BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25746_g1_i6 len=1897 path=[6596:0-356 1858:357-381 1883:382-433
1935:434-471 1973:472-496 1998:497-502 2004:503-527 19220:528-539
17036:540-550 19237:551-591 19278:592-594 16784:595-595
14617:596-631 19308:632-652 14672:653-661 14681:662-666
14686:667-705 19421:706-706 10595:707-707 5447:708-725 19431:726-739
19445:740-749 15881:750-855 19543:856-862 19550:863-880
19568:881-885 19573:886-891 19579:892-900 19588:901-910 5650:911-922
5662:923-960 19700:961-961 19622:962-976 19637:977-981 19642:982-998
19659:999-1011 19672:1012-1038 14151:1039-1039 14152:1040-1067
19714:1068-1104 19749:1105-1128 19773:1129-1136 8106:1137-1139
8109:1140-1179 2681:1180-1186 2688:1187-1192 19874:1193-1210
19892:1211-1219 19901:1220-1233 2735:1234-1264 19947:1265-1274
19957:1275-1276 19959:1277-1301 19984:1302-1311 20032:1312-1312
20033:1313-1327 5965:1328-1355 5993:1356-1375 3851:1376-1411
20110:1412-1421 20120:1422-1435 9598:1436-1460 9623:1461-1474
3950:1475-1508 3984:1509-1669 4145:1670-1670 3172:1671-1675
20292:1676-1695 3426:1696-1896]

Length=1897
                                                                      Score     E

ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               853   0.0      
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               837   0.0      
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               836   0.0      
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               830   0.0      Vitis vinifera
gb|ABG74350.1|  cytochrome P450                                         820   0.0      Capsicum chinense [bonnet pepper]
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      819   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               818   0.0      
gb|ABC69383.1|  CYP92A2v4                                               818   0.0      Nicotiana tabacum [American tobacco]
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             818   0.0      
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               816   0.0      
gb|ABC69381.1|  CYP92A2v2                                               816   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69382.1|  CYP92A2v2                                               816   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               808   0.0      
emb|CAN77776.1|  hypothetical protein VITISV_021888                     804   0.0      Vitis vinifera
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             804   0.0      
ref|XP_009771564.1|  PREDICTED: flavonoid 3'-monooxygenase-like         803   0.0      
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               801   0.0      
gb|AED99875.1|  cytochrome P450                                         801   0.0      
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               798   0.0      
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   798   0.0      
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               797   0.0      
emb|CAA65580.1|  cytochrome P450                                        795   0.0      Nicotiana tabacum [American tobacco]
gb|ADC34701.1|  flavonoid 3' hydroxylase                                795   0.0      
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                792   0.0      
gb|KHG15722.1|  Cytochrome P450                                         790   0.0      
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             789   0.0      
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               789   0.0      
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          788   0.0      Sorghum bicolor [broomcorn]
emb|CAA64635.1|  cytochrome P450                                        788   0.0      Nicotiana tabacum [American tobacco]
ref|XP_010086796.1|  Cytochrome P450 71A1                               785   0.0      
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          785   0.0      Zea mays [maize]
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               785   0.0      
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         784   0.0      
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               784   0.0      
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               783   0.0      
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               781   0.0      
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          781   0.0      Sorghum bicolor [broomcorn]
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               778   0.0      
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               777   0.0      
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  777   0.0      Ricinus communis
ref|NP_001063285.1|  Os09g0441400                                       776   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AGT17103.1|  flavonoid 3-monooxygenase                               776   0.0      
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               775   0.0      
gb|EAZ09259.1|  hypothetical protein OsI_31532                          775   0.0      Oryza sativa Indica Group [Indian rice]
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         775   0.0      
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               774   0.0      
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               774   0.0      
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             772   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               771   0.0      
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               770   0.0      
gb|ADO16185.1|  cytochrome P450 mono-oxygenase                          769   0.0      
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         770   0.0      
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         768   0.0      
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               766   0.0      
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               765   0.0      
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                765   0.0      
gb|ABA01477.1|  cytochrome P450 DDWF1                                   764   0.0      Gossypium hirsutum [American cotton]
emb|CBI35858.3|  unnamed protein product                                763   0.0      
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    761   0.0      
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             760   0.0      
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    760   0.0      
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    759   0.0      
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        756   0.0      
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         755   0.0      
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    755   0.0      
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             755   0.0      
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               754   0.0      
gb|AJD25214.1|  cytochrome P450 CYP92A73                                753   0.0      
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              753   0.0      
emb|CDP17539.1|  unnamed protein product                                754   0.0      
gb|AFK47419.1|  unknown                                                 753   0.0      
gb|AER39774.1|  CYP92A44-4                                              753   0.0      
gb|AER39773.1|  CYP92A44-3                                              751   0.0      
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         750   0.0      
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               750   0.0      
emb|CDP12827.1|  unnamed protein product                                748   0.0      
emb|CCP37679.1|  cytochrome P450                                        746   0.0      
gb|AER39771.1|  CYP92A44-1                                              745   0.0      
gb|AER39772.1|  CYP92A44-2                                              743   0.0      
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         741   0.0      
ref|XP_004148565.1|  PREDICTED: flavonoid 3'-monooxygenase-like         741   0.0      
gb|AGV54723.1|  flavonoid 3'-monooxygenase-like protein                 739   0.0      
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         739   0.0      
ref|XP_010685305.1|  PREDICTED: cytochrome P450 71A1-like               736   0.0      
gb|EMS57898.1|  Flavonoid 3'-monooxygenase                              736   0.0      
ref|XP_006426678.1|  hypothetical protein CICLE_v10025392mg             735   0.0      
gb|EAZ09260.1|  hypothetical protein OsI_31533                          735   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            734   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AET01782.2|  cytochrome P450 family protein                          733   0.0      
emb|CDP17013.1|  unnamed protein product                                731   0.0      
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              729   0.0      
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             728   0.0      
ref|XP_006465907.1|  PREDICTED: cytochrome P450 71A1-like               728   0.0      
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   725   0.0      
gb|AAG44132.1|AF218296_1  cytochrome P450                               722   0.0      Pisum sativum [garden pea]
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         720   0.0      
ref|XP_010239382.1|  PREDICTED: cytochrome P450 71A1-like               719   0.0      
emb|CDP21484.1|  unnamed protein product                                716   0.0      
gb|KHF98584.1|  Cytochrome P450                                         716   0.0      
gb|EMT01785.1|  Flavonoid 3'-monooxygenase                              715   0.0      
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        716   0.0      
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   712   0.0      
dbj|BAJ96250.1|  predicted protein                                      711   0.0      
ref|NP_001063284.1|  Os09g0441100                                       709   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         708   0.0      
ref|XP_003627307.1|  Flavonoid 3',5'-hydroxylase                        705   0.0      
ref|XP_011036445.1|  PREDICTED: flavonoid 3'-monooxygenase-like         702   0.0      
gb|EAZ09261.1|  hypothetical protein OsI_31534                          699   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006427726.1|  hypothetical protein CICLE_v10025388mg             698   0.0      
dbj|BAD36163.1|  putative elicitor-inducible cytochrome P450            697   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303387.2|  hypothetical protein POPTR_0003s06510g             696   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006494828.1|  PREDICTED: cytochrome P450 71A1-like               696   0.0      
ref|XP_011036443.1|  PREDICTED: flavonoid 3'-monooxygenase-like         692   0.0      
ref|XP_011039208.1|  PREDICTED: cytochrome P450 71A1-like               691   0.0      
ref|XP_008784472.1|  PREDICTED: cytochrome P450 71A2-like               701   0.0      
ref|XP_007012628.1|  Cytochrome P450 superfamily protein isoform 1      690   0.0      
emb|CDP21888.1|  unnamed protein product                                686   0.0      
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               687   0.0      
ref|XP_002278462.1|  PREDICTED: flavonoid 3'-monooxygenase              686   0.0      Vitis vinifera
emb|CAN82000.1|  hypothetical protein VITISV_023195                     685   0.0      Vitis vinifera
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               684   0.0      
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             683   0.0      
ref|XP_002462454.1|  hypothetical protein SORBIDRAFT_02g025830          682   0.0      Sorghum bicolor [broomcorn]
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               680   0.0      
ref|XP_002277926.2|  PREDICTED: flavonoid 3'-monooxygenase              680   0.0      Vitis vinifera
gb|EAZ07221.1|  hypothetical protein OsI_29466                          676   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007012629.1|  Cytochrome P450 superfamily protein isoform 2      676   0.0      
ref|XP_006475100.1|  PREDICTED: flavonoid 3'-monooxygenase-like         674   0.0      
ref|XP_004956936.1|  PREDICTED: flavonoid 3'-monooxygenase-like         672   0.0      
ref|NP_001061964.2|  Os08g0456200                                       669   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006369134.1|  hypothetical protein POPTR_0001s16790g             668   0.0      
ref|NP_001062713.1|  Os09g0264400                                       667   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035731.1|  PREDICTED: cytochrome P450 71A1-like               666   0.0      
ref|XP_002516018.1|  flavonoid 3-hydroxylase, putative                  666   0.0      Ricinus communis
ref|XP_002277972.1|  PREDICTED: flavonoid 3'-monooxygenase-like         665   0.0      Vitis vinifera
ref|XP_002310738.2|  hypothetical protein POPTR_0007s11380g             660   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007203722.1|  hypothetical protein PRUPE_ppa019048mg             661   0.0      
ref|XP_009359731.1|  PREDICTED: flavonoid 3'-monooxygenase-like         661   0.0      
ref|XP_010064025.1|  PREDICTED: flavonoid 3'-monooxygenase-like         661   0.0      
ref|XP_008337887.1|  PREDICTED: flavonoid 3'-monooxygenase-like         660   0.0      
gb|AGT17101.1|  flavonoid 3-monooxygenase                               658   0.0      
ref|XP_011046010.1|  PREDICTED: flavonoid 3'-monooxygenase-like         655   0.0      
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  652   0.0      Ricinus communis
gb|EMT12610.1|  Flavonoid 3'-monooxygenase                              652   0.0      
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               653   0.0      
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         650   0.0      
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             650   0.0      
gb|KGN58498.1|  hypothetical protein Csa_3G651820                       644   0.0      
gb|KCW71321.1|  hypothetical protein EUGRSUZ_F04403                     647   0.0      
ref|XP_008242247.1|  PREDICTED: flavonoid 3'-monooxygenase-like         643   0.0      
gb|EMT12612.1|  Flavonoid 3'-monooxygenase                              642   0.0      
ref|XP_008678485.1|  PREDICTED: flavonoid 3'-monooxygenase-like         642   0.0      
gb|AFW61881.1|  putative cytochrome P450 superfamily protein            641   0.0      
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         638   0.0      
gb|AGI98132.1|  cytochrome P450                                         636   0.0      
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             636   0.0      
ref|XP_002324180.2|  hypothetical protein POPTR_0018s05370g             635   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008242249.1|  PREDICTED: flavonoid 3'-monooxygenase-like         634   0.0      
ref|XP_002445595.1|  hypothetical protein SORBIDRAFT_07g022320          635   0.0      Sorghum bicolor [broomcorn]
ref|XP_007204846.1|  hypothetical protein PRUPE_ppa026438mg             634   0.0      
ref|XP_007203042.1|  hypothetical protein PRUPE_ppa022777mg             634   0.0      
ref|XP_011035092.1|  PREDICTED: flavonoid 3'-monooxygenase-like         634   0.0      
gb|AGI98131.1|  cytochrome P450 CYP92                                   631   0.0      
ref|XP_008242245.1|  PREDICTED: flavonoid 3'-monooxygenase-like         630   0.0      
ref|XP_004984305.1|  PREDICTED: cytochrome P450 71A1-like               631   0.0      
ref|XP_006381618.1|  hypothetical protein POPTR_0006s14370g             630   0.0      
ref|XP_011015794.1|  PREDICTED: flavonoid 3'-monooxygenase-like         629   0.0      
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             629   0.0      
ref|XP_006493374.1|  PREDICTED: cytochrome P450 71A1-like               628   0.0      
ref|NP_001148045.1|  flavonoid 3-monooxygenase                          627   0.0      Zea mays [maize]
gb|ACF84248.1|  unknown                                                 627   0.0      Zea mays [maize]
ref|XP_002444467.1|  hypothetical protein SORBIDRAFT_07g022300          626   0.0      Sorghum bicolor [broomcorn]
ref|XP_009337219.1|  PREDICTED: flavonoid 3'-monooxygenase-like         625   0.0      
gb|AGI97940.1|  flavonoid 3'-monooxygenase-like protein                 624   0.0      
gb|EAZ44883.1|  hypothetical protein OsJ_29523                          623   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956935.1|  PREDICTED: flavonoid 3'-monooxygenase-like         624   0.0      
gb|KCW71322.1|  hypothetical protein EUGRSUZ_F04404                     622   0.0      
ref|XP_007202994.1|  hypothetical protein PRUPE_ppa019215mg             620   0.0      
gb|EAY85957.1|  hypothetical protein OsI_07321                          620   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT17908.1|  Flavonoid 3'-monooxygenase                              614   0.0      
dbj|BAD23209.1|  putative cytochrome P450 monooxygenase                 617   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407098.1|  PREDICTED: cytochrome P450 71A1-like               616   0.0      
ref|XP_011095827.1|  PREDICTED: flavonoid 3'-monooxygenase-like         611   0.0      
ref|XP_004288987.1|  PREDICTED: flavonoid 3'-monooxygenase-like         611   0.0      
ref|XP_004288988.1|  PREDICTED: flavonoid 3'-monooxygenase-like         611   0.0      
ref|XP_004984304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         609   0.0      
ref|XP_002467824.1|  hypothetical protein SORBIDRAFT_01g034710          607   0.0      Sorghum bicolor [broomcorn]
ref|XP_006493375.1|  PREDICTED: cytochrome P450 71A1-like               605   0.0      
ref|XP_008354562.1|  PREDICTED: flavonoid 3'-monooxygenase-like         604   0.0      
ref|XP_006427648.1|  hypothetical protein CICLE_v10025417mg             603   0.0      
ref|XP_009413943.1|  PREDICTED: cytochrome P450 71A1-like               601   0.0      
ref|XP_010090165.1|  Flavonoid 3'-monooxygenase                         600   0.0      
ref|XP_009388239.1|  PREDICTED: flavonoid 3'-monooxygenase-like         600   0.0      
ref|XP_002467827.1|  hypothetical protein SORBIDRAFT_01g034740          598   0.0      Sorghum bicolor [broomcorn]
ref|XP_002467826.1|  hypothetical protein SORBIDRAFT_01g034730          598   0.0      Sorghum bicolor [broomcorn]
ref|XP_002462453.1|  hypothetical protein SORBIDRAFT_02g025820          596   0.0      Sorghum bicolor [broomcorn]
emb|CDP21012.1|  unnamed protein product                                595   0.0      
dbj|BAK04187.1|  predicted protein                                      595   0.0      
ref|XP_008388825.1|  PREDICTED: flavonoid 3'-monooxygenase-like         593   0.0      
ref|XP_008344040.1|  PREDICTED: flavonoid 3'-monooxygenase-like         592   0.0      
gb|AAL66767.1|  cytochrome P450 monooxygenase CYP92A1                   592   0.0      Zea mays [maize]
ref|NP_001151318.1|  flavonoid 3-monooxygenase                          589   0.0      Zea mays [maize]
emb|CDP18923.1|  unnamed protein product                                587   0.0      
ref|NP_001151053.1|  cytochrome P450 12                                 588   0.0      Zea mays [maize]
ref|XP_008354460.1|  PREDICTED: flavonoid 3'-monooxygenase-like         588   0.0      
gb|KDP33920.1|  hypothetical protein JCGZ_07491                         585   0.0      
ref|XP_006493372.1|  PREDICTED: cytochrome P450 71A1-like               587   0.0      
ref|XP_011095838.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    586   0.0      
gb|ABK24537.1|  unknown                                                 586   0.0      Picea sitchensis
gb|ABC69418.1|  CYP92B3                                                 583   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009766074.1|  PREDICTED: flavonoid 3'-monooxygenase-like         582   0.0      
ref|XP_011095822.1|  PREDICTED: flavonoid 3'-monooxygenase-like         582   0.0      
ref|XP_004250647.1|  PREDICTED: flavonoid 3'-monooxygenase-like         581   0.0      
gb|EMT08550.1|  Flavonoid 3'-monooxygenase                              582   0.0      
gb|ACN27918.1|  unknown                                                 579   0.0      Zea mays [maize]
ref|XP_002459381.1|  hypothetical protein SORBIDRAFT_02g003780          585   0.0      Sorghum bicolor [broomcorn]
ref|XP_006452810.1|  hypothetical protein CICLE_v10008392mg             575   0.0      
gb|KDO46294.1|  hypothetical protein CISIN_1g015436mg                   574   0.0      
ref|XP_006477116.1|  PREDICTED: flavonoid 3'-monooxygenase-like         577   0.0      
gb|ABC69388.1|  CYP92B2v2                                               575   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006492022.1|  PREDICTED: flavonoid 3'-monooxygenase-like         576   0.0      
ref|XP_009605293.1|  PREDICTED: flavonoid 3'-monooxygenase-like         575   0.0      
gb|ABC69387.1|  CYP92B2v3                                               574   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006363444.1|  PREDICTED: cytochrome P450 71A1-like               573   0.0      
ref|NP_001151273.1|  flavonoid 3-monooxygenase                          573   0.0      Zea mays [maize]
ref|XP_006465159.1|  PREDICTED: flavonoid 3'-monooxygenase-like         574   0.0      
ref|XP_006355423.1|  PREDICTED: flavonoid 3'-monooxygenase-like         572   0.0      
ref|XP_008242317.1|  PREDICTED: flavonoid 3'-monooxygenase-like         572   0.0      
gb|ABC69386.1|  CYP92B2v1                                               572   0.0      Nicotiana tabacum [American tobacco]
tpg|DAA40165.1|  TPA: putative cytochrome P450 superfamily protein      573   0.0      
ref|XP_006477121.1|  PREDICTED: flavonoid 3'-monooxygenase-like         572   0.0      
ref|XP_003581159.2|  PREDICTED: flavonoid 3'-monooxygenase-like         573   0.0      
emb|CAN82001.1|  hypothetical protein VITISV_023196                     565   0.0      Vitis vinifera
ref|XP_011070722.1|  PREDICTED: flavonoid 3'-monooxygenase-like         568   0.0      
emb|CDP20032.1|  unnamed protein product                                568   0.0      
ref|XP_004237819.1|  PREDICTED: cytochrome P450 71A1-like               568   0.0      
ref|XP_002467849.1|  hypothetical protein SORBIDRAFT_01g035150          568   0.0      Sorghum bicolor [broomcorn]
ref|XP_006648650.1|  PREDICTED: flavonoid 3'-monooxygenase-like         567   0.0      
ref|XP_004238495.1|  PREDICTED: cytochrome P450 71A1-like               566   0.0      
ref|XP_006363443.1|  PREDICTED: cytochrome P450 71A1-like               566   0.0      
ref|XP_007201979.1|  hypothetical protein PRUPE_ppa004832mg             565   0.0      
ref|XP_009591954.1|  PREDICTED: cytochrome P450 71A1-like               561   0.0      
emb|CAN82002.1|  hypothetical protein VITISV_023197                     558   0.0      Vitis vinifera
ref|XP_009626729.1|  PREDICTED: flavonoid 3'-monooxygenase-like         556   0.0      
ref|XP_004237820.1|  PREDICTED: cytochrome P450 71A1-like               556   0.0      
ref|NP_001146066.1|  uncharacterized protein LOC100279597               557   0.0      Zea mays [maize]
ref|XP_006367943.1|  PREDICTED: cytochrome P450 71A1-like               555   0.0      
ref|XP_006350345.1|  PREDICTED: cytochrome P450 71A1-like               555   0.0      
ref|XP_006363445.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    553   0.0      
ref|XP_010320112.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    553   0.0      
ref|XP_006492016.1|  PREDICTED: cytochrome P450 71A1-like               551   0.0      
ref|XP_006427734.1|  hypothetical protein CICLE_v10025408mg             550   0.0      
ref|XP_006340220.1|  PREDICTED: cytochrome P450 71A1-like               548   0.0      
ref|XP_004237821.1|  PREDICTED: cytochrome P450 71A1-like               547   0.0      
ref|NP_001152903.1|  uncharacterized protein LOC100273153               545   0.0      Zea mays [maize]
gb|EYU22742.1|  hypothetical protein MIMGU_mgv1a004987mg                545   0.0      
ref|XP_004148586.1|  PREDICTED: cytochrome P450 71A1-like               539   0.0      
ref|XP_008344136.1|  PREDICTED: flavonoid 3'-monooxygenase-like         543   0.0      
gb|AJD25216.1|  cytochrome P450 CYP92B29                                543   0.0      
gb|KHN39623.1|  Flavonoid 3',5'-hydroxylase                             536   0.0      
ref|XP_006359061.1|  PREDICTED: cytochrome P450 71A1-like               540   0.0      
ref|XP_007202840.1|  hypothetical protein PRUPE_ppa014596mg             539   0.0      
gb|ADD84653.1|  CYP92A46                                                539   0.0      Scoparia dulcis [escobilla]
gb|KDO38954.1|  hypothetical protein CISIN_1g048184mg                   535   0.0      
ref|XP_009337217.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    535   0.0      
ref|XP_004955502.1|  PREDICTED: flavonoid 3'-monooxygenase-like         533   5e-180   
ref|XP_004955501.1|  PREDICTED: flavonoid 3'-monooxygenase-like         533   1e-179   
gb|EMT33409.1|  Flavonoid 3'-monooxygenase                              526   1e-178   
gb|KDO40461.1|  hypothetical protein CISIN_1g048667mg                   526   1e-178   
ref|XP_002443882.1|  hypothetical protein SORBIDRAFT_07g003720          520   9e-175   Sorghum bicolor [broomcorn]
ref|XP_008670125.1|  PREDICTED: flavonoid 3'-monooxygenase-like         516   3e-174   
ref|XP_006427731.1|  hypothetical protein CICLE_v10025335mg             517   9e-174   
gb|AFW57306.1|  putative cytochrome P450 superfamily protein            516   4e-173   
emb|CDP20453.1|  unnamed protein product                                507   3e-171   
gb|ADD84652.1|  CYP92A45                                                509   5e-171   Scoparia dulcis [escobilla]
gb|EMT01786.1|  Flavonoid 3',5'-hydroxylase 1                           505   2e-170   
tpg|DAA42609.1|  TPA: putative cytochrome P450 superfamily protein      506   1e-168   
ref|XP_003561409.2|  PREDICTED: flavonoid 3'-monooxygenase-like         503   5e-168   
emb|CDP12826.1|  unnamed protein product                                494   5e-167   
gb|KGN58437.1|  Flavonoid 3-hydroxylase                                 491   6e-167   
ref|XP_008652034.1|  PREDICTED: flavonoid 3'-monooxygenase-like         499   1e-166   
gb|AGT17102.1|  flavonoid 3-monooxygenase                               492   1e-166   
gb|AJD25215.1|  cytochrome P450 CYP92B28                                497   3e-166   
ref|XP_002461490.1|  hypothetical protein SORBIDRAFT_02g003470          497   7e-166   
ref|XP_002461489.1|  hypothetical protein SORBIDRAFT_02g003460          494   6e-165   
emb|CDP21011.1|  unnamed protein product                                491   7e-165   
gb|ACG28049.1|  cytochrome P450 CYP92C5                                 493   3e-164   
ref|XP_004962701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         491   1e-163   
tpg|DAA45474.1|  TPA: putative cytochrome P450 superfamily protein      489   2e-163   
dbj|BAJ97422.1|  predicted protein                                      478   9e-162   
gb|EAZ09257.1|  hypothetical protein OsI_31530                          481   1e-159   
gb|ABD65478.1|  cytochrome P450                                         471   2e-159   
ref|NP_001146388.1|  uncharacterized protein LOC100279968               478   3e-159   
ref|XP_002442357.1|  hypothetical protein SORBIDRAFT_08g018780          479   1e-158   
emb|CDP20028.1|  unnamed protein product                                474   2e-158   
gb|EMT33578.1|  hypothetical protein F775_52187                         475   4e-158   
ref|XP_010041658.1|  PREDICTED: flavonoid 3'-monooxygenase-like         471   6e-158   
emb|CDP00858.1|  unnamed protein product                                471   2e-156   
gb|EEC84207.1|  hypothetical protein OsI_30611                          467   4e-156   
ref|XP_004962700.1|  PREDICTED: flavonoid 3'-monooxygenase-like         469   3e-155   
ref|NP_001050784.2|  Os03g0650200                                       462   4e-152   
gb|AAX95529.1|  Putative cytochrome P450                                461   8e-152   
emb|CDO97842.1|  unnamed protein product                                450   3e-151   
ref|XP_004238498.1|  PREDICTED: cytochrome P450 71A2-like isoform X2    456   4e-151   
emb|CBI27805.3|  unnamed protein product                                447   3e-148   
emb|CDP17538.1|  unnamed protein product                                441   4e-147   
ref|XP_006363446.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    438   4e-144   
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                439   1e-143   
gb|ABR18406.1|  unknown                                                 438   4e-143   
gb|ABR18060.1|  unknown                                                 438   5e-143   
gb|AGO59346.1|  hypothetical protein OB_ABa0085D15.11                   438   6e-143   
ref|XP_010911364.1|  PREDICTED: cytochrome P450 750A1-like              429   2e-142   
ref|XP_002277107.2|  PREDICTED: cytochrome P450 93A3                    435   1e-141   
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   432   9e-141   
gb|ABR16821.1|  unknown                                                 432   1e-140   
gb|ABV80343.1|  cytochrome P450-dependent monooxygenase                 431   4e-140   
ref|XP_002988182.1|  hypothetical protein SELMODRAFT_70547              429   6e-140   
ref|XP_002980509.1|  hypothetical protein SELMODRAFT_113134             430   6e-140   
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               430   6e-140   
ref|XP_002963471.1|  hypothetical protein SELMODRAFT_166299             429   1e-139   
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                428   2e-139   
ref|XP_010917480.1|  PREDICTED: cytochrome P450 750A1-like              421   3e-139   
ref|XP_006850107.1|  hypothetical protein AMTR_s00022p00225170          428   3e-139   
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       427   4e-139   
ref|XP_002984650.1|  hypothetical protein SELMODRAFT_120910             427   4e-139   
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                427   6e-139   
gb|KGN58496.1|  hypothetical protein Csa_3G651800                       419   1e-138   
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               426   2e-138   
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                426   3e-138   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             425   3e-138   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          425   3e-138   
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                425   4e-138   
ref|XP_007048087.1|  Cytochrome P450                                    425   4e-138   
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                425   5e-138   
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                425   5e-138   
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      424   8e-138   
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    423   2e-137   
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            422   3e-137   
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              422   5e-137   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         421   8e-137   
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              422   8e-137   
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             422   8e-137   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               421   1e-136   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              421   1e-136   
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                421   2e-136   
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              421   2e-136   
emb|CDX69984.1|  BnaA10g23330D                                          421   2e-136   
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                421   2e-136   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          420   2e-136   
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      421   2e-136   
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                421   2e-136   
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                419   2e-136   
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                420   3e-136   
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    420   4e-136   
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                420   4e-136   
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                420   5e-136   
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               420   5e-136   
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                419   5e-136   
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             419   6e-136   
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                419   7e-136   
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              419   8e-136   
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                419   8e-136   
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         419   8e-136   
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          419   9e-136   
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                419   1e-135   
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                418   1e-135   
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                419   1e-135   
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              419   1e-135   
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               419   1e-135   
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                418   2e-135   
gb|KDO65006.1|  hypothetical protein CISIN_1g0386481mg                  409   2e-135   
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               418   2e-135   
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             418   2e-135   
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                418   2e-135   
ref|XP_002310015.1|  cytochrome P450 family protein                     417   2e-135   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          417   2e-135   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               418   3e-135   
gb|AJD25177.1|  cytochrome P450 CYP75B79                                418   3e-135   
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            417   4e-135   
gb|ACN38268.1|  flavonoid 3' hydroxylase                                417   4e-135   
ref|XP_008792895.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    409   4e-135   
emb|CDP19008.1|  unnamed protein product                                417   4e-135   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          417   6e-135   
ref|XP_002310014.1|  cytochrome P450 family protein                     416   6e-135   
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         417   6e-135   
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             417   6e-135   
emb|CDP19009.1|  unnamed protein product                                417   6e-135   
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      417   6e-135   
gb|ABK23613.1|  unknown                                                 411   6e-135   
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        417   7e-135   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  416   8e-135   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             416   9e-135   
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              417   9e-135   
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           416   9e-135   
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             416   1e-134   
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                416   2e-134   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    415   2e-134   
ref|XP_006850110.1|  hypothetical protein AMTR_s00022p00225440          415   2e-134   
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                415   3e-134   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             415   3e-134   
gb|ACF85239.1|  unknown                                                 412   3e-134   
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               415   3e-134   
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             415   4e-134   
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               415   4e-134   
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            414   4e-134   
ref|XP_002310007.2|  cytochrome P450 family protein                     414   5e-134   
gb|KDP24589.1|  hypothetical protein JCGZ_25505                         415   5e-134   
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      414   6e-134   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               414   6e-134   
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            414   6e-134   
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             415   6e-134   
emb|CAN68303.1|  hypothetical protein VITISV_041731                     414   7e-134   
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                414   7e-134   
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             414   7e-134   
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             414   9e-134   
gb|ACO35755.1|  chalcone 3-hydroxylase                                  414   1e-133   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          413   1e-133   
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                414   1e-133   
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         413   2e-133   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          413   2e-133   
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            413   2e-133   
ref|XP_010928984.1|  PREDICTED: cytochrome P450 93A3                    413   2e-133   
ref|XP_010099912.1|  Cytochrome P450 71A1                               412   2e-133   
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            412   3e-133   
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                412   3e-133   
ref|XP_008783087.1|  PREDICTED: cytochrome P450 93A3                    412   3e-133   
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                412   3e-133   
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               412   3e-133   
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              412   4e-133   
ref|XP_006849709.1|  hypothetical protein AMTR_s00024p00242390          404   4e-133   
gb|AJD25256.1|  cytochrome P450 CYP736A121                              412   4e-133   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             412   4e-133   
gb|AGC29948.1|  CYP75B65                                                412   5e-133   
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            412   6e-133   
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            412   7e-133   
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                412   7e-133   
gb|ABK25581.1|  unknown                                                 412   7e-133   
ref|XP_007028932.1|  Cytochrome P450 93A3                               411   8e-133   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          411   8e-133   
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            411   9e-133   
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         411   9e-133   
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              411   1e-132   
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               410   1e-132   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          410   1e-132   
ref|XP_010111422.1|  Cytochrome P450 93A1                               411   1e-132   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             410   2e-132   
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              410   2e-132   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               409   3e-132   
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       410   3e-132   
gb|AFK79031.1|  cytochrome P450 CYP736A54                               409   3e-132   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   409   4e-132   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          409   4e-132   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             409   4e-132   
ref|XP_010090163.1|  Flavonoid 3',5'-hydroxylase                        403   4e-132   
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              409   5e-132   
gb|AEN71546.1|  flavanone 3'-hydroxylase                                409   5e-132   
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    409   5e-132   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             409   5e-132   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             409   6e-132   
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         409   6e-132   
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          409   6e-132   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    408   9e-132   
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             409   9e-132   
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            408   1e-131   
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             408   1e-131   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   408   1e-131   
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              409   1e-131   
gb|KEH32010.1|  flavonoid hydroxylase                                   408   1e-131   
gb|EAZ41669.1|  hypothetical protein OsJ_26206                          402   1e-131   
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            408   1e-131   
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    408   2e-131   
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             408   2e-131   
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             407   2e-131   
gb|AGI16386.1|  flavonoid 3' hydroxylase                                408   2e-131   
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             408   2e-131   
ref|XP_011075268.1|  PREDICTED: cytochrome P450 93A3-like               407   2e-131   
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            407   3e-131   
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    407   3e-131   
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   407   3e-131   
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            407   4e-131   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             407   4e-131   
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               407   4e-131   
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         407   5e-131   
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            407   6e-131   
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            406   6e-131   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    406   6e-131   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              421   7e-131   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             406   7e-131   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               405   9e-131   
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            406   1e-130   
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            406   1e-130   
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                406   1e-130   
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             405   1e-130   
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330          405   1e-130   
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            405   1e-130   
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                406   1e-130   
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like               405   1e-130   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          405   1e-130   
emb|CBI21489.3|  unnamed protein product                                407   1e-130   
ref|XP_007146137.1|  hypothetical protein PHAVU_006G015400g             405   2e-130   



