL  1011
              + D FLEHVLD H  +R  EG+ F A+DMVDVL+Q ADDP  EV+I R GVKAFT DL+
Sbjct  293   ARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDPTSEVQIGRVGVKAFTQDLI  352

Query  1012  AGGTE--SSTV  1038
              GGTE  S+TV
Sbjct  353   VGGTEPVSATV  363



>ref|XP_002516018.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46438.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 217/306 (71%), Gaps = 11/306 (4%)
 Frame = +1

Query  151   ILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvv  330
             +  ++H   R L+LPPGPKPWPIIGN NLIG LPH+S+H LSQK+GPIMQL+FGS+PVV+
Sbjct  22    LFTSRHYYNRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIMQLKFGSYPVVI  81

Query  331   gssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSA  510
              SS EMAK  L+T D  F  RP+  AGK+ TYNYSNVTW+ YG YW Q R+++  E+FS+
Sbjct  82    VSSAEMAKQILRTNDHIFASRPQTAAGKYTTYNYSNVTWAPYGAYWRQGRKIYLHELFSS  141

Query  511   KRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYL-----  675
             KRLDS+  IR  E+++ + +++ +S T +P+LLKD+L    L++ISR+ LGK Y      
Sbjct  142   KRLDSYHDIRVEEMRAFVSRIHTLSVTGKPILLKDHLSRATLSIISRIVLGKKYFITESE  201

Query  676   -----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKL  840
                        I   GEF+K+LDE+FLL+G +NIGD IPWL FLDLQGY+K+ KAL  K 
Sbjct  202   SESLSESETSVITTLGEFQKILDELFLLNGVMNIGDWIPWLAFLDLQGYVKRMKALKVKW  261

Query  841   DRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGG  1020
             DRF +HVL EH +++  E   FV KDMVD+LLQ ADDP +EVK+    VK F  DL+AGG
Sbjct  262   DRFHDHVLGEHKAKK-AEVKNFVPKDMVDLLLQLADDPELEVKLNNDSVKGFIQDLIAGG  320

Query  1021  TESSTV  1038
             T++S  
Sbjct  321   TDTSAT  326



>gb|KDO65007.1| hypothetical protein CISIN_1g043529mg [Citrus sinensis]
Length=307

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/270 (64%), Positives = 207/270 (77%), Gaps = 9/270 (3%)
 Frame = +1

Query  193  PPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTM  372
            PPGPKPWPIIGNLNLIG LP+RSIH LS+KYGPIMQL+FGSFPVVVGSSVEMA+ FLKT 
Sbjct  36   PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  95

Query  373  DINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHEL  552
            D  F  RPK  AGK+ T+NYSN+TWSQYGPYW Q R++  ME+F+AKRL+S+E+IR  E 
Sbjct  96   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  155

Query  553  KSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDE  732
               L  LY   S+ +P++LKD L  LNL V+SRM LGK Y NE    IV   EFK+M DE
Sbjct  156  MLFLRNLY--ESSGKPIILKDNLLDLNLEVMSRMVLGKKYTNE----IVARHEFKEMADE  209

Query  733  VFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFV  909
            +F+L G L+IGD+IPWL FLDLQGYIK+ K L KK DR  E+ LDEH +RR  +G D + 
Sbjct  210  LFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDEHNARR--KGVDNYE  267

Query  910  AKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
            AKDM+DVLLQ ADDP +EVK+ER  +KA T
Sbjct  268  AKDMMDVLLQLADDPTLEVKLERHSLKAVT  297



>ref|XP_008337887.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=509

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 218/289 (75%), Gaps = 5/289 (2%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +KL LPPGPKPWP+IGNLNLIG LPH+S+H LSQ YGPIM+L FGS+PVV+ SS EMA+ 
Sbjct  29    QKLKLPPGPKPWPVIGNLNLIGPLPHQSLHKLSQTYGPIMKLMFGSYPVVIASSAEMARQ  88

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             FLKT D  F  RP+  AGK+ TYNY N+TW+ +GPYW Q R+++   +FS+K LDS E+I
Sbjct  89    FLKTHDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYI  148

Query  538   RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGSIVNPGE  711
             R  E ++ L +L  VS   +P +LK++L  L L++ISR+ LGK Y  ++ESE SIV+  E
Sbjct  149   RVEENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFSVSESETSIVSLEE  206

Query  712   FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
             F++MLDE+FLL+G LNIGD IPW   LDLQGY+K+ KAL KK DRF +HVLDEH +  + 
Sbjct  207   FQEMLDELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKA-NMK  265

Query  892   EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             E   FV+KDMVD+L+Q A+DP++EVK+    VK FT DL+AGGT++S  
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIEVKLNYDSVKGFTQDLIAGGTDTSAT  314



>gb|EAZ07221.1| hypothetical protein OsI_29466 [Oryza sativa Indica Group]
Length=520

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 222/301 (74%), Gaps = 7/301 (2%)
 Frame = +1

Query  157   IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgs  336
             I +   RR  +LPPGP PWP+IGN NLIG LPHRSIH+LS+KYG +M L+FGSFPVVVGS
Sbjct  23    IKRKGSRRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGS  82

Query  337   svEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKR  516
             SV MA++ LKT D  F+DRP+  +GKH TY Y+++TWS YG YW QARR+   E+FSA+R
Sbjct  83    SVAMARLVLKTHDAVFIDRPRTASGKHTTYGYADITWSPYGAYWRQARRICVTELFSARR  142

Query  517   LDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl---fllnlNVISRMALGKSYLNE--  681
             + SFEHIR  E+++++  L+  +S+ +   +         L++NVI+RM LGK +  E  
Sbjct  143   VASFEHIRADEVRALVRGLFAAASSGRSGAVYLNRDHLSTLSMNVITRMVLGKRFFGEGA  202

Query  682   --SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLE  855
               +EG +    EFK MLDE+ LL+G LN+GD IPW+D++DLQGY+++ K + K  D F+E
Sbjct  203   DAAEGPVSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFME  262

Query  856   HVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             HVLDEH  RR  EG+ FVA+DMVDVL+  ADDP++E+K+ R GVKAFT DL+AGGTESS+
Sbjct  263   HVLDEHSERRRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSS  322

Query  1036  V  1038
             V
Sbjct  323   V  323



>ref|XP_008242247.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=529

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 223/295 (76%), Gaps = 8/295 (3%)
 Frame = +1

Query  163   KHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssv  342
             K L  ++  LPPGPKPWPIIGNLNL+G LPH+S+H LSQ YGP+MQL+FGS+PVVV SS 
Sbjct  43    KILFAKRPKLPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPVMQLKFGSYPVVVASSP  102

Query  343   EMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLD  522
             EM K F KT D  F  RP+  AGK+LTY+Y NVTW+ YGPYW Q R++F  E+FS+KRL+
Sbjct  103   EMTKQFSKTHDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLTELFSSKRLE  162

Query  523   SFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGSI  696
             SF +IR  E ++   +LY +S   + V+LK++L  LNL+++SR+ LGK Y  L + E SI
Sbjct  163   SFRYIRVEENRAFASRLYALSG--KAVVLKEHLSRLNLSIMSRIVLGKEYFSLTDFESSI  220

Query  697   VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHM  876
             ++  EF+ MLDE+FLL+G  NIGD IPWLDFLDLQGY+K+ KA+ KK+DRF E VL EH 
Sbjct  221   MSLKEFQDMLDELFLLNGVSNIGDWIPWLDFLDLQGYVKRMKAVKKKMDRFYEFVLHEHK  280

Query  877   SRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESST  1035
             +R+  EG  +FVAKDMVD+LLQ  DDPN +EVK+    +KAFT DL+AGGT++S 
Sbjct  281   ARK--EGVQEFVAKDMVDLLLQLVDDPNDLEVKLTYDSIKAFTQDLIAGGTDTSA  333



>ref|XP_009359731.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=509

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 219/289 (76%), Gaps = 5/289 (2%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +KL LPPGPKPWPIIGNL+LIG LPH+S+H LSQKYGPIM+L FGS+PVV+ SS EMA+ 
Sbjct  29    QKLKLPPGPKPWPIIGNLSLIGPLPHQSLHKLSQKYGPIMKLMFGSYPVVIASSAEMARQ  88

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             FLKT D  F  RP+  AGK+ TYNY N+TW+ +GPYW Q R+++   +FS+K LDS E+I
Sbjct  89    FLKTHDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYI  148

Query  538   RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGSIVNPGE  711
             R  E ++ L +L  VS   +P +LK++L  L L++ISR+ LGK Y  ++ESE SIV+  E
Sbjct  149   RVEENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFSVSESETSIVSLEE  206

Query  712   FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
             F++ML+E+FLL+G LNIGD IPW   LDLQGY+K+ KAL KK DRF +HVLDEH +  + 
Sbjct  207   FQEMLNELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKA-NMN  265

Query  892   EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             E   FV+KDMVD+L+Q A+DP++EVK+    VK FT DL+AGGT++S  
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIEVKLNYDSVKGFTQDLIAGGTDTSAT  314



>ref|XP_008242319.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=508

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 222/296 (75%), Gaps = 8/296 (3%)
 Frame = +1

Query  160   AKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgss  339
             +K L  ++ +LPPGPKPWPIIGNLNLIG LP++S H LSQ YGPIMQL+FGS+PVV+ SS
Sbjct  21    SKILFPKRPNLPPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASS  80

Query  340   vEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRL  519
              EMAK FLKT D  F  RP+   GK+LTY Y NVTW+ YGPYW QAR++F  E+FS+K+L
Sbjct  81    PEMAKQFLKTHDHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKL  140

Query  520   DSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES--EGS  693
             +SF++IR  E ++ + +LY +S   + V+LK++L  L L+++SR+  GK Y   S  E S
Sbjct  141   ESFQYIRVEENRAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFGMSKFESS  198

Query  694   IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEH  873
             I++  EF+   DE+FLLSG  NIGD IPWL+FLDLQGY+K+ KAL KKLDRF E VLDEH
Sbjct  199   IMSFKEFQDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEH  258

Query  874   MSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESST  1035
              +R+  EG +KFVA DMVD+LL+ ADDPN +EVK+    VKA T DL+ GG+++S 
Sbjct  259   KARK--EGVEKFVAGDMVDLLLRLADDPNDLEVKLTYDSVKALTQDLITGGSDTSA  312



>ref|XP_002467827.1| hypothetical protein SORBIDRAFT_01g034740 [Sorghum bicolor]
 gb|EER94825.1| hypothetical protein SORBIDRAFT_01g034740 [Sorghum bicolor]
Length=531

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/299 (55%), Positives = 219/299 (73%), Gaps = 12/299 (4%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             R+  LPPGP+PWP+IGNLNL+G+LPHRSIH LS ++GP M L+FGS PVVVGSSV+ A+ 
Sbjct  36    REYRLPPGPRPWPVIGNLNLLGSLPHRSIHALSARHGPFMSLRFGSVPVVVGSSVDAARF  95

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             FLKT D +F+DRPK  +GKH  Y+YS++ WS YG YW QAR+++   +F+ ++L S EH+
Sbjct  96    FLKTNDASFIDRPKMASGKHTAYDYSDIVWSPYGAYWRQARKLWKANLFNDRQLRSLEHV  155

Query  538   RTHELKSMLHKLYNVSSTRQP----------VllkdylfllnlNVISRMALGKSYLNE--  681
             R+ EL+ +L  L  +S +             V LK++L +L+LNVISRMALG  Y+ E  
Sbjct  156   RSEELRVLLRDLRALSLSSSSSASAGRGGGVVALKEHLLMLSLNVISRMALGGKYVGEGG  215

Query  682   SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
             + GS ++P EF+ M+DE+FLL+G   +GD IPWL +LD+ GY+ + K L K  DRFLEH+
Sbjct  216   TAGSPISPAEFRWMVDELFLLNGVFCVGDFIPWLSWLDIHGYVGRMKKLGKMFDRFLEHM  275

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             ++EH  RR  EGDKFVA DMVD+LL+ ADDP +EV I+R GVK F LDL+AGGT+SS V
Sbjct  276   VEEHSQRRRREGDKFVAADMVDLLLELADDPKLEVPIKRDGVKGFALDLIAGGTDSSAV  334



>ref|XP_007204134.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
 gb|EMJ05333.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
Length=508

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 225/296 (76%), Gaps = 8/296 (3%)
 Frame = +1

Query  160   AKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgss  339
             +K L  ++ +LPPGPKPWPIIGNLNLIG LP++S H LSQ YGPIMQL+FGS+PVV+ SS
Sbjct  21    SKILFPKRPNLPPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASS  80

Query  340   vEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRL  519
              EMAK FLKT D  F  RP+   GK+LTY Y NVTW+ YGPYW QAR++F  E+FS+K+L
Sbjct  81    PEMAKQFLKTHDHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKL  140

Query  520   DSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGS  693
             +SF++IR  E ++ + +LY +S   + V+LK++L  L L+++SR+  GK Y  +++SE S
Sbjct  141   ESFQYIRVEENRAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFGMSKSESS  198

Query  694   IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEH  873
             I++  EF+   DE+FLLSG  NIGD IPWL+FLDLQGY+K+ KAL KK+D F E VLDEH
Sbjct  199   IMSFKEFQDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKVDHFYEFVLDEH  258

Query  874   MSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESST  1035
              +R+  EG +KFVA+DMVD+LL+ ADDPN +EVK+    VKA T DL+ GG+++S 
Sbjct  259   KARK--EGVEKFVAEDMVDLLLRLADDPNDLEVKLTYDSVKALTQDLITGGSDTSA  312



>ref|XP_006427642.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
 gb|ESR40882.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
Length=516

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 229/319 (72%), Gaps = 8/319 (3%)
 Frame = +1

Query  91    SMEGPTWLA--YAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSI  264
             SM  P+  A  Y++ +   I + L  +   R KL+LPPGP+PWP+IGNLNLIG LPH SI
Sbjct  4     SMTSPSNSAIFYSILFFLPIVLFLFRRQFSR-KLNLPPGPRPWPLIGNLNLIGPLPHVSI  62

Query  265   HDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVT  444
             H LSQKYGP+M L++G  PVVVGSS E+A++ LKT DI+F  RP  +AGK+ TYNYS ++
Sbjct  63    HSLSQKYGPLMHLKYGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSAMS  122

Query  445   WSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylf  624
              + YGPYW QAR++  ME+ SAKRLD FE+IR  E  + L +L+  +ST  PV LKD L+
Sbjct  123   TAPYGPYWRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAST--PVHLKDRLY  180

Query  625   llnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQG  804
              LNL +I RM LGK Y +E+E + V P +F +M++E+FLL G L+IGD IPWL   DLQG
Sbjct  181   TLNLTLICRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQG  240

Query  805   YIKQTKALNKKLDRFLEHVLDEHMSRR-VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             ++K+ K ++KKLD+F E +LDEH  RR  V+G  +   DMVDVL+Q ADDP++EVK+ER+
Sbjct  241   HVKRMKDVSKKLDKFYEGILDEHHERRKSVKG--YGVHDMVDVLMQLADDPSLEVKLERE  298

Query  982   GVKAFTLDLLAGGTESSTV  1038
              +KA   DLL  GT++S +
Sbjct  299   HIKALIQDLLTAGTDTSAI  317



>ref|XP_008242245.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 217/290 (75%), Gaps = 8/290 (3%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             KL  PPGPKPWPIIGNLNLIG LPH+S H LSQ YGPIMQL+FGS+PVV+ SS EMAK+F
Sbjct  30    KLKYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKLF  89

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LK  D  F  RP+  AGK+LTY++ NVTW+ YGPYW Q R++F  E+FSA+RL+SFE+IR
Sbjct  90    LKIHDHIFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSARRLESFEYIR  149

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES--EGSIVNPGEF  714
               E  + + +LY +S  +  ++LK++L  L L+++SR+  GK Y   S  E SI++  EF
Sbjct  150   VEESHAFVSRLYALSGKK--IMLKEHLSRLTLSIMSRIVFGKEYFGVSKFESSIMSLKEF  207

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
             +  LDE+FLLSG  NIGD IPWL FLDLQGY+K+ KAL KKLDRF E VLDEH +++  E
Sbjct  208   QDTLDELFLLSGVFNIGDWIPWLKFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKK--E  265

Query  895   G-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESSTV  1038
             G ++FV++DMVD+LL+  DDPN +EVK+    VKA T D +AGGT++S  
Sbjct  266   GVEEFVSEDMVDLLLRLVDDPNDLEVKLTNDSVKAITQDSVAGGTDTSAT  315