>ref|XP_004235547.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/506 (81%), Positives = 460/506 (91%), Gaps = 4/506 (1%)
 Frame = +3

Query  252   SYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGP  431
             S+ A +++T+ +LLL+K+L ++RKL+LPPGPKPWP+IGNLNLIGSLPHRSIHDLSVKYGP
Sbjct  5     SWTAVFLATLFVLLLSKYL-FQRKLNLPPGPKPWPIIGNLNLIGSLPHRSIHDLSVKYGP  63

Query  432   IMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWR  611
             IMQLQFGSFPVVVGSS EMAK FLKTMDINFV RPKTAAGKYTTYNYSDITWSPYG YWR
Sbjct  64    IMQLQFGSFPVVVGSSVEMAKVFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWR  123

Query  612   QARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISW  791
             QARRMCL ELFSAKRL+SYEYIR++EL SIL  L   S   KPILL+DY++TLSLNVIS 
Sbjct  124   QARRMCLMELFSAKRLDSYEYIRAEELHSILHNLKKTSG--KPILLKDYLTTLSLNVISR  181

Query  792   MVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALS  971
             MVLGKSYL+ES+ +IV+P+EF+KMLDELFLLNGVLNIGDSIPW+DF+DLQGY+KRMK +S
Sbjct  182   MVLGKSYLDESKNSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVVS  241

Query  972   KKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLL  1151
             KKFD+FLEHVLDEHN RR A  +++VA+DMVD+LLQLADDP+LE+KLERHGVKAF QD+L
Sbjct  242   KKFDKFLEHVLDEHNVRRNAV-ENYVAEDMVDVLLQLADDPTLEIKLERHGVKAFTQDML  300

Query  1152  AGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEV  1331
             AGGTE+S V VEWAISELLKKPEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AI KE 
Sbjct  301   AGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIAKET  360

Query  1332  MRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGK  1511
             MRLHPVAPMLVPR CREDCKVAGYDIPKGTRVLVSVWT+ RDP LWD P  F P+RF+ K
Sbjct  361   MRLHPVAPMLVPRECREDCKVAGYDIPKGTRVLVSVWTIGRDPTLWDEPEAFKPERFLEK  420

Query  1512  DIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEI  1691
              IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGFNW LP++ TPE+LNMEEI
Sbjct  421   SIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNRTPEELNMEEI  480

Query  1692  FGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             FGLSTPKKFPL+TV+EPRLP  LYS+
Sbjct  481   FGLSTPKKFPLSTVVEPRLPSKLYSI  506



>ref|XP_006342921.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=509

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/510 (81%), Positives = 457/510 (90%), Gaps = 4/510 (1%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
              TW +YAA +++T+ LLLL+K LR +RKL+LPPGPKPWP+IGNLNLIGSL HRSIHDLSV
Sbjct  4     TTWTAYAAVFLATLFLLLLSKFLR-QRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDLSV  62

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGPIMQLQFGSFPVVVGSS EMAK FLKTMDINFV RPKTAAGKYTTYNYSDITWSPYG
Sbjct  63    KYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYG  122

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
              YWRQARRMCL ELFSAKRL+SYEYIR QEL SIL  L   S   KPILL+DY++TLSLN
Sbjct  123   SYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNKLSG--KPILLKDYLTTLSLN  180

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             VIS MVLGKSYL+ SE +IV+P+EF+KMLDELFLLNGVLNIGDSIPW+DF+DLQGY+KRM
Sbjct  181   VISRMVLGKSYLDVSENSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRM  240

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K +SKKFD+FLEHVLDEHN RR A  +++VAKDMVD+LLQLADDP+L+VKLERHGVKAF 
Sbjct  241   KVVSKKFDKFLEHVLDEHNVRRNAV-ENYVAKDMVDILLQLADDPTLDVKLERHGVKAFT  299

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDLLAGGTE+S V VEWAISELLKKPEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AI
Sbjct  300   QDLLAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAI  359

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
              KE MRLHPVAPMLVPR CREDCKVAGYD+ KGTRVLVSVWT+ RDP LWD P  F P+R
Sbjct  360   AKETMRLHPVAPMLVPRECREDCKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEAFKPER  419

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             F+ K IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGFNW LP+++TPE+LN
Sbjct  420   FLDKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEELN  479

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             MEE+FGLSTPKKFPL+ VIEPRL   LYSV
Sbjct  480   MEEVFGLSTPKKFPLSAVIEPRLSSKLYSV  509



>ref|XP_004235548.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=508

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/485 (82%), Positives = 442/485 (91%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNL+GSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSS EMAK
Sbjct  27    KRKLNLPPGPKPWPIIGNLNLMGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSVEMAK  86

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLKTMDINFV RPKTAAGKYTTYNYSDITWSPYG YWRQARRMCL ELFSAKRL+SYEY
Sbjct  87    IFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYEY  146

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL SIL  L  +S   KPILL+DY++TLSLNVIS MVLGKSYL+ES+ +IV+P+EF
Sbjct  147   IRAEELHSILHNLNKSSG--KPILLKDYLTTLSLNVISRMVLGKSYLDESDNSIVTPDEF  204

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPW+DF+DLQGY+KRMK +SKKFD+FLEHVLDEHN RR A 
Sbjct  205   KKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVVSKKFDKFLEHVLDEHNMRRNAV  264

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDMVD+LLQLADDP+L+VKLERHGVKAF QDLLAGGTE+S V VEWAISELLKK
Sbjct  265   -ENYVAKDMVDVLLQLADDPTLDVKLERHGVKAFTQDLLAGGTESSAVTVEWAISELLKK  323

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AI KE MRLHPVAPMLVPR CREDCKV
Sbjct  324   PEIFKKATNELDRVIGQNRWVQEKDIPNLPYIEAIAKETMRLHPVAPMLVPRECREDCKV  383

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F PDRF+ K IDVKG DFELLPFGAGRRMC
Sbjct  384   AGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPDRFLEKSIDVKGHDFELLPFGAGRRMC  443

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLKVIQASL NLLHGFNW LP+++TPE+LNMEEIFGLSTPKKFPL+ VI+PRL  
Sbjct  444   PGYSLGLKVIQASLANLLHGFNWSLPDNMTPEELNMEEIFGLSTPKKFPLSAVIQPRLSS  503

Query  1755  HLYSV  1769
              LYSV
Sbjct  504   KLYSV  508



>ref|XP_002273390.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=511

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/512 (77%), Positives = 450/512 (88%), Gaps = 4/512 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             + TW SY AAW++T+AL+LL+ HLR RRKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS
Sbjct  3     SGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHELS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFPVVVGSS  MAK FLKT D+ F  RPKTAAGKYTTYNYSDITWSPY
Sbjct  63    QKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MCL ELFSA+RLESYEYIR +E KS+L  LY  S++  P+ L+D++ST+SL
Sbjct  123   GPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTVSL  180

Query  777   NVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             NVIS MVLGK YL+E+ EG+IV+P EF+KMLDELFLL+GVLNIGDSIPWIDFLDLQGY+K
Sbjct  181   NVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVK  240

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK LSKKFDRFLEHVLDEHNARR    +++VAKDMVD+LLQ ADDP+LEVKLERHGVKA
Sbjct  241   RMKVLSKKFDRFLEHVLDEHNARRKGV-ENYVAKDMVDVLLQFADDPTLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISELL+KPE+F KAT+ELDRVIG++RWVEEKD+PNLPY+ 
Sbjct  300   FTQDLIAGGTESSAVTVEWAISELLRKPELFDKATEELDRVIGKERWVEEKDIPNLPYLD  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
              IVKE MR+HPVAPMLVPR  RED K+A YDIPK TRVLV+VWT+ RDP +WD PNEFIP
Sbjct  360   TIVKETMRMHPVAPMLVPRFSREDIKIADYDIPKDTRVLVNVWTIGRDPEIWDQPNEFIP  419

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIGK+IDVKG DFELLPFG GRRMCPGYSLGLKVIQ+SL NLLHGF WKLP D+ P  
Sbjct  420   ERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWKLPGDMKPGD  479

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEEIFGLSTPKK PL  + EPRLP HLY +
Sbjct  480   LSMEEIFGLSTPKKIPLVAMAEPRLPAHLYDM  511



>gb|ABG74350.1| cytochrome P450 [Capsicum chinense]
Length=509

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/510 (79%), Positives = 456/510 (89%), Gaps = 4/510 (1%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
              TW +YAA ++ T+ LLLL+K LR ++KL+LPPGPKPWP+IGNL+L+G+LPHRSIH+LSV
Sbjct  4     TTWTAYAAVFLGTLFLLLLSKFLR-QKKLNLPPGPKPWPIIGNLHLMGNLPHRSIHELSV  62

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGPI+QLQFGSFPVVVGSS EMAK FLK+MDINFV RPKTAAGK+TTYNYSDITWSPYG
Sbjct  63    KYGPILQLQFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKHTTYNYSDITWSPYG  122

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
              YWRQARRMCLTELFSAKRL+SYEYIR++EL  ILR L   S   KPILL+DY++TLSLN
Sbjct  123   SYWRQARRMCLTELFSAKRLDSYEYIRAEELHLILRNLNKLSG--KPILLKDYLTTLSLN  180

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             VIS MVLGK YL+ES+ +IV+P EF+KMLDELFLLNGVLNIGDSIPW+ F+DLQGY+KRM
Sbjct  181   VISRMVLGKRYLDESKNSIVTPEEFKKMLDELFLLNGVLNIGDSIPWLGFMDLQGYVKRM  240

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K LSKKFD+FLEHVLDEHN RR A  +++VAKDMVD+LLQLADDPSLE+KLERHGVKAF 
Sbjct  241   KVLSKKFDKFLEHVLDEHNVRRKAV-ENYVAKDMVDVLLQLADDPSLEIKLERHGVKAFT  299

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDLLAGGTE+S V VEWAISELLK+P+I KKAT+ELDRVIGQ RWV+EKD+PNLPYI+A+
Sbjct  300   QDLLAGGTESSAVTVEWAISELLKRPDIIKKATEELDRVIGQNRWVQEKDIPNLPYIEAV  359

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             VKE MRLHPVAPMLVPR CREDCKVAGYD+ KGTRVLVSVWT+ RDP LWD P  F P+R
Sbjct  360   VKETMRLHPVAPMLVPRECREDCKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEAFEPER  419

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             F+ K IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGF W LP+++TPE LN
Sbjct  420   FLEKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFKWSLPDNMTPEDLN  479

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             MEEIFGLSTPKKFPL+ +IEPRLP  LYSV
Sbjct  480   MEEIFGLSTPKKFPLSAMIEPRLPPSLYSV  509



>gb|AAK62346.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/485 (80%), Positives = 437/485 (90%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGPIMQLQFG+FPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCL ELFS KRL+SYEY
Sbjct  88    VFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSTKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE +IV+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSIVTPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKFVSKKFDKFLEHVIDEHNVRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              ++++AKDMVD+LLQLADDP+LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYIAKDMVDVLLQLADDPTLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPMLVPR CREDCKV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDCKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K IDVKG DFELLPFGAGRRMC
Sbjct  385   AGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPERFHEKSIDVKGHDFELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGY+LGLKVIQASL NL+HGFNW LP+++TPE L+M+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYNLGLKVIQASLANLIHGFNWSLPDNMTPEDLDMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>ref|XP_009771565.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana sylvestris]
Length=509

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/485 (81%), Positives = 435/485 (90%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGP+MQLQFGSFPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS KRL+SYEY
Sbjct  88    IFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE + V+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSFVNPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYVAKDMVDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPMLVPR CRED KV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDSKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K IDVKG D+ELLPFGAGRRMC
Sbjct  385   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLKVIQASL NLLHGFNW LP+++TPE LNM+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>gb|ABC69383.1| CYP92A2v4 [Nicotiana tabacum]
Length=509

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/485 (81%), Positives = 435/485 (90%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGP+MQLQFGSFPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS KRL+SYEY
Sbjct  88    IFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE + V+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSFVNPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYVAKDMVDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPMLVPR CRED KV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDIKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K IDVKG D+ELLPFGAGRRMC
Sbjct  385   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLKVIQASL NLLHGFNW LP+++TPE LNM+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>ref|XP_007215252.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
 gb|EMJ16451.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
Length=510

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/511 (75%), Positives = 449/511 (88%), Gaps = 3/511 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             + +W++YAAAW+  + L+LL++ LR  RKL+LPPGPKPWP+IGNLNLI  LPHRSIH L+
Sbjct  3     SISWVAYAAAWLGALVLILLSRRLR-HRKLNLPPGPKPWPIIGNLNLISQLPHRSIHALA  61

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGS PVVVGSS +MAK FLKT D+ F  RPK AAGK+TTYNYSDITWSPY
Sbjct  62    QKYGPIMQLKFGSHPVVVGSSVDMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPY  121

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MC+ ELFSA+RLESYEYIR +E+ ++LR L+ +S+    ILL+D++ST+SL
Sbjct  122   GPYWRQARKMCVMELFSARRLESYEYIRKEEMNALLRGLFESSNTN--ILLKDHLSTVSL  179

Query  777   NVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             NVIS MVLGK Y +ESE +IVSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKR
Sbjct  180   NVISRMVLGKKYTDESEDSIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKR  239

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MK LSKK DRFLEHVLD H A+R A G+ FVAKDMVD+LLQLADDP+LEVKLERHGVKAF
Sbjct  240   MKTLSKKLDRFLEHVLDVHIAKRKAGGEDFVAKDMVDVLLQLADDPNLEVKLERHGVKAF  299

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGTE+S V VEWAISELL+KPE+FKKAT+ELDRVIG++RWVEE D+ NLPY+ A
Sbjct  300   TQDLIAGGTESSAVTVEWAISELLRKPEVFKKATEELDRVIGRERWVEENDIVNLPYVDA  359

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I KE MRLHPVAPMLVPRL REDC+VAGYDIPKGTR+LVSVWT+ RDP LWD+P EF P+
Sbjct  360   IAKETMRLHPVAPMLVPRLAREDCQVAGYDIPKGTRILVSVWTIGRDPQLWDSPEEFCPE  419

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RF+GKDIDVKG DFELLPFG+GRRMCPGYSLG+KVIQASL NLLHGF W+LP+++  E L
Sbjct  420   RFLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQASLANLLHGFTWRLPDNLKEEDL  479

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NMEEIFGLSTPKK+PL  V EPRLP H+YS+
Sbjct  480   NMEEIFGLSTPKKYPLVAVCEPRLPPHVYSI  510



>ref|XP_009607330.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana tomentosiformis]
Length=509

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/485 (80%), Positives = 436/485 (90%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGPIMQLQFG+FPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCL ELFS KRL+SYEY
Sbjct  88    VFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSPKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE +I +P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSIATPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKFVSKKFDKFLEHVIDEHNVRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              ++++AKDMVD+LLQLADDP+LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYIAKDMVDVLLQLADDPTLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPMLVPR CREDCKV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDCKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K IDVKG DFELLPFGAGRRMC
Sbjct  385   AGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPERFHEKSIDVKGHDFELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGY+LGLKVIQASL NL+HGFNW LP+++TPE L+M+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYNLGLKVIQASLANLIHGFNWSLPDNMTPEDLDMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>gb|ABC69381.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/485 (81%), Positives = 434/485 (89%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGP+MQLQFGSFPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS KRL+SYEY
Sbjct  88    IFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY +TLSLNVIS MVLGK YL+ESE + V+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYSTTLSLNVISRMVLGKRYLDESENSFVNPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYVAKDMVDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPMLVPR CRED KV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDIKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  + IDVKG D+ELLPFGAGRRMC
Sbjct  385   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHERSIDVKGHDYELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLKVIQASL NLLHGFNW LP+++TPE LNM+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>gb|ABC69382.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/485 (81%), Positives = 434/485 (89%), Gaps = 3/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS+KYGP+MQLQFGSFPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS KRL+SYEY
Sbjct  88    IFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE + V+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSFVNPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QD+LAGGTE+S V VEWAISELLKK
Sbjct  266   -ENYVAKDMVDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PN PYI+AIVKE MRLHPVAPMLVPR CRED KV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNHPYIEAIVKETMRLHPVAPMLVPRECREDIKV  384

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K IDVKG D+ELLPFGAGRRMC
Sbjct  385   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLPFGAGRRMC  444

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLKVIQASL NLLHGFNW LP+++TPE LNM+EIFGLSTPKKFPL TVIEPRL  
Sbjct  445   PGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEPRLSP  504

Query  1755  HLYSV  1769
              LYSV
Sbjct  505   KLYSV  509



>ref|XP_009341741.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=510

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/511 (75%), Positives = 447/511 (87%), Gaps = 4/511 (1%)
 Frame = +3

Query  240   ATWI-SYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             ATW+ ++ AAW+  +AL+LL++ LR  RKL+LPPGPKPWP+IGNLNLI  LPHRS+H+L+
Sbjct  3     ATWVVAHVAAWLGALALILLSRRLR-HRKLNLPPGPKPWPIIGNLNLISHLPHRSVHELA  61

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
             +KYGPIMQL+FGS+PVVVGSS EMAK FLKT D+ F  RPK AAGK+TTYNYSDITWSPY
Sbjct  62    LKYGPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPY  121

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MC+TELFS KRLESYEYIR +E+ ++L+ LY +S++   +LL+D++ST+SL
Sbjct  122   GPYWRQARKMCITELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--VLLKDHLSTVSL  179

Query  777   NVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             NVIS MVLGK Y +E++ AIVSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKR
Sbjct  180   NVISRMVLGKKYTDETKDAIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKR  239

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MK LSKK D FLEHVLDEH  +R A G  FVAKDMVD+LLQLADDP+LEVKLERHGVKAF
Sbjct  240   MKTLSKKLDMFLEHVLDEHITKREAGGKDFVAKDMVDVLLQLADDPNLEVKLERHGVKAF  299

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGTE+S V VEWAISELL+KPEIFKKA +ELDRVIG++RWVEEKD+ NLPY+ A
Sbjct  300   TQDLIAGGTESSAVTVEWAISELLRKPEIFKKAAEELDRVIGRERWVEEKDIVNLPYVDA  359

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I KE MRLHPVAPMLVPR  REDC+VAGYDIPKGTR LVSVWT+ RDP LWDNP EF P+
Sbjct  360   IAKETMRLHPVAPMLVPRQTREDCQVAGYDIPKGTRALVSVWTIGRDPELWDNPEEFFPE  419

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RF+GKDIDVKG DFELLPFG+GRRMCPGYSLG+KVIQ+SL NLLHGF W++P ++  E L
Sbjct  420   RFLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQSSLANLLHGFTWRMPYNMKKEDL  479

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +MEE+FGLSTPKK PL  V EPRLP H+YS+
Sbjct  480   SMEEVFGLSTPKKTPLVAVCEPRLPPHVYSL  510



>emb|CAN77776.1| hypothetical protein VITISV_021888 [Vitis vinifera]
Length=500

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/512 (75%), Positives = 442/512 (86%), Gaps = 15/512 (3%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             + TW SY AAW++T+AL+LL+ HLR RRKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS
Sbjct  3     SGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHELS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFPVVVGSS  MAK FLKT D+ F  RPKTAAGKYTTYNYSDITWSPY
Sbjct  63    QKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MCL ELFSA+RLESYEYIR +E KS+L  LY  S++  P+ L+D++ST+SL
Sbjct  123   GPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTVSL  180

Query  777   NVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             NVIS MVLGK YL+E+ EG+IV+P EF+KMLDELFLL+GVLNIGDSIPWIDFLDLQGY+K
Sbjct  181   NVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVK  240

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK           HVLDEHNARR    +++VAKDMVD+LLQ A+DP+LEVKLERHGVKA
Sbjct  241   RMK-----------HVLDEHNARRKGV-ENYVAKDMVDVLLQFAEDPTLEVKLERHGVKA  288

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISELL+KPE+F+KAT+ELDRVIG++RWVEEKD+PNLPY+ 
Sbjct  289   FTQDLIAGGTESSAVTVEWAISELLRKPELFEKATEELDRVIGKERWVEEKDIPNLPYLD  348

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
              IVKE MR+HPVAPMLVPR  RED K+AGYDIPK TRVLV+VWT+ RDP +WD PNEFIP
Sbjct  349   TIVKETMRMHPVAPMLVPRFSREDIKIAGYDIPKDTRVLVNVWTIGRDPEIWDQPNEFIP  408

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIGK+IDVKG DFELLPFG GRRMCPGYSLGLKVIQ+SL NLLHGF WKLP D+ P  
Sbjct  409   ERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWKLPGDMKPGD  468

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEEIFGLSTPKK PL  + EPRLP HLY +
Sbjct  469   LSMEEIFGLSTPKKIPLVAMAEPRLPAHLYDM  500



>ref|XP_006426680.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
 gb|ESR39920.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
Length=512

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/516 (76%), Positives = 448/516 (87%), Gaps = 5/516 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME    +W+SY  AW++T+AL+LL+  LR RRKL+LPPGPKPWP+IGNL+LIGSLPHRS+
Sbjct  1     MELIHPSWVSYLTAWLATLALVLLSVRLR-RRKLNLPPGPKPWPIIGNLHLIGSLPHRSV  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPVVVGSS EMAK  LKT D+ F  RPKTAAGKYTT+NYSDIT
Sbjct  60    HALSEKYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLES+EYIR QELK +L +LY  S   KPI+L+D++S
Sbjct  120   WSPYGPYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLS  177

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              LSL VIS MVLGK+Y + + E  IV+P EF+ MLDELFLLNGVL+IGDSIPW+ FLDLQ
Sbjct  178   DLSLAVISRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             G IKRMKAL+KKFD+FLEHVLDEHNARR    +++VAKDMVD+LLQLADDPSLEVK+ERH
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGV-ENYVAKDMVDVLLQLADDPSLEVKIERH  296

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWAISEL+KKPEIF+KAT+ELDRVIG++RWVEEKD+ NL
Sbjct  297   GVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKATEELDRVIGKERWVEEKDIVNL  356

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             P+I AIVKE MRLHPVAP LVPR  REDCKVAGYDIPKGTRVLVSVW + RDP+LW+ PN
Sbjct  357   PFIDAIVKETMRLHPVAPFLVPRAAREDCKVAGYDIPKGTRVLVSVWAIGRDPSLWEKPN  416

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFIGK IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGF WKLP ++
Sbjct  417   EFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGNM  476

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             + E+LNMEEIFGLSTP+KFPL  +  PRL  HLY++
Sbjct  477   SNEELNMEEIFGLSTPRKFPLEVLAHPRLSPHLYNL  512



>ref|XP_009771564.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=510

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/494 (78%), Positives = 435/494 (88%), Gaps = 3/494 (1%)
 Frame = +3

Query  288   LLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVV  467
               L+K+LR +RKL+LPPGPKPWP+IGN NLIG L HRS+H+LS+KYGPI+Q +FGS+PVV
Sbjct  20    FFLSKYLR-QRKLNLPPGPKPWPIIGNFNLIGPLAHRSVHELSLKYGPILQRRFGSYPVV  78

Query  468   VGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS  647
             VGSS EMAK FLK+MDINFVDRPK AAGKYTTYNYS+ITWS YGPYWRQAR+MCL ELF+
Sbjct  79    VGSSVEMAKVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSAYGPYWRQARKMCLMELFT  138

Query  648   AKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE  827
             AKRLES EYIR++EL S+L  LY  S+  KPILL+DY+ TLSLNVIS MVLGK YL+ES+
Sbjct  139   AKRLESLEYIRTEELHSLLHDLYNLSTG-KPILLKDYLMTLSLNVISRMVLGKRYLDESK  197

Query  828   GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLD  1007
              +IV+P EF+KMLDELFLLNGVLNIGD IPWIDF+DLQGY+KRMK LS KFDRFLEHVLD
Sbjct  198   NSIVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQGYVKRMKVLSNKFDRFLEHVLD  257

Query  1008  EHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVE  1187
             +HNARR AE +++VAKDMVD+LLQ ADDP+LEVKLERHGVKAF QDLLAGGTE+S VIVE
Sbjct  258   QHNARRNAE-ENYVAKDMVDVLLQFADDPTLEVKLERHGVKAFTQDLLAGGTESSAVIVE  316

Query  1188  WAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVP  1367
             WAISELLKKPEIF KAT+ELDRVIGQ RWV+EKD+P+LPYI+AIVKE MRLHPVAPML P
Sbjct  317   WAISELLKKPEIFNKATEELDRVIGQNRWVQEKDIPHLPYIEAIVKETMRLHPVAPMLTP  376

Query  1368  RLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELL  1547
             RLC EDCKVAGYDI KGTR+LVSVWT+ARDP LWD P  F P+RF+G  IDVKG +FELL
Sbjct  377   RLCGEDCKVAGYDILKGTRLLVSVWTIARDPTLWDEPEAFKPERFLGNSIDVKGHNFELL  436

Query  1548  PFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLT  1727
             PFGAGRRMCPGY+LGLKVIQASL NLLHGF W LP+++TPE LNMEEIFGLS PKK PL 
Sbjct  437   PFGAGRRMCPGYNLGLKVIQASLANLLHGFKWSLPDNMTPEDLNMEEIFGLSIPKKIPLA  496

Query  1728  TVIEPRLPMHLYSV  1769
              V+EPRL   LYS 
Sbjct  497   AVVEPRLAPTLYSA  510



>ref|XP_008228182.1| PREDICTED: cytochrome P450 71A1-like [Prunus mume]
Length=510

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/511 (76%), Positives = 450/511 (88%), Gaps = 3/511 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             + +W++YAAAW+  +AL+LL++ LR  RKL+LPPGPKPWP+IGNLNLI  LPHRSIH L+
Sbjct  3     SISWVAYAAAWLGALALILLSRRLR-HRKLNLPPGPKPWPIIGNLNLISQLPHRSIHALA  61

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGS PVVVGSS +MAK FLKT D+ F  RPK AAGK+TTYNY+DITWSPY
Sbjct  62    HKYGPIMQLKFGSHPVVVGSSVDMAKAFLKTHDVTFAGRPKFAAGKHTTYNYTDITWSPY  121

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MC+ ELFSAKRLESYEYIR +E+ ++LR L+ +S+    ILL+D++ST+SL
Sbjct  122   GPYWRQARKMCVMELFSAKRLESYEYIRKEEMNALLRGLFESSNTN--ILLKDHLSTVSL  179

Query  777   NVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             NVIS MVLGK Y +ESE +IVSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKR
Sbjct  180   NVISRMVLGKKYTDESEDSIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKR  239

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MKALSKK DRFLEHVLDEH A+R A G+ FVAKDMVD+LLQLADDP LEVKLERHGVKAF
Sbjct  240   MKALSKKLDRFLEHVLDEHIAKRKAGGEDFVAKDMVDVLLQLADDPDLEVKLERHGVKAF  299

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGTE+S V VEWAISELLKKPE+FKKAT+ELDRVIG++RWVEE D+ NLPY+ A
Sbjct  300   TQDLIAGGTESSAVTVEWAISELLKKPEVFKKATEELDRVIGRERWVEENDIVNLPYVDA  359

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I KE MRLHPVAPMLVPRL REDC+VAGYDIPKGTR+LVSVW + RDP LWDNP EF PD
Sbjct  360   IAKETMRLHPVAPMLVPRLAREDCQVAGYDIPKGTRILVSVWAIGRDPQLWDNPEEFCPD  419

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RF+GKDIDVKG DFELLPFG+GRRMCPGYSLG+KVIQASL NLLHGF W+LP+++  E L
Sbjct  420   RFLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQASLANLLHGFTWRLPDNLKEEDL  479

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NMEEIFGLSTPKK+PL  V EPRLP H+YS+
Sbjct  480   NMEEIFGLSTPKKYPLVAVCEPRLPPHVYSL  510



>gb|AED99875.1| cytochrome P450 [Panax notoginseng]
Length=512

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/511 (77%), Positives = 448/511 (88%), Gaps = 6/511 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             TW  Y+A W++ +AL LL+K+LR   KL+ PPGPKPWP+IGNLNLIGSLPHRSIH LS K
Sbjct  6     TWAVYSATWLAILALFLLSKYLR--PKLNPPPGPKPWPIIGNLNLIGSLPHRSIHQLSQK  63

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGPIMQL+FGSFPVVVGSS EMAK FLKTMD+NFV RPKTAAGK+TTYNYSDITWSPYG 
Sbjct  64    YGPIMQLRFGSFPVVVGSSVEMAKIFLKTMDVNFVGRPKTAAGKHTTYNYSDITWSPYGA  123

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCL ELFSAKRL+SYEYIR +E+KS+L+QLY  S  +  I L+DY+ST+SLNV
Sbjct  124   YWRQARKMCLMELFSAKRLDSYEYIRVEEMKSMLKQLYELSGQK--IALKDYLSTVSLNV  181

Query  783   ISWMVLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             IS MVLGK YL+ES  + A+V P EF+KMLDELFLLNGV NIGDSIPWIDFLDLQGY+KR
Sbjct  182   ISRMVLGKRYLDESVDQKAVVRPEEFKKMLDELFLLNGVFNIGDSIPWIDFLDLQGYVKR  241

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MK +SKKFDRFLEHVLDEH ARR  E   +VAKDMVDLLLQL+DDP+LEVKLERHGVKAF
Sbjct  242   MKVVSKKFDRFLEHVLDEHIARRETEKGDYVAKDMVDLLLQLSDDPTLEVKLERHGVKAF  301

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDLLAGGTE+S V VEWAIS+LLKKPEIF+KAT+ELDRVIG+ RWVEEKD+ NLPYIQA
Sbjct  302   TQDLLAGGTESSAVTVEWAISQLLKKPEIFEKATEELDRVIGKSRWVEEKDIQNLPYIQA  361

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             IVKE MRLHPVAPMLVPR  R DCKV GYDI KGTR+LVSVWT+ RDP LWD P+EF+P+
Sbjct  362   IVKETMRLHPVAPMLVPREARVDCKVGGYDIVKGTRILVSVWTIGRDPTLWDKPDEFVPE  421

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RFIGK +DVKG DFELLPFGAGRRMCPGY+LGLKVI++SL NLLHGFNWKLP+ +T E L
Sbjct  422   RFIGKTMDVKGHDFELLPFGAGRRMCPGYTLGLKVIESSLANLLHGFNWKLPDSMTTEDL  481

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NM+EIFGLSTPK+ PL T+ +PRLP+ LYS+
Sbjct  482   NMDEIFGLSTPKEIPLVTLAQPRLPLELYSL  512



>ref|XP_006465906.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 445/516 (86%), Gaps = 5/516 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME   ++W SY  AW++T+AL+LL+  LR RRKL+LPPGPKPWP+IGNL+LIGSLPHRS+
Sbjct  1     MELIHSSWASYLTAWLATLALVLLSVRLR-RRKLNLPPGPKPWPIIGNLHLIGSLPHRSV  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPVVVGSS EMAK  LKT D+ F  RPKTAAGKYTT+NYSDIT
Sbjct  60    HALSEKYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLES+EYIR QELK +L +LY  S   KPI+L+D++S
Sbjct  120   WSPYGPYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLS  177

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              LSL VIS MVLGK+Y + + E  IV+P EF+ MLDELFLLNGVL+IGDSIPW+ FLDLQ
Sbjct  178   DLSLAVISRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             G IKRMKAL+KKFD+FLEHVLDEHNARR    +++VAKDMVD+LLQLADDPSLEVK+ERH
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGV-ENYVAKDMVDVLLQLADDPSLEVKIERH  296

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWAISEL+KKPEIF+KA +ELDRVIG++RWVEEKD+ NL
Sbjct  297   GVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKAIEELDRVIGKERWVEEKDIVNL  356

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             P+I AIVKE MRLHPVAP LVPR  REDC VAGYDIPKGTRVLVSVW + R P+LW+ PN
Sbjct  357   PFIDAIVKETMRLHPVAPFLVPRAAREDCNVAGYDIPKGTRVLVSVWAIGRHPSLWEKPN  416

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFIGK IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGF WKLP ++
Sbjct  417   EFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGNM  476

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             + E+LNMEEIFGLSTP+KFPL  +  PRL  HLY++
Sbjct  477   SNEELNMEEIFGLSTPRKFPLEVLAHPRLSPHLYNL  512



>gb|KDO65002.1| hypothetical protein CISIN_1g010388mg [Citrus sinensis]
Length=512

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 445/516 (86%), Gaps = 5/516 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME    +W+SY  AW++T+AL+LL+  LR RRKL+LPPGPKPWP+IGNL+LIGSLPHRS+
Sbjct  1     MELIHPSWVSYLTAWLATLALVLLSVRLR-RRKLNLPPGPKPWPIIGNLHLIGSLPHRSV  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPVVVGSS EMAK  LKT D+ F  RPKTAAGKYTT+NYSDIT
Sbjct  60    HALSEKYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLES+EYIR QELK +L +LY  S   KPI+L+D++S
Sbjct  120   WSPYGPYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLS  177

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              LSL VIS MVLGK+Y + + E  IV+P EF+ MLDELFLLNGVL+IGDSIPW+ FLDLQ
Sbjct  178   DLSLAVISRMVLGKNYTDKQQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             G IKRMKAL+KKFD+FLEHVLDEHNARR    +++VAKDMVD+LLQLADDPSLEVK+ERH
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGV-ENYVAKDMVDVLLQLADDPSLEVKIERH  296

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWAISEL+KKPEIF+KA +ELDRVIG++RWVEEKD+ NL
Sbjct  297   GVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKAIEELDRVIGKERWVEEKDIVNL  356

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             P+I AIVKE MRLHPVAP LVPR  REDC VAGYDIPKGTRVLVSVW + R P+LW+ PN
Sbjct  357   PFIDAIVKETMRLHPVAPFLVPRAAREDCNVAGYDIPKGTRVLVSVWAIGRHPSLWEKPN  416

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFIGK IDVKG DFELLPFGAGRRMCPGYSLGLKVIQASL NLLHGF WKLP ++
Sbjct  417   EFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGNM  476

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             + E+LNMEEIFGLSTP+KFPL  +  PRL  HLY++
Sbjct  477   SNEELNMEEIFGLSTPRKFPLEVLAHPRLSPHLYNL  512



>ref|XP_010273844.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=509

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/514 (75%), Positives = 442/514 (86%), Gaps = 6/514 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P+  W  YA AW+ ++AL++L+ H R RR+ +LPPGPKPWP+IGNLNLIG LPHRSI
Sbjct  1     MEAPS--WAVYALAWLLSLALVILSGHFR-RRRANLPPGPKPWPIIGNLNLIGPLPHRSI  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGPIMQL+FGS P+VVGSS EMAK FLK  DI F  RPK AAGKYTTYNYSDIT
Sbjct  58    HELSKKYGPIMQLRFGSRPIVVGSSVEMAKQFLKIHDITFASRPKMAAGKYTTYNYSDIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFS KRLESYEYIR +EL+++L+ LY +S   KPI+L+D++S
Sbjct  118   WSPYGPYWRQARKMCLMELFSVKRLESYEYIRVEELRAVLKGLYASSG--KPIVLKDHLS  175

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
             TLSLNVIS MVLGK Y +ESE +IV+P EF+KMLDELFLLNGV+NIGD IPWIDFLDLQG
Sbjct  176   TLSLNVISRMVLGKKYTDESETSIVTPGEFKKMLDELFLLNGVVNIGDYIPWIDFLDLQG  235

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             Y+KRMK LSKKFD+FLEHV+DEHNARR    + +VAKDMVD+LLQLADDP+LEVKL R G
Sbjct  236   YVKRMKILSKKFDKFLEHVIDEHNARRQGV-EGYVAKDMVDVLLQLADDPTLEVKLHREG  294

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VK F QDL+AGGTE+S V VEWAISELLK+PE+FKKAT+ELDRVIG++RWVEEKD+P LP
Sbjct  295   VKGFTQDLIAGGTESSAVTVEWAISELLKRPEMFKKATEELDRVIGRERWVEEKDIPQLP  354

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YIQAIVKE MR+HPVAPMLVPR  REDC++AGYDIP GT V V+ WT+ RDP LWD P+E
Sbjct  355   YIQAIVKETMRMHPVAPMLVPRFSREDCEIAGYDIPAGTEVFVNTWTIGRDPTLWDAPDE  414

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F PDRFIG+DIDVKG DFELLPFG+GRRMCPGYSLGLKVIQASL NLL GF W LP+ + 
Sbjct  415   FRPDRFIGRDIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQASLANLLQGFTWNLPDKMK  474

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             PE LNMEEIFGLSTPKK PL  V+EPRLP H+Y 
Sbjct  475   PENLNMEEIFGLSTPKKIPLVAVVEPRLPTHVYG  508