>ref|NP_001061964.2| Os08g0456200 [Oryza sativa Japonica Group]
 dbj|BAD10411.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ42966.1| hypothetical protein OsJ_27558 [Oryza sativa Japonica Group]
 dbj|BAF23878.2| Os08g0456200 [Oryza sativa Japonica Group]
Length=520

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 221/301 (73%), Gaps = 7/301 (2%)
 Frame = +1

Query  157   IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgs  336
             I +   RR  +LPPGP PWP+IGN NLIG LPHRSIH+LS+KYG +M L+FGSFPVVVGS
Sbjct  23    IKRKGSRRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGS  82

Query  337   svEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKR  516
             SV MA++ LKT D  F+DRP+  + KH TY Y+++TWS YG YW QARR+   E+FSA+R
Sbjct  83    SVAMARLVLKTHDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARRICVTELFSARR  142

Query  517   LDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl---fllnlNVISRMALGKSYLNE--  681
             + SFEHIR  E+++++  L+  +S+ +   +         L++NVI+RM LGK +  E  
Sbjct  143   VASFEHIRADEVRALVRGLFAAASSGRSGAVHLNRDHLSTLSMNVITRMVLGKRFFGEGA  202

Query  682   --SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLE  855
               +EG +    EFK MLDE+ LL+G LN+GD IPW+D++DLQGY+++ K + K  D F+E
Sbjct  203   DAAEGPVSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFME  262

Query  856   HVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             HVLDEH  RR  EG+ FVA+DMVDVL+  ADDP++E+K+ R GVKAFT DL+AGGTESS+
Sbjct  263   HVLDEHSERRRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSS  322

Query  1036  V  1038
             V
Sbjct  323   V  323



>ref|XP_002310738.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
 gb|EEE91188.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
Length=487

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 215/295 (73%), Gaps = 18/295 (6%)
 Frame = +1

Query  160   AKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgss  339
              + +RRRKLHLPPGPKPWPIIGNLNL+G LPHRS+  LS+KYG +MQ++FGS PVVVGSS
Sbjct  12    GRLIRRRKLHLPPGPKPWPIIGNLNLMGELPHRSLEALSKKYGSLMQVKFGSHPVVVGSS  71

Query  340   vEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRL  519
             VEMA+  LKT D++   RPK  +GK+ TYNY N+TW+ YGPYW QAR++  +E+FS KRL
Sbjct  72    VEMARAILKTHDLSLAGRPKTASGKYTTYNYQNITWAPYGPYWRQARKLCLIELFSPKRL  131

Query  520   DSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGS--  693
             D FE+IR  E    L+ L+      +P+ ++D+   L+ +VISR+ LG+ Y+ ESE    
Sbjct  132   DQFEYIRVEENLKFLNTLFQKRG--KPITVRDHFSDLSFSVISRLVLGRKYMAESEDEKD  189

Query  694   IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEH  873
             +++  E K++LDE+FLL+G L IGD IPWL FLDLQGYIK+ KA+ KK+D F+EH  +  
Sbjct  190   MLSLKELKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRMKAVAKKMDMFMEHANE--  247

Query  874   MSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
                          +DM+D+LLQ ADDPN+EVK++R GVKAFT DL+ GGTESS V
Sbjct  248   ------------PRDMLDILLQVADDPNLEVKLDRIGVKAFTQDLINGGTESSAV  290



>ref|XP_008344136.1| PREDICTED: flavonoid 3'-monooxygenase-like, partial [Malus domestica]
Length=483

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 223/310 (72%), Gaps = 6/310 (2%)
 Frame = +1

Query  121   AVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
              +A L+T+A++      + +    PPGP PWPIIGNLNLIG LPH+S+H LS  YGPIMQ
Sbjct  11    TLACLATLALVSKTLFPQLKXQKFPPGPNPWPIIGNLNLIGPLPHQSLHKLSLTYGPIMQ  70

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L  GS PVVV SS EMAK FLKT D  F  RP+  AGK+LTY+Y +V+WS YGPYW Q R
Sbjct  71    LXXGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQSVSWSPYGPYWRQGR  130

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             ++F  E+FS+KRL+SFE+IR  E ++   +L  ++ +  PV+LK++L  L  +++SR+ L
Sbjct  131   KIFLYELFSSKRLESFEYIRVEENRAFTSRLCAIAKSGNPVVLKEHLSRLTFSIMSRIVL  190

Query  661   GKSYLN--ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             GK Y +  E EGSI++  EF+ MLDE F+L+G  NIGD IPWL+FLDL GYIK+ KA+ K
Sbjct  191   GKDYFSVAEYEGSIMSLKEFQDMLDEFFVLNGVFNIGDWIPWLNFLDLHGYIKRMKAMQK  250

Query  835   KLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDL  1008
             K++RF + +L+EH +++  EG ++FV KDMVD+LLQ  D  N +EVK+    +KAFT DL
Sbjct  251   KINRFYDFMLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDL  308

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  309   IAGGTDTSAT  318



>ref|XP_006493371.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=556

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 225/316 (71%), Gaps = 4/316 (1%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR-RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHD  270
             M GP+  A   + L  + I+L   H +  RKL+LPPGP+PWP+IGNLNLIG LPH SIH 
Sbjct  45    MTGPSNSAIFYSILFFLPIVLFLFHRQFSRKLNLPPGPRPWPLIGNLNLIGPLPHVSIHS  104

Query  271   LSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWS  450
             LSQKYGP+M L+FG  PVVVGSS E+A++ LKT DI+F  RP  +AGK+ TYNYS +  +
Sbjct  105   LSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATA  164

Query  451   QYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfll  630
              YGPYW QAR++  ME+ SAKRLD FE+IR  E  + L +L+  +ST  PV LKD L+ L
Sbjct  165   PYGPYWRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAST--PVHLKDRLYTL  222

Query  631   nlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             NL  I RM LGK Y +E+E + V P +F +M++E+FLL G L+IGD IPWL   DLQG++
Sbjct  223   NLTSICRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQGHV  282

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
             K+ K ++KKLD+F E +LDEH  RR    D +   DMVDVL+Q ADDP++EVK+ER+ +K
Sbjct  283   KRMKDVSKKLDKFYEGILDEHHERRKSVKD-YGVHDMVDVLMQLADDPSLEVKLEREHIK  341

Query  991   AFTLDLLAGGTESSTV  1038
             A   DLL  GT++S +
Sbjct  342   ALIQDLLTAGTDTSAI  357



>ref|XP_007203042.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
 gb|EMJ04241.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
Length=510

 Score =   301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 167/290 (58%), Positives = 217/290 (75%), Gaps = 8/290 (3%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             KL  PPGPKPWPIIGNLNLIG LPH+S H LSQ YGPIMQL FGSFPVV+ SS EMAK+F
Sbjct  30    KLKYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLNFGSFPVVIASSPEMAKLF  89

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LK  D  F  RP+  AGK+LTY++ NVTW+ YGPYW Q R++F  E+FS++RL+SFE+IR
Sbjct  90    LKIHDHVFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSSRRLESFEYIR  149

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES--EGSIVNPGEF  714
               E  + + +LY +S  +  ++LK++L  L L+++SR+  GK Y   S  E S+++  EF
Sbjct  150   VEESHAFVSRLYALSGKQ--IMLKEHLSRLTLSIMSRIVFGKEYFGVSKFESSVMSLKEF  207

Query  715   KKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVE  894
             +  LDE+FLLSG  NIGD IPWL+FLDLQGY+K+ KAL KKLDRF E VLDEH +++  E
Sbjct  208   QDTLDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKK--E  265

Query  895   G-DKFVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESSTV  1038
             G ++FV++DMVD+LL+  DDPN +EVK+    VKA T D +AGGT++S  
Sbjct  266   GVEEFVSEDMVDLLLRLVDDPNDLEVKLTYDSVKAITQDSVAGGTDTSAT  315



>ref|NP_001148045.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG29574.1| flavonoid 3-monooxygenase [Zea mays]
Length=525

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 226/318 (71%), Gaps = 7/318 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRR--RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
             ++   AV   +T+ ++ + +   R  RK  LPPGP+PWP+IGNLNLIG LPH S+H+LS+
Sbjct  10    SFFLVAVVAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLPHHSVHELSK  69

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             +YGP+M L+FGSFPVVV SSV+ A++ LKT D+ F+DRP+  AG++ TYN + + +  YG
Sbjct  70    RYGPLMSLRFGSFPVVVASSVDTARLILKTHDLAFIDRPQTAAGRYTTYNCAGLFYQPYG  129

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSST----RQPVllkdylfl  627
              YW QARR+   E+FSA+RL S EH+R+ E+++ML  L   SS        V L+++L++
Sbjct  130   AYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAASSAPAGGHDAVTLREHLYM  189

Query  628   lnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +NL+V+SRM LGK Y+ E   S   P EF+ ++DE F L+G LN+ D+IPWL  LD QGY
Sbjct  190   VNLSVVSRMLLGKKYVVEGSSSPATPEEFRWLIDEHFFLNGVLNVADMIPWLSPLDPQGY  249

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPN-MEVKIERQG  984
             +K+ K   K LDRFLEHV+DEH  RR  EG+ FVA DM+DVLL+ ADDP+ +EV I R  
Sbjct  250   VKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDPSQLEVPITRDN  309

Query  985   VKAFTLDLLAGGTESSTV  1038
             VK FTLDL+ GGT++S V
Sbjct  310   VKGFTLDLMGGGTDTSAV  327



>gb|AGI98132.1| cytochrome P450 [Narcissus tazetta]
Length=505

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 209/289 (72%), Gaps = 8/289 (3%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             RRR+L+LPPGPKP+PI+GNL  IG + HRSIHDLS KYGPIMQL+FGS P+VVGSSVE A
Sbjct  29    RRRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAA  88

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             + FLKT D+ F  RP++ AGK+  Y+YS++T+S YGPY  Q R++  +E+FS +RLDS E
Sbjct  89    RFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLE  148

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGE  711
             +IR  E++ ++  L+  S  R  V +KD +  L +NVISRM LGK YL E EG      E
Sbjct  149   YIRVEEIRLLMQDLFRSSGER--VAVKDCMSTLGMNVISRMVLGKKYLGE-EGE-----E  200

Query  712   FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
              K M+DE F L+ A N GDL PWL F D +G +K+ KAL+K+  RF + VLDEH  RR  
Sbjct  201   LKGMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSKRFHRFWDRVLDEHNERRKE  260

Query  892   EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EG++F AKDMVDVLLQ ADDP +EVK+ R  VKAFT DL+ GGTE+S  
Sbjct  261   EGERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSAT  309



>gb|ACF84248.1| unknown [Zea mays]
 tpg|DAA45476.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=525

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 226/318 (71%), Gaps = 7/318 (2%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRR--RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
             ++   AV   +T+ ++ + +   R  RK  LPPGP+PWP+IGNLNLIG LPH S+H+LS+
Sbjct  10    SFFLVAVVAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLPHHSVHELSK  69

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             +YGP+M L+FGSFPVVV SS++ A++ LKT D+ F+DRP+  AG++ TYN + + +  YG
Sbjct  70    RYGPLMSLRFGSFPVVVASSIDTARLILKTHDLAFIDRPQTAAGRYTTYNCAGLFYQPYG  129

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSST----RQPVllkdylfl  627
              YW QARR+   E+FSA+RL S EH+R+ E+++ML  L   +S        V L+++L++
Sbjct  130   AYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAAASAPAGGHDAVTLREHLYM  189

Query  628   lnlNVISRMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             +NL+V+SRM LGK Y+ E   S   P EF+ ++DE F L+G LN+ D+IPWL  LD QGY
Sbjct  190   VNLSVVSRMLLGKKYVVEGSSSPATPEEFRWLIDEHFFLNGVLNVADMIPWLSPLDPQGY  249

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPN-MEVKIERQG  984
             +K+ K   K LDRFLEHV+DEH  RR  EG+ FVA DM+DVLL+ ADDP+ +EV I R  
Sbjct  250   VKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDPSQLEVPITRDN  309

Query  985   VKAFTLDLLAGGTESSTV  1038
             VK FTLDL+ GGT++S V
Sbjct  310   VKGFTLDLMGGGTDTSAV  327



>gb|EMS55696.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=330

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 219/309 (71%), Gaps = 8/309 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRR----KLHLPPGPKPWPIIGNLNLIGTLPHRS  261
             ME P W A ++A L   A+ L+A  LR R    K ++PPGP+PWP+IGNLNLIG LPHRS
Sbjct  1     MEVP-W-APSLAVLLATALFLVAVLLRHRQQARKYNIPPGPRPWPVIGNLNLIGPLPHRS  58

Query  262   IHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNV  441
             IH LS +YGP+M L+FGSFP+VVGSS+E A+  L+T D+ F+DRP+   GK+  YN+S +
Sbjct  59    IHALSARYGPLMSLRFGSFPIVVGSSLEAAEFILRTHDLAFLDRPRMACGKYTVYNFSGM  118

Query  442   TWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl  621
              WS YGPYW Q R+++  E+ SA++L   EHIR  E+++ML  L+  +ST + V+LKD L
Sbjct  119   LWSHYGPYWRQLRKLWLTELLSARQLRLTEHIRGEEVRAMLRDLHPSTSTGRTVVLKDRL  178

Query  622   fllnlNVISRMALGKSYLNE--SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLD  795
              ++ LNVISRM LGK Y+ E  S  S   P EF+ M++E+F L+GA +IGD+IPWL +LD
Sbjct  179   LMVTLNVISRMVLGKRYVGEGASSASAAKPEEFRWMIEEIFFLNGAPHIGDMIPWLSWLD  238

Query  796   LQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIE  975
              QGY+ + K L+K  DRF+EHVL EH  RR+ EG  FV  DMVD+LLQ ADDP +EV I 
Sbjct  239   PQGYVSRMKRLSKMFDRFIEHVLREHNERRLQEGKAFVPMDMVDLLLQLADDPTLEVPIT  298

Query  976   RQGVKAFTL  1002
               GVKA  L
Sbjct  299   GDGVKASVL  307



>ref|XP_004288988.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 222/312 (71%), Gaps = 10/312 (3%)
 Frame = +1

Query  121   AVAWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLI-GTLPHRSIHDLSQKYGP  291
              ++WL  +A++       L++ KL  PPGPKPWPIIGNLNLI G LPHRS+H LSQ YGP
Sbjct  11    TLSWLFLLALVSKFFFSQLQKLKLKFPPGPKPWPIIGNLNLINGPLPHRSLHKLSQTYGP  70

Query  292   IMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWH  471
             +MQL+FGS+PVVV SS EMAK FLKT+D  F  RP+  AGK++TYNY N+T S +GPYW 
Sbjct  71    LMQLKFGSYPVVVASSAEMAKQFLKTLDHVFASRPRTAAGKYITYNYLNITSSPHGPYWR  130

Query  472   QARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISR  651
             Q R++F  E+FS+KRL+SF +IR  E ++ + +LY +S    PV+LK+ L  L L++++R
Sbjct  131   QGRKIFLSELFSSKRLESFAYIRVEETRAFISRLYALSGN--PVMLKEQLSRLTLSIMTR  188

Query  652   MALGKSYLNESE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKA  825
               +GK Y  E E   S++   EF+ MLDE+FLL G  NIGD IPWL+ LDLQGY+K+ K 
Sbjct  189   SVMGKEYFREPEFQRSVMKLEEFQDMLDELFLLHGVFNIGDWIPWLEVLDLQGYVKRMKD  248

Query  826   LNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAFTL  1002
             L KK + F ++VLDEH  +   +G K +VAKDMVD LLQ  DDP++EVK+    VKAF  
Sbjct  249   LKKKSEPFYDYVLDEH--KAASQGRKDYVAKDMVDSLLQLVDDPDLEVKLTVDSVKAFIQ  306

Query  1003  DLLAGGTESSTV  1038
             DL+AGGT++S  
Sbjct  307   DLIAGGTDTSAT  318



>tpg|DAA45474.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=484

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME   +L   +A    +  +L  K    RK  +PPGP+PWP+IGNLNLIG LPHRSIH L
Sbjct  3     MELDPFLGVVLATAVLLVAVLRRKRGSSRKYKMPPGPRPWPVIGNLNLIGALPHRSIHAL  62

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S ++G  M L+FGS PVVVGSSVE A+ FL+T D +F+DRP+  AGK+  Y+YS++ WS 
Sbjct  63    SARHGAFMSLRFGSVPVVVGSSVEAARFFLRTSDTSFIDRPRMAAGKYTAYDYSDIVWSP  122

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELK------SMLHKLYNVSSTRQPVllkd  615
              G YW QAR+++   +FS ++L S EH+R+ EL+      S           R+ V LK+
Sbjct  123   CGAYWRQARKLWKAHLFSDRQLRSQEHVRSEELRVLLRALSSSSSAGAAGRGRRAVALKE  182