>emb|CAA65580.1| cytochrome P450 [Nicotiana tabacum]
Length=498

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/503 (77%), Positives = 441/503 (88%), Gaps = 6/503 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W +YAAA ++T++L LL+K LR +RKL+LPPGPKPWP++GN NLI  L HRS+
Sbjct  1     METPT--WTAYAAACLATLSLFLLSKFLR-QRKLNLPPGPKPWPIVGNFNLIAPLAHRSV  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS+KYGPIMQL+FGSFPVVVGSS EMAK FLK+MDINFVDRPK AAGKYTTYNYS+IT
Sbjct  58    HELSLKYGPIMQLRFGSFPVVVGSSVEMAKVFLKSMDINFVDRPKMAAGKYTTYNYSNIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYWRQAR+MCL ELF+AKRLES EYIR++EL+S+L  LY  +   KPILL+DY+ 
Sbjct  118   WSAYGPYWRQARKMCLMELFTAKRLESLEYIRTEELQSLLHDLYNLTG--KPILLKDYLM  175

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
             TLSLNVIS MVLGK YL+ES+ +IV+P EF+KMLDELFLLNGVLNIGD IPWIDF+DLQG
Sbjct  176   TLSLNVISRMVLGKRYLDESKNSIVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQG  235

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             Y+KRMK LS KFDRFLE+VLDEHNARR AE +++VAKDMVD+LLQ ADDP+LEVKLERHG
Sbjct  236   YVKRMKVLSNKFDRFLEYVLDEHNARRNAE-ENYVAKDMVDVLLQFADDPTLEVKLERHG  294

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKAF QDLLAGGTE++ VIVEWAISELLKKPEIF KAT+ELDRVIGQ RWV+EKD+PN P
Sbjct  295   VKAFTQDLLAGGTESTAVIVEWAISELLKKPEIFNKATEELDRVIGQNRWVQEKDIPNFP  354

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+AIVKE MRLHPVAPML PRLC EDCKVAGYDI KGTRVLVSVWT+ARDP LWD P  
Sbjct  355   YIEAIVKETMRLHPVAPMLTPRLCGEDCKVAGYDILKGTRVLVSVWTIARDPTLWDEPEA  414

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RF+G  IDVKG +FELLPFGAGRRMCPGY+LGLKVIQASL NLLHGF W LP+++T
Sbjct  415   FKPERFLGNSIDVKGHNFELLPFGAGRRMCPGYNLGLKVIQASLANLLHGFKWSLPDNMT  474

Query  1665  PEKLNMEEIFGLSTPKKFPLTTV  1733
             PE LNMEEIF LS PKK PL   
Sbjct  475   PEDLNMEEIFCLSIPKKIPLAAC  497



>gb|ADC34701.1| flavonoid 3' hydroxylase [Actinidia chinensis]
Length=511

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 452/515 (88%), Gaps = 4/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P+  W +YA AW++T +LLLL+ HLR RRKL+LPPGPKPWP+IGNLNLIGSLPHRS+
Sbjct  1     METPS--WAAYAVAWLATASLLLLSAHLRRRRKLNLPPGPKPWPIIGNLNLIGSLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             HDLS +YGPIM L+FGSFPVVVGSS   AKTFLKTMD+ F  RPKTAAGK+TTYNYSDIT
Sbjct  59    HDLSQQYGPIMHLRFGSFPVVVGSSVAAAKTFLKTMDVTFASRPKTAAGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFS KRLESYEYIR +E++S+++++Y   SA  PI+++D +S
Sbjct  119   WSPYGAYWRQARKMCLTELFSTKRLESYEYIRIEEMRSLIKEIY--QSAGTPIMIKDNLS  176

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
             T+SLNVIS MVLG+ YL+ SE ++V+P +F+KMLDELFLLNGV NIGDSIPWIDFLDLQG
Sbjct  177   TVSLNVISRMVLGRRYLDASESSVVTPEDFKKMLDELFLLNGVFNIGDSIPWIDFLDLQG  236

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
              +KRMK ++KKFD+FLEHVLDEHN +R  EG  FVAKDMVD+LLQLADDP+L++KLERHG
Sbjct  237   NVKRMKVVAKKFDKFLEHVLDEHNEKRREEGVGFVAKDMVDVLLQLADDPNLDIKLERHG  296

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKAF QDLLAGGTE+S V VEWAISELLKKP+IFK AT+ELDRVIG+ RWVEEKD+PNLP
Sbjct  297   VKAFTQDLLAGGTESSAVTVEWAISELLKKPKIFKMATEELDRVIGKSRWVEEKDIPNLP  356

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+AIVKE MR+HPVAPMLVPRL REDC+V GYDI +GTRVLV+VWT+ RDP LWD PNE
Sbjct  357   YIEAIVKETMRMHPVAPMLVPRLTREDCQVDGYDIQEGTRVLVNVWTIGRDPELWDEPNE  416

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RFIGK IDVKG DFELLPFG+GRRMCPGYSLGLKVIQASL NLLHGF W LP ++ 
Sbjct  417   FCPERFIGKSIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQASLANLLHGFTWNLPANMK  476

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              + LNM+EIFGLSTP+K PL TV EPRLP HLY++
Sbjct  477   VDDLNMDEIFGLSTPRKVPLATVAEPRLPPHLYAL  511



>ref|XP_007024645.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY27267.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=511

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/515 (77%), Positives = 444/515 (86%), Gaps = 6/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P+  W SY AAW++TIAL+LL+  LR RRKL+LPPGPKPWP+IGNLNLIGSLPHRSI
Sbjct  1     METPS--WASYLAAWLATIALVLLSLRLRRRRKLNLPPGPKPWPIIGNLNLIGSLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPV+VGSS EMAK  L+T D+ F  RPK AAGKYTTYNYSDIT
Sbjct  59    HALSQKYGPIMQLRFGSFPVIVGSSVEMAKAILRTHDVAFAGRPKIAAGKYTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCLTELFSAKRLESYEYIR +E+  +L+ L   S +  PI L+D++S
Sbjct  119   WSPYGPYWRQARKMCLTELFSAKRLESYEYIRREEMNLLLKGLCNLSGS--PICLKDHLS  176

Query  765   TLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             +LSLNVIS MVLGK Y   + E  IV+P EF++MLDELFLLNGVL+IGDSIPW+ FLDLQ
Sbjct  177   SLSLNVISRMVLGKKYTEGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLSFLDLQ  236

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GYIKRMKALSKKFDRFLEHVLDEHNARR    D +VAKDMVD+LLQLADDP L+VKLERH
Sbjct  237   GYIKRMKALSKKFDRFLEHVLDEHNARRKGVKD-YVAKDMVDVLLQLADDPHLDVKLERH  295

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWAISELLKKPEIF KAT+ELDRVIG+ RWVEE D+ NL
Sbjct  296   GVKAFSQDLIAGGTESSAVTVEWAISELLKKPEIFAKATEELDRVIGRDRWVEENDIANL  355

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PY+ +I KE MRLHPVAPMLVPRL REDC++AGYDIPK TRVLV+VWT+ RDP LWDNP+
Sbjct  356   PYVNSIAKETMRLHPVAPMLVPRLAREDCQLAGYDIPKDTRVLVNVWTIGRDPTLWDNPD  415

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF PDRFIGK IDVKG DFELLPFGAGRRMCPGY LG+KVIQASL NLLHGF WKLP ++
Sbjct  416   EFCPDRFIGKAIDVKGHDFELLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWKLPGNM  475

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
               E LNMEEIFGLSTPKKFPL  V +PRLP+H+YS
Sbjct  476   AKEDLNMEEIFGLSTPKKFPLEAVAQPRLPLHMYS  510



>gb|KHG15722.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/515 (74%), Positives = 441/515 (86%), Gaps = 6/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             MESP+  W+SY  AW++T+AL+LL+   R RRKL+LPPGPKPWPVIGNL+LIGSLPHRSI
Sbjct  1     MESPS--WVSYLIAWLATLALILLSLRFRPRRKLNLPPGPKPWPVIGNLDLIGSLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP+MQL+FGSFPVVV SS EMAK FLKT D+ F  RPK AAG+YTTYNYSDIT
Sbjct  59    HSLSQKYGPLMQLKFGSFPVVVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MC+TELFSAKRLESYEYIR +E+K +L+  Y +S    PI+L+D++S
Sbjct  119   WSPYGPYWRQARKMCMTELFSAKRLESYEYIRREEMKLLLKGFYESSGV--PIVLKDHLS  176

Query  765   TLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              LSLNVIS MV GK Y   + E  IV+P EF++MLDELFLLNGVL+IGDSIPW+ FLDLQ
Sbjct  177   DLSLNVISRMVFGKKYTEGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQ  236

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             G IKRMKALSKKFD+FLEHVLDEHNARR    D ++AKDMVD+LLQLADDP+L+VKLERH
Sbjct  237   GNIKRMKALSKKFDKFLEHVLDEHNARRRDVKD-YIAKDMVDVLLQLADDPNLDVKLERH  295

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWAISE+LKKPEIF KAT+ELDRVIG++RWVEE+D+ NL
Sbjct  296   GVKAFSQDLIAGGTESSAVTVEWAISEMLKKPEIFAKATEELDRVIGRERWVEERDIVNL  355

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PYI +I KE MRLHPVAPMLVPR+ REDC+V GYDI KGTR LV+VWT+ RDP +WDNPN
Sbjct  356   PYIDSIAKETMRLHPVAPMLVPRMTREDCQVDGYDILKGTRALVNVWTIGRDPTVWDNPN  415

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFI K IDVKG DF+LLPFGAGRRMCPGY LG+KVIQASL NLLHGF WKLP ++
Sbjct  416   EFFPERFIDKTIDVKGHDFQLLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWKLPGNM  475

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             T + L+MEEIFGLSTPKK PL  V  P+LP+H+YS
Sbjct  476   TKDDLDMEEIFGLSTPKKCPLQAVAVPKLPLHMYS  510



>ref|XP_006369135.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
 gb|ERP65704.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
Length=511

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/510 (74%), Positives = 440/510 (86%), Gaps = 6/510 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             TW+SYA AW++T++L+LLA  LR RRKL LPPGPKPWP+IGNLNLIG LPHRS+H LS K
Sbjct  3     TWVSYAFAWLATVSLILLASRLR-RRKLKLPPGPKPWPIIGNLNLIGELPHRSLHALSQK  61

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGPIMQ+QFGSFPVVVGSS EMAKT LKT D+ F  RPKTAAGKYTTYNYSDITWSPYGP
Sbjct  62    YGPIMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGP  121

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCL ELFSAKRLESYEYIR +ELK++L+ L+ +S   +PI L+D+++ +SLNV
Sbjct  122   YWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHKSSG--RPINLKDHLTDVSLNV  179

Query  783   ISWMVLGKSYL---NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             IS MVLGK Y    +E+E  IV+P EF++MLDELFLLNGVL+IGDSIPWI FLDLQGYIK
Sbjct  180   ISRMVLGKKYTVKSSENEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIK  239

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK LSKKFD+F+EHVLDEH +RR  E +++  KDMVD+LLQLA DP+LEVKLERHGVKA
Sbjct  240   RMKVLSKKFDKFMEHVLDEHESRRKTEDENWEPKDMVDVLLQLASDPNLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISE+L+KPE+F+KA++ELDRVIG++RWVEEKDM NLPYI 
Sbjct  300   FSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMVNLPYIY  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AI KEVMRLHPVAPMLVPR  RED  V GYDI KG+RVLV+VWT+ RDP +WD P+EF P
Sbjct  360   AIAKEVMRLHPVAPMLVPREAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFCP  419

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIG  IDV+G D+ELLPFGAGRRMCPGY LGLKVIQA+L NLLHGF W+LP+ V  E+
Sbjct  420   ERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGVRKEE  479

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             L+MEEIFGLSTPKK+PL  V EPRLP H+Y
Sbjct  480   LSMEEIFGLSTPKKYPLVAVAEPRLPAHVY  509



>ref|XP_009375474.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=509

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/510 (75%), Positives = 446/510 (87%), Gaps = 3/510 (1%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             ATW++Y AAW+  +AL+LL++ LR RRKL+LPPGPKPWP+IGNLNLIG LPHRS+H+LS 
Sbjct  3     ATWVAYTAAWLGALALILLSRRLR-RRKLNLPPGPKPWPIIGNLNLIGHLPHRSVHELSQ  61

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGPIMQL+FGS+PVVVGSS EMAK FLKT D+ F  RPK AAGK+TTYNYSDITWS YG
Sbjct  62    KYGPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSQYG  121

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PYWRQAR+MC+ ELFS KRLESYEYIR +E+ ++L+ LY +S++   ILL+D++ST+SLN
Sbjct  122   PYWRQARKMCIMELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--ILLKDHLSTVSLN  179

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             VIS MVLGK Y +E+E +IVSP++F+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKRM
Sbjct  180   VISRMVLGKKYTDETEDSIVSPDDFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRM  239

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K LSKK DRFLEHVLDEH ARR A G  FVAKDMVD+LLQLADDP LEVKLERHGVKAF 
Sbjct  240   KTLSKKMDRFLEHVLDEHIARREASGKDFVAKDMVDVLLQLADDPGLEVKLERHGVKAFT  299

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGTE+S V VEWAI+ELL+KPE+FKKA +ELDRVIG+ RWVEEKD+ NLPY+ AI
Sbjct  300   QDLIAGGTESSAVTVEWAIAELLRKPEVFKKAVEELDRVIGRGRWVEEKDIVNLPYVDAI  359

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
              KE MRLHPVAPMLVPR   EDC++AGYDIPKGTR LVSVWT+ RDP LWDNP EF P+R
Sbjct  360   AKETMRLHPVAPMLVPRQATEDCQIAGYDIPKGTRALVSVWTIGRDPELWDNPEEFCPER  419

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
              +GKDIDVKG DFELLPFG+GRRMCPGYSLG+KVIQ+SL NLLHGF W+LP+++  E L+
Sbjct  420   LLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQSSLANLLHGFTWRLPDNMKKEDLS  479

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             MEEIFGLSTPKKFPL  V EPRLP H+YS+
Sbjct  480   MEEIFGLSTPKKFPLVAVCEPRLPPHVYSL  509



>ref|XP_002462455.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
 gb|EER98976.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
Length=517

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/517 (72%), Positives = 439/517 (85%), Gaps = 5/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME PT  W S+    ++T+ LL      R RR  +LPPGPKPWP+IGNLNL+G+LPHRSI
Sbjct  1     MELPT--WASFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLNLMGALPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGP+MQLQFGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DIT
Sbjct  59    HELSRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFSAKRLESYEYIR+ E++++LR L++AS + + ++L+DY+S
Sbjct  119   WSPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDYLS  178

Query  765   TLSLNVISWMVLGKSYLNESE---GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
             T+SLNVI+ MVLGK YL++ E   G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D++D
Sbjct  179   TVSLNVITRMVLGKKYLDKEEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  238

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGYIKRMK L K FDRFLEHV++EHN RR+ EG  FVAKDMVD+LLQ+ADDP+LEV+L 
Sbjct  239   LQGYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELN  298

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             R  VKAF QDL+AGGTE+S V VEWAISELLKKPE+  KAT+ELDRVIG+ RWV EKDMP
Sbjct  299   RESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMP  358

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             +LPY+ A+VKE MRLHPVAP+LVPRL RED  VAGYDIP GTRVLVSVW++ RDPALWD 
Sbjct  359   SLPYVDAVVKETMRLHPVAPLLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDA  418

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             P EF+P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W LP+
Sbjct  419   PEEFMPERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPD  478

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              VT E+L+MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  479   GVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  515



>emb|CAA64635.1| cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/486 (79%), Positives = 427/486 (88%), Gaps = 5/486 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +RKL+LPPGPKPWP+IGNLNLIG+LP+RSIH+LS+KYGP+MQLQFGSFPVVVGSS EMAK
Sbjct  28    QRKLNLPPGPKPWPIIGNLNLIGNLPYRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLK+MDINFV RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFS K L+SYEY
Sbjct  88    IFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKCLDSYEY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR++EL S+L  L   S   KPI+L+DY++TLSLNVIS MVLGK YL+ESE + V+P EF
Sbjct  148   IRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRYLDESENSFVNPEEF  205

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             +KMLDELFLLNGVLNIGDSIPWIDF+DLQGY+KRMK +SKKFD+FLEHV+DEHN RR   
Sbjct  206   KKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNGV  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
              +++VAKDM D+LLQLADDP LEVKLERHGVKAF QD+LAGGTE+S V VEWAISEL KK
Sbjct  266   -ENYVAKDMEDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELSKK  324

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEIFKKAT+ELDRVIGQ RWV+EKD+PNLPYI+AIVKE MRLHPVAPM     CRE+ KV
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMKATE-CRENSKV  383

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGK-DIDVKGCDFELLPFGAGRRM  1571
             AGYD+ KGTRVLVSVWT+ RDP LWD P  F P+RF  K  IDVKG D+ELLPFG GRRM
Sbjct  384   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKASIDVKGHDYELLPFGVGRRM  443

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLGLKVIQASL NLLHGFNW LP+++TPE LNM+EIFGLSTPKKFPL TVIEPRL 
Sbjct  444   CPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEPRLS  503

Query  1752  MHLYSV  1769
               LYSV
Sbjct  504   PKLYSV  509



>ref|XP_010086796.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB23806.1| Cytochrome P450 71A1 [Morus notabilis]
Length=514

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/517 (76%), Positives = 452/517 (87%), Gaps = 5/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME PT  W+SYAAAW++TIAL+LL++ LR RRKL+LPPGPKPWP+IGNLNLIG LPHRSI
Sbjct  1     MEGPT--WVSYAAAWLATIALILLSRRLR-RRKLNLPPGPKPWPIIGNLNLIGPLPHRSI  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             +DLS KYGPIMQL FGSFPVVVGSS EMAK FLKT D+ FV RPK AAGKYTTYNYS+IT
Sbjct  58    YDLSQKYGPIMQLWFGSFPVVVGSSVEMAKIFLKTHDLTFVGRPKIAAGKYTTYNYSNIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSA+RL+SYEYIR +E++++L+ L+  S  +K +LL+D +S
Sbjct  118   WSPYGPYWRQARKMCLMELFSARRLDSYEYIRREEMRALLKALFEFSKTEKLVLLKDQLS  177

Query  765   TLSLNVISWMVLGKSYLNESE-GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             T+SLNVIS MVLGK+Y + S+  A+VSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQ
Sbjct  178   TVSLNVISRMVLGKNYTDGSDPNAVVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV-AKDMVDLLLQLADDPSLEVKLER  1118
             GYIKRMKALSKK+DRFLEHVLDEHN RR    D    A+DMVD+LLQLADDP+LEVKLER
Sbjct  238   GYIKRMKALSKKWDRFLEHVLDEHNERRKGVKDYVPHAQDMVDVLLQLADDPTLEVKLER  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
             HGVKAF QDL+AGGTE+S V VEWAISELLKKPEIFKKAT+ELDRVIG++RWVEEKD+ N
Sbjct  298   HGVKAFTQDLIAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGRERWVEEKDIVN  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI AI KE MRLHPVAPMLVPR C +D K+ GYDIPK TRVLVSVW + RDP+LWDNP
Sbjct  358   LPYIDAIAKETMRLHPVAPMLVPRFCLDDIKINGYDIPKDTRVLVSVWAIGRDPSLWDNP  417

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF+P+RFIGKD+DVKG +FELLPFG+GRRMCPGYSLGLKVIQ+SL NLLHGF W LP +
Sbjct  418   NEFVPERFIGKDVDVKGQNFELLPFGSGRRMCPGYSLGLKVIQSSLANLLHGFTWNLPPN  477

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E L+M EIFGLSTPKK PL  V EPRLP HLY++
Sbjct  478   MKREDLDMNEIFGLSTPKKIPLVAVAEPRLPPHLYAL  514



>ref|NP_001147572.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG27961.1| flavonoid 3-monooxygenase [Zea mays]
 tpg|DAA40166.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/512 (72%), Positives = 436/512 (85%), Gaps = 5/512 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             W S+    ++T+ LL      R RR  +LPPGPKPWP+IGNL+L+G+LPHRSIH+LS KY
Sbjct  6     WASFLGIVLATVMLLKALTGRRSRRMYNLPPGPKPWPIIGNLDLVGALPHRSIHELSRKY  65

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             GP+MQL+FGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DITWSPYG Y
Sbjct  66    GPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGAY  125

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
             WRQAR+MCLTELFSAKRLESYEYIR+ E++++LR L+ ASS+ + ++L+DY+ST+SLNVI
Sbjct  126   WRQARKMCLTELFSAKRLESYEYIRADEVRALLRDLHAASSSGRAVMLKDYLSTVSLNVI  185

Query  786   SWMVLGKSYLNESE-----GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             + MVLGK YL++ E     G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D++DLQGYI
Sbjct  186   TRMVLGKKYLDKEEAAAAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYI  245

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             KRMK LSK FDRFLEHV++EHN RR+ EG  FVAKDMVD+LLQ+ADDP+LEV+L+R  VK
Sbjct  246   KRMKKLSKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELDRESVK  305

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
             AF QDL+AGGTE+S V VEWAISELLKKPE+  KAT+ELDRVIG+ RWV EKDMP+LPY+
Sbjct  306   AFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLPYV  365

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AIVKE MRLHPVAP+LVPRL RED  VAGYDIP GTRVLVSVW++ RDPALWD P EF+
Sbjct  366   DAIVKETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEEFM  425

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W LP+ VT E
Sbjct  426   PERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGVTKE  485

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             + +MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  486   EFSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_008652774.1| PREDICTED: cytochrome P450 71A1-like [Zea mays]
 tpg|DAA61659.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/517 (72%), Positives = 440/517 (85%), Gaps = 5/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME PT  W S+    ++T+ LL      R RR  +LPPGPKPWP+IGNL+L+G+LPHRSI
Sbjct  1     MELPT--WASFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLDLVGALPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGP+MQL+FGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DIT
Sbjct  59    HELSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFSAKRLESYEYIR+ E++ +LR L++AS + + ++L+DY+S
Sbjct  119   WSPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRVLLRDLHSASGSGRAVMLKDYLS  178

Query  765   TLSLNVISWMVLGKSYLNESE---GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
             T+SLNVI+ MVLGK YL+  E   GA+ +P EF+ MLDELFLLNGVLNIGDSIPW+D++D
Sbjct  179   TVSLNVITRMVLGKKYLDREEAAAGAVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMD  238

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGYIKRMK LSK FDRFLEHV++EH+ RR++EG  FVAKDMVD+LLQ+ADDP+LEV+L+
Sbjct  239   LQGYIKRMKKLSKMFDRFLEHVVEEHHQRRLSEGKGFVAKDMVDVLLQIADDPTLEVELD  298

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             R  VKAF QDL+AGGTE+S V VEWAISELLKKPE+  KAT+ELDRVIG+ RWV EKD+P
Sbjct  299   RESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDIP  358

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             +LPY+ AIVKE MRLHPVAPMLVPRL RED  VAGYDIP GTRVLVSVW++ RDPALWD 
Sbjct  359   SLPYVDAIVKETMRLHPVAPMLVPRLSREDTAVAGYDIPAGTRVLVSVWSIGRDPALWDA  418

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             P EF+P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W LP+
Sbjct  419   PEEFMPERFLGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPD  478

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              VT E+L+MEEIFGLSTP+KFPL  V++P+LP HLY+
Sbjct  479   GVTMEELSMEEIFGLSTPRKFPLEAVVQPKLPAHLYA  515



>ref|XP_004303698.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/511 (76%), Positives = 444/511 (87%), Gaps = 4/511 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
               +W++YAAAW+ ++ALLLL      RRKL+LPPGPKPWP+IGNLNLIG LPH SIH LS
Sbjct  3     ATSWVTYAAAWLGSLALLLLLSRHLRRRKLNLPPGPKPWPIIGNLNLIGHLPHLSIHTLS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFPVVVGSS EMAK FLKT D+ F  RPK AAGK+TTYNYSDITWSPY
Sbjct  63    QKYGPIMQLKFGSFPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MC+ ELFS KRLESYEYIR +E+ ++LR LY +S+    +LL+D++ST+SL
Sbjct  123   GPYWRQARKMCIMELFSNKRLESYEYIRREEMGALLRGLYESSNTN--VLLKDHLSTVSL  180

Query  777   NVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             NVIS MVLGK Y ++SE AIVSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKR
Sbjct  181   NVISRMVLGKKYTDDSEDAIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKR  240

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MKALSKK DRFLEHVLDEH   + A+G  FVA DMVD+LLQLADDP+LEVKLERHGVKAF
Sbjct  241   MKALSKKLDRFLEHVLDEHIENKKAKG--FVATDMVDVLLQLADDPNLEVKLERHGVKAF  298

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGTE+S V VEWAISELL+KPEIFKKAT+ELDRVIG++RWVEEKD+ NLP+I A
Sbjct  299   TQDLIAGGTESSAVTVEWAISELLRKPEIFKKATEELDRVIGRERWVEEKDIVNLPFIDA  358

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I KE MRLHPVAPMLVPRL REDC+VAGYDIPK TRVLVSVWT+ RDP LW+NP+EF P+
Sbjct  359   IAKETMRLHPVAPMLVPRLAREDCQVAGYDIPKDTRVLVSVWTIGRDPNLWENPDEFCPE  418

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RFIGKDIDVKG DFELLPFG+GRRMCPGYSLG+KVI  SL NLLHGF W+LP+ +  E L
Sbjct  419   RFIGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIHTSLANLLHGFTWRLPDGMKKEDL  478

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NMEEIFGLSTPKKFPL  V EPRLP H+YS+
Sbjct  479   NMEEIFGLSTPKKFPLVAVAEPRLPAHVYSL  509



>ref|XP_008342571.1| PREDICTED: cytochrome P450 71A1-like [Malus domestica]
Length=511

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/511 (73%), Positives = 442/511 (86%), Gaps = 3/511 (1%)
 Frame = +3

Query  240   ATWI-SYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             AT++ +Y AAW+  +AL+LL++      KL+LPPGPKPWP+IGNLNLI  LPHRS+H+L+
Sbjct  3     ATYVGAYVAAWLGVLALILLSRRRLRHPKLNLPPGPKPWPIIGNLNLISHLPHRSVHELA  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
             +KYGPIMQL+FGS+PVVVGSS EMAK FLKT D+ F  RPK AAGK+TTYNYSDITWSPY
Sbjct  63    LKYGPIMQLKFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MC+TELFS KRLESYEYIR +E+ ++L+ LY +S++   +LL+D++ST+SL
Sbjct  123   GPYWRQARKMCITELFSNKRLESYEYIRREEMSALLKGLYDSSNSN--VLLKDHLSTVSL  180

Query  777   NVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             NVIS MVLGK Y +E++ AIVSP+EF+KMLDELFLL+GVLNIGDSIPW+DFLDLQGYIKR
Sbjct  181   NVISRMVLGKKYTDETKDAIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKR  240

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MK LSKK DRFLEHVLDEH  +R   G  FVAKDMVD+LLQLADDP+LEVKLERHGVKAF
Sbjct  241   MKTLSKKLDRFLEHVLDEHITKREVGGKDFVAKDMVDVLLQLADDPNLEVKLERHGVKAF  300

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGTE+S V VEWAISELL+KP++FKKA +ELDRVIG+ RWVEEKD+  LPY+ A
Sbjct  301   TQDLIAGGTESSAVTVEWAISELLRKPDLFKKAAEELDRVIGRDRWVEEKDIVKLPYVDA  360

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I KE MRLHPVAPMLVPR  REDC+VAGYDIPKGTR LVSVWT+ RDP LWDNP +F P+
Sbjct  361   IAKETMRLHPVAPMLVPRQTREDCQVAGYDIPKGTRALVSVWTIGRDPELWDNPEQFFPE  420

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RF+GKDIDVKG DFELLPFG+GRRMCPGY+LG+KVIQ+SL NLLHGF W+LP ++  E L
Sbjct  421   RFLGKDIDVKGQDFELLPFGSGRRMCPGYNLGIKVIQSSLANLLHGFTWRLPYNMKKEDL  480

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +MEE+FGLSTPKK PL  V EPRLP H+YS+
Sbjct  481   SMEEVFGLSTPKKTPLVAVCEPRLPPHIYSL  511



>ref|XP_010917481.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=511

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/515 (73%), Positives = 439/515 (85%), Gaps = 4/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             MESP+   +   AA +++I  LL +   R RRKL+LPPGPKPWP+IGNLNLI SLPHRS+
Sbjct  1     MESPSL--VVSLAAILASILFLLRSLFGRRRRKLNLPPGPKPWPIIGNLNLISSLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP+M L FGSFPV+V +S ++AK  LKT D+ F  RPKTAAGKYTTYNYSDIT
Sbjct  59    HALSQKYGPLMHLYFGSFPVIVAASVDVAKLVLKTHDVTFCGRPKTAAGKYTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYWRQAR+MC+ ELFSAKRL+SYEYIR +E+K++LR L+  +SA + + L+D++S
Sbjct  119   WSQYGPYWRQARKMCIMELFSAKRLDSYEYIRVEEVKNLLRDLF--NSAGRSVNLKDHLS  176

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
              +SLNVIS MVLGK YL +SEGAIVSP EF+ MLDELFLLNGV+NIGDSIPW+ FLDLQG
Sbjct  177   NVSLNVISRMVLGKKYLVKSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLGFLDLQG  236

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             YIKRMK + KKFDRFLEHVLDEHN RR  EG++FVA DMVD+LLQLADDPSLEVKLERHG
Sbjct  237   YIKRMKKVGKKFDRFLEHVLDEHNERRRREGENFVAMDMVDVLLQLADDPSLEVKLERHG  296

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKAF QDL+AGGTE+S V VEWAISELLK+PEIFKKAT+ELDRVIG++RWVEEK++ NLP
Sbjct  297   VKAFTQDLIAGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRERWVEEKEVHNLP  356

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+AIVKE MR+HPVAP+LVPR+ REDC +AGYDI  GTRVLV+VWT+ RDP +WD+P E
Sbjct  357   YIEAIVKETMRMHPVAPLLVPRMSREDCNIAGYDILAGTRVLVNVWTIGRDPTIWDSPEE  416

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RFIG +IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ + 
Sbjct  417   FRPERFIGSNIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGMK  476

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              E L+MEEIFGLSTPKK PL  V++P+LP HLY V
Sbjct  477   VEDLSMEEIFGLSTPKKVPLEVVVQPKLPAHLYGV  511



>ref|XP_008792870.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=511

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/515 (72%), Positives = 438/515 (85%), Gaps = 4/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             MESP+   +S AA  +++I L L +   R RR L+LPPGPKPWP+IGNLNLI SLPHRS+
Sbjct  1     MESPSVA-VSLAAI-LASILLFLKSLFGRRRRSLNLPPGPKPWPIIGNLNLISSLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP++ L FGSFPV+V +S +MAK  LK+ D++F  RPK AAGKYTTYNYSDIT
Sbjct  59    HALSQKYGPLIHLYFGSFPVIVAASVDMAKLVLKSHDVSFCGRPKIAAGKYTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYWRQAR+MC+ ELFSA+RL+SYEYIR +E+K++LR L+ +S +  P+ L+D++S
Sbjct  119   WSQYGPYWRQARKMCIMELFSARRLDSYEYIRVEEVKNLLRDLFKSSGS--PVSLKDHLS  176

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
              +SLNVIS MVLGK YL+ SEGAIVSP EF+ MLDELFLLNGV+NIGDSIPW+DFLDLQG
Sbjct  177   NVSLNVISRMVLGKKYLDRSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLDFLDLQG  236

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             YIKRMK +S+KFDRFLEHVLDEHN RR  EG++FVA DMVD+LL+LADDP+LEVKLER G
Sbjct  237   YIKRMKKISRKFDRFLEHVLDEHNERRRREGENFVAVDMVDVLLELADDPNLEVKLERRG  296

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKAF QDL+AGGTE+S V VEWAISELLK+PEIFKKAT+ELDRVIG+ RWVEEK++ NLP
Sbjct  297   VKAFTQDLIAGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRDRWVEEKEVHNLP  356

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+AIVKE MR+HPVAPMLVPRL REDC +AGYDIP GTRVLV+VWT+ RDP +WD+P E
Sbjct  357   YIEAIVKETMRMHPVAPMLVPRLSREDCNIAGYDIPAGTRVLVNVWTIGRDPTVWDSPEE  416

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+   
Sbjct  417   FRPERFIGSKIDVKGHDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGTK  476

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              E L+MEEIFGLSTP+K PL  V+EP+LP HLY V
Sbjct  477   LEDLSMEEIFGLSTPRKVPLEAVVEPKLPAHLYGV  511



>ref|XP_002460274.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
 gb|EER96795.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
Length=518

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/511 (72%), Positives = 434/511 (85%), Gaps = 4/511 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALL-LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             W S+    ++T+ LL  +    R RR  +LPPGPKPWP+IGNLNL+G+LPHRSIH+LS K
Sbjct  6     WASFLGVVLATVMLLKAIIGRRRSRRVYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRK  65

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQL+FGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DITWSPYG 
Sbjct  66    YGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGA  125

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCLTELFS KRLESYEYIR+ E++++LR L +AS + + ++L+DY+ST+SLNV
Sbjct  126   YWRQARKMCLTELFSVKRLESYEYIRAAEVRALLRDLNSASGSGRAVMLKDYLSTVSLNV  185

Query  783   ISWMVLGKSYLNESE---GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             I+ MVLGK YL+  E   G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D++DLQGYIK
Sbjct  186   ITRMVLGKKYLDREEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIK  245

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK L K FDRFLEHV++EHN RR+ EG  FVAKDMVD+LLQ+ADDP+LEV+L+R  VKA
Sbjct  246   RMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELDRESVKA  305

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISELLKKPE+  KAT+ELDRVIG+ RWV EKDMP+LPY+ 
Sbjct  306   FTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLPYVD  365

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             A+VKE MRLHPVAP+LVPRL RED  VAGYDIP GTRVLVSVW++ RDPALWD P EF+P
Sbjct  366   AVVKETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEEFMP  425

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W LP+ VT E+
Sbjct  426   ERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGVTKEE  485

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             L+MEEIFGLSTP+KFPL  V+EP+LP HLYS
Sbjct  486   LSMEEIFGLSTPRKFPLEAVVEPKLPAHLYS  516



>ref|XP_004956938.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/513 (71%), Positives = 435/513 (85%), Gaps = 7/513 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALL--LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             W S+    ++T+ LL  ++ +H R RR  +LPPGPKPWP+IGNL+L+G+LPHRSIH+LS 
Sbjct  6     WASFLGVVLATVMLLKAIVGRHRR-RRAYNLPPGPKPWPIIGNLDLVGALPHRSIHELSR  64

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGP+MQLQFGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DITWSPYG
Sbjct  65    KYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYG  124

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
              YWRQAR+MCLTELFSAKRLESYEYIR+ E++++LR L+  S +   ++L+DY+ST+SLN
Sbjct  125   AYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGCAVMLKDYLSTVSLN  184

Query  780   VISWMVLGKSYLNESEGA----IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             VI+ MVLGK YL++   A    + +P EF+ MLDELFLLNGVLNIGDSIPW+D++DLQGY
Sbjct  185   VITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGY  244

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             IKRMK L K FDRFLEHV++EHN RR+ EG SFVAKDMVD+LLQ+ADDP+LEV+L R  V
Sbjct  245   IKRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELNRESV  304

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAF QDL+AGGTE+S V VEWAISELLKKPE+F KAT+ELDRVIG+ RWV EKD+P LPY
Sbjct  305   KAFTQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLPY  364

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             + AIVKE MRLHPVAPMLVPRL RED  VAGYDIP GTRVLVSVW++ RDP LWD P EF
Sbjct  365   VDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDAPEEF  424

Query  1488  IPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTP  1667
             +P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF+W LP+ +T 
Sbjct  425   MPERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWSLPDGLTK  484

Query  1668  EKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             E+L+MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  485   EELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_008460308.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=508

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/504 (76%), Positives = 439/504 (87%), Gaps = 4/504 (1%)
 Frame = +3

Query  258   AAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIM  437
               AW++T+A+LLL++ +R RRKL+LPPGPKPWP+IGNL+LIGSLPH+SIH LS KYGPIM
Sbjct  9     VVAWIATLAILLLSRRIR-RRKLNLPPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIM  67

Query  438   QLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQA  617
              L+FGSFPVVVGSS EMAK FLKT D+NFV RPKTAAGKYTTYNYSDITWS YGPYWRQA
Sbjct  68    HLRFGSFPVVVGSSVEMAKIFLKTQDLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQA  127

Query  618   RRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMV  797
             R+MCL ELFSA+RL+SYEYIR +E+ ++LR++Y   S  + I ++DY+ST+SLNVIS MV
Sbjct  128   RKMCLMELFSARRLDSYEYIRKEEMNALLREIY--KSCGEVIKIKDYLSTVSLNVISRMV  185

Query  798   LGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKK  977
             LGK Y +ESE  IVSP+EF+KMLDELFLL+GVLNIGDSIPWIDFLDLQGY+KRMKALSKK
Sbjct  186   LGKKYTDESENGIVSPDEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKK  245

Query  978   FDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAG  1157
             FDRFLEHVLDEHN RR    D +VAKDMVD+LLQLADDP LEVKLERHGVKAF QDL+AG
Sbjct  246   FDRFLEHVLDEHNERRKGVED-YVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAG  304

Query  1158  GTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMR  1337
             GTE+S V VEWA+SELLKKPEIF KA +ELDRVIG++RWVEEKD+ NLPYI AI KE MR
Sbjct  305   GTESSAVTVEWAMSELLKKPEIFNKAREELDRVIGKERWVEEKDIINLPYIDAIAKETMR  364

Query  1338  LHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDI  1517
             LHPVAPMLVPR+ REDC++AGYDI KGTRV V+VWT+ RDP +W+NP EF P+RF+GK+I
Sbjct  365   LHPVAPMLVPRMTREDCQIAGYDIVKGTRVFVNVWTIGRDPTVWENPLEFKPERFMGKNI  424

Query  1518  DVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFG  1697
             DVKG DFELLPFG+GRRMCPGYSLGLKVIQ+SL NLLHGF WKL  D+  E LNM+E+FG
Sbjct  425   DVKGQDFELLPFGSGRRMCPGYSLGLKVIQSSLANLLHGFTWKLSGDMKNEDLNMDEVFG  484

Query  1698  LSTPKKFPLTTVIEPRLPMHLYSV  1769
             LSTPKKFPL  V EPRL   LY +
Sbjct  485   LSTPKKFPLDVVAEPRLSSSLYFI  508



>ref|XP_002521317.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF40985.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/517 (75%), Positives = 448/517 (87%), Gaps = 8/517 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W++YA+ W++T+AL+LL++ LR RRKL+LPPGPKPWP+IGNLNLIG+LPHRS+
Sbjct  1     METPT--WVAYASVWLATVALILLSRRLR-RRKLNLPPGPKPWPIIGNLNLIGALPHRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS  YGPIMQL+FGSFPVVVGSS EMAK  LKT D+ F  RPK AAGKYTTYNYSDIT
Sbjct  58    HSLSQTYGPIMQLKFGSFPVVVGSSVEMAKAILKTHDVAFAGRPKIAAGKYTTYNYSDIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MC+ ELFSAKRLESYEYIR +EL+ +L+ ++ +S    PI L+D+++
Sbjct  118   WSPYGAYWRQARKMCVMELFSAKRLESYEYIRIEELRLLLKSMFLSSG--NPINLKDHLT  175

Query  765   TLSLNVISWMVLGKSYLNESEGA--IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              LSLNVIS MVLGK Y  +SE    IV+P EF++MLDELFLLNGVL+IGDSI W+ FLDL
Sbjct  176   DLSLNVISRMVLGKKYTVKSENVDEIVTPEEFKEMLDELFLLNGVLDIGDSISWLAFLDL  235

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QGYIKRMK +SKKFDRFLEHVLDEH+ARR    D+ VAKDMVD+LLQLADDP+LE+KLER
Sbjct  236   QGYIKRMKTVSKKFDRFLEHVLDEHDARR-KRVDNHVAKDMVDVLLQLADDPNLEIKLER  294

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
             +GVK F QDL+AGGTE+S V VEWAISELL+KPEIF KAT+ELDRVIG++RWVEEKD+ N
Sbjct  295   NGVKGFTQDLIAGGTESSAVTVEWAISELLRKPEIFGKATEELDRVIGRERWVEEKDIVN  354

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LP+I AI+KE MRLHPVAPMLVPR CRED KVAGYDIP+GTRVLV+VWT+ RDP++WDNP
Sbjct  355   LPFIYAIIKETMRLHPVAPMLVPRQCREDTKVAGYDIPEGTRVLVNVWTIGRDPSIWDNP  414

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             +EF P+RFIGK IDVKGCDFELLPFGAGRRMCPGY LG+KVIQASL NLLHGF WKLP D
Sbjct  415   DEFCPERFIGKTIDVKGCDFELLPFGAGRRMCPGYPLGIKVIQASLANLLHGFKWKLPGD  474

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E LNMEEIFGLSTPKKFPL  V EPRLP H+YS+
Sbjct  475   MKIEDLNMEEIFGLSTPKKFPLVVVAEPRLPSHVYSL  511



>ref|NP_001063285.1| Os09g0441400 [Oryza sativa Japonica Group]
 dbj|BAD36161.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38066.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF25199.1| Os09g0441400 [Oryza sativa Japonica Group]
Length=514

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/515 (72%), Positives = 436/515 (85%), Gaps = 4/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME     W S+    ++T+ L L A   R RR  +LPPGPKPWPVIGNLNL+G+LPHRSI
Sbjct  1     MELMLPPWASFVGVVLATV-LFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSI  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGP+M L+FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAGK+TTYNYSDIT
Sbjct  60    HNLSKKYGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFSAKRLESYEYIR +E++++LR L+ A+     ++L+DY+S
Sbjct  120   WSPYGAYWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGV--VVLKDYLS  177

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             T+SLNVI+ MVLGK YL+ ++ G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D+LDLQ
Sbjct  178   TVSLNVITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GYIKRMK L K FDRFLEHV+DEHN RR  EG+SFVAKDMVD+LLQ AD+P+LEVKL+R 
Sbjct  238   GYIKRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKRE  297

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F KAT+ELDRV+G+ RWV EKD+P+L
Sbjct  298   GVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSL  357

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
              Y+ AIVKE MRLHPVAPMLVPRL RED  V GYDIP GTRVLVSVWT+ RDP LWD P 
Sbjct  358   TYVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPE  417

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF+P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ V
Sbjct  418   EFMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGV  477

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             T E+L+MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  478   TREQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  512



>gb|AGT17103.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=519

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/520 (71%), Positives = 440/520 (85%), Gaps = 9/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME PT  W S+    ++T+ +LL A   R RR  +LPPGPKPWP+IGNLNL+G+LPHRSI
Sbjct  1     MELPT--WASFLGVVLATV-MLLKAILGRRRRVYNLPPGPKPWPIIGNLNLMGALPHRSI  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGP+MQL+FGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DIT
Sbjct  58    HELSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFSAKRLESYEYIR+ E++++LR L++AS + + ++L+D++S
Sbjct  118   WSPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDHLS  177

Query  765   TLSLNVISWMVLGKSYLNESEGA------IVSPNEFRKMLDELFLLNGVLNIGDSIPWID  926
             T+SLNVI+ MVLGK YL++ E A      + +P EF+ MLDELFLLNGVLNIGDSIPW+D
Sbjct  178   TVSLNVITRMVLGKKYLDKDEVASAGSVTMTTPEEFKWMLDELFLLNGVLNIGDSIPWLD  237

Query  927   FLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEV  1106
             ++DLQGYIKRMK LSK FDRFLEHV++EHN RR+ EG  FVAKDMVD+LLQ+ADDP+LEV
Sbjct  238   WMDLQGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKDFVAKDMVDVLLQIADDPTLEV  297

Query  1107  KLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEK  1286
             +L R  VKAF QDL+AGGTE+S V VEWAISELLKKPE+  KAT+ELDRVIG+ RWV EK
Sbjct  298   ELNRESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIVKATEELDRVIGRGRWVTEK  357

Query  1287  DMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPAL  1466
             D+P+LPY+ AIVKE MRLHPVAPMLVPRL RED  VAGYDIP GTRVLVSVW++ RDPAL
Sbjct  358   DIPSLPYVDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPAL  417

Query  1467  WDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWK  1646
             WD P EF+P+RF+   +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF+W 
Sbjct  418   WDAPEEFMPERFLSSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWS  477

Query  1647  LPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LP  VT E+L+MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  478   LPYGVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_011079634.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=507

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/516 (74%), Positives = 447/516 (87%), Gaps = 10/516 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P      ++A  +  + L LLAK +R RRKL+LPPGPKPWPVIGNLNLIG LPHRS+
Sbjct  1     METPI-----WSACLLLLVFLYLLAKTIR-RRKLNLPPGPKPWPVIGNLNLIGPLPHRSL  54

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP++ LQFGSFPVVVGSS EMAK FLKTMD+ F  RPKTAAGKYTTYNYSDIT
Sbjct  55    HQLSQKYGPLLHLQFGSFPVVVGSSVEMAKVFLKTMDVTFASRPKTAAGKYTTYNYSDIT  114

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLESYEYIR +E+ S+L+ L+ +S   + +LL+DY+S
Sbjct  115   WSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEEMNSLLKSLFKSSG--QSVLLKDYLS  172

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             T+SLNVIS MVLGK YL+ ++E A+VSP EF+KMLDELFLLNGV+N+GD IPWI FLDLQ
Sbjct  173   TVSLNVISRMVLGKRYLDKDNENAVVSPEEFKKMLDELFLLNGVINVGDLIPWISFLDLQ  232

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GY+KRMK +SKKFDRFLEHVLDEH  RR    + +V++DMVD+LL+LA+DP+LEVKLERH
Sbjct  233   GYVKRMKIVSKKFDRFLEHVLDEHEERRRRV-EGYVSRDMVDVLLELAEDPTLEVKLERH  291

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDLLAGGTE+S V VEWAI+ELLKKPEIFKKAT+EL+RVIGQ +WV+EKD+PNL
Sbjct  292   GVKAFTQDLLAGGTESSAVTVEWAIAELLKKPEIFKKATEELNRVIGQNKWVQEKDIPNL  351

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PYI+AIVKE MRLHPVAP+LVPR  REDCKVAGYDI KGT+VLV+VWT+ RDP+LW+NP 
Sbjct  352   PYIEAIVKETMRLHPVAPLLVPRFSREDCKVAGYDIKKGTQVLVNVWTIGRDPSLWENPT  411