Query  616   ylfllnlNVISRMALGKSYLNE--SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDF  789
             +L + +LNVISRMALG  Y+ E  + GS ++P EF  M+DE+FLL+G   +GD IPWL +
Sbjct  183   HLLMYSLNVISRMALGGKYVGEGGTAGSPISPAEFSWMVDELFLLNGVFCVGDFIPWLGW  242

Query  790   LDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVK  969
             LDLQGY+ + K L K  DRFLEHV+DEH  RR  EG  FV  DMVD+LL+ ADDP +EV 
Sbjct  243   LDLQGYVGRMKRLGKMFDRFLEHVVDEHDQRRRREGGGFVPADMVDLLLELADDPKLEVP  302

Query  970   IERQGVKAFTLDLLAGGTESSTV  1038
             IER GVK F LDL+AGGT+S+ V
Sbjct  303   IERDGVKGFALDLIAGGTDSTAV  325



>ref|XP_011095827.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 215/301 (71%), Gaps = 8/301 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
             ++ I +  H +R   + PPGPKPWP+IGNLNL+G++PH+S+H LSQKYG IMQL+FG FP
Sbjct  24    LSKIFLRPHPKR---NFPPGPKPWPVIGNLNLVGSIPHQSLHFLSQKYGDIMQLKFGKFP  80

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             VVV SS EMAK FL+  D  F  RP   AGK+ +YNYS++TW+ YGP+W QAR+++  EV
Sbjct  81    VVVASSPEMAKQFLRVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEV  140

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             FSAK+L+S EHIR  E  + L +LY++S   +PV+L+++L    L+ ISRM L   Y +E
Sbjct  141   FSAKKLESLEHIRIEERHNFLARLYSLSG--KPVVLREHLSRYTLSNISRMVLSSKYFSE  198

Query  682   SE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLE  855
             SE   S+V   E ++MLDE FLL+G  NIGD IPWL FLDLQGY+K+ KAL KK DRF  
Sbjct  199   SEHDKSVVKLDELQEMLDEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALYKKFDRFHN  258

Query  856   HVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             +V+D+H +R   E D     D+VD LLQ A+DPN+EVK+ R GVK    DLLAGGT++S 
Sbjct  259   YVIDDHQTRMATEKDS-APGDVVDALLQLAEDPNLEVKLTRDGVKGLLQDLLAGGTDTSA  317

Query  1036  V  1038
              
Sbjct  318   T  318



>gb|KGN58498.1| hypothetical protein Csa_3G651820 [Cucumis sativus]
Length=428

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 188/233 (81%), Gaps = 6/233 (3%)
 Frame = +1

Query  346   MAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDS  525
             MAK+FLKT D+NF  RPK  AGK+ TYN+SN+TWSQYGPYW Q R+M  ME+FSA+RLDS
Sbjct  1     MAKLFLKTQDLNFASRPKTTAGKYTTYNHSNITWSQYGPYWGQLRKMCLMELFSARRLDS  60

Query  526   FEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE-SEGSIVN  702
             +E+IR  E+  ++ ++Y   S  + + +KDYLF ++LNVISRM LGK Y +E SE  IV+
Sbjct  61    YEYIRKEEMNGLIREIY--KSCGEVIKVKDYLFAVSLNVISRMVLGKKYTDEPSESGIVS  118

Query  703   PGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSR  882
             P EF+KM+DE+FLL+G LNIGD IPW+DFLDLQGY+K+ K L+KKLDRFLEHVLDEH  R
Sbjct  119   PDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRMKGLSKKLDRFLEHVLDEHKER  178

Query  883   RVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             R  +G + +VAKDMVDVLLQ ADDP++EVK+ER GVKAFT DLL GG ESSTV
Sbjct  179   R--KGVENYVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLLGGGIESSTV  229



>ref|XP_007203722.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
 gb|EMJ04921.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
Length=509

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 227/318 (71%), Gaps = 7/318 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME  ++    +A ++T+A++      + +KL  PPGPKPWPIIGNLN IG LPH+S+H L
Sbjct  1     MEAISYAILTLALVATLALVSKIFFPQSQKLKFPPGPKPWPIIGNLNHIGPLPHQSLHKL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             SQ YGPIMQL+FGS+PVV+ SS EMA+ FL+T D  F  RP+  AGK+ TYNYSN+TW+ 
Sbjct  61    SQIYGPIMQLKFGSYPVVIASSAEMARQFLRTHDHIFASRPQTAAGKYTTYNYSNLTWAP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             +GPYW Q R+++   +FS+K LDS E+IR  E ++ L +L  +S   +P +LK++L  L 
Sbjct  121   HGPYWRQGRKIYLSHLFSSKILDSVEYIRVEENRAFLSRLCALSG--KPTMLKEHLSRLT  178

Query  634   lNVISRMALGKSYLNESEGSIVNPG--EFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
             L +ISR+ LGK Y + SE         EF++MLDE+FLL+G LNIGD IPW+ F DLQG+
Sbjct  179   LTIISRIVLGKKYFSVSESESSIVTLEEFQEMLDELFLLNGVLNIGDWIPWVQFFDLQGF  238

Query  808   IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQG  984
             +K+ KAL KK DRF +HV DEH +++  EG K FV KDMVD+LLQ A+DP++EVK+    
Sbjct  239   VKRMKALKKKFDRFHDHVFDEHRAKK--EGVKDFVPKDMVDLLLQLAEDPDIEVKLNYDS  296

Query  985   VKAFTLDLLAGGTESSTV  1038
             VK FT DL+AGGT++S  
Sbjct  297   VKGFTQDLIAGGTDTSAT  314



>dbj|BAK04187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 230/328 (70%), Gaps = 16/328 (5%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRR-----RKLHLPPGPKPWPIIGNLNLIGTLPHR  258
             ME P W    V  L+T A+ L+A  LRR     RK ++PPGP+PWP+IGNLNLIG LPHR
Sbjct  6     MEVP-WAPSLVVLLAT-AVFLVAI-LRRHRQQSRKYNIPPGPRPWPVIGNLNLIGPLPHR  62

Query  259   SIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSN  438
             SIH LS +YGP+M L+FGSFP+VVGSS+E A+ FL+T D+ F+DRP+   GK+  YNYS 
Sbjct  63    SIHVLSSRYGPLMSLRFGSFPIVVGSSLEAAEFFLRTHDLAFLDRPRMACGKYTVYNYSG  122

Query  439   VTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTR------QP  600
             + WS YGPYW   R+++  E+ S ++L   EHIR  E+++ML  L+  +ST       + 
Sbjct  123   MLWSHYGPYWRLLRKLWLTELLSTRQLRLTEHIRGEEVRAMLRDLHPSTSTAASTSTGRA  182

Query  601   VllkdylfllnlNVISRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLI  774
             V+LKD+L ++ LNVISRM LGK Y+ E  G  S V P +F+ M++E+F L+GA +IGD+I
Sbjct  183   VVLKDHLLMVTLNVISRMVLGKKYVGEGAGSASAVKPEQFRWMIEEIFFLNGAPHIGDMI  242

Query  775   PWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDP  954
             PWL +LD QGY+ + K L K  DRF+EHVL EH  RR+ EG  FV KDMVD+LLQ ADDP
Sbjct  243   PWLSWLDPQGYVGRMKRLGKMFDRFIEHVLREHNERRLQEGKAFVPKDMVDLLLQLADDP  302

Query  955   NMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              +EV I   GVKA  L+L+AG T++S V
Sbjct  303   TLEVPISGDGVKASVLELIAGATDTSAV  330



>ref|XP_002445595.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
 gb|EES15090.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
Length=530

 Score =   296 bits (759),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 217/318 (68%), Gaps = 18/318 (6%)
 Frame = +1

Query  139   TIAIILIAKHLR----RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQ  306
              +AI++  + L+    RR   LPPGP PWP+IGN NLIG LPHRSIH+LS+KYG +M L+
Sbjct  15    VLAIVIFGRRLKGRPSRRVYRLPPGPSPWPVIGNFNLIGALPHRSIHELSKKYGELMHLR  74

Query  307   fgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRM  486
             FGS+ VVV SS EMAK+FLKT D+ F+DRP+  AG+H TYNY ++TWS YG YW  ARR+
Sbjct  75    FGSYTVVVASSAEMAKLFLKTHDLLFLDRPRTAAGRHTTYNYGDITWSPYGAYWRHARRI  134

Query  487   FTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdy-lfllnlNVISRMALG  663
                ++F   RL SFEHIR  E++S++  L+  S++ + V L    L   ++NVI+RM LG
Sbjct  135   CATQLFIPGRLASFEHIRADEVRSLVRGLFAASASGRAVRLGKDHLSTFSMNVITRMVLG  194

Query  664   KSYLNESEGS-------IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTK  822
             K   + + G        + +  EF  M+DE+ LL+G LNIGD IPWLD LDLQGY+++ K
Sbjct  195   KRLFDAAGGENAAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDRLDLQGYVRRMK  254

Query  823   ALNKKLDRFLEHVLDEH----MSRRVVEGDKFVAK--DMVDVLLQHADDPNMEVKIERQG  984
              + ++ D FLEHVLD H      R   +G+ FVA+  DMVDVL+Q ADDP  +V+I R G
Sbjct  255   RVAERFDAFLEHVLDAHSQHQQRRHERDGESFVARDMDMVDVLMQLADDPTFDVQIGRVG  314

Query  985   VKAFTLDLLAGGTESSTV  1038
             VKAFT DL+ GG+ES+ V
Sbjct  315   VKAFTQDLIVGGSESTAV  332



>ref|XP_011046010.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/319 (51%), Positives = 225/319 (71%), Gaps = 9/319 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             M+  + + + +AW+   A++ + K  +  R  L+LPPGPKPWPIIGN +L+G LPH+S+H
Sbjct  1     MDAFSLVVFVLAWV--FALLYLPKVFKSWRNPLNLPPGPKPWPIIGNFDLLGPLPHQSLH  58

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LS KYG  MQLQFGS+PV V SS+++AK  LKT D  F  RP+  AGK+ TY YS++ W
Sbjct  59    QLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfl  627
             + YGPYW Q R+++  E+FSAKRL+S+E++R  E++    +LY   +  + + LKDYL  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLYR--NCGKSIELKDYLSH  176

Query  628   lnlNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQ  801
               L++ISR+ LGK Y   +ESE  IV   EF++MLDE+FLL+G LNIGD IPWLDFLDLQ
Sbjct  177   YTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQ  236

Query  802   GYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQ  981
             GY+K+ K L  + DRF +HV+DEH ++R    + +  KDMVD+LLQ ADDP +EVK+ R 
Sbjct  237   GYVKRMKELKVRFDRFHDHVIDEHNAKRKATKN-WQPKDMVDLLLQLADDPELEVKLTRD  295

Query  982   GVKAFTLDLLAGGTESSTV  1038
              +K  T DL+AGGT+++  
Sbjct  296   NIKGLTQDLIAGGTDTAAT  314



>gb|KCW71322.1| hypothetical protein EUGRSUZ_F04404 [Eucalyptus grandis]
Length=502

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 225/316 (71%), Gaps = 10/316 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             M+ P+W    +A L+  + +L++ HLRRRKL LPPGPKPWPIIGNLNLI  L HRS+H+L
Sbjct  1     MDAPSWAVCGIACLAVASFLLLSSHLRRRKLKLPPGPKPWPIIGNLNLISPLLHRSLHEL  60

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S+ YGPIM+LQ GS  VVV SS +MAK  LKT D  F  RPK+ AGK+  YNYS +TWS 
Sbjct  61    SRIYGPIMKLQLGSGSVVVCSSADMAKAILKTHDAVFAYRPKSAAGKYTAYNYSGMTWSP  120

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylflln  633
             YGPY+ + R++F  ++FSA RL S E+IR  E++ +   L++     Q + LKD+L  LN
Sbjct  121   YGPYFQEIRKIFLAQLFSAARLQSSEYIRVEEMRVLTRNLFDAKG--QSINLKDHLSDLN  178

Query  634   lNVISRMALGKSYLNESEGS-IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYI  810
             LN+I RM LGK Y ++SE S IV+   F+KM+DE+FLL G LN+GD +P LDFLDLQ   
Sbjct  179   LNMICRMVLGKKYSDKSENSNIVSAEGFRKMVDELFLLIGVLNLGDFLPLLDFLDLQ---  235

Query  811   KQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVK  990
              + KA+NKK DRFLE VL EH +R+V   + + AKDMVDVLLQH +DPN+ VKIER  VK
Sbjct  236   -RMKAVNKKFDRFLEDVLGEHEARKV---EGYEAKDMVDVLLQHVNDPNLGVKIERHVVK  291

Query  991   AFTLDLLAGGTESSTV  1038
             A   +L+AGGTE S  
Sbjct  292   ALIQELIAGGTEGSAA  307



>ref|NP_001151318.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG42367.1| flavonoid 3-monooxygenase [Zea mays]
Length=524

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 218/323 (67%), Gaps = 8/323 (2%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDL  273
             ME   +L   +A    +  +L  K    RK  +P GP+PWP+IGNLNLIG LPHRSIH L
Sbjct  3     MELDPFLGVVLATAVLLVAVLRRKRGSSRKYKMPSGPRPWPVIGNLNLIGALPHRSIHAL  62

Query  274   SQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQ  453
             S ++G  M L+FGS PVVVGSSVE A+ FL+T D +F+DRP+  AGK+  Y+YS++ WS 
Sbjct  63    SARHGAFMSLRFGSVPVVVGSSVEAARFFLRTSDTSFIDRPRMAAGKYTAYDYSDIVWSP  122

Query  454   YGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELK------SMLHKLYNVSSTRQPVllkd  615
              G YW QAR+++   +FS ++L S EH+R+ EL+      S           R+ V LK+
Sbjct  123   CGAYWRQARKLWKAHLFSDRQLRSQEHVRSEELRVLLRALSSSSSAGAAGRGRRAVALKE  182

Query  616   ylfllnlNVISRMALGKSYLNE--SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDF  789
             +L + +LNVISRMALG  Y+ E  + GS ++P EF  M+DE+FLL+G   +GD IPWL +
Sbjct  183   HLLMYSLNVISRMALGGKYVGEGGTAGSPISPAEFSWMVDELFLLNGVFCVGDFIPWLGW  242

Query  790   LDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVK  969
             LDLQGY+ + K L K  DRFLEHV+DEH  RR  EG  FV  DMVD+LL+ ADDP +EV 
Sbjct  243   LDLQGYVGRMKRLGKMFDRFLEHVVDEHDQRRRREGGGFVPADMVDLLLELADDPKLEVP  302

Query  970   IERQGVKAFTLDLLAGGTESSTV  1038
             IER GVK F LDL+AGGT+S+ V
Sbjct  303   IERDGVKGFALDLIAGGTDSTAV  325



>gb|AGI98131.1| cytochrome P450 CYP92 [Narcissus tazetta]
Length=505

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 208/289 (72%), Gaps = 8/289 (3%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             R R+L+LPPGPKP+PI+GNL  IG + HRSIHDLS KYGPIMQL+FGS P+VVGSSVE A
Sbjct  29    RGRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAA  88

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             + FLKT D+ F  RP++ AGK+  Y+YS++T+S YGPY  Q R++  +E+FS +RLDS E
Sbjct  89    RFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLE  148

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGE  711
             +IR  E++ ++  L+  S  R  V +KD +  L ++VISRM LGK YL E EG      E
Sbjct  149   YIRVEEIRLLMQDLFRSSGER--VAVKDCMSTLGMDVISRMVLGKKYLGE-EGE-----E  200

Query  712   FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
              K M+DE F L+ A N GDL PWL F D +G +K+ KAL+++  RF + VLDEH  RR  
Sbjct  201   LKGMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSERFHRFWDRVLDEHNERRKE  260

Query  892   EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EG++F AKDMVDVLLQ ADDP +EVK+ R  VKAFT DL+ GGTE+S  
Sbjct  261   EGERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSAT  309



>gb|AGI97940.1| flavonoid 3'-monooxygenase-like protein [Narcissus tazetta]
Length=506

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 208/289 (72%), Gaps = 8/289 (3%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             R R+L+LPPGPKP+PI+GNL  IG + HRSIHDLS KYGPIMQL+FGS P+VVGSSVE A
Sbjct  29    RGRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAA  88

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             + FLKT D+ F  RP++ AGK+  Y+YS++T+S YGPY  Q R++  +E+FS +RLDS E
Sbjct  89    RFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLE  148

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGE  711
             +IR  E++ ++  L+  S  R  V +KD +  L ++VISRM LGK YL E EG      E
Sbjct  149   YIRVEEIRLLMQDLFRSSGGR--VAVKDCMSTLGMDVISRMVLGKKYLGE-EGE-----E  200

Query  712   FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
              K M+DE F L+ A N GDL PWL F D +G +K+ KAL+++  RF + VLDEH  RR  
Sbjct  201   LKGMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSERFHRFWDRVLDEHNERRKE  260

Query  892   EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             EG++F AKDMVDVLLQ ADDP +EVK+ R  VKAFT DL+ GGTE+S  
Sbjct  261   EGERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSAT  309



>ref|XP_002467824.1| hypothetical protein SORBIDRAFT_01g034710 [Sorghum bicolor]
 gb|EER94822.1| hypothetical protein SORBIDRAFT_01g034710 [Sorghum bicolor]
Length=537

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 213/301 (71%), Gaps = 13/301 (4%)
 Frame = +1

Query  175   RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAK  354
             R K  LPPGP+PWP+IGNLNLIG LPHRSIH+LS++YGP+M L+FGSFPVVVGSSV+ A+
Sbjct  35    RNKYRLPPGPRPWPVIGNLNLIGRLPHRSIHELSKRYGPLMSLRFGSFPVVVGSSVDTAR  94

Query  355   IFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEH  534
             +FL+T D+ F+DRP+  AGK+ TYN   + +  YG YW Q R++   E+F+ +RL S EH
Sbjct  95    LFLRTHDLAFIDRPQTAAGKYTTYNCGGLFYQPYGAYWRQGRKLCQAELFNERRLTSLEH  154

Query  535   IRTHELKSMLHKLYNVSSTRQP-------------VllkdylfllnlNVISRMALGKSYL  675
             +R  E+++M+  L+  +S                 V LK++L+++NL+VISRM LGK Y+
Sbjct  155   VRGEEVRAMVRDLHAAASAAAAGCSGGGGGGGRAVVALKEHLYMVNLHVISRMLLGKKYI  214

Query  676   NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLE  855
              +  GS   P EF+ ++DE F L+G LN+ D+IPWL  LD  GYIK+ K   K  DRFLE
Sbjct  215   VDGSGSPATPEEFRWLIDEHFFLNGVLNVADMIPWLSCLDPHGYIKRMKRSAKMWDRFLE  274

Query  856   HVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             HVLDEH  RR  EG  FVA DM+DVLL+ ADDPN+EV I+R  VKAF LDL+ GGT++S 
Sbjct  275   HVLDEHNRRRRREGKDFVAMDMMDVLLELADDPNLEVPIKRDNVKAFILDLMGGGTDTSA  334

Query  1036  V  1038
             V
Sbjct  335   V  335



>gb|EMT12610.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=513

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 215/291 (74%), Gaps = 7/291 (2%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +K +LPPGPKPWPIIGN +LIG LPHRSIH+LS+KYGP+M L+FGSFP++V SSV+MA+ 
Sbjct  28    KKYNLPPGPKPWPIIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIVASSVDMARF  87

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             FL+T DI +VDRPK  +GK+ TYNY+++TWS YG YW QARR+   ++FS +RL    HI
Sbjct  88    FLRTKDILYVDRPKTASGKYTTYNYADITWSPYGAYWRQARRICLTKLFSPRRLALMAHI  147

Query  538   RTHELKSMLHKLYNVSS-TRQPVllkdylfllnlNVISRMALGKSYLNES--EGSIVNPG  708
             R  E+ +M+  ++ VS  TR   L +D++  L+LNVI+RM +GK    +   EG + +  
Sbjct  148   RVDEVHAMVRDIFAVSGPTRVVHLYRDHMSTLSLNVITRMVMGKRLFADGSLEGPVPSME  207

Query  709   EFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHM--SR  882
              F+ M+DE+FLL+G LNIGD IPWLD++DLQGY+++ K + K  D  +EHVLDEH     
Sbjct  208   VFRWMMDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKVGKMFDALMEHVLDEHSVGEH  267

Query  883   RVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             R  EG+   A+DMVDVL+  ADDP++EV + R GVKAFT DL+AGGTESS 
Sbjct  268   RRREGE--AARDMVDVLMDIADDPSLEVPLGRIGVKAFTQDLIAGGTESSA  316



>ref|XP_011070722.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=504

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 226/315 (72%), Gaps = 10/315 (3%)
 Frame = +1

Query  109   WLAYAVAWLSTIAII--LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQK  282
             W  +A+ +++ +  +  +I K    RKL  PPGPKPWPIIGNLNLIG+LPH+S+H LSQK
Sbjct  5     WPLFALVYVALLTFLSKIIYKRCPERKL--PPGPKPWPIIGNLNLIGSLPHQSLHLLSQK  62

Query  283   YGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGP  462
             YG IMQL+FG FPVVV SS EMAK FLK  D+ F  RP   AGK+  +NYS++ W+ YGP
Sbjct  63    YGEIMQLKFGKFPVVVASSPEMAKQFLKVHDMAFAGRPALAAGKYTGFNYSDMAWASYGP  122

Query  463   YWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNV  642
             +W QAR++F ++VFSAK+L+SFE IR  + ++   +L+++S   +PV+LKD+LF   L+ 
Sbjct  123   FWRQARKIFLIQVFSAKKLESFEDIRVEKRRNFFSRLHSLSG--KPVVLKDHLFRHTLST  180

Query  643   ISRMALGKSYLNESE---GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
             +SRM LG  Y +ESE    SIV   + + MLDE FLL+G  NIGD IPWL FLDLQGY+K
Sbjct  181   MSRMVLGSKYFSESEDDKSSIVKLDDLQAMLDEWFLLNGVFNIGDWIPWLSFLDLQGYVK  240

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             + KAL K+ D+F  +V+D+H +RR  + D  + +D+VDVLLQ A+DP+++VK+ R  +K 
Sbjct  241   RMKALYKRYDKFHNYVIDDHQTRRAKDKDS-IPRDVVDVLLQQAEDPDLDVKLTRDHIKG  299

Query  994   FTLDLLAGGTESSTV  1038
                +LLAGGT+++  
Sbjct  300   LLHNLLAGGTDTAAA  314



>dbj|BAJ96903.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 209/284 (74%), Gaps = 14/284 (5%)
 Frame = +1

Query  190  LPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKT  369
            LPPGPKPWPIIGNL+LI  LPHRSIH+LS+++GP+MQL+FGSFPVVVGSS EMA+ FLKT
Sbjct  64   LPPGPKPWPIIGNLHLIDALPHRSIHELSKRHGPLMQLRFGSFPVVVGSSSEMARFFLKT  123

Query  370  MDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHE  549
             D  F DRP+  AG++ TY+YS++ WS YG +W + R++   E+FSA RLDS+EHIR  E
Sbjct  124  HDALFADRPRTAAGRYTTYDYSDMLWSPYGAHWRRLRKVCLTELFSAARLDSYEHIRLEE  183

Query  550  LKSMLHKLYNV------SSTRQPVllkdylfllnlNVISRMALGKSYLNESEGS------  693
            ++++L  L+        S  R  V++K+YLF   L +ISRM LGK Y+  +EG+      
Sbjct  184  VRTLLRDLHRATTTTTGSGRRATVVIKEYLFTATLGMISRMVLGKKYVENAEGTPSSEAA  243

Query  694  -IVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDE  870
              + P EF +++DE FLL+G LN+GD IPWL++LDLQGY+ +   +++ LD F+E VLDE
Sbjct  244  AAMTPQEFTRIMDEFFLLNGVLNVGDFIPWLEWLDLQGYVGRMNKISRTLDAFMERVLDE  303

Query  871  HMSRRVVEGDKFVAKDMVDVLLQHADDP-NMEVKIERQGVKAFT  999
            H  RR +EG+ F A+DMVDVLLQ ADDP N++ ++ERQ +KA T
Sbjct  304  HNERRRMEGESFAARDMVDVLLQLADDPTNVDGQLERQTIKALT  347



>gb|AGT17101.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=507

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 210/281 (75%), Gaps = 7/281 (2%)
 Frame = +1

Query  172  RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
            RRR  +  PGPKPWPIIGN NL+G LPHRS+  LS+++GP+M++QFGSFPVV+ SSV+MA
Sbjct  27   RRRACNSLPGPKPWPIIGNFNLLGALPHRSLDALSKRHGPLMRVQFGSFPVVIASSVDMA  86

Query  352  KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
            K FLKT D  F+DRPK  AGK+ TYNYSN+ WS YG YW QAR++   E+FSA+RL+SFE
Sbjct  87   KFFLKTHDSVFIDRPKMAAGKYTTYNYSNIAWSPYGAYWRQARKICADELFSARRLESFE  146

Query  532  HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE-----SEGSI  696
            H+R  E+ ++L  L+  +   Q V LK+ L  ++LN+I+RM LG+  +++       GS+
Sbjct  147  HVRQEEVHALLRTLHGTAG--QVVPLKECLSTMSLNIITRMVLGRKCVDKEVVASGGGSV  204

Query  697  VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHM  876
                EF+ MLDE+FLL+G LNIGD IPWL +LDLQGY+++ K + +  ++F+E+V++EH 
Sbjct  205  TTWKEFRWMLDELFLLNGVLNIGDWIPWLSWLDLQGYVRRMKRVGRMFNQFMENVVEEHN  264

Query  877  SRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFT  999
             RR+ EGD FV +DMVD LLQ ADDP+++VK+ R  VKAFT
Sbjct  265  ERRLREGDAFVPQDMVDRLLQLADDPSLDVKLTRDSVKAFT  305



>ref|XP_002459381.1| hypothetical protein SORBIDRAFT_02g003780 [Sorghum bicolor]
 gb|EER95902.1| hypothetical protein SORBIDRAFT_02g003780 [Sorghum bicolor]
Length=679

 Score =   297 bits (761),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 224/328 (68%), Gaps = 16/328 (5%)
 Frame = +1

Query  103   PTWLAYAVAWLS-TIAIILIAKHLRRR------KLHLPPGPKPWPIIGNLNLIGTLPHRS  261
             P W ++ +  +   IA+ L++   RRR      K +LPPGP+PWP+IGNLNLIG LPHRS
Sbjct  4     PPWTSFFLGIIVLAIALFLLSILHRRRHPSGNSKYNLPPGPRPWPVIGNLNLIGPLPHRS  63

Query  262   IHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNV  441
             +H+LS++YG +M L+FGS PVVV SSV+MA+ FLKT D+ F+DRP+  +G++  YNYS++
Sbjct  64    VHELSKRYGSLMSLRFGSLPVVVASSVDMARFFLKTHDLAFIDRPRTASGRYTGYNYSDM  123

Query  442   TWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdyl  621
              WS YG YW QAR+    EVFSA RL S EH+R  E+++ML  LY       PV L D+L
Sbjct  124   LWSPYGAYWRQARKFCKAEVFSAARLRSQEHVRAAEVRAMLRDLYAAGPAAAPVRLMDHL  183

Query  622   fllnlNVISRMALGKSYLNESEGS---------IVNPGEFKKMLDEVFLLSGALNIGDLI  774
             F L +NVIS M LG+ +    +G             P  FK M++E FLLSG L++GD+I
Sbjct  184   FQLTINVISLMVLGEKHAVAVDGDGRSAAGGGLPATPEAFKWMIEEFFLLSGRLDVGDMI  243

Query  775   PWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDP  954
             PWL +LD  G++++ K L +  D FL++V+DEH  RR  EGD FVA D VD+LL+ ADDP
Sbjct  244   PWLRWLDPHGHVRRLKRLREMFDHFLDNVVDEHSERRWREGDAFVAMDAVDLLLELADDP  303

Query  955   NMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             N+EV I+R G+KAFTL+LL G  ++++V
Sbjct  304   NLEVPIQRDGIKAFTLNLLVGLPDTTSV  331



>ref|XP_007202994.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
 gb|EMJ04193.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
Length=509

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 222/295 (75%), Gaps = 8/295 (3%)
 Frame = +1

Query  163   KHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssv  342
             K L  ++  LPPGPKPWPIIGNLNL+G LPH+S+H LSQ YGPIMQL+FGS+PVVV SS 
Sbjct  23    KILFPKRPKLPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPIMQLKFGSYPVVVASSP  82

Query  343   EMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLD  522
             EM K FLKT D  F  RP+  AGK+LTY+Y NVTW+ YGPYW Q R++F ME+FS KRL+
Sbjct  83    EMTKQFLKTHDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLMELFSPKRLE  142

Query  523   SFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGSI  696
             SF +IR  E ++   +LY +S   + V+LK++L  L+L+++SR+ LGK Y  L + E SI
Sbjct  143   SFRYIRVEENRAFASRLYALSG--KAVVLKEHLSRLSLSIMSRIVLGKEYFSLTDFESSI  200

Query  697   VNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHM  876
             ++  EF+ MLDE+FLL+G  NIGD IPWLDFLDLQGY+K+ K + KK+D F E VL EH 
Sbjct  201   MSLKEFQDMLDELFLLNGVFNIGDWIPWLDFLDLQGYVKRMKVVKKKMDWFYEFVLHEHK  260

Query  877   SRRVVEGDK-FVAKDMVDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESST  1035
             +R+  EG K FVAKDMVD+LLQ  DDPN +EVK+    +KAFT D++AGGT++S 
Sbjct  261   ARK--EGVKEFVAKDMVDLLLQLVDDPNDLEVKLTYDSIKAFTQDVIAGGTDTSA  313



>emb|CDP21012.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 220/314 (70%), Gaps = 9/314 (3%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHL--RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
             TWL  A+A   T+A+  ++K L  +R KL+ PPGPKPWPIIGNLNL+G++PH+S+H L Q
Sbjct  4     TWLLLALA--GTVALAFLSKALTHKRLKLNHPPGPKPWPIIGNLNLLGSIPHQSLHLLFQ  61

Query  280   KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
             KYG IMQL+FGS PVVV SS EMAK FL+T D  F  RP   A K+ +YN S + W+ YG
Sbjct  62    KYGEIMQLKFGSSPVVVASSPEMAKEFLQTHDNIFASRPATAAAKYTSYNCSGMLWAPYG  121

Query  460   PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlN  639
             P+W QAR+++  ++FS K+LD FE  R  E ++ + +LY  S   +PV+++D+L  L+L+
Sbjct  122   PHWRQARKIYLTQIFSPKQLDFFESTRIEERRAFISRLYAQSG--KPVVMRDHLMRLSLS  179

Query  640   VISRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIK  813
               S+M L   Y  +SE  GS+V   EF++M+D  FLL G  NIGD IPWLD  DLQGY+K
Sbjct  180   TASQMVLSNKYFAQSEGDGSLVTFEEFQEMIDTWFLLGGVFNIGDWIPWLDRFDLQGYVK  239

Query  814   QTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
             Q K L KK D+F  HVLD+H +RR  E D F+ KDMVD+LLQ+A+DP+++VK+ R  +K 
Sbjct  240   QMKELYKKFDKFHNHVLDDHQARRKTEKD-FIPKDMVDILLQYAEDPDLQVKLTRDQIKG  298

Query  994   FTLDLLAGGTESST  1035
                DLL GGT++S 
Sbjct  299   LIQDLLVGGTDTSA  312



>ref|XP_008242249.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 207/278 (74%), Gaps = 5/278 (2%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPI+GNLNL+G LPH+ +H LSQ YGP+MQL+FGS+PVV+ SS EMAK FLKT D  F  
Sbjct  41    WPILGNLNLMGPLPHQCLHKLSQTYGPLMQLKFGSYPVVIASSAEMAKQFLKTHDHVFAS  100

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+LTYNY N+TW+ +GPYW Q R++F  E+FS+KRL SFE+IR  E+++   +
Sbjct  101   RPQTAAGKYLTYNYRNITWAPFGPYWRQGRKIFMSELFSSKRLASFEYIRVEEIRAFTSR  160

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLL  744
              Y +S   +PV+LK+++  L L+ +SR+ LGK Y +ES+   S V  GEF+ MLDE+  L
Sbjct  161   FYALSG--KPVILKEHISRLTLSTVSRIVLGKEYFSESQFVTSTVTLGEFQDMLDELVCL  218

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMV  924
             SG LNIGD IPWL F DLQGY+KQ KAL KK D F +++LDEH +R+  E + FV KDMV
Sbjct  219   SGVLNIGDWIPWLKFFDLQGYVKQMKALKKKFDLFHDYILDEHKARKKEETN-FVPKDMV  277

Query  925   DVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+LLQ  DDP++EVK+ R  VK FT DL+AGGT++S  
Sbjct  278   DLLLQLVDDPDLEVKLNRDSVKGFTQDLIAGGTDTSAT  315