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFIGK IDVKG DFELLPFG+GRRMCPGY+LGLKVIQ+SL NLLHGFNW+LP+ +
Sbjct  412   EFCPERFIGKAIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQSSLANLLHGFNWELPDHM  471

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              PE LNMEEIFGLSTP+K PL  V++PRLP  +Y++
Sbjct  472   RPEDLNMEEIFGLSTPRKIPLVAVVKPRLPYEVYNL  507



>gb|EAZ09259.1| hypothetical protein OsI_31532 [Oryza sativa Indica Group]
Length=514

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/515 (72%), Positives = 436/515 (85%), Gaps = 4/515 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME     W S+ A  ++T+ L L     R RR  +LPPGPKPWPVIGNLNL+G+LPHRSI
Sbjct  1     MELMLPPWASFVAVVLATV-LFLKTVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSI  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYGP+M L+FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAGK+TTYNYSDIT
Sbjct  60    HNLSKKYGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MCLTELFSAKRLESYEYIR +E++++LR L+ A+     ++L+DY+S
Sbjct  120   WSPYGAYWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGV--VVLKDYLS  177

Query  765   TLSLNVISWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             T+SLNVI+ MVLGK YL+ ++ G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D+LDLQ
Sbjct  178   TVSLNVITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GYIKRMK L K FDRFLEHV+DEHN RR  EG+SFVAKDMVD+LLQ AD+P+LEVKL+R 
Sbjct  238   GYIKRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKRE  297

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F KAT+ELDRV+G+ RWV EKD+P+L
Sbjct  298   GVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSL  357

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
              Y+ AIVKE MRLHPVAPMLVPRL RED  V GYDIP GTRVLVSVWT+ RDP LWD P 
Sbjct  358   TYVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPE  417

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF+P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ V
Sbjct  418   EFMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGV  477

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             T E+L+MEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  478   TREQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  512



>gb|KDP40690.1| hypothetical protein JCGZ_24689 [Jatropha curcas]
Length=511

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/517 (74%), Positives = 443/517 (86%), Gaps = 8/517 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W++++ AWV+ I  LLL      RRKLHLPPGPK WP+IGNLNLIGSLPHRS+
Sbjct  1     METPT--WVAFSTAWVA-ILALLLLSRRLRRRKLHLPPGPKSWPIIGNLNLIGSLPHRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPVVVGSS EMAKT LKT D+NF  RPKTAAGKYTT+NYSDIT
Sbjct  58    HSLSEKYGPIMQLKFGSFPVVVGSSVEMAKTILKTHDVNFAGRPKTAAGKYTTFNYSDIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MC+ ELFSAKRLESYEYIR +EL+S+L+ L+ +S     I ++D++S
Sbjct  118   WSPYGPYWRQARKMCVMELFSAKRLESYEYIRVEELRSLLKTLFLSSG--NAINVKDHLS  175

Query  765   TLSLNVISWMVLGKSYL--NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              LSLNVIS MVLGK Y   NE+E  IV+P EF++MLDELFLLNGVL+IGDSIPW+ FLDL
Sbjct  176   DLSLNVISRMVLGKKYTVKNENENEIVTPEEFKEMLDELFLLNGVLDIGDSIPWLAFLDL  235

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG IKRMK LSKKF+RFLEHVLDEH +RR    +++VAKDMVD+LLQLA+DP+LEVKLER
Sbjct  236   QGNIKRMKVLSKKFNRFLEHVLDEHESRRKGV-ENYVAKDMVDILLQLAEDPNLEVKLER  294

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
             +GVK F QD++AGGTE+S V VEWA+SELL+KPEIFKKAT+ELDRVIG++RWVEEKD+ N
Sbjct  295   NGVKGFTQDMIAGGTESSAVTVEWALSELLRKPEIFKKATEELDRVIGRERWVEEKDIVN  354

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LP+I+AI KE MRLHPVAPMLVPR CRED ++AGYDI KGTRVLV+VWT+ RDP +WDNP
Sbjct  355   LPFIEAIAKETMRLHPVAPMLVPRQCREDTQIAGYDIQKGTRVLVNVWTIGRDPTIWDNP  414

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RFIGK IDVKG DFELLPFGAGRRMCPGY LG+KVIQASL NLL GFNWKLP +
Sbjct  415   NEFCPERFIGKAIDVKGHDFELLPFGAGRRMCPGYPLGIKVIQASLANLLQGFNWKLPGN  474

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E LNMEEIFGLSTPKKFPL  V EPRLP H+Y +
Sbjct  475   LKKEDLNMEEIFGLSTPKKFPLVAVAEPRLPFHVYGM  511



>ref|XP_006665048.1| PREDICTED: cytochrome P450 71A1-like [Oryza brachyantha]
Length=517

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/519 (71%), Positives = 434/519 (84%), Gaps = 7/519 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME     W S+    ++T+ LLL A   R RR  +LPPGPKPWPVIGNLNL+G+LPHRSI
Sbjct  1     MELVLPPWASFVGVVLATV-LLLKAVFGRGRRVYNLPPGPKPWPVIGNLNLVGTLPHRSI  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS +YGPIM L+FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAGKYTTYNYSDIT
Sbjct  60    HELSKRYGPIMSLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKYTTYNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YG YWRQAR+MCLTELFSAKRLESYEYIR++E+ ++LR L+ A+     ++L+DY+S
Sbjct  120   WSSYGAYWRQARKMCLTELFSAKRLESYEYIRAEEVSALLRDLHGAAGGV--VMLKDYLS  177

Query  765   TLSLNVISWMVLGKSYLNE----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFL  932
             T+SLNVI+ MVLGK YL++      G++ +P EF+ MLDELFLLNGVLNIGDSIPW+D+L
Sbjct  178   TVSLNVITRMVLGKKYLDKETTAQNGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWL  237

Query  933   DLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKL  1112
             DLQGYIKRMK LSK FDRFLEHV+DEHN RR  EG SFVAKDMVD+LLQ ADDP+LEVKL
Sbjct  238   DLQGYIKRMKKLSKMFDRFLEHVVDEHNERRRLEGQSFVAKDMVDVLLQFADDPNLEVKL  297

Query  1113  ERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDM  1292
             +R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F +AT+ELDRVIG+ RWV EKD+
Sbjct  298   KREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFTRATEELDRVIGRDRWVTEKDI  357

Query  1293  PNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWD  1472
             PNLPYI AIVKE MR+HPVAPMLVPRL RED  + GYDIP GTRVLVSVW++ RDP LWD
Sbjct  358   PNLPYIDAIVKETMRMHPVAPMLVPRLSREDTSIDGYDIPAGTRVLVSVWSIGRDPKLWD  417

Query  1473  NPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLP  1652
              P EF+P+RFIG  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP
Sbjct  418   APEEFMPERFIGNKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFKWRLP  477

Query  1653  NDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             + +T + L+MEEIFGLSTP+KFPL  ++EP+L  HLY+ 
Sbjct  478   DGMTRKNLSMEEIFGLSTPRKFPLEAIVEPKLSAHLYAT  516



>ref|XP_008463991.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=514

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/482 (77%), Positives = 420/482 (87%), Gaps = 4/482 (1%)
 Frame = +3

Query  327   HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLK  506
             +LPPGPKPWPVIGNL+LIGSLPH+SIH LS KYGPIM L+FGSFPVVVGSS EMAK FLK
Sbjct  35    NLPPGPKPWPVIGNLHLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLK  94

Query  507   TMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQ  686
             T D+NFV RPKTAAGKYTTYNYSDITWS YGPYWRQAR+MCL ELFSA+RL+SYEYIR +
Sbjct  95    TQDLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKE  154

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKM  863
             E+  ++R++Y   S  + I ++DY+ST+SLNVIS MVLGK Y +ES E  IVSP+EF+KM
Sbjct  155   EMNGLVREIY--KSCGEVIKVKDYLSTVSLNVISRMVLGKKYTDESSENGIVSPDEFKKM  212

Query  864   LDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDS  1043
             LDELFLL+GVLNIGDSIPWIDFLDLQGY+KRMKALSKKFDRFLEHVLDEHN RR     +
Sbjct  213   LDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLEHVLDEHNERRKGV-QN  271

Query  1044  FVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEI  1223
             +VAKDMVD+LLQLADDP+LEVKLERHGVKAF QDL+AGGTE+S V VEWAISELLK PEI
Sbjct  272   YVAKDMVDVLLQLADDPNLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLKNPEI  331

Query  1224  FKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGY  1403
             F KA +EL+ VIG++RWVEEKD+ NLPYI AI KE MRLHPVAPMLVPR+ REDC++AGY
Sbjct  332   FNKAIEELNEVIGKERWVEEKDIVNLPYINAIAKETMRLHPVAPMLVPRMAREDCQIAGY  391

Query  1404  DIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGY  1583
             DI KGTRVLV+VWT+ RDP +W NP+ F PDRF+   IDVKG DFELLPFG+GRRMCPGY
Sbjct  392   DIAKGTRVLVNVWTIGRDPTVWRNPHAFDPDRFMESSIDVKGQDFELLPFGSGRRMCPGY  451

Query  1584  SLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             SLGLKVIQ+SL NLLHGFNWKLP D+  E LNMEEIFGLSTPKK+PL  V EPRLP HLY
Sbjct  452   SLGLKVIQSSLANLLHGFNWKLPGDMEKEDLNMEEIFGLSTPKKYPLDAVAEPRLPPHLY  511

Query  1764  SV  1769
             S+
Sbjct  512   SL  513



>ref|XP_002303241.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
 gb|EEE78220.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
Length=512

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/516 (72%), Positives = 438/516 (85%), Gaps = 9/516 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W+SYA AW++T++L+LLA  LR RRKL+ PPGPK WP+IGNLNLIG LPHRS+
Sbjct  1     METPT--WMSYAFAWLATVSLILLASRLR-RRKLNPPPGPKSWPIIGNLNLIGELPHRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP+MQ++FGSFPVVVGSS EMAKT LKT D+ F  RPKTAAGKYTTYNYSDIT
Sbjct  58    HALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDIT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLESYEYIR +EL+++L+ L  +S   +PI L+D+++
Sbjct  118   WSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTLNKSSG--RPINLKDHLA  175

Query  765   TLSLNVISWMVLGKSYL---NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
              +SLNVIS MVLGK Y    +E+E  IV+P EF++MLDELFLLNGVL+IGDSIPWI FLD
Sbjct  176   DVSLNVISRMVLGKKYTVKSSENEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLD  235

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGYIKRMK LSKKFD+F+EHVLDEH ARR  E  ++  KDMVD+LLQLA DP+LE+KLE
Sbjct  236   LQGYIKRMKTLSKKFDKFMEHVLDEHEARR-KEDKNWEPKDMVDVLLQLASDPNLEIKLE  294

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             RHGVKAF QDL+AGGTE+S V VEW ISE+L+KPE+F+KAT+ELDRVIG++RWVEEKDM 
Sbjct  295   RHGVKAFSQDLIAGGTESSAVTVEWGISEILRKPEVFEKATEELDRVIGRERWVEEKDMV  354

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             NLPYI AI KEVMRLHPVAPMLVPR  RED  + GYDI KG+RVLV+VWT+ RDP +WD 
Sbjct  355   NLPYIYAIAKEVMRLHPVAPMLVPRAAREDININGYDIKKGSRVLVNVWTIGRDPKVWDK  414

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             P+EF P+RFIG  IDV+G D+ELLPFGAGRRMCPGY LGLKVIQA+L NLLHGF W+LP+
Sbjct  415   PDEFFPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPD  474

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
                 + LNM+EIFGLSTPKK+PL  V EPRLP H+Y
Sbjct  475   GQKKDDLNMDEIFGLSTPKKYPLVAVAEPRLPAHVY  510



>ref|XP_004956937.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 432/512 (84%), Gaps = 5/512 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALL-LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             W S+    ++T+ LL  +    R RR  +LPPGPKPWP+IGNL+L+G+LPHRSIH+LS K
Sbjct  6     WASFLGVVLATVMLLKAIVGRRRRRRAYNLPPGPKPWPIIGNLDLMGALPHRSIHELSRK  65

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQLQFGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGKYTTYNY DITWSPYG 
Sbjct  66    YGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGA  125

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCLTELFSAKRLESYEYIR+ E++++LR L+  S + + ++L+DY+ST+SLNV
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGRAVMLKDYLSTVSLNV  185

Query  783   ISWMVLGKSYLNESEGA----IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             I+ MVLGK YL++   A    + +P EF+ MLDELFLLNGVLNIGDSIPW+D++DLQGYI
Sbjct  186   ITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYI  245

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             KRMK L K FDRFLEHV++EHN RR+ EG SFVAKDMVD+LLQ+ADDP+LEV+L R  VK
Sbjct  246   KRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELNRESVK  305

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
             AF QDL+AGGTE+S V VEWAISELLKKPE+F KAT+ELDRVIG+ RWV EKD+P LPY+
Sbjct  306   AFTQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLPYV  365

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AIVKE MRLHPVAPMLVPRL RED  VAGYDIP GTRVLVSVW++ RDP LWD P +F+
Sbjct  366   DAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDTPEQFM  425

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W LP+ +T E
Sbjct  426   PERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGLTKE  485

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             +LNMEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  486   ELNMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_010932407.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=513

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/517 (72%), Positives = 437/517 (85%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRW--RRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             ME P+  W SY A  +++I LLL    LR    RK +LPPGPKPWPVIGNLNLIGSLPHR
Sbjct  1     MELPS--WASYLATVLASILLLLQPLFLRRRRHRKPNLPPGPKPWPVIGNLNLIGSLPHR  58

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             S+H LS KYGP+M L FGSFPV+V SS +MAK  LKT D+ F  RPKTAAG+YTTYNYS+
Sbjct  59    SLHALSHKYGPLMHLYFGSFPVIVASSVDMAKLILKTHDVTFCGRPKTAAGRYTTYNYSN  118

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             ITWS YG YWRQAR+MC+ ELFSA+RL+SYEYIR +E K++LR L+ +S   +P+ L+D+
Sbjct  119   ITWSQYGAYWRQARKMCVMELFSARRLDSYEYIRVEEAKNLLRDLFNSSG--RPVNLKDH  176

Query  759   MSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             +S +SLNVIS MVLGK YL+ESE A+VSP EF+ MLDELFLLNGV+NIGDS+PW+DFLDL
Sbjct  177   LSNVSLNVISRMVLGKKYLDESEDAVVSPEEFKAMLDELFLLNGVMNIGDSMPWLDFLDL  236

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QGYI+RMK L KKFDRFLEHV+DEHN RR  EG+ FVA+DMVD+LLQLADDP+LEVKLER
Sbjct  237   QGYIRRMKKLGKKFDRFLEHVVDEHNERRRREGEKFVARDMVDVLLQLADDPTLEVKLER  296

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              GVKAF QD++AGGTE+S + VEWAISELLK+PEIFKKAT+ELDRVIG+ RWVEEK++ +
Sbjct  297   RGVKAFTQDMIAGGTESSAMTVEWAISELLKRPEIFKKATEELDRVIGRHRWVEEKELHH  356

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI+AI+KE MR+HPVAPMLVPR CREDC VAGYDIP GTRVLV+VWT+ RDP +WD P
Sbjct  357   LPYIEAIIKETMRMHPVAPMLVPRQCREDCNVAGYDIPAGTRVLVNVWTIGRDPTIWDAP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
              EF P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ 
Sbjct  417   EEFRPERFIGSTIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDG  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E L+MEEIFGLSTP+K PL  V+EP+LP+HLY+V
Sbjct  477   MKVEDLSMEEIFGLSTPRKVPLEVVVEPKLPVHLYAV  513



>gb|ADO16185.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=513

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/515 (72%), Positives = 435/515 (84%), Gaps = 2/515 (0%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME  + ++  Y  AW++T+ALL++++  R +RKL+ PPGPKPWP+IGNLNLIG+LPHRSI
Sbjct  1     MEPLSNSYTYYTVAWLATVALLIISRRTRRQRKLNPPPGPKPWPIIGNLNLIGTLPHRSI  60

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             HDLS KYG IMQL+F SF V+V SSAE AK  LKT D++F  RPKTAAGKY+TYNYS+IT
Sbjct  61    HDLSQKYGDIMQLKFRSFNVLVASSAEAAKIILKTQDVSFACRPKTAAGKYSTYNYSNIT  120

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR++CL ELFSAKRLESYEYIR +E  S+L+++Y  SS  + ILL+D +S
Sbjct  121   WSPYGAYWRQARKICLMELFSAKRLESYEYIRVEETNSLLKKIY--SSVGEEILLKDMLS  178

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
              +SLNVIS MVLGK YL+ESE + VSPNEF+KMLDEL LLNGV NIGDSIPWIDFLDLQG
Sbjct  179   DVSLNVISRMVLGKKYLDESEDSKVSPNEFKKMLDELLLLNGVFNIGDSIPWIDFLDLQG  238

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             Y+KRMK L KKFDRFLEHVLDEHN RR AEG+ FVA DMVD+LLQLA+DP L+VKLERHG
Sbjct  239   YVKRMKILGKKFDRFLEHVLDEHNERRKAEGEKFVATDMVDVLLQLAEDPDLDVKLERHG  298

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKAFIQD+L GGTE STV +EWAIS+LL KPEIF+K T+ELDRVIG+ RWV+EKDMPNLP
Sbjct  299   VKAFIQDMLGGGTETSTVTIEWAISQLLMKPEIFQKVTEELDRVIGKNRWVQEKDMPNLP  358

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+AI KE MRLHPVAPMLVP   REDCKV  YDI +GTRVLVSVWT+ RDP LWD P E
Sbjct  359   YIEAIAKETMRLHPVAPMLVPGRAREDCKVGSYDITEGTRVLVSVWTIGRDPKLWDKPEE  418

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RFIG+DIDV+G DF+ LPFGAGRRMCPGYSLG KVI+A+L NLLHGF W LP  +T
Sbjct  419   FCPERFIGRDIDVEGHDFKFLPFGAGRRMCPGYSLGFKVIEATLANLLHGFTWTLPGKMT  478

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              + LNMEEIFGL+TPKKFPL TV +PRLP+ +Y +
Sbjct  479   KDDLNMEEIFGLTTPKKFPLVTVAQPRLPVEIYHL  513



>ref|XP_003547756.2| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=536

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/483 (76%), Positives = 419/483 (87%), Gaps = 3/483 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPKPWP+IGNLNLIGSLPH+SIH LS  YGPIM + FGS PVVVGSS +MAK  
Sbjct  57    KYNLPPGPKPWPIIGNLNLIGSLPHQSIHALSKTYGPIMHVWFGSNPVVVGSSVDMAKAI  116

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D     RPK AAGKYTTYNYSDITWS YGPYWRQARRMCL ELFSAKRLE YEYIR
Sbjct  117   LKTHDATLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLEEYEYIR  176

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              QEL+ +L +L+  +SA K ILL+D++S LSLNVIS MVLGK YL ESE A+VSP++F+K
Sbjct  177   KQELRGLLNELF--NSANKTILLKDHLSNLSLNVISRMVLGKKYLEESENAVVSPDDFKK  234

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDELFLLNGV NIGD IPW+DFLDLQGYIKRMKALSKKFD F+EHVLDEH  R+    D
Sbjct  235   MLDELFLLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHIERKKGVED  294

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
              +VAKDMVD+LLQLA+DP+LEVKLERHGVKAF QDL+AGGTE+S V VEWAI+ELL++PE
Sbjct  295   -YVAKDMVDVLLQLAEDPTLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAITELLRRPE  353

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             IFKKAT+ELDRVIG++RWVEEKD+ NLPY+ AI KE MRLHPVAPMLVPRL REDC+V G
Sbjct  354   IFKKATEELDRVIGRERWVEEKDIVNLPYVNAIAKEAMRLHPVAPMLVPRLAREDCQVGG  413

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT+VLV+VWT+ RDP++WDNP EF P+RF+ K+IDVKG D+ELLPFGAGRRMCPG
Sbjct  414   YDIPKGTQVLVNVWTIGRDPSIWDNPTEFQPERFLTKEIDVKGHDYELLPFGAGRRMCPG  473

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             Y LGLKVIQASL NLLHGFNW+LP++V  E LNM+EIFGLSTPKK PL TV+EPRLP HL
Sbjct  474   YPLGLKVIQASLANLLHGFNWRLPDNVKNEDLNMDEIFGLSTPKKIPLETVVEPRLPHHL  533

Query  1761  YSV  1769
             YS+
Sbjct  534   YSL  536



>ref|XP_004303697.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/479 (76%), Positives = 418/479 (87%), Gaps = 4/479 (1%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGPKPWP+IGNLNL+G LPHRS+H+LS KYGPIMQL+FGSFPVVVGSSAEMAK FLKT 
Sbjct  34    PPGPKPWPIIGNLNLMGHLPHRSLHELSQKYGPIMQLRFGSFPVVVGSSAEMAKAFLKTH  93

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D+   DRPK AAGKYTTYNYS+ITWSPYGPYWRQAR+MCL ELFSAKRLESYEYIR +E+
Sbjct  94    DVAVADRPKIAAGKYTTYNYSNITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRKEEM  153

Query  693   KSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDE  872
              ++LR LY +S+    ILL+ ++S LSLNVIS MVLGK Y +ESE AIV P+EF+KMLDE
Sbjct  154   NALLRGLYKSSNTN--ILLKAHLSDLSLNVISRMVLGKKYTDESENAIVRPDEFKKMLDE  211

Query  873   LFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVA  1052
             LFLL GVLNIGDSIPW++FLDLQGYIKRMKALSKKFDRFLEHVLDEH +   ++   FVA
Sbjct  212   LFLLTGVLNIGDSIPWLNFLDLQGYIKRMKALSKKFDRFLEHVLDEHISN--SKAPDFVA  269

Query  1053  KDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKK  1232
              DMVD+LLQLA DP+LEVKLERHGVKAF QDLLAGGTE+S + VEW +SE+L+KPEIFKK
Sbjct  270   TDMVDVLLQLAADPNLEVKLERHGVKAFSQDLLAGGTESSAMTVEWGMSEVLRKPEIFKK  329

Query  1233  ATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIP  1412
             AT+ELDRVIG++RWVEEKD+ NLPYI AI KE MRLHPVAP+LVPRL REDC++AGYDI 
Sbjct  330   ATEELDRVIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPLLVPRLAREDCQIAGYDIT  389

Query  1413  KGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLG  1592
             KGTRV+VS+W + RDP  WDNP EF P+RFIGKDIDVKG DFELLPFG+GRRMCPGYSLG
Sbjct  390   KGTRVIVSIWAIGRDPKYWDNPLEFSPERFIGKDIDVKGQDFELLPFGSGRRMCPGYSLG  449

Query  1593  LKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              K+IQ+S+ NLLHGFNW+ P+++  E L+MEEIFGLSTP+KFPL  V EPRLP HLYS+
Sbjct  450   HKLIQSSIANLLHGFNWRFPDNMKKEDLSMEEIFGLSTPRKFPLIAVTEPRLPAHLYSM  508