>ref|XP_006493375.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=506

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 213/287 (74%), Gaps = 3/287 (1%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +K +LPPGPKPWPIIGNLNLIG LPH SIH LS+KYGP+M L+FG   VVVGSSVE+A++
Sbjct  26    KKPNLPPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAEL  85

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
              LKT D++F  RP+ +AGK+LTY+Y+ +  + Y PYW QAR++  ME+ S KRLD FE++
Sbjct  86    LLKTHDLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYM  145

Query  538   RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFK  717
             R  E K  LH ++   S  +PV LKD L++LNL+ +SRM LGK Y  E E +IV P EF 
Sbjct  146   RVEERKLFLHDMFK--SCSKPVQLKDRLYMLNLSTMSRMVLGKRYTEEDENNIVTPKEFT  203

Query  718   KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
             +ML+E+FL+ G L+IGD IPWL  LDLQG++K+ K +N+KLDRF EH+LDE  +R+    
Sbjct  204   EMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEHILDERYARKKSGK  263

Query  898   DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+ V  DMVDVL+Q ADDP +EVK+ER  +KA   DLL  GT++S +
Sbjct  264   DQGV-NDMVDVLVQFADDPTLEVKLERHQLKAIIQDLLTAGTDTSAL  309



>ref|XP_002516270.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46272.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 227/325 (70%), Gaps = 10/325 (3%)
 Frame = +1

Query  94    MEGP---TWLAYAVAWLSTIAIILIAKHL---RRRKLHLPPGPKPWPIIGNLNLIGTLPH  255
             M+ P   +W+  A+AWL+   ++ +AK         L LPPGPKPWPIIGNLNLIG LPH
Sbjct  2     MDAPLNQSWILSAMAWLAGAGLLFLAKLFISHHHSSLKLPPGPKPWPIIGNLNLIGPLPH  61

Query  256   RSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYS  435
             RS+H L+Q+YG IMQL+FGSFPVVV SS EMAK  LKT D  F  RPK  AGK+  YNYS
Sbjct  62    RSLHKLAQQYGHIMQLRFGSFPVVVASSAEMAKQILKTNDEIFASRPKFAAGKYTAYNYS  121

Query  436   NVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkd  615
             NV W+ YG YW Q R+++  E+F++KRL S+E+IR  E+ + L  ++++S + + VLLKD
Sbjct  122   NVLWAPYGEYWRQGRKLYLNELFNSKRLQSYEYIRVEEMHNFLSGVHSLSCSGKAVLLKD  181

Query  616   ylfllnlNVISRMALGKSYL---NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLD  786
             +L    L+++SR+ LGK Y    +ES+ +IV P EF++MLDE+F L+G  +IGD IPWLD
Sbjct  182   HLSHYTLSILSRIVLGKKYSSAESESQTNIVTPEEFQEMLDELFSLNGVFHIGDWIPWLD  241

Query  787   FLDLQGYIKQTKALNKKLDRFLEHVLDEH-MSRRVVEGDKFVAKDMVDVLLQHADDPNME  963
             FLDLQGY+K+ KAL  K DRF +HV+ EH + R+    +    K++VD +LQ AD+P+++
Sbjct  242   FLDLQGYVKRMKALKIKFDRFHDHVISEHRIKRKGALLEDSAPKNIVDHMLQLADNPDLD  301

Query  964   VKIERQGVKAFTLDLLAGGTESSTV  1038
             +K+    VK F+ +++ GG +++  
Sbjct  302   IKLNTDSVKGFSQEIIGGGKDTAAA  326



>gb|EMT12612.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=510

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 216/291 (74%), Gaps = 4/291 (1%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             R +K +LPPGPKPWP+IGN +LIG LPHRSIH+LS+KYGP+M L+FGSFP+++GSSV+MA
Sbjct  26    RGQKYNLPPGPKPWPVIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIIGSSVDMA  85

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             + FLKT DI +VDRPK  +GK+ TYNY+++TWS YG YW QARR+   ++F+ +RL   E
Sbjct  86    RYFLKTQDILYVDRPKTASGKYTTYNYADMTWSPYGAYWRQARRICLTQLFNPRRLALLE  145

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE--SEGSIVNP  705
             HIR  E+K+++  L+ VS     +  +D++ ++++NVI+RM +GK    +  +EG + + 
Sbjct  146   HIRADEVKALMCDLFAVSGHAVHL-SRDHMSMVSMNVITRMVMGKRLFVDGVAEGPVPSL  204

Query  706   GEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRR  885
               F+ MLDE+FLL+G LNIGD IPWLD++DLQGY+++ K + K  D F EHVLDEH   R
Sbjct  205   KVFRWMLDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKIGKLFDAFNEHVLDEHSGER  264

Query  886   VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
                G+   A+DM  VL++ A+D  +EV+  R GVKAFT DL+AGGTESS V
Sbjct  265   -GRGEGEAARDMGGVLMEKANDNALEVQYGRIGVKAFTQDLIAGGTESSAV  314



>ref|XP_006427648.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
 gb|ESR40888.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
Length=506

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 212/287 (74%), Gaps = 3/287 (1%)
 Frame = +1

Query  178   RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
             +K +LPPGPKPWPIIGNLNLIG LPH SIH LS+KYGP+M L+FG   VVVGSSVE+A++
Sbjct  26    KKPNLPPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAEL  85

Query  358   FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
              LKT D++F  RP+ +AGK+LTY+Y+ +  + Y PYW QAR++  ME+ S KRLD FE++
Sbjct  86    LLKTHDLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYM  145

Query  538   RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFK  717
             R  E K  LH ++   S  +PV LKD L++LNL+ +SRM LGK Y  E E +IV P EF 
Sbjct  146   RVEERKLFLHDMF--KSCSKPVQLKDRLYMLNLSTMSRMVLGKRYTEEDENNIVTPKEFT  203

Query  718   KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
             +ML+E+FL+ G L+IGD IPWL  LDLQG++K+ K +N+KLDRF E +LDE  +R+    
Sbjct  204   EMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEQILDERYARKKSGK  263

Query  898   DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+ V  DMVDVL+Q ADDP +EVKIER  +KA   DLL  GT++S +
Sbjct  264   DQGV-NDMVDVLVQFADDPTLEVKIERHQLKAIIQDLLTAGTDTSAL  309



>ref|XP_007204846.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
 gb|EMJ06045.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
Length=510

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 207/278 (74%), Gaps = 5/278 (2%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPI+GNLNL+G LPH+ +H LSQ YGP+MQL+FGS+PVV+ SS EMAK FLKT D  F  
Sbjct  41    WPILGNLNLMGPLPHQCLHKLSQTYGPLMQLKFGSYPVVIASSAEMAKQFLKTHDHVFAS  100

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+LTYNY N+TW+ +GPYW Q R++F  E+FS+KRL+SFE+IR  E+++   +
Sbjct  101   RPQTAAGKYLTYNYRNITWAPFGPYWRQGRKIFMSELFSSKRLESFEYIRVEEIRAFTSR  160

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--GSIVNPGEFKKMLDEVFLL  744
              Y +S   +PV+LK+++  L L+ +SR+ LGK Y +ES+   S +   EF+ MLDE+  L
Sbjct  161   FYALSG--KPVMLKEHISRLTLSTVSRIVLGKEYFSESQFVTSTMTLREFQDMLDELVCL  218

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMV  924
             SG LNIGD IPWL F DLQGY+KQ KAL KK D F +++LDEH +R+  E + FV KDMV
Sbjct  219   SGVLNIGDWIPWLKFFDLQGYVKQMKALKKKFDLFHDYILDEHKARKKEETN-FVPKDMV  277

Query  925   DVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+LLQ  DDP++EVK+ R  VK FT DL+AGGT++S  
Sbjct  278   DLLLQLVDDPDLEVKLNRDSVKGFTQDLIAGGTDTSAT  315



>ref|XP_006493372.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=511

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 209/293 (71%), Gaps = 4/293 (1%)
 Frame = +1

Query  118  YAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
            Y++ +   I + L  +   R KL+LPPGP PWP IGNLNLIG LPH SIH LSQKYGP+M
Sbjct  15   YSILFFLPIVLFLFRRQFSR-KLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLM  73

Query  298  QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
             L+FG  PVVVGSS E+A++ LKT DI+F  RP  +AGK+ TYNYS +  + YGPYW QA
Sbjct  74   HLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYGPYWRQA  133

Query  478  RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMA  657
            R++  ME+ SAKRLD FE+IR  E  + L +L+  +ST  PV LKD L+ LNL  I RM 
Sbjct  134  RKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAST--PVHLKDRLYTLNLTSICRMV  191

Query  658  LGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKK  837
            LGK Y +E+E + V P +F +M++E+FLL G L+IGD IPWL   DLQG++K+ K ++KK
Sbjct  192  LGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQGHVKRMKDVSKK  251

Query  838  LDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
            LD+F E +LDEH  RR    D +   DMVDVL+Q ADDP++EVK+ER+ +KA 
Sbjct  252  LDKFYEGILDEHHERRKSVKD-YGVHDMVDVLMQLADDPSLEVKLEREHIKAL  303



>ref|XP_006427644.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|ESR40884.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|KDO55336.1| hypothetical protein CISIN_1g010172mg [Citrus sinensis]
Length=516

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 216/307 (70%), Gaps = 4/307 (1%)
 Frame = +1

Query  118   YAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
             Y++ +   I + L  +   R K++LPPGPKPWP IGNLNLIG LPH SIH LSQKYGP+M
Sbjct  15    YSILFFLPIVLFLFRRRFSR-KVNLPPGPKPWPFIGNLNLIGPLPHVSIHSLSQKYGPLM  73

Query  298   QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
              L+FG   VVVGSSVE+A++ LKT DI+F  RP  +AGK+ TYNYS +  + YGPYW QA
Sbjct  74    HLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYGPYWRQA  133

Query  478   RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMA  657
             R++  ME+   KRLD FE++R  E  + L +L+   ST   V LKD+L+ LN   I RM 
Sbjct  134   RKICLMELLGTKRLDQFEYMRVEERNAFLFELFKSVSTY--VHLKDHLYTLNHTSICRMV  191

Query  658   LGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKK  837
             LGK Y +++E + V P +F +ML+E+FLL+G L+IGD IPWL   DLQG++K+ K ++KK
Sbjct  192   LGKRYTDKAEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDLQGHVKRMKDVSKK  251

Query  838   LDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAG  1017
             LD+F E +LDEH +RR    D +   DMVDVLL  ADDP++EVK+ER+ +KA   DLL  
Sbjct  252   LDKFYEDILDEHYARRKSIKD-YGVHDMVDVLLHLADDPSLEVKLEREHIKALIQDLLTA  310

Query  1018  GTESSTV  1038
             GT++S +
Sbjct  311   GTDTSAI  317



>ref|XP_011095846.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Sesamum 
indicum]
Length=306

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/277 (56%), Positives = 203/277 (73%), Gaps = 5/277 (2%)
 Frame = +1

Query  172  RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
            R  K +LPPGPKPWP+IGNLNL+G++PHRS+H LSQKYG IMQL+FG FPVVV SS EMA
Sbjct  27   RHPKPNLPPGPKPWPVIGNLNLLGSIPHRSLHLLSQKYGDIMQLKFGKFPVVVASSPEMA  86

Query  352  KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
            K FLK  D  F  RP   AGK+ +YNYS++TW+ YGP+W QAR+++  EVFSAK+L+S+E
Sbjct  87   KQFLKVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLESWE  146

Query  532  HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--GSIVNP  705
            HIR  E  + L +LY++S   +PV+L+ +L+  NL+ ISRM L   Y +ESE   S+V  
Sbjct  147  HIRIEERHNFLARLYSLSG--KPVILRPHLYRYNLSSISRMVLSSKYFSESEHDKSVVKL  204

Query  706  GEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRR  885
             E ++M++E FLL+G  NIGD IPWL FLDLQGY+K+ KAL KKLD+F  +V+++H +R 
Sbjct  205  DELQEMVEEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALQKKLDKFFSYVINDHQTRI  264

Query  886  VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
              E D  V  D+VD LLQ A+DPN+EVK+    +K  
Sbjct  265  ATEKDP-VQGDVVDALLQLAEDPNLEVKLTSDRIKGL  300



>gb|ABC69418.1| CYP92B3 [Nicotiana tabacum]
Length=508

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 220/314 (70%), Gaps = 8/314 (3%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             +W+  A+  L T+  +    H  RRK +LPPGPKPWPI+GN++L+G+ PHRS+H+L+++Y
Sbjct  4     SWVVLALTGLLTLVFLSKFLHSPRRKQNLPPGPKPWPIVGNIHLLGSTPHRSLHELAKRY  63

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             G +M L+FGS  V++ SS +MA+ FLKT D  +  RP+  AGK+  YNY ++TW++YGP+
Sbjct  64    GDLMLLKFGSRNVLILSSPDMAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWARYGPF  123

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QARR++  E+F+ KRLDSFE+IR  E  +++ +L+ +S   +P+LL+D+L    L  I
Sbjct  124   WRQARRIYLNEIFNPKRLDSFEYIRIEERHNLISRLFVLSG--KPILLRDHLTRYTLTSI  181

Query  646   SRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             SR  L   Y +ES G  S++   + + MLD+ FLL+G +NIGD IPWL FLDLQGY+KQ 
Sbjct  182   SRTVLSGKYFSESPGQNSMITLKQLQDMLDKWFLLNGVINIGDWIPWLAFLDLQGYVKQM  241

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             K L++  D+F   VLD+H + R   G+K FV +DMVDVLLQ A+DPN+EVK+    VK  
Sbjct  242   KELHRNFDKFHNFVLDDHKANR---GEKNFVPRDMVDVLLQQAEDPNLEVKLTNDCVKGL  298

Query  997   TLDLLAGGTESSTV  1038
               DLLAGGT++S  
Sbjct  299   MQDLLAGGTDTSAT  312



>ref|XP_011095838.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Sesamum 
indicum]
Length=509

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 210/291 (72%), Gaps = 5/291 (2%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             R  K +LPPGPKPWP+IGNLNL+G++PHRS+H LSQKYG IMQL+FG FPVVV SS EMA
Sbjct  27    RHPKPNLPPGPKPWPVIGNLNLLGSIPHRSLHLLSQKYGDIMQLKFGKFPVVVASSPEMA  86

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             K FLK  D  F  RP   AGK+ +YNYS++TW+ YGP+W QAR+++  EVFSAK+L+S+E
Sbjct  87    KQFLKVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLESWE  146

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--GSIVNP  705
             HIR  E  + L +LY++S   +PV+L+ +L+  NL+ ISRM L   Y +ESE   S+V  
Sbjct  147   HIRIEERHNFLARLYSLSG--KPVILRPHLYRYNLSSISRMVLSSKYFSESEHDKSVVKL  204

Query  706   GEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRR  885
              E ++M++E FLL+G  NIGD IPWL FLDLQGY+K+ KAL KKLD+F  +V+++H +R 
Sbjct  205   DELQEMVEEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALQKKLDKFFSYVINDHQTRI  264

Query  886   VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
               E D  V  D+VD LLQ A+DPN+EVK+    +K     L+  GT+++  
Sbjct  265   ATEKDP-VQGDVVDALLQLAEDPNLEVKLTSDRIKGLLQGLVGAGTDTAAT  314



>ref|XP_006493374.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=516

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 215/307 (70%), Gaps = 4/307 (1%)
 Frame = +1

Query  118   YAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
             Y++ +   I + L  +   R K++LPPGPKPWP IGNLNLIG LPH SIH LSQKYGP+M
Sbjct  15    YSILFFLPIVLFLFRRRFSR-KVNLPPGPKPWPFIGNLNLIGPLPHVSIHSLSQKYGPLM  73

Query  298   QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
              L+FG   VVVGSSVE+A++ LKT DI+F  RP  +AGK+ TYNYS +  + YGPYW QA
Sbjct  74    HLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYGPYWRQA  133

Query  478   RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMA  657
             R++  ME+   KRL+ FE++R  E  + L +L+   ST   V LKD+L  LN   I RM 
Sbjct  134   RKICLMELLGTKRLNQFEYMRVEERNAFLFELFKSVSTY--VHLKDHLHTLNHTSICRMV  191

Query  658   LGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKK  837
             LGK Y +++E + V P +F +ML+E+FLL+G L+IGD IPWL   DLQG++K+ K ++KK
Sbjct  192   LGKRYTDKAEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDLQGHVKRMKDVSKK  251

Query  838   LDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAG  1017
             LD+F E +LDEH +RR    D +   DMVDVLL  ADDP++EVK+ER+ +KA   DLL  
Sbjct  252   LDKFYEDILDEHYARRKSIKD-YGVHDMVDVLLHLADDPSLEVKLEREHIKALIQDLLTA  310

Query  1018  GTESSTV  1038
             GT++S +
Sbjct  311   GTDTSAI  317



>ref|XP_004288987.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 219/310 (71%), Gaps = 8/310 (3%)
 Frame = +1

Query  121   AVAWLSTIAIIL-IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIM  297
              +  L+T+A++  +    R+  L  PPGPKPW IIGNLNLIG +PH+S+H LSQ YGPIM
Sbjct  11    TLVCLATLALLFNLVLFPRKEVLKSPPGPKPWLIIGNLNLIGPIPHQSLHKLSQTYGPIM  70

Query  298   QLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA  477
              L+FGS PVV+ SS EMAK FLK  D  F  RP+  AGK+LTYNY +VTW+ YG YW Q 
Sbjct  71    HLKFGSHPVVIASSAEMAKQFLKHHDHVFASRPQTAAGKYLTYNYLDVTWAPYGDYWSQG  130

Query  478   RRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMA  657
             R++F  E+FS+KRL+SFE+IR  E+++ L +L  +S   +PV+LK+ +  L L  +SR+ 
Sbjct  131   RKIFITELFSSKRLESFEYIRVEEIRAFLSRLCALSG--KPVILKEQISRLTLTTVSRIV  188

Query  658   LGKSYLNES--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALN  831
             LGK Y +++  + S+V    F+ MLDE+  LSG LNIGD IPWL FLDLQGY K+   L 
Sbjct  189   LGKDYFSQTDIQTSVVTLKGFQDMLDELVSLSGVLNIGDWIPWLKFLDLQGYEKKMMDLK  248

Query  832   KKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDL  1008
             +KLD F +++L EH ++  ++G + FV KDMVD+LL+  D+P++EVK+   GVK FT DL
Sbjct  249   RKLDSFHDYILAEHKAK--MKGVENFVPKDMVDLLLKLVDNPDLEVKLTLDGVKGFTQDL  306

Query  1009  LAGGTESSTV  1038
             +AGGT++S  
Sbjct  307   IAGGTDTSAT  316



>gb|KDO55337.1| hypothetical protein CISIN_1g0106252mg, partial [Citrus sinensis]
Length=297

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 203/272 (75%), Gaps = 3/272 (1%)
 Frame = +1

Query  178  RKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKI  357
            +K +LPPGPKPWPIIGNLNLIG LPH SIH LS+KYGP+M L+FG   VVVGSSVE+A++
Sbjct  26   KKPNLPPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAEL  85

Query  358  FLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHI  537
             LKT D++F  RP+ +AGK+LTY+Y+ +  + Y PYW QAR++  ME+ S KRLD FE++
Sbjct  86   LLKTHDLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYM  145

Query  538  RTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFK  717
            R  E K  LH ++   S  +PV LKD L++LNL+ +SRM LGK Y  E E +IV P EF 
Sbjct  146  RVEERKLFLHDMFK--SCSKPVQLKDRLYMLNLSTMSRMVLGKRYTEEDENNIVTPKEFT  203

Query  718  KMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG  897
            +ML+E+FL+ G L+IGD IPWL  LDLQG++K+ K +N+KLDRF E +LDE  +R+    
Sbjct  204  EMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEQILDERYARKKSGK  263

Query  898  DKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
            D+ V  DMVDVL+Q ADDP +EVKIER  +KA
Sbjct  264  DQGV-NDMVDVLVQFADDPTLEVKIERHQLKA  294



>ref|XP_003581159.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=600

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 222/343 (65%), Gaps = 27/343 (8%)
 Frame = +1

Query  76    TKYFASMEGPTWLAYAVAWLSTIAIILIA--------KHLR---RRKLHLPPGPKPWPII  222
             T  F SME    LA   AW S+   +L+A        +H R   R +  LPPGPKPWPII
Sbjct  49    TMQFKSME----LALPAAWASSFLAVLMATAILLLVLRHGRNSHRHRYRLPPGPKPWPII  104

Query  223   GNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKN  402
             GNL+L+G LPHRS+ +LS++YGP++QL+ GSFPVVVGSS E A+ FLKT D     RP+ 
Sbjct  105   GNLHLLGALPHRSLRELSKRYGPLIQLRLGSFPVVVGSSAETARFFLKTHDAASAGRPRT  164

Query  403   VAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNV  582
              AG+H  YNYS++ WS YG +W + RR+   E+FSA RL SFEHIR  E++++L  L++ 
Sbjct  165   AAGRHTAYNYSDMLWSPYGAHWRRLRRVCLAELFSAARLGSFEHIRRDEVRALLRGLHDA  224

Query  583   SSTRQPVllkdyl--fllnlNVISRMALGKSYLNE--SEGSIVNPGEFKKMLDEVFLLSG  750
             S    PV++K     F   L +ISRM LG  Y+ +    GS + P EF ++++E F L+G
Sbjct  225   SGIGMPVVVKVKEHLFAATLGMISRMVLGNKYVGKDAGSGSAMEPEEFMRVMEEFFFLNG  284

Query  751   ALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGD-KFVAKDMVD  927
             ALN+GD +PWL +LDLQGY+ + K +   LD F+E VLDEH +RR +EGD  FVAKDM D
Sbjct  285   ALNVGDFVPWLGWLDLQGYVGRMKNVAWALDAFMERVLDEHDARRRLEGDGSFVAKDMAD  344

Query  928   VL-LQH-----ADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VL LQ      + D   E  +ER  VKA  +DL+AGGT ++ V
Sbjct  345   VLRLQQRRQIESGDEEGE-PLERDSVKALAMDLIAGGTNTNAV  386



>ref|XP_008670125.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 tpg|DAA39881.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=466

 Score =   278 bits (712),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 201/278 (72%), Gaps = 7/278 (3%)
 Frame = +1

Query  217   IIGNLNLI-GTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDR  393
             I+GNLNLI G LPHRS+++LS++YGP+MQL FGS PVVVG+S EMAK+FLKT D  F DR
Sbjct  39    IVGNLNLIMGELPHRSMNELSKRYGPLMQLWFGSLPVVVGASAEMAKLFLKTNDAAFADR  98

Query  394   PKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKL  573
             P+   GK+  Y+ S++ W+  GPY  QARR+   E+FSAKRL+S EHIR  E++ ML +L
Sbjct  99    PRFAVGKYTAYDCSDILWAPLGPYLRQARRICAAELFSAKRLESLEHIRDEEVRVMLQQL  158

Query  574   YNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGS----IVNPGEFKKMLDEVFL  741
                 +T + V L DYL  + L VISR+ LG+ Y+ + EG+    +V P EF++M+DE F+
Sbjct  159   RQ--ATGRTVQLGDYLQTMTLGVISRIVLGRKYVVQEEGNSAPPVVTPAEFREMVDEFFV  216

Query  742   LSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDM  921
             L GA NIGD IPWLD+LDLQGY+ + K +N +  RFLEHVLD H  RR+ EG  FV KDM
Sbjct  217   LHGAFNIGDFIPWLDWLDLQGYVARMKRMNARFGRFLEHVLDVHNERRLREGGSFVPKDM  276

Query  922   VDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             VDVLLQ ADD  +EV++ R  VKA T DL+ GGT+++ 
Sbjct  277   VDVLLQLADDTILEVQLSRDNVKAITQDLIIGGTDTTA  314



>ref|XP_011095822.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 216/301 (72%), Gaps = 8/301 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
             I II   +H +R+    PPGPKPWP+IGNL+L+G+ PHRS H LSQKYG IMQL++G FP
Sbjct  24    IPIINFRQHPKRK---FPPGPKPWPVIGNLHLVGSHPHRSFHVLSQKYGDIMQLKYGKFP  80

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             VVV SS EMAK FL+  D  F  RP   AGK+ +++YS+VTW+ YGP+W QAR+++  EV
Sbjct  81    VVVASSPEMAKQFLRLHDKVFASRPALAAGKYTSFDYSDVTWAPYGPHWRQARKIYLSEV  140

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             F+AK+L+SFE+IR  E +++L +L+++S   +PV+LKD+L   +L++ISRM  G  Y++E
Sbjct  141   FNAKKLESFEYIRIEERRNLLSRLHSLSG--KPVVLKDHLSRYSLSIISRMVFGDGYISE  198

Query  682   S--EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLE  855
             S    SIV   E  ++LDE FLL+G  N GD IPWL+FLDLQG +K+ K L +KLDRFL 
Sbjct  199   SGPNKSIVTLDELHELLDEWFLLNGVFNFGDWIPWLNFLDLQGCVKKMKGLYQKLDRFLN  258

Query  856   HVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             +V+D+H +RR +  D  +  D VD+LLQ A+D N+E+K+ R  +K    DLL GG ++++
Sbjct  259   YVIDDHQTRRAIGKDS-IQGDAVDMLLQLAEDDNLEIKLTRDRIKGLIQDLLGGGADTAS  317

Query  1036  V  1038
              
Sbjct  318   T  318



>gb|ABK24537.1| unknown [Picea sitchensis]
Length=514

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 220/311 (71%), Gaps = 9/311 (3%)
 Frame = +1

Query  118   YAVAWLSTIAII---LIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYG  288
             +A+ +L  +AI+   LI   LR   + LPPGP+ WPIIGNLNL+G LPHRS+  LS+ YG
Sbjct  7     FALPYLPVLAIVSVYLIYMRLRP-SVKLPPGPRAWPIIGNLNLMGKLPHRSLDRLSKTYG  65

Query  289   PIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYW  468
             P+M ++ GS P VV SS EMA+ FL+T D+ F  RP+  +GK+ TYNYS++TWS YG Y+
Sbjct  66    PLMYIRLGSIPCVVASSAEMAREFLQTHDLTFSSRPQVASGKYTTYNYSDITWSPYGDYF  125

Query  469   HQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVIS  648
               AR++  ME+FSAKRL+SFE+IR  E+  ML  ++       PV ++   + ++ N+IS
Sbjct  126   RLARKVCLMELFSAKRLESFEYIRVEEVARMLGSVFETCQRGLPVEIRKETYGVSNNIIS  185

Query  649   RMALGKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKAL  828
             RMALG+ Y ++  G+++   E K+ML+E FLL+G  NI D IPWL +LDLQGY+ + K L
Sbjct  186   RMALGRRYFDKEAGNMMRLEELKEMLEEFFLLNGVFNIVDFIPWLGWLDLQGYVGRMKKL  245

Query  829   NKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLD  1005
             +++LD FLE V++EH  RR  +G + +VAKDM+DVLL+ ADDP  ++ + R  VKAFTLD
Sbjct  246   SERLDVFLEEVVEEHDRRR--KGVENYVAKDMMDVLLKQADDP--QLNLSRIKVKAFTLD  301

Query  1006  LLAGGTESSTV  1038
             ++AGGTE+S  
Sbjct  302   IIAGGTETSAT  312



>ref|XP_009788131.1| PREDICTED: cytochrome P450 750A1-like [Nicotiana sylvestris]
Length=331

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 212/305 (70%), Gaps = 8/305 (3%)
 Frame = +1

Query  106   TWLAYAVAWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKY  285
             +W+  A+  L T+  +    H  RRK +LPPGPKPWPI+GN++L+G+ PHRS+H+L+++Y
Sbjct  4     SWVVLALTGLLTLVFLSKFLHSPRRKQNLPPGPKPWPIVGNIHLLGSTPHRSLHELAKRY  63

Query  286   GPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPY  465
             G +M L+FGS  V++ SS +MA+ FLKT D  +  RP+  AGK+  YNY ++TW++YGP+
Sbjct  64    GDLMLLKFGSRNVLILSSPDMAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWARYGPF  123

Query  466   WHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVI  645
             W QARR++  E+F+ KRLDSFE+IR  E  +++ +L+ +S   +P+LL+D+L    L  I
Sbjct  124   WRQARRIYLNEIFNPKRLDSFEYIRIEERHNLISRLFALSG--KPILLRDHLTRYTLTSI  181

Query  646   SRMALGKSYLNESEG--SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQT  819
             SR  L   Y +ES G  S++   + + MLD+ FLL+G +NIGD IPWL FLDLQGY+KQ 
Sbjct  182   SRTVLSGKYFSESPGQNSMITLKQLQDMLDKWFLLNGVINIGDWIPWLAFLDLQGYVKQM  241

Query  820   KALNKKLDRFLEHVLDEHMSRRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             K L++  D+F   VLD+H + R   G+K FV +DMVDVLLQ A+DPN+EVK+    VK  
Sbjct  242   KELHRNFDKFHNFVLDDHKANR---GEKNFVPRDMVDVLLQQAEDPNLEVKLTNDCVKGL  298

Query  997   TLDLL  1011
                LL
Sbjct  299   MQVLL  303



>ref|XP_006648650.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=518

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 195/293 (67%), Gaps = 30/293 (10%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             R RK ++PPGP+PWP+IGNLNLIG LPHRSIH LS ++GP+M L+FGSFPVVV SSV+MA
Sbjct  46    RARKHNIPPGPRPWPVIGNLNLIGPLPHRSIHALSARHGPLMSLRFGSFPVVVASSVDMA  105

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             + FLKT D+ F+DRP+  AGK+  YN++ + WS YG YW QAR+++  E+ SA+RL S E
Sbjct  106   RYFLKTNDLAFLDRPRTAAGKYTVYNFTGMLWSHYGEYWRQARKVWVTELLSARRLASAE  165

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG----SIV  699
             H+R  E+++ML                             M LGK Y+ E       +  
Sbjct  166   HVRAEEVRAMLRVA--------------------------MVLGKKYIVEGADPAAAAAA  199

Query  700   NPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMS  879
              P +F+ M++E+F L+G  N+GD++PWL +LD QGYI + K L K  DRFLE VL+EH  
Sbjct  200   TPEQFRWMIEEIFFLNGVFNVGDMVPWLAWLDPQGYIGRMKRLGKMFDRFLEDVLEEHDE  259

Query  880   RRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             RR   G   VA DMVD+LLQ ADDPN++V I+R GVKAF  +L+ G T++S+V
Sbjct  260   RRRRGGAAVVAADMVDLLLQFADDPNLKVPIQRDGVKAFIPELITGSTDTSSV  312



>emb|CDP20032.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 201/290 (69%), Gaps = 5/290 (2%)
 Frame = +1

Query  172   RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
             +R KL+ PPGPKPWPIIGNLNL+G+ PH+S+H LSQKYG IMQL+FGS PVVV SS EMA
Sbjct  26    KRLKLNHPPGPKPWPIIGNLNLLGSNPHQSLHLLSQKYGEIMQLKFGSSPVVVASSPEMA  85

Query  352   KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
             K FL+T D  F  RP   A K+ +YN S + W+ YGP+W QAR++   ++FS KRLD +E
Sbjct  86    KEFLQTHDNIFASRPTTAAAKYTSYNCSGMLWAPYGPHWRQARKICLTQIFSPKRLDRYE  145

Query  532   HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESE--GSIVNP  705
              IR  E  + + +LY +S   +PVLL+D+L    L+   +M L   Y  +SE  GS+V  
Sbjct  146   SIRIEERHAFMSRLYALSG--KPVLLRDHLIRFTLSAACQMVLSNKYFAQSEGDGSVVTF  203

Query  706   GEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRR  885
              E ++M+D  F L G  NIGD IPWLD  DLQG +KQ K L KK DRF  HVLD+H ++R
Sbjct  204   EELQEMIDTWFSLGGVFNIGDWIPWLDRFDLQGCVKQMKELYKKFDRFHNHVLDDHRAKR  263

Query  886   VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
               E D F+ KDMVD+LLQ+A+DP+++VK+    +K   LDLLAGGT++S 
Sbjct  264   KTEKD-FIPKDMVDILLQYAEDPDLQVKLTGDQMKGLILDLLAGGTDTSA  312



>ref|XP_002467849.1| hypothetical protein SORBIDRAFT_01g035150 [Sorghum bicolor]
 gb|EER94847.1| hypothetical protein SORBIDRAFT_01g035150 [Sorghum bicolor]
Length=514

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 203/299 (68%), Gaps = 10/299 (3%)
 Frame = +1

Query  172   RRR-----KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgs  336
             RRR     K  LPPGP+PWP+IGNLNLIG LPHRS+H+LS +YGP+M L+FGS P+VVGS
Sbjct  23    RRRSTSSSKYKLPPGPRPWPVIGNLNLIGHLPHRSMHELSTRYGPLMSLRFGSCPIVVGS  82