>ref|XP_010033730.1| PREDICTED: cytochrome P450 71A1-like [Eucalyptus grandis]
 gb|KCW53529.1| hypothetical protein EUGRSUZ_J02808 [Eucalyptus grandis]
Length=509

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/481 (75%), Positives = 413/481 (86%), Gaps = 3/481 (1%)
 Frame = +3

Query  327   HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLK  506
             +LPPGPKPWP+IGNLNLIGSLPHRS+H+L+  YGP+MQ+QFGSFPVVVGSS EMA+ FLK
Sbjct  32    NLPPGPKPWPIIGNLNLIGSLPHRSLHELTKTYGPLMQVQFGSFPVVVGSSVEMARAFLK  91

Query  507   TMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQ  686
             T D+ F  RPKTAAGKYTTYNYSDITWSPYGPYWRQAR++C+ ELFSAKRLESYEYIR++
Sbjct  92    THDVTFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKLCIMELFSAKRLESYEYIRTE  151

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKML  866
             EL S+L  LY +  AQ  + L+D+++ LSLNVIS MVLGK Y  E+E +IV P+EF+KML
Sbjct  152   ELMSLLGSLYVSRGAQ--LTLKDHLTDLSLNVISRMVLGKKYTEETENSIVKPDEFKKML  209

Query  867   DELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSF  1046
             DELFLLNG LNIGDSIPW+DFLDLQGYIKRMKALSKKFDRFLEHVLDEH+ RR    + +
Sbjct  210   DELFLLNGALNIGDSIPWLDFLDLQGYIKRMKALSKKFDRFLEHVLDEHDERRRGVPN-Y  268

Query  1047  VAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIF  1226
             VAKDMVD+LLQ ADDP+L+VKLER GVK F QDL+AGGTE+S V VEWAISELLK+PEIF
Sbjct  269   VAKDMVDVLLQFADDPNLDVKLERKGVKGFTQDLIAGGTESSAVTVEWAISELLKRPEIF  328

Query  1227  KKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYD  1406
             KKAT+ELDRVIG+ RWV EKD+ NLPYI AI KE MRLHPVAPMLVPR+ REDC + GYD
Sbjct  329   KKATEELDRVIGRDRWVSEKDIANLPYIDAIAKETMRLHPVAPMLVPRMAREDCNINGYD  388

Query  1407  IPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYS  1586
             IPKGTR+LV VWT+ RDP +WD P EF P+RF+  D DVKG  FELLPFG+GRRMCPGYS
Sbjct  389   IPKGTRILVLVWTIGRDPKIWDAPEEFRPERFLEHDFDVKGQSFELLPFGSGRRMCPGYS  448

Query  1587  LGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LGLKVIQASL NLLHGFNWKLP  ++ E L+MEEIFGLSTPKK PL  V EPRLP H+YS
Sbjct  449   LGLKVIQASLANLLHGFNWKLPEGMSNEDLDMEEIFGLSTPKKIPLVAVAEPRLPEHMYS  508

Query  1767  V  1769
             +
Sbjct  509   I  509



>ref|XP_009401319.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/505 (73%), Positives = 427/505 (85%), Gaps = 7/505 (1%)
 Frame = +3

Query  267   WVSTIALLLLAKHLRW----RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             WV    ++L+   LR     RRKL+LPPGP+ WP+IGNLNLIGSLPHRS+H LS KYGPI
Sbjct  6     WVMCSTIILVIVFLRALAGRRRKLNLPPGPRAWPIIGNLNLIGSLPHRSLHALSQKYGPI  65

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M L+FGSFPVVVGSS EMAK FLKT D++FV RPKTAAGKYTTYNYSDITWSPYGPYWRQ
Sbjct  66    MYLRFGSFPVVVGSSVEMAKFFLKTHDVSFVSRPKTAAGKYTTYNYSDITWSPYGPYWRQ  125

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             AR+MCL ELFSAKRLESYEYIR +E++++LR L+ +S     +LL+D++ST+SLNVIS M
Sbjct  126   ARKMCLLELFSAKRLESYEYIRVEEVRALLRDLFRSSGGI--VLLKDHLSTVSLNVISRM  183

Query  795   VLGKSYLNESE-GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALS  971
             VLGK YL+ +E  AIVSP EF++MLDELFLLNGV+NIGDSIPW+D LDLQGYI+RMK LS
Sbjct  184   VLGKKYLDRTEVAAIVSPEEFKEMLDELFLLNGVMNIGDSIPWLDGLDLQGYIRRMKKLS  243

Query  972   KKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLL  1151
             KKFDRFLEHVLDEHN RR  EG+ FVA+DMVD+LLQLADDP+L+VKLERHGVKAF QDL+
Sbjct  244   KKFDRFLEHVLDEHNERRQREGEGFVARDMVDVLLQLADDPNLDVKLERHGVKAFTQDLI  303

Query  1152  AGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEV  1331
             AGGTE+S V VEWAISELL +PE+ +KAT+ELDRV+G+ RWVEE+D+  LPY++AIVKE 
Sbjct  304   AGGTESSAVTVEWAISELLMRPEVLEKATEELDRVVGRGRWVEERDVSRLPYVEAIVKET  363

Query  1332  MRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGK  1511
             MRLHPVAPMLVPRL RE   V GYDIP G RVLVSVW + RDP++WD P EF P+RF+G 
Sbjct  364   MRLHPVAPMLVPRLSREHTTVDGYDIPAGARVLVSVWAIGRDPSVWDAPEEFRPERFVGS  423

Query  1512  DIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEI  1691
              IDVKG DFELLPFGAGRRMCPGYSLGLKVIQ SL NLLHGF W+LP  +  E+L+MEEI
Sbjct  424   QIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQLSLANLLHGFEWRLPAGMKAEELSMEEI  483

Query  1692  FGLSTPKKFPLTTVIEPRLPMHLYS  1766
             FGLSTP+K PL  V++P+L  HLY 
Sbjct  484   FGLSTPRKVPLEVVVKPKLSAHLYG  508



>gb|EYU21317.1| hypothetical protein MIMGU_mgv1a004638mg [Erythranthe guttata]
Length=517

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 426/498 (86%), Gaps = 7/498 (1%)
 Frame = +3

Query  291   LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVV  470
              LAK  R  + L LPPGPKPWPVIGNLNLIG LPHRS+H LS KYGP+M L+FGS P+VV
Sbjct  22    FLAKLFRRPKNLRLPPGPKPWPVIGNLNLIGELPHRSLHHLSQKYGPLMHLRFGSCPIVV  81

Query  471   GSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSA  650
             GSS + AK FLKTMD  F  RPKTAAGKYTTYNYSDITWSPYGPYWRQAR+MCL ELFSA
Sbjct  82    GSSVDTAKIFLKTMDATFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSA  141

Query  651   KRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE-SE  827
             KRLESYEYIR +E+ S+++++Y   +A KP  L+D++ST+SLNVIS MVLGK YL+E +E
Sbjct  142   KRLESYEYIRLEEMNSLIKEVY--KTAGKPFPLKDFLSTVSLNVISRMVLGKRYLDEGNE  199

Query  828   GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLD  1007
              A+VSP EF+KM+DELFLLNGVLN+GD IPW+ FLDLQGY+KRMK +S+KFDRFLEHVLD
Sbjct  200   NAVVSPEEFKKMIDELFLLNGVLNVGDLIPWLGFLDLQGYVKRMKIVSRKFDRFLEHVLD  259

Query  1008  EHNARR----VAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENST  1175
             EH  RR     A  D     DMVDLLL+LA+DP+LEVKLERHGVKAF QDLLAGGTE+S 
Sbjct  260   EHEERRRGRKTAAEDCGGGGDMVDLLLELAEDPTLEVKLERHGVKAFTQDLLAGGTESSA  319

Query  1176  VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAP  1355
             V VEWAISE+LKKP+IF KAT+ELDRVIGQ  WV+EKD+ NLPYI+AI+KE MRLHPVAP
Sbjct  320   VTVEWAISEILKKPKIFIKATEELDRVIGQNNWVKEKDIINLPYIEAIIKETMRLHPVAP  379

Query  1356  MLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCD  1535
             MLVPR+ REDCKV GYDI KGT+VLV+VWT+ RDPA+W NPNEF P+RFIGKDIDVKG D
Sbjct  380   MLVPRMSREDCKVDGYDIEKGTQVLVNVWTIGRDPAIWVNPNEFWPERFIGKDIDVKGQD  439

Query  1536  FELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKK  1715
             FELLPFG+GRRMCPGYSLGLKVIQ+SL NLLHGFNWKLP+++ PE L+M+EIFGLSTP+K
Sbjct  440   FELLPFGSGRRMCPGYSLGLKVIQSSLANLLHGFNWKLPDNMKPEDLDMDEIFGLSTPRK  499

Query  1716  FPLTTVIEPRLPMHLYSV  1769
              PL TV+ PRLP+ LYS+
Sbjct  500   VPLVTVVGPRLPLELYSL  517



>gb|ABA01477.1| cytochrome P450 DDWF1 [Gossypium hirsutum]
Length=497

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/498 (75%), Positives = 421/498 (85%), Gaps = 4/498 (1%)
 Frame = +3

Query  276   TIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGS  455
             T   +LL+   R RRKL+ PPGPKPWPVIGNL+LIGSLPHRSIH LS KYGP+MQL+FGS
Sbjct  2     TQQAILLSLRFRPRRKLNFPPGPKPWPVIGNLDLIGSLPHRSIHALSQKYGPLMQLKFGS  61

Query  456   FPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLT  635
             FPVVV SS EMAK FLKT D+ F  RPK AAG+YTTYNYSDITWSPYGPYWRQAR+MC+T
Sbjct  62    FPVVVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDITWSPYGPYWRQARKMCMT  121

Query  636   ELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYL  815
             ELFSAKRLESYEYIR +E+K +L+ LY +S    PI+L+D +S LSLNVIS MV GK Y 
Sbjct  122   ELFSAKRLESYEYIRREEMKLLLKGLYESSGV--PIVLKDRLSDLSLNVISRMVFGKKYT  179

Query  816   NES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFL  992
               + E  IV+P EF++MLDELFLLNGVL+IGDSIPW+ FLDLQG IKRMKALSKKFD+FL
Sbjct  180   EGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQGNIKRMKALSKKFDKFL  239

Query  993   EHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENS  1172
             EHVLDEHNARR    D + AKDMVD+LLQLADDP+L+VKLERHGVKAF QDL+AGGTE+S
Sbjct  240   EHVLDEHNARRRDVKD-YAAKDMVDVLLQLADDPNLDVKLERHGVKAFSQDLIAGGTESS  298

Query  1173  TVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVA  1352
              V VEWAISE+LKKPEIF KAT ELDRVIG++RWVEE+D  NLPYI +I KE MRLHPVA
Sbjct  299   AVTVEWAISEMLKKPEIFAKATGELDRVIGRERWVEERDTVNLPYIDSIAKETMRLHPVA  358

Query  1353  PMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGC  1532
             PMLVPR+ REDC+V GYDI KGTR LV+VWT+ RDP +WDNPNEF P+RFI K IDVKG 
Sbjct  359   PMLVPRMTREDCQVDGYDILKGTRALVNVWTIGRDPTVWDNPNEFCPERFIDKTIDVKGH  418

Query  1533  DFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPK  1712
             DF+LLPFGAGRRMCPGY LG+KVIQASL NLLHGF WKLP ++T E L+MEEIFGLSTPK
Sbjct  419   DFQLLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWKLPGNMTKENLDMEEIFGLSTPK  478

Query  1713  KFPLTTVIEPRLPMHLYS  1766
             K PL  V  P+LP+HLYS
Sbjct  479   KCPLQAVAVPKLPLHLYS  496



>emb|CBI35858.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/512 (72%), Positives = 423/512 (83%), Gaps = 38/512 (7%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             + TW SY AAW++T+AL+LL+ HLR RRKL+LPPGPKPWP+IGNLNLIG+LPHRSIH+LS
Sbjct  3     SGTWASYVAAWLATVALILLSTHLRRRRKLNLPPGPKPWPIIGNLNLIGALPHRSIHELS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFPVVVGSS  MAK FLKT D+ F  RPKTAAGKYTTYNYSDITWSPY
Sbjct  63    QKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MCL ELFSA+RLESYEYIR +E KS+L  LY  S++  P+ L+D++ST+SL
Sbjct  123   GPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQSNS--PVDLKDHLSTVSL  180

Query  777   NVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             NVIS MVLGK YL+E+ EG+IV+P EF+KMLDELFLL+GVLNIGDSIPWIDFLDLQGY+K
Sbjct  181   NVISRMVLGKKYLDENVEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVK  240

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK LSKKFDRFLEHVLDEHNARR    +++VAKDMVD+LLQ ADDP+LEVKLERHGVKA
Sbjct  241   RMKVLSKKFDRFLEHVLDEHNARRKGV-ENYVAKDMVDVLLQFADDPTLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISELL+KPE+F KAT+ELDRVIG++RWVEEKD+PNLPY+ 
Sbjct  300   FTQDLIAGGTESSAVTVEWAISELLRKPELFDKATEELDRVIGKERWVEEKDIPNLPYLD  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
              IVKE MR+HPVAPML+                                  WD PNEFIP
Sbjct  360   TIVKETMRMHPVAPMLI----------------------------------WDQPNEFIP  385

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIGK+IDVKG DFELLPFG GRRMCPGYSLGLKVIQ+SL NLLHGF WKLP D+ P  
Sbjct  386   ERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWKLPGDMKPGD  445

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEEIFGLSTPKK PL  + EPRLP HLY +
Sbjct  446   LSMEEIFGLSTPKKIPLVAMAEPRLPAHLYDM  477



>ref|XP_011035728.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Populus euphratica]
Length=511

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/510 (74%), Positives = 437/510 (86%), Gaps = 6/510 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             TW+SYA AW++T++L+LLA  LR RRKL+ PPGPKPWP+IGNLNLIG LPHRS+H LS K
Sbjct  3     TWVSYAFAWLATVSLILLASRLR-RRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQK  61

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQ+QFGSFPVVVGSS EMAKT LKT D+ F  RPKTAAGKYTTYNYSDITWSPYGP
Sbjct  62    YGPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGP  121

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCL ELFSAKRLESYEYIR +ELK++L+ L  +S   +PI L+D+++ +SLNV
Sbjct  122   YWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLNKSSG--RPINLKDHLADVSLNV  179

Query  783   ISWMVLGKSYL---NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             IS MVLGK Y    +E+E  IV+P EF++MLDELFLLNGVL+IGDSIPWI FLDLQGYIK
Sbjct  180   ISRMVLGKKYTVKSSENEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIK  239

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK LSKKFD+F+EHVLDEH +RR  E  ++  KDMVD+LLQLA DP+LEVKLERHGVKA
Sbjct  240   RMKTLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISE+L+KPE+F+KA++ELDRVIG++RWVEEKDM NLPYI 
Sbjct  300   FSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMVNLPYIY  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AI KEVMRLHPVAPMLVPR  RED  V GYDI KG+RVLV+VWT+ RDP +WD P+EF P
Sbjct  360   AIAKEVMRLHPVAPMLVPRAAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFCP  419

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIG  IDV+G D+ELLPFGAGRRMCPGY LGLKVIQA+L NLLHGF W+LP+ V  E 
Sbjct  420   ERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGVRKED  479

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             L+MEEIFGLSTPKK+PL  V EPRLP H+Y
Sbjct  480   LSMEEIFGLSTPKKYPLVAVAEPRLPAHVY  509



>ref|XP_007135432.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
 gb|ESW07426.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
Length=512

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/481 (75%), Positives = 417/481 (87%), Gaps = 3/481 (1%)
 Frame = +3

Query  327   HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLK  506
             +LPPGPKPWP+IGNLNLIG LPHRSIH+LS KYGPI+ + FGS PVVVGSS +MAK FLK
Sbjct  35    NLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIVHVWFGSNPVVVGSSVDMAKAFLK  94

Query  507   TMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQ  686
             T D     RPK +AGKYTTYNY+DITWS YGPYWRQARRMCL ELFS KRLE YEYIR Q
Sbjct  95    THDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRKQ  154

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKML  866
             EL+S+L +L+   SA K ILL+D++S LSLNVI  MVLGK+YL ESE A+VSP EF++M+
Sbjct  155   ELRSLLNKLF--HSADKTILLKDHLSNLSLNVICRMVLGKNYLEESENAVVSPEEFKRMI  212

Query  867   DELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSF  1046
             DELFLLNGVLNIGD IPWI+FLDLQGYIKRMK+  KKFDRFLEHVLDEH  R+    D +
Sbjct  213   DELFLLNGVLNIGDFIPWINFLDLQGYIKRMKSCGKKFDRFLEHVLDEHIERKKGVKD-Y  271

Query  1047  VAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIF  1226
             VAKDMVD+LLQLA+DP+LEVKLER GVKAF QDL+AGGTE+S V VEWAISELL++PEIF
Sbjct  272   VAKDMVDVLLQLAEDPTLEVKLERQGVKAFTQDLIAGGTESSAVTVEWAISELLRRPEIF  331

Query  1227  KKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYD  1406
             KKAT+ELDRVIG++RWVEEKD+ +LPY+ AIVKEVMRLHPVAPMLVPR+ REDC++ GYD
Sbjct  332   KKATEELDRVIGRERWVEEKDIVDLPYVNAIVKEVMRLHPVAPMLVPRMAREDCQIGGYD  391

Query  1407  IPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYS  1586
             IPKGT+VLV VW + RDPA+WD+PNEF P+RF+ K+IDVKG ++ELLPFGAGRRMCPGY 
Sbjct  392   IPKGTQVLVHVWAIGRDPAIWDSPNEFQPERFLAKEIDVKGHNYELLPFGAGRRMCPGYP  451

Query  1587  LGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LGLKVIQASL NLLHGFNW+LP +V  E LNMEEIFGLSTPKK PL TV++PRLP HLYS
Sbjct  452   LGLKVIQASLANLLHGFNWRLPQNVQTEDLNMEEIFGLSTPKKIPLETVLQPRLPHHLYS  511

Query  1767  V  1769
             +
Sbjct  512   L  512



>ref|XP_011035730.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Populus euphratica]
Length=511

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/510 (73%), Positives = 438/510 (86%), Gaps = 6/510 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             TW+SYA AW++T++L+LLA  LR RRKL+ PPGPKPWP+IGNLNLIG LPHRS+H LS K
Sbjct  3     TWVSYAFAWLATVSLILLASRLR-RRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQK  61

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQ+QFGSFPVVVGSS EMAKT LKT D+ F  RPKTAAGKYTTYNYSDITWSPYGP
Sbjct  62    YGPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGP  121

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR+MCL ELFSAKRLESYEYIR +ELK++L+ L+ +S   +PI L+D+++ +SLNV
Sbjct  122   YWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHKSSG--RPINLKDHLADVSLNV  179

Query  783   ISWMVLGKSYL---NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             IS MVLGK Y    +E+E  IV+P EF++MLDELFLLNGVL+IGDSIPW+ FLDLQG+IK
Sbjct  180   ISRMVLGKKYTVKSSENEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWVAFLDLQGHIK  239

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMK LSKKFD+F+EHVLDEH +RR  E  ++  KDMVD+LLQLA DP+LEVKLERHGVKA
Sbjct  240   RMKVLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QDL+AGGTE+S V VEWAISE+L+KPE+F+KA++ELDRVIG++RWVEEKDM NLPYI 
Sbjct  300   FSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMVNLPYIY  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AI KEVMRLHPVAPMLVPR  RED  V GYDI KG+RVLV+VWT+ RDP +WD P+EF P
Sbjct  360   AIAKEVMRLHPVAPMLVPRAAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFCP  419

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RFIG  IDV+G D+ELLPFGAGRRMCPGY LGLKVIQA+L NLLHGF W+LP+ V  E 
Sbjct  420   ERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGVRKED  479

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             L+MEEIFGLSTPKK+PL  V EPRLP H+Y
Sbjct  480   LSMEEIFGLSTPKKYPLVAVAEPRLPAHVY  509



>ref|XP_011071968.1| PREDICTED: cytochrome P450 71A1 [Sesamum indicum]
Length=507

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/509 (71%), Positives = 431/509 (85%), Gaps = 9/509 (2%)
 Frame = +3

Query  258   AAAWVSTIALLL----LAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             A  W + ++LL+    LAK LR RRKL+LPPGPKPWPVIGNLNLIGSLPH+S+H+LS KY
Sbjct  3     AKIWSACLSLLVFVYVLAKILR-RRKLNLPPGPKPWPVIGNLNLIGSLPHKSLHELSQKY  61

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             GP+M LQFGS PVVVGSS EMAK  LKTMD+NF  RP+TAAGKYTTYNYSDITWSPYGPY
Sbjct  62    GPLMHLQFGSCPVVVGSSVEMAKVILKTMDVNFSSRPRTAAGKYTTYNYSDITWSPYGPY  121

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
              +QAR+MCLTELFS KRLESYEYIR +E+ S+L+ LY +S   +PI L+DY+ST++L+VI
Sbjct  122   LKQARKMCLTELFSNKRLESYEYIRVEEINSMLKSLYKSSG--QPIFLKDYLSTVTLSVI  179

Query  786   SWMVLGKSYLN-ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMK  962
             S MVLGK YL+ ++E A+VS +EF+KMLDEL  LNGV+N+GD IPW+ F DLQGY+KRMK
Sbjct  180   SRMVLGKKYLDKDNENAVVSLDEFKKMLDELIYLNGVINVGDVIPWLSFFDLQGYVKRMK  239

Query  963   ALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQ  1142
              +SKK DRFLEHVLDEH  RR  + + +V++DMVD+LL+ A+DP+LEVK+ERH VKA  Q
Sbjct  240   IVSKKLDRFLEHVLDEHQERR-RKVEGYVSRDMVDVLLEQAEDPTLEVKMERHNVKALTQ  298

Query  1143  DLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIV  1322
             DLLAGGTE+S V VEWAISELLKKPEIFKKAT+E+DRVIGQ RWV+EKDMPNLPY++AIV
Sbjct  299   DLLAGGTESSAVTVEWAISELLKKPEIFKKATEEIDRVIGQNRWVQEKDMPNLPYVEAIV  358

Query  1323  KEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRF  1502
             KE MRLHPVAP+L+PRL REDCKVAGYDI KGT+V V+ WT+  DP+LW+NP +F P+RF
Sbjct  359   KETMRLHPVAPLLMPRLVREDCKVAGYDIKKGTQVFVNTWTIGTDPSLWENPTDFCPERF  418

Query  1503  IGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNM  1682
             I K ID KG DF+ LPFG+GRRMCP YSLG++VI +SL NLLHGFNWKLPN + PE LNM
Sbjct  419   IEKAIDAKGHDFQFLPFGSGRRMCPAYSLGMRVISSSLANLLHGFNWKLPNKMRPEDLNM  478

Query  1683  EEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             EEIFGLSTP+KFPL  V EPRLP  +Y++
Sbjct  479   EEIFGLSTPRKFPLAAVAEPRLPPEVYNL  507



>ref|XP_003627305.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|ABC59081.1| cytochrome P450 monooxygenase CYP92A29 [Medicago truncatula]
 gb|AET01781.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=512