Query  337   svEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKR  516
             SV+MAK FLKT D+ F+DRP    G+++ YNYS+V  + YGPYW Q R++F  E+ SA R
Sbjct  83    SVDMAKFFLKTHDLAFLDRPAIATGRYIFYNYSDVLMASYGPYWRQGRKLFQNELLSAGR  142

Query  517   LDSFEH----IRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES  684
             + S+ H    +       +             + LKD+L +  LN++SRMALG  Y+ + 
Sbjct  143   MKSYPHRGGALHAAGDVVVGGGGIPHGGAVVVLKLKDHLSMATLNMVSRMALGNKYVFDG  202

Query  685   EGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVL  864
              GS++ P EF+ M+ E F L+G + +GD+IPWL FLD QGYIK+ K L+K  D FLEHVL
Sbjct  203   AGSLMPPEEFRWMMQEFFFLNGVVTVGDVIPWLSFLDPQGYIKRMKRLSKMFDAFLEHVL  262

Query  865   DEHMSRRVVEGD-KFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              EH  RR  +G+ +FV +DMVD LLQ ADD ++E  IER G+K F LD++A G E+S V
Sbjct  263   REHSDRRRRQGEGRFVPRDMVDQLLQLADDASLEAPIERDGIKGFILDIIAAGAETSAV  321



>ref|XP_004237819.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 211/306 (69%), Gaps = 8/306 (3%)
 Frame = +1

Query  127   AWLSTIAIIL-IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQL  303
             +WL   A +L I  H  +RKL  PPGPKPWPIIGNLNL+G+LPH S+H LSQKYG +M L
Sbjct  12    SWLFAFAFVLKILNHPAKRKL--PPGPKPWPIIGNLNLLGSLPHVSLHHLSQKYGDLMLL  69

Query  304   QfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARR  483
             +FGS PV+V SS EMAK  LKT D  F  RP+  AGK+ +YNYS++TW+ YG +W QARR
Sbjct  70    KFGSKPVLVASSPEMAKEILKTHDAIFASRPELAAGKYTSYNYSDMTWAPYGAHWRQARR  129

Query  484   MFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALG  663
             ++  E+FS KRLDSFEHIR  E ++++ +L+ +S   +PVLLKD+L    L  ISR+ + 
Sbjct  130   IYLTEIFSPKRLDSFEHIRVEEGRTLISRLFPLSG--KPVLLKDHLPRFTLRTISRLVMS  187

Query  664   KSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLD  843
               Y N+ + SI+     ++MLDE FLL G +NIGD IPWL + DLQGY+KQ K L K   
Sbjct  188   DKYYNDDQ-SIITLETLQQMLDEWFLLGGVINIGDWIPWLSWFDLQGYLKQMKTLGKNFT  246

Query  844   RFLEHVLDEH-MSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGG  1020
              F  +V+++H  ++R +E D +VAKDMVD LL  ADDPN++VK+    +     DL++G 
Sbjct  247   IFFNYVIEDHKATKREIEED-YVAKDMVDTLLHFADDPNLDVKLTSDRLMGLIHDLISGA  305

Query  1021  TESSTV  1038
             T++S  
Sbjct  306   TDTSAA  311



>ref|XP_002462453.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
 gb|EER98974.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
Length=522

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 202/285 (71%), Gaps = 12/285 (4%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGNLNLIG LPHRSIH+LS++YGP+MQL+FGS PVVVG+S E+AK+FLK  D  F D
Sbjct  41    WPIIGNLNLIGELPHRSIHELSKRYGPLMQLRFGSLPVVVGASAEIAKLFLKVNDAAFSD  100

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+   GK+  Y+ S++ WS +GPY  QARR+   E+FSAKRL+SFEHIR  E++ +L +
Sbjct  101   RPRFAVGKYTAYDCSDILWSPFGPYLRQARRICATELFSAKRLESFEHIRDEEVRVLLRQ  160

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNES-----EG-----SIVNPGEFKK  720
             L   S   + V L+DYL +L L VISR+ LGK Y+ E+     EG     +++   EF++
Sbjct  161   LRQASG--RAVRLRDYLQMLTLGVISRIVLGKKYVQEAAAGDGEGDSSAPTVITADEFRE  218

Query  721   MLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGD  900
             M+ E F L G  N+GD IPWLD LDLQGY+ + K +N + DRFLEHVLD H  RR  EG 
Sbjct  219   MVGEYFELHGVFNVGDFIPWLDCLDLQGYVARMKRMNARFDRFLEHVLDVHNERRRREGG  278

Query  901   KFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
              FV KDM+DVLLQ ADD ++EV++ R  VKA T DL+ G T+++ 
Sbjct  279   SFVPKDMLDVLLQLADDTDLEVQLSRDNVKAITQDLIVGATDTTA  323



>emb|CDP18924.1| unnamed protein product, partial [Coffea canephora]
Length=284

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 187/274 (68%), Gaps = 23/274 (8%)
 Frame = +1

Query  172  RRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMA  351
            +R KL+ PPGPKPWPIIGNLNLIG++PH+S+H LS KYG IMQL+ GS PVV+ SS EMA
Sbjct  26   KRLKLNHPPGPKPWPIIGNLNLIGSIPHQSLHLLSLKYGEIMQLKLGSSPVVIASSPEMA  85

Query  352  KIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFE  531
            K FL+T D  F  RP   AGK+ +YN S++TW+ YGP+W QAR+++  ++F+ KRLD FE
Sbjct  86   KEFLQTHDNIFASRPTTAAGKYTSYNCSDLTWAPYGPFWRQARKLYLTQIFNPKRLDFFE  145

Query  532  HIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGE  711
             IR  E ++ + +LY +S   +PV    +                    E EGS+    E
Sbjct  146  SIRIEERRAFISRLYALSG--KPVYFAQF--------------------EGEGSLPTFEE  183

Query  712  FKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVV  891
            F++M+D  +LLSG  NIGD IPWLD  DLQGY+KQ K L+KK DRF  HVLD+H +RR  
Sbjct  184  FQEMIDTWYLLSGVFNIGDWIPWLDRFDLQGYVKQMKELHKKFDRFHNHVLDDHQARRKT  243

Query  892  EGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKA  993
            E D F+ KDMVD+LLQ+A+DP+++VK+ R  +K 
Sbjct  244  ERD-FIPKDMVDILLQYAEDPDLQVKLTRDQIKG  276



>ref|XP_006381618.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
 gb|ERP59415.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
Length=510

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/320 (52%), Positives = 224/320 (70%), Gaps = 11/320 (3%)
 Frame = +1

Query  94    MEGPTWLAYAVAWLSTIAIILIAKHLR--RRKLHLPPGPKPWPIIGNLNLIGTLPHRSIH  267
             ME  + +   +AW+S  A++ + K  +  R  L LPPGPKPWPIIGN +L+G LPH+S+H
Sbjct  1     MEAFSLVVLVLAWVS--ALLYLPKFFKSLRNPLKLPPGPKPWPIIGNFDLLGPLPHQSLH  58

Query  268   DLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTW  447
              LS KYG  MQLQFGS+PV V SS+++AK  LKT D  F  RP+  AGK+ TY YS++ W
Sbjct  59    QLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  448   SQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLY-NVSSTRQPVllkdylf  624
             + YGPYW Q R+++  E+FSAKRL+S+E++R  E++    +LY N   T   + LKDYL 
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRIEEMREFTRRLYRNCGKT---IELKDYLS  175

Query  625   llnlNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDL  798
                L++ISR+ LGK Y   +ESE  IV   EF++MLDE+FLL+G LNIGD IPWLDFLD+
Sbjct  176   HYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDM  235

Query  799   QGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIER  978
             QGY+K+ K L  + DRF +HV+DEH ++R    + +  KDMVD+LLQ ADDP +EVK+ R
Sbjct  236   QGYVKRMKELKVRFDRFHDHVIDEHNAKRKATKN-WQPKDMVDLLLQLADDPELEVKLTR  294

Query  979   QGVKAFTLDLLAGGTESSTV  1038
               +K  T DL+AGGT+++  
Sbjct  295   DNIKGLTQDLIAGGTDTAAT  314



>ref|XP_002324180.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
 gb|EEF02745.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
Length=510

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 200/278 (72%), Gaps = 5/278 (2%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGN NL+G LPH+S+H LS KYG  MQL FGS+PV+V SS++MAK  LKT D  F  
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLHFGSYPVMVTSSLDMAKQILKTYDHMFAS  99

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+ TY YS++ W+ YGPYW Q R+++  E+FSAKRL+S+E++R  E++    +
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLL  744
             LY   +  + + LKDYL    L++ISR+ LGK Y   +ESE  IV+  EF++MLDE+FLL
Sbjct  160   LYR--NCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVSLEEFQEMLDELFLL  217

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMV  924
             +G LNIGD IPWLDFLDLQGY+K+ K L  + D+F +HV+DEH  RR    + +  KDMV
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKN-WQPKDMV  276

Query  925   DVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+LLQ ADDP +EVK+ R  +K  T DL+AGGT+++  
Sbjct  277   DLLLQLADDPELEVKLTRDNMKGLTQDLIAGGTDTAAT  314



>ref|XP_011035092.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 199/278 (72%), Gaps = 5/278 (2%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGN NL+G LPH+S+H LS KYG  MQL FGS+PV+V SS++MAK  LKT D  F  
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFAS  99

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+ TY YS++ W+ YGPYW Q R+++  E+FSAKRL+S+E++R  E++    +
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLL  744
             LY   +  + + LKDYL    L++ISR+ LGK Y   +ESE  IV   EF++MLDE+FLL
Sbjct  160   LYR--NCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLL  217

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMV  924
             +G LNIGD IPWLDFLDLQGY+K+ K L  + D+F +HV+DEH  RR    + +  KDMV
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKN-WQPKDMV  276

Query  925   DVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+LLQ ADDP +EVK+ R  +K  T DL+AGGT+++  
Sbjct  277   DLLLQLADDPELEVKLTRDNIKGLTQDLIAGGTDTAAT  314



>ref|XP_011015794.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 199/278 (72%), Gaps = 5/278 (2%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGN NL+G LPH+S+H LS KYG  MQL FGS+PV+V SS++MAK  LKT D  F  
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFAS  99

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+ TY YS++ W+ YGPYW Q R+++  E+FSAKRL+S+E++R  E++    +
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYL--NESEGSIVNPGEFKKMLDEVFLL  744
             LY   +  + + LKDYL    L++ISR+ LGK Y   +ESE  IV   EF++MLDE+FLL
Sbjct  160   LYR--NCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLL  217

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMV  924
             +G LNIGD IPWLDFLDLQGY+K+ K L  + D+F +HV+DEH  RR    + +  KDMV
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKN-WQPKDMV  276

Query  925   DVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             D+LLQ ADDP +EVK+ R  +K  T DL+AGGT+++  
Sbjct  277   DLLLQLADDPELEVKLTRDNIKGLTQDLIAGGTDTAAT  314



>ref|XP_009766074.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=508

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 204/296 (69%), Gaps = 8/296 (3%)
 Frame = +1

Query  151   ILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvv  330
             I+ ++ L   KL  PPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS PV+V
Sbjct  22    IITSRRLVNSKL--PPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSKPVLV  79

Query  331   gssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSA  510
              SS EMAK FLK  D NF  RP    GK+ +YNY ++TW+ YGPYW QARR++  E+F+ 
Sbjct  80    ASSAEMAKQFLKIHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNEIFTP  139

Query  511   KRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG  690
             KRLDSFE+IR  E ++++ +L +++   +P  LKD+L   +L  ++RM L   Y  E   
Sbjct  140   KRLDSFEYIRVEERQTLISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGE---  194

Query  691   SIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDE  870
             S V   + + ++D+ FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   VLD+
Sbjct  195   STVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDD  254

Query  871   HMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             H +++  E + FV KDMVDVLL+ A+DPN+EVK+    VK    DLL GGT+S T 
Sbjct  255   HRAKKNEEKN-FVPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTA  309



>ref|XP_009603956.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=312

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/280 (51%), Positives = 199/280 (71%), Gaps = 8/280 (3%)
 Frame = +1

Query  166  HLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvE  345
            H  RRK +LPPGPKPWPI GN++L+G+ PHRS+H+L+++YG +M L+FG   V++ SS +
Sbjct  24   HSPRRKQNLPPGPKPWPIAGNIHLLGSTPHRSLHELAKRYGDLMLLKFGLRNVLIASSPD  83

Query  346  MAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDS  525
            MA+ FLKT D  +  RP+  AGK+  YNY ++TW++YGP+W QARR++  E+F+ KRLDS
Sbjct  84   MAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWARYGPFWRQARRIYLNEIFNPKRLDS  143

Query  526  FEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEG--SIV  699
            FE+IR  E  +++ +L+ +S   +P+LL+D+L    L  ISR  L   Y +ES G  S+V
Sbjct  144  FEYIRIEERHNLISRLFALSG--KPILLRDHLTRYTLTSISRTVLSGKYFSESPGQRSMV  201

Query  700  NPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMS  879
               + + MLD+ FLL+G +NIGD IPWL FLDLQGY+KQ K L++  D+F   VLD+H +
Sbjct  202  TLEKLQDMLDKWFLLNGVINIGDWIPWLAFLDLQGYVKQMKELHRNFDKFHNFVLDDHKA  261

Query  880  RRVVEGDK-FVAKDMVDVLLQHADDPNMEVKIERQGVKAF  996
             R   G+K FV +DMVDVLLQ A+DPN+EVK+    VK  
Sbjct  262  NR---GEKNFVPRDMVDVLLQQAEDPNLEVKLTTDCVKGL  298



>gb|ABC69388.1| CYP92B2v2 [Nicotiana tabacum]
Length=508

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 204/299 (68%), Gaps = 9/299 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
               II   + + R+   +PPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS P
Sbjct  20    CKIITCRRPVNRK---IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRP  76

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             V+V SS EMAK FLK  D NF  RP    GK+ +YNY ++TW+ YGPYW QARR++  ++
Sbjct  77    VLVASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQI  136

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             F+ KRLDSFE+IR  E ++++ +L +++   +P  LKD+L   +L  ++RM L   Y  E
Sbjct  137   FTPKRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGE  194

Query  682   SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
                S V   + + ++D+ FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   V
Sbjct  195   ---STVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIV  251

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             LD+H +++  E + FV KDMVDVLL+ A+DPN+EVK+    VK    DLL GGT+S T 
Sbjct  252   LDDHRAKKNAEKN-FVPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTA  309



>ref|XP_009605293.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 204/299 (68%), Gaps = 9/299 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
               II   + + R+   +PPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS P
Sbjct  20    CKIITCRRPVNRK---IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRP  76

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             V+V SS EMAK FLK  D NF  RP    GK+ +YNY ++TW+ YGPYW QARR++  ++
Sbjct  77    VLVASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQI  136

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             F+ KRLDSFE+IR  E ++++ +L +++   +P  LKD+L   +L  ++RM L   Y  E
Sbjct  137   FTPKRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGE  194

Query  682   SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
                S V   + + ++D+ FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   V
Sbjct  195   ---STVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIV  251

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             LD+H +++  E + FV KDMVDVLL+ A+DPN+EVK+    VK    DLL GGT+S T 
Sbjct  252   LDDHRAKKNAEKN-FVPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTA  309



>gb|AAL66767.1| cytochrome P450 monooxygenase CYP92A1 [Zea mays subsp. mays]
 tpg|DAA40164.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/282 (55%), Positives = 202/282 (72%), Gaps = 9/282 (3%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGNLNL+G LPHRS+++LS++YGP+MQL+FGS PV+VG+SVEMAK+FLKT D  F D
Sbjct  39    WPIIGNLNLMGELPHRSMNELSKRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSD  98

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+   GK+  Y++S++ W+  GPY  QARR+   E+FSA RL+SFEHIR  E++ ML +
Sbjct  99    RPRFAIGKYTAYDFSDLLWAPSGPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQ  158

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE----SEGS---IVNPGEFKKMLD  729
             L   +   + V L+DYL +L L VISR+ LG  Y+ E     EG     + P EF++M+D
Sbjct  159   LRQAAG--RTVRLRDYLQMLALGVISRIVLGNKYVMEEVADGEGDSAPAITPAEFREMVD  216

Query  730   EVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFV  909
             E F L GA NIGD IPWLD+LDLQGY+ + K +  +  RFLE VLD H  RR+ EG  FV
Sbjct  217   EFFALHGAFNIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFV  276

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             AKDM+DVLLQ ADD ++EV++ R  VKA T DL+  GT+S+ 
Sbjct  277   AKDMLDVLLQLADDTSLEVQLSRDNVKAITQDLIIAGTDSNA  318