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/505 (72%), Positives = 421/505 (83%), Gaps = 6/505 (1%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLRWRRKLH---LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             +WV+  A  ++      R + H   LPPGPKPWP+IGNLNLIGSLPH+S+H L+ KYGPI
Sbjct  11    SWVTLFATFVILLLFSRRLRRHKYNLPPGPKPWPIIGNLNLIGSLPHQSLHGLTQKYGPI  70

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M L FGS PV+VG++ E+AK+FLKT D     RPK +AGKYTTYNYSDITWS YGPYWRQ
Sbjct  71    MHLYFGSKPVIVGATVELAKSFLKTHDATLAGRPKLSAGKYTTYNYSDITWSQYGPYWRQ  130

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             ARRMCL ELFSAKRLESYEYIR QE+   L +L+  +S  K IL++D++STLSLNVIS M
Sbjct  131   ARRMCLLELFSAKRLESYEYIRKQEMHDFLHKLF--NSKNKTILVKDHLSTLSLNVISRM  188

Query  795   VLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSK  974
             VLGK YL +++ A++SP+EF+KMLDELFLLNG+LNIGD IPWI FLDLQGY+KRMK LSK
Sbjct  189   VLGKKYLEKTDNAVISPDEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYVKRMKTLSK  248

Query  975   KFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLA  1154
             KFDRF+EHVL+EH  RR    D +VAKDMVD+LLQLA+DP+LEVKLERHGVKAF QDL+A
Sbjct  249   KFDRFMEHVLEEHIERRKNVKD-YVAKDMVDVLLQLAEDPNLEVKLERHGVKAFTQDLIA  307

Query  1155  GGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVM  1334
             GGTE+S V VEWAISEL++KPEIFKKAT+ELDRVIG+ RWVEEKD+ NLPY+ AI KE M
Sbjct  308   GGTESSAVTVEWAISELVRKPEIFKKATEELDRVIGKDRWVEEKDIANLPYVYAIAKETM  367

Query  1335  RLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD  1514
             RLHPVAP LVPR  REDCKV GYDIPKGT VLV+ WT+ARD  +W+NP EF+P+RF+GKD
Sbjct  368   RLHPVAPFLVPREAREDCKVDGYDIPKGTIVLVNTWTIARDSEVWENPYEFMPERFLGKD  427

Query  1515  IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIF  1694
             IDVKG DFELLPFGAGRRMCPGY LG+KVIQ SL NLLHGFNW LPN+V  E LNMEEIF
Sbjct  428   IDVKGHDFELLPFGAGRRMCPGYPLGIKVIQTSLANLLHGFNWTLPNNVKKEDLNMEEIF  487

Query  1695  GLSTPKKFPLTTVIEPRLPMHLYSV  1769
             GLSTPKK PL  V+EPRL  HLYS+
Sbjct  488   GLSTPKKIPLEIVVEPRLADHLYSL  512



>ref|XP_004144428.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=503

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/479 (75%), Positives = 415/479 (87%), Gaps = 3/479 (1%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGPKPWP+IGNL+LIGSLPH+SIH LS KYGPIM L+FGSFPVVVGSS EMAK FLKT 
Sbjct  28    PPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  87

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D+NFV RPKTAAGKYTTY+YS+ITWS YGPYWRQAR+MCL ELFSA+RL+SYEYIR +E+
Sbjct  88    DLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKEEM  147

Query  693   KSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDE  872
               ++R++Y   S  + I ++DY+  +SLNVIS MVLGK Y + SE  IVSP+EF+KMLDE
Sbjct  148   NGLIREIY--KSCGEVIKVKDYLFAVSLNVISRMVLGKKYTDGSENGIVSPDEFKKMLDE  205

Query  873   LFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVA  1052
             LFLL+GVLNIGDSIPWIDFLDLQGY+KRMKALSKKFDRFLE VLDEHN RR    +++VA
Sbjct  206   LFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLERVLDEHNERRKGV-ENYVA  264

Query  1053  KDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKK  1232
             KDMVD+LLQLADDP LEVKLERHG+KAF QDL+AGGTE+S V VEWAISELLKKPEIF K
Sbjct  265   KDMVDVLLQLADDPDLEVKLERHGIKAFTQDLIAGGTESSAVTVEWAISELLKKPEIFNK  324

Query  1233  ATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIP  1412
             A +ELDRVIG++RWVEEKD+ NLPYI AI KE MRLHPVAPMLVPR+ RED ++AGYDI 
Sbjct  325   AREELDRVIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPMLVPRMAREDSQIAGYDIA  384

Query  1413  KGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLG  1592
             KGTRVLV+VWT+ RDP +W++P EF P+RF+GK+IDVKG DFELLPFG+GRRMCPGY+LG
Sbjct  385   KGTRVLVNVWTIGRDPTVWEDPLEFKPERFMGKNIDVKGQDFELLPFGSGRRMCPGYNLG  444

Query  1593  LKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             LKVIQ+SL NLLHGF WKL  D+  E LNM+E+FGLSTPKKFPL  V EPRL   LYS+
Sbjct  445   LKVIQSSLANLLHGFTWKLSGDMKIEDLNMDEVFGLSTPKKFPLDVVAEPRLSSSLYSI  503



>ref|XP_004168558.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=508

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/504 (75%), Positives = 436/504 (87%), Gaps = 4/504 (1%)
 Frame = +3

Query  258   AAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIM  437
              AAW++T+A+LLL++ LR RRKL+LPPGPKPWP+IGNL+LIGSLPH+SIH LS KYGPIM
Sbjct  9     VAAWIATLAILLLSRRLR-RRKLNLPPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIM  67

Query  438   QLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQA  617
              L+FGSFPVVVGSS EMAK FLKT D+NFV RPKTAAGKYTTY+YS+ITWS YGPYWRQA
Sbjct  68    HLRFGSFPVVVGSSVEMAKIFLKTQDLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQA  127

Query  618   RRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMV  797
             R+MCL ELFSAKRL+SYEYIR +E+  +L ++Y   S  + I ++DY+ST+SLNVIS MV
Sbjct  128   RKMCLMELFSAKRLDSYEYIRKEEMNGLLGEIY--KSCGEVIKVKDYLSTVSLNVISRMV  185

Query  798   LGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKK  977
              GK Y + SE  IVSP+EF+KMLDELFLL+GVLNIGDSIPWIDFLDLQGY+KRMKALSKK
Sbjct  186   XGKKYTDGSENGIVSPDEFKKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKK  245

Query  978   FDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAG  1157
             FDRFLE VLDEHN RR    +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QDL+AG
Sbjct  246   FDRFLERVLDEHNERRKGV-ENYVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAG  304

Query  1158  GTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMR  1337
             GTE+S V VEWAISELLKKPEIF KA +ELDRVIG++RWVEEKD+ NLPYI AI KE MR
Sbjct  305   GTESSAVTVEWAISELLKKPEIFNKAREELDRVIGRERWVEEKDIVNLPYIDAIAKETMR  364

Query  1338  LHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDI  1517
             LHPVAPMLVPR+ RED ++AGYDI KGTRVLV+VWT+ RDP +W++P EF P+RF+GK+I
Sbjct  365   LHPVAPMLVPRMAREDSQIAGYDIAKGTRVLVNVWTIGRDPTVWEDPLEFKPERFMGKNI  424

Query  1518  DVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFG  1697
             DVKG DFELLPFG+GRRMCPGY+ GLKVIQ+SL NLLHGF WKL  D+  E LNM+E+FG
Sbjct  425   DVKGQDFELLPFGSGRRMCPGYNHGLKVIQSSLANLLHGFTWKLSGDMKIEDLNMDEVFG  484

Query  1698  LSTPKKFPLTTVIEPRLPMHLYSV  1769
             LSTPKKFPL  V EPRL   LYS+
Sbjct  485   LSTPKKFPLDVVAEPRLSSSLYSI  508



>gb|KHF98582.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/511 (72%), Positives = 432/511 (85%), Gaps = 4/511 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             T +WI+Y  AW++T+AL+LL+ HLR  RKL+LPPGPKPWP+IGNLNLIGSLPH+SIH LS
Sbjct  3     TTSWIAYLTAWLATLALILLSLHLRRCRKLNLPPGPKPWPIIGNLNLIGSLPHQSIHALS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFP+VV SS EMAK  LKT D  F DRPKTAAGKYTTYNYSDITWS Y
Sbjct  63    QKYGPIMQLKFGSFPIVVASSVEMAKAILKTNDAIFSDRPKTAAGKYTTYNYSDITWSSY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR+MCLTELFSAKRLESYEYIR +E   +L++LY +S  Q  I+L++++ +L+L
Sbjct  123   GPYWRQARKMCLTELFSAKRLESYEYIRKEERNLLLKRLYESSGTQ--IVLKEHLLSLNL  180

Query  777   NVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             NVIS MV GK Y   + +  IV+PNEF +ML+ELF LNGVL+IGDSIPW+ FLDLQGYIK
Sbjct  181   NVISRMVFGKKYTEGTGKNEIVTPNEFNEMLNELFFLNGVLDIGDSIPWLSFLDLQGYIK  240

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMKALSKKFDRFLEHVLDEHNARR    D +VAKDMVD+LLQL+++P+LEVKLERHGVKA
Sbjct  241   RMKALSKKFDRFLEHVLDEHNARRKRVKD-YVAKDMVDVLLQLSEEPNLEVKLERHGVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F QD++A GT++S V VEWAI+ELL+KPEI  KA +ELD+VIG+++WV EKD+ NLPYI+
Sbjct  300   FSQDIIAAGTDSSAVTVEWAITELLRKPEILAKAMEELDKVIGREQWVGEKDIGNLPYIK  359

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             +I KE MRLHPVAPMLVP +  +DC++AGYDIPKGTR LV++WT+ RDP LWD PNEF P
Sbjct  360   SIAKEAMRLHPVAPMLVPHVASQDCEIAGYDIPKGTRALVNIWTIGRDPNLWDKPNEFWP  419

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             DRFIGK IDVKG DFELLPFG+GRR CPGY L +KVIQASL N+LHGFNWKLP   T + 
Sbjct  420   DRFIGKSIDVKGHDFELLPFGSGRRKCPGYPLAIKVIQASLANILHGFNWKLPAKTTKDD  479

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LNMEE+FGLST KK PL  V EPRLP+H+YS
Sbjct  480   LNMEELFGLSTSKKHPLVVVAEPRLPLHMYS  510



>ref|XP_011036442.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=532

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/516 (73%), Positives = 440/516 (85%), Gaps = 9/516 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W+SYA AW++T++L+LLA  LR RRKL+ PPGPKPWP+IGNLNLIG LPHRS+
Sbjct  21    METPT--WMSYAFAWLATVSLILLASRLR-RRKLNPPPGPKPWPIIGNLNLIGELPHRSL  77

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP+MQ++FGSFPVVVGSS EMAKT LKT D+ F  RPKTAAGKYTTYNYSDIT
Sbjct  78    HALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDIT  137

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR+MCL ELFSAKRLESYEYIR +EL+++L+ L  +S   +PI L+D+++
Sbjct  138   WSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTLNKSSG--RPINLKDHLA  195

Query  765   TLSLNVISWMVLGKSYL---NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
              +SLNVIS MVLGK Y    +E+E  IV+P EF++MLDELFLLNGVL+IGDSIPWI FLD
Sbjct  196   DVSLNVISRMVLGKKYTVKSSENEKEIVTPVEFKEMLDELFLLNGVLDIGDSIPWIAFLD  255

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGYIKRMK LSKKFD+F+EHVLDEH ARR  E  ++  KDMVD+LLQLA DP+LE+KLE
Sbjct  256   LQGYIKRMKTLSKKFDKFMEHVLDEHEARR-REDKNWEPKDMVDVLLQLASDPNLEIKLE  314

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             RHGVKAF QDL+AGGTE+S V VEWAISE+L+KPE+F+KAT+ELDRVIG++RWVEEKDM 
Sbjct  315   RHGVKAFSQDLIAGGTESSAVTVEWAISEILRKPEVFEKATEELDRVIGRERWVEEKDMV  374

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             NLPYI AI KEVMRLHPVAPMLVPR  RED  + GYDI KG+RVLV+VWT+ RDP +WD 
Sbjct  375   NLPYIYAIAKEVMRLHPVAPMLVPRAAREDININGYDIKKGSRVLVNVWTIGRDPKVWDK  434

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             P+EF P+RFIG  IDV+G D+ELLPFGAGRRMCPGY LGLKVIQA+L NLLHGF W+LP+
Sbjct  435   PDEFFPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPD  494

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
                 E LNM+EIFGLSTPKK+PL  V EPRLP H+Y
Sbjct  495   GQKKEDLNMDEIFGLSTPKKYPLVAVAEPRLPAHVY  530



>gb|AJD25214.1| cytochrome P450 CYP92A73 [Salvia miltiorrhiza]
Length=509

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/497 (74%), Positives = 430/497 (87%), Gaps = 4/497 (1%)
 Frame = +3

Query  276   TIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGS  455
             T   L + K +   +KL+ PPGPKPWPVIGNLNLIGSLPH S+H LS KYGPIM L+FGS
Sbjct  15    TFLSLHILKKILQNKKLNPPPGPKPWPVIGNLNLIGSLPHHSLHSLSQKYGPIMLLKFGS  74

Query  456   FPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLT  635
              PVVVGSS   AK FLKTMD+ F  RPKT+AGK TTYNYSDITWSPYGPYWRQAR+MCL 
Sbjct  75    APVVVGSSVAAAKIFLKTMDLTFASRPKTSAGKITTYNYSDITWSPYGPYWRQARKMCLM  134

Query  636   ELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYL  815
             ELFSA+RLESYEYIR++E+ S+L++L+  S   +P LL+D +ST+SLNVIS MVLG+ YL
Sbjct  135   ELFSARRLESYEYIRAEEMSSLLKELFGFSG--RPFLLKDCLSTVSLNVISRMVLGRRYL  192

Query  816   NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLE  995
             +  E A+VSP EF+KMLDELFLLNGVLNIGD IP+I+FLDLQGY+KRMK +SKKFDRFLE
Sbjct  193   DGDENAVVSPEEFKKMLDELFLLNGVLNIGDLIPYINFLDLQGYVKRMKVVSKKFDRFLE  252

Query  996   HVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENST  1175
             HVLDEH ARR      +V++DMVD+LL+LA+DP+LEVKLERHGVKAF QDLLAGGTE+S 
Sbjct  253   HVLDEHEARR--RTTEYVSRDMVDVLLELAEDPTLEVKLERHGVKAFTQDLLAGGTESSA  310

Query  1176  VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAP  1355
             V VEWAISELLKKPEIFKKAT+ELDRVIG  RWV+EKD+P+LPY++AIVKE MRLHPVAP
Sbjct  311   VTVEWAISELLKKPEIFKKATEELDRVIGPTRWVKEKDIPSLPYVEAIVKETMRLHPVAP  370

Query  1356  MLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCD  1535
             MLVPRL REDCKV GYDI KGT+VLV+ WT+ RDP++W+NPNEF PDRFIGK+IDVKG D
Sbjct  371   MLVPRLAREDCKVDGYDIKKGTQVLVNTWTIQRDPSIWENPNEFNPDRFIGKNIDVKGQD  430

Query  1536  FELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKK  1715
             FELLPFG+GRRMCPGY+LGLKVIQ+SL NLLHGFNW+LP+ + P +LNMEEIFGLSTP+K
Sbjct  431   FELLPFGSGRRMCPGYALGLKVIQSSLANLLHGFNWRLPDKMKPAELNMEEIFGLSTPRK  490

Query  1716  FPLTTVIEPRLPMHLYS  1766
             FPL  V EPRLP++LY+
Sbjct  491   FPLVAVAEPRLPLNLYN  507



>ref|XP_003528553.1| PREDICTED: flavonoid 3'-monooxygenase [Glycine max]
Length=516

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/481 (77%), Positives = 419/481 (87%), Gaps = 3/481 (1%)
 Frame = +3

Query  327   HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLK  506
             +LPPGPKPWP+IGNLNLIGSLPHRSIH LS KYGPIM + FGS  VVVGSS E+AK  LK
Sbjct  39    NLPPGPKPWPIIGNLNLIGSLPHRSIHTLSKKYGPIMHVWFGSSSVVVGSSVEIAKAVLK  98

Query  507   TMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQ  686
             T D     RPK AAGKYTTYNYSDITWS YGPYWRQARRMCL ELFSAKRL+ YEYIR Q
Sbjct  99    THDATLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLQEYEYIRKQ  158

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKML  866
             EL+ +L +L+  +SA K ILL+D++S+LSLNVIS MVLGK YL ES+ A+VSP+EF+KML
Sbjct  159   ELRCLLNELF--NSANKTILLKDHLSSLSLNVISRMVLGKKYLEESQNAVVSPDEFKKML  216

Query  867   DELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSF  1046
             DELFLLNGV NIGD IPWIDFLDLQGYIKRMK LSKKFD F+EHVLDEH  R+    D +
Sbjct  217   DELFLLNGVYNIGDFIPWIDFLDLQGYIKRMKTLSKKFDMFMEHVLDEHIERKKGIKD-Y  275

Query  1047  VAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIF  1226
             VAKDMVD+LLQLA+DP+LEVKLERHGVKAF QDL+AGGTE+S V VEWAISELL++PEIF
Sbjct  276   VAKDMVDVLLQLAEDPTLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRRPEIF  335

Query  1227  KKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYD  1406
             KKAT+ELDRVIG++RWVEEKD+ NLPY+ AIVKE MRLHPVAPMLVPRL REDC + GYD
Sbjct  336   KKATEELDRVIGRERWVEEKDIVNLPYVNAIVKEAMRLHPVAPMLVPRLAREDCNLGGYD  395

Query  1407  IPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYS  1586
             IPKGT+VLV+VWT+ RDP++WDNPNEF P+RF+ K+IDVKG D+ELLPFGAGRRMCPGY 
Sbjct  396   IPKGTQVLVNVWTIGRDPSIWDNPNEFQPERFLNKEIDVKGHDYELLPFGAGRRMCPGYP  455

Query  1587  LGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LGLKVIQASL NLLHGFNW+LP++V  E LNM+EIFGLSTPKK PL TV+EPRLP HLYS
Sbjct  456   LGLKVIQASLANLLHGFNWRLPDNVRKEDLNMDEIFGLSTPKKLPLETVVEPRLPYHLYS  515

Query  1767  V  1769
             +
Sbjct  516   L  516



>emb|CDP17539.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/485 (73%), Positives = 419/485 (86%), Gaps = 4/485 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +KL+LPPGPKPWP++GNLNLIGSL HRS+H LS+ YGP+M L+FGSFPVVVGSS  MAK 
Sbjct  40    KKLNLPPGPKPWPIVGNLNLIGSLSHRSLHQLSLTYGPLMHLRFGSFPVVVGSSMMMAKV  99

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKTMD+ F DRPKTAAGKYT+YN SDI WSPYG YWRQAR+MCL ELFSAKRLESYE+I
Sbjct  100   FLKTMDVTFADRPKTAAGKYTSYNCSDIMWSPYGAYWRQARKMCLMELFSAKRLESYEHI  159

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES-EGAIVSPNEF  854
             R +E+ S+L  L+   S  KP+LL+DY++T+SLNVIS MVLGK YL+ES + +I++P EF
Sbjct  160   RVEEMNSLLLGLF--QSLGKPVLLKDYLTTMSLNVISRMVLGKRYLDESDQNSIITPEEF  217

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHN-ARRVA  1031
              KM+DEL LLNGV NIGDSIPW++FLDLQGYIKRMK LSKKFD FLEHVLDEHN AR   
Sbjct  218   VKMMDELLLLNGVFNIGDSIPWLNFLDLQGYIKRMKILSKKFDWFLEHVLDEHNVARMRN  277

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
             +  + V+KDMVD+LL LA+  + EVKLERHGVKAF QDLL GGTE+S + VEWAISELLK
Sbjct  278   DEQNQVSKDMVDVLLDLAEHQTSEVKLERHGVKAFTQDLLVGGTESSALTVEWAISELLK  337

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             KPE+FKKAT +LDRVIGQ RWV EKD+PNLPY++AIVKE MR+HPV PMLVPR  REDC 
Sbjct  338   KPELFKKATQQLDRVIGQNRWVTEKDIPNLPYVEAIVKETMRMHPVVPMLVPRCAREDCN  397

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDI KGTRVL++VW++ RDP LW +P EF P+RFIGK+IDVKG D+ELLPFG+GRRM
Sbjct  398   VAGYDIQKGTRVLINVWSIGRDPELWKDPQEFYPERFIGKEIDVKGQDYELLPFGSGRRM  457

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLGLKV+Q++L NLLHG+NWKLP+D+ PE+L+MEEIFGLSTP+KFPL T++EPRLP
Sbjct  458   CPGYSLGLKVVQSTLANLLHGYNWKLPSDMNPEELDMEEIFGLSTPRKFPLVTIVEPRLP  517

Query  1752  MHLYS  1766
              HLYS
Sbjct  518   HHLYS  522



>gb|AFK47419.1| unknown [Medicago truncatula]
Length=512

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/505 (72%), Positives = 420/505 (83%), Gaps = 6/505 (1%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLRWRRKLH---LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             +WV+  A  ++      R + H   LPPGPKPWP+IGNLNLIGSLPH+S+H L+ KYGPI
Sbjct  11    SWVTLFATFVILLLFSRRLRRHKYNLPPGPKPWPIIGNLNLIGSLPHQSLHGLTQKYGPI  70

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M L FGS PV+VG++ E+AK+FLKT D     RPK +AGKYTTYNYSDITWS YGPYWRQ
Sbjct  71    MHLYFGSKPVIVGATVELAKSFLKTHDATLAGRPKLSAGKYTTYNYSDITWSQYGPYWRQ  130

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             ARRMCL ELFSAKRLESYEYIR QE+   L +L+  +S  K IL++D++STLSLNVIS M
Sbjct  131   ARRMCLLELFSAKRLESYEYIRKQEMHDFLHKLF--NSKNKTILVKDHLSTLSLNVISRM  188

Query  795   VLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSK  974
             VLGK YL +++ A++SP+EF+KMLDELFLLNG+LNIGD IPWI FLDLQGY+KRMK LSK
Sbjct  189   VLGKKYLEKTDNAVISPDEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYVKRMKTLSK  248

Query  975   KFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLA  1154
             KFDRF+EHVL+EH  RR    D +VAKDMVD+LLQLA+DP+LEVKLERHGVKAF QDL+A
Sbjct  249   KFDRFMEHVLEEHIERRKNVKD-YVAKDMVDVLLQLAEDPNLEVKLERHGVKAFTQDLIA  307

Query  1155  GGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVM  1334
             GGTE+S V VEWA+SEL++KPEIFKKAT+ELDRVIG+ RWVEEKD+ NLPY+ AI KE M
Sbjct  308   GGTESSAVTVEWAVSELVRKPEIFKKATEELDRVIGKDRWVEEKDIANLPYVYAIAKETM  367

Query  1335  RLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD  1514
             RLHPVAP LVPR  REDCKV GYDIPKGT VLV+ WT+ARD  +W+NP EF+P+ F+GKD
Sbjct  368   RLHPVAPFLVPREAREDCKVDGYDIPKGTIVLVNTWTIARDSEVWENPYEFMPEGFLGKD  427

Query  1515  IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIF  1694
             IDVKG DFELLPFGAGRRMCPGY LG+KVIQ SL