>ref|XP_006363444.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=506

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 205/305 (67%), Gaps = 6/305 (2%)
 Frame = +1

Query  127   AWLSTIAIIL-IAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQL  303
             +WL  +A +L +  H +R+   LPPGPKPWPIIGNLNL+G+LPH S H LS+KYG +M L
Sbjct  12    SWLLALAFVLKLFNHPKRK---LPPGPKPWPIIGNLNLLGSLPHVSFHHLSKKYGDLMLL  68

Query  304   QfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARR  483
             +FGS PV+V SS EMAK  LKT D  F  RP+  AGK+ +Y YS++TW+ YG YW QAR+
Sbjct  69    KFGSKPVLVASSPEMAKEILKTHDTIFASRPELAAGKYTSYYYSDMTWAPYGAYWRQARK  128

Query  484   MFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALG  663
             ++  E+FS KRLDSFE+IR  E ++++  L+ +S   +PVLLKD+L    L  ISR+ + 
Sbjct  129   IYLTEIFSPKRLDSFEYIRVEEGQTLISGLFPLSG--KPVLLKDHLPRFTLRTISRLVMS  186

Query  664   KSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLD  843
               Y +    SI+     ++MLDE F+L G +NIGD IPWL + DLQGY+KQ K L K   
Sbjct  187   DKYYSSHASSIITLETLQQMLDEWFILGGVINIGDWIPWLSWFDLQGYVKQMKTLGKNFK  246

Query  844   RFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGT  1023
              F ++V+++H + +    + +V KDMVD LL  ADDPN+EVK+    +     DL++GGT
Sbjct  247   EFFKYVIEDHKAIKTQIEEDYVPKDMVDTLLHLADDPNLEVKLTSDRLMGLMHDLISGGT  306

Query  1024  ESSTV  1038
             ++S  
Sbjct  307   DTSAA  311



>gb|ABC69387.1| CYP92B2v3 [Nicotiana tabacum]
Length=508

 Score =   266 bits (681),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 149/299 (50%), Positives = 203/299 (68%), Gaps = 9/299 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
               II   + + R+   +PPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS P
Sbjct  20    CKIITCRRPVNRK---IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRP  76

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEV  501
             V+V SS EMAK FLK  D NF  RP    GK+ +YNY ++TW+ YGPYW QARR++  ++
Sbjct  77    VLVASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQI  136

Query  502   FSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE  681
             F+ KRLDSFE+IR  E ++++ +L +++   +P  LKD+L   +L  ++RM L   Y  E
Sbjct  137   FTPKRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGE  194

Query  682   SEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHV  861
                S V   + + ++D+ FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   V
Sbjct  195   ---STVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIV  251

Query  862   LDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             LD+  +++  E + FV KDMVDVLL+ A+DPN+EVK+    VK    DLL GGT+S T 
Sbjct  252   LDDRRAKKNAEKN-FVPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTA  309



>gb|EYU22742.1| hypothetical protein MIMGU_mgv1a004987mg [Erythranthe guttata]
Length=501

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 207/309 (67%), Gaps = 13/309 (4%)
 Frame = +1

Query  133   LSTIAII-LIAK---HLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQ  300
             + T AII  I+K    LR+ + + PPGPKPWPIIGNLNLIG +PH+S H LS+KYG IMQ
Sbjct  9     ICTAAIIAFISKTISKLRQPRRNTPPGPKPWPIIGNLNLIGPIPHQSFHFLSRKYGEIMQ  68

Query  301   LQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQAR  480
             L+FG +PVVV SS EMAK FL+  D  F  RP   AGK+  YNYS++TW+ YGP W  AR
Sbjct  69    LKFGKYPVVVASSPEMAKQFLRVHDTVFATRPPLAAGKYTAYNYSDMTWAPYGPQWRLAR  128

Query  481   RMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMAL  660
             +++  EVFSAK+++SFEH+R  E ++++ +L +VS    PV+L+D+L    ++   RM L
Sbjct  129   KIYLSEVFSAKKIESFEHVRIEETRNLVSRLRSVSG--DPVVLRDHLMHYTVSATCRMIL  186

Query  661   GKSYLNESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKL  840
             GK Y  +SE         + MLDE FLL+GA  I D IPWL FLDLQGY+K+ K L  +L
Sbjct  187   GKKYFCDSEDDKFV--TLQDMLDEWFLLNGAFVISDWIPWLKFLDLQGYVKRMKTLYNRL  244

Query  841   DRFLEHVLDEHMSRR---VVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLL  1011
             D F  +V+D+H +R+     E +K     +VD LL+ ADDPN+EVK+ R  VK    DLL
Sbjct  245   DNFHNYVIDDHQTRQKGAAAEEEKDFT--LVDKLLKMADDPNLEVKLTRDCVKGLLQDLL  302

Query  1012  AGGTESSTV  1038
             AGGT++S  
Sbjct  303   AGGTDTSAA  311



>ref|XP_004238495.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=510

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 204/308 (66%), Gaps = 8/308 (3%)
 Frame = +1

Query  127   AWLSTIAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQ  306
             AWL  ++++ ++K     K  LPPGPKPWPIIGNLNLIG+LPH S H LSQKYG +M L+
Sbjct  12    AWL--LSLVFLSKKFNHSKRKLPPGPKPWPIIGNLNLIGSLPHVSFHHLSQKYGDLMLLK  69

Query  307   fgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRM  486
             FGS PV+V SS EMAK  LKT D  F  RP    GKH ++NYS++ W+ Y  YW QAR++
Sbjct  70    FGSKPVLVASSPEMAKEILKTHDTIFASRPSLAVGKHTSFNYSDMVWASYCAYWRQARKI  129

Query  487   FTMEVFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGK  666
             +  E+FS KRLD  E++R  E K+++  L+  + + +P+ LKD+L    L  I+R+ +  
Sbjct  130   YLTEIFSPKRLDYLEYVRIEERKTLISCLF--AHSGKPIFLKDHLPRFTLRTINRLVMSD  187

Query  667   SYL----NESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNK  834
             +Y     N+S+ SIV     + MLDE F+L G +NIGD IPWL + DLQGY+++ KAL K
Sbjct  188   NYCSDQSNDSDTSIVTLERLQWMLDEWFILGGVINIGDWIPWLSWFDLQGYVRRMKALGK  247

Query  835   KLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLA  1014
              +  F ++VLD+H ++R+ +   FV KDMVD LL  A+DPN EVK+    +     +L+A
Sbjct  248   NMTEFYKYVLDDHNAKRIQKSGDFVPKDMVDALLHLANDPNREVKLTSDRMMGLIHNLVA  307

Query  1015  GGTESSTV  1038
             GGT++S  
Sbjct  308   GGTDTSAA  315



>gb|EMT08550.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=531

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 214/304 (70%), Gaps = 14/304 (5%)
 Frame = +1

Query  121  AVAWLSTIAIILIAKHLRRRKL-------HLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  279
            A AW S +A++L+   + RR          LPPGPKPWP+IGNLNLIG LPHRSIH+LS+
Sbjct  5    AWAWASFLAVVLVVLTILRRGRGSQPQGNRLPPGPKPWPVIGNLNLIGALPHRSIHELSK  64

Query  280  KYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYG  459
            +YGP+MQL+FGSFPVVVGSS EMA+ FLKT D  F DRP+  AGKH TYNYS+V W+ Y 
Sbjct  65   QYGPLMQLRFGSFPVVVGSSAEMARFFLKTHDKVFADRPRTAAGKHTTYNYSDVLWAPYN  124

Query  460  PYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHKLYNV--SSTRQPVllkdylflln  633
             ++ +ARR+F  E+FSA RL S++HIR  E+ ++L  L      ++ + V L+ +LF   
Sbjct  125  AHFRRARRLFATELFSAARLKSYKHIRHEEVSALLRDLAAAAHGASGRAVPLRGHLFAAT  184

Query  634  lNVISRMALGKSYLNESEGSIVNPG--EFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGY  807
              +ISR+ LGK Y  +  G        +   +++E FLL+G +N+GD IPW D+LDLQGY
Sbjct  185  NGIISRVVLGKKYAEKEAGGSAAMALEDLSGLIEEFFLLNGVINVGDFIPWFDWLDLQGY  244

Query  808  IKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGV  987
            +++ K  +KK+DRFLEHVL+EH  RR V+G++FVA+DMVDVLLQ AD+PN   +++R  V
Sbjct  245  VRRMKKYSKKMDRFLEHVLEEHEERRRVKGEQFVARDMVDVLLQLADNPN---RLDRDTV  301

Query  988  KAFT  999
            KA T
Sbjct  302  KALT  305



>ref|XP_008242317.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=517

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 200/280 (71%), Gaps = 8/280 (3%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGNLNL+G LPH+S H  SQ YGPIMQ++ GS PVVV SS EMAK FLKT D  F  
Sbjct  48    WPIIGNLNLVGPLPHQSAHKWSQIYGPIMQIKLGSCPVVVASSPEMAKQFLKTHDRIFAS  107

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+  AGK+L Y Y +VT + YGPYW Q R++ T E+FS K L+SF +IR  E ++ + +
Sbjct  108   RPQTAAGKYLNYGYQSVTHAPYGPYWRQGRKILTSELFSPKSLESFRYIRVEENRTFISR  167

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSY--LNESEGSIVNPGEFKKMLDEVFLL  744
             LY +S   + V+LK +L  L L+V+ R+ LGK +  L +S+ S ++  E + M DE++LL
Sbjct  168   LYAMSG--KAVVLKQHLSRLTLSVLCRVVLGKDHFSLTKSKSSTISLKESQDMTDELYLL  225

Query  745   SGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEG-DKFVAKDM  921
             +G  NIGD IPWLD  DLQGY+K+ KAL KKLD+F E VL+EH +R+  EG ++FVAKDM
Sbjct  226   AGVANIGDWIPWLDVFDLQGYVKRMKALQKKLDQFYEFVLNEHKARK--EGVEEFVAKDM  283

Query  922   VDVLLQHADDPN-MEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VD+LLQ  DDPN +EVK+    VKAFT DL+ GG+++S  
Sbjct  284   VDLLLQQVDDPNDLEVKLTYDTVKAFTQDLVIGGSDNSAT  323



>ref|NP_001151053.1| cytochrome P450 12 [Zea mays]
 gb|ACG41431.1| flavonoid 3-monooxygenase [Zea mays]
Length=517

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/282 (55%), Positives = 199/282 (71%), Gaps = 9/282 (3%)
 Frame = +1

Query  211   WPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKTMDINFVD  390
             WPIIGNLNL+G LPHRS+++LS++YGP+MQL FGS PVVVG+S EMAK+FLKT D  F D
Sbjct  39    WPIIGNLNLMGELPHRSMNELSKRYGPLMQLWFGSLPVVVGASAEMAKLFLKTNDAAFSD  98

Query  391   RPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHELKSMLHK  570
             RP+   GK+  Y+ S + W+ + PY  QARR+   E+FSA RL+SFEHIR  E++ ML +
Sbjct  99    RPRFAVGKYTAYDCSGLLWAPFEPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQ  158

Query  571   LYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNE----SEGS---IVNPGEFKKMLD  729
             L   +   + V L+DYL +L L VISR+ LGK Y+ E     EG     + P EF++M+D
Sbjct  159   LRQAAG--RTVRLRDYLQMLALGVISRIVLGKKYVMEEAADGEGDSAPAITPAEFREMVD  216

Query  730   EVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFV  909
             E F L GA NIGD IPWLD+LDLQGY+ + K +  +  RFLE VLD H  RR+ EG  FV
Sbjct  217   EFFALHGAFNIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFV  276

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESST  1035
             AKDM+DVLLQ ADD ++EV++ R  VKA T DL+  GT+S+ 
Sbjct  277   AKDMLDVLLQLADDTSLEVQLSRDNVKAITQDLIIAGTDSNA  318



>gb|ABC69386.1| CYP92B2v1 [Nicotiana tabacum]
Length=509

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 204/300 (68%), Gaps = 10/300 (3%)
 Frame = +1

Query  142   IAIILIAKHLRRRKLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfp  321
               II   + + R+   +PPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS P
Sbjct  20    CKIITCRRPVNRK---IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRP  76

Query  322   vvvgssvEMAKIFLKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQA-RRMFTME  498
             V+V SS EMAK FLK  D NF  RP    GK+ +YNY ++TW+ YGPYW QA RR++  +
Sbjct  77    VLVASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRRIYLNQ  136

Query  499   VFSAKRLDSFEHIRTHELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLN  678
             +F+ KRLDSFE+IR  E ++++ +L +++   +P  LKD+L   +L  ++RM L   Y  
Sbjct  137   IFTPKRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFG  194

Query  679   ESEGSIVNPGEFKKMLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEH  858
             E   S V   + + ++D+ FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   
Sbjct  195   E---STVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNI  251

Query  859   VLDEHMSRRVVEGDKFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
             VLD+H +++  E + FV KDMVDVLL+ A+DPN+EVK+    VK    DLL GGT+S T 
Sbjct  252   VLDDHRAKKNAEKN-FVPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTA  310



>ref|XP_004250647.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum lycopersicum]
Length=501

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 147/283 (52%), Positives = 194/283 (69%), Gaps = 9/283 (3%)
 Frame = +1

Query  190   LPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIFLKT  369
             LPPGPKPWPIIGNLNL+G +PH+S   LS+KYG +M L+FGS PV+V SS EMAK FLK 
Sbjct  30    LPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFLKI  89

Query  370   MDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIRTHE  549
              D NF  RP    GK+ +YNY ++TW+ YGPYW QARR++  E+F+ KRL+SFE+IR  E
Sbjct  90    HDANFASRPLLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNEIFTPKRLESFEYIRVEE  149

Query  550   LKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKKMLD  729
              ++ + +L +++   +   LKD+L   +L  ++RM L   Y  E   S V   + + ++D
Sbjct  150   RQTFISQLNSLAG--KTFFLKDHLSRFSLCSMTRMVLSNKYFGE---STVRVEDLQHLVD  204

Query  730   EVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGDKFV  909
             + FLL+GA NIGD IPWL FLDLQGY+KQ KAL +  D+F   VLD+H +++    + FV
Sbjct  205   QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAKK----NAFV  260

Query  910   AKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
              KDMVDVLLQ A DPN+EVK+    VK    DLL GGT+S T 
Sbjct  261   PKDMVDVLLQMAQDPNLEVKLTDDCVKGLMQDLLTGGTDSLTA  303



>ref|XP_006350345.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=502

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 204/286 (71%), Gaps = 10/286 (3%)
 Frame = +1

Query  181   KLHLPPGPKPWPIIGNLNLIGTLPHRSIHDLSQKYGPIMQLQfgsfpvvvgssvEMAKIF  360
             K ++PPGP+PWPIIGNLNLIG+LPH S+H+LSQKYG +M L+FGS PV++ SS EMAK  
Sbjct  32    KRNVPPGPRPWPIIGNLNLIGSLPHESLHNLSQKYGDLMLLKFGSKPVLIASSPEMAKEI  91

Query  361   LKTMDINFVDRPKNVAGKHLTYNYSNVTWSQYGPYWHQARRMFTMEVFSAKRLDSFEHIR  540
             LKT D  F  RP   AGK++++NYS+V+W+ YG +W Q+R+++  E+FS KRL+SFE+IR
Sbjct  92    LKTHDAIFSSRPALTAGKYISFNYSDVSWAPYGAHWRQSRKIYQTEIFSPKRLESFEYIR  151

Query  541   THELKSMLHKLYNVSSTRQPVllkdylfllnlNVISRMALGKSYLNESEGSIVNPGEFKK  720
               E ++++ +L+ +S  +  + L+ +L    L++ISRM +  +Y    + SI N    + 
Sbjct  152   VEERRNLISRLHVLSGKK--IFLRHHLTEFTLSIISRMVMSGTY--HRDESIEN---LQG  204

Query  721   MLDEVFLLSGALNIGDLIPWLDFLDLQGYIKQTKALNKKLDRFLEHVLDEHMSRRVVEGD  900
             MLDE F+L G +NIGD IPWL++LDLQGYIK+ KAL+KKL  F ++VL++H ++     +
Sbjct  205   MLDEWFILGGVINIGDWIPWLNWLDLQGYIKRMKALDKKLREFFKYVLEDHKAK---GKE  261

Query  901   KFVAKDMVDVLLQHADDPNMEVKIERQGVKAFTLDLLAGGTESSTV  1038
                 KDMVDVLLQ  DDPN+EVKI    +    LDLLAGGT++S  
Sbjct  262   DSAPKDMVDVLLQLVDDPNLEVKITTDNLMGLILDLLAGGTDTSAT  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2364220596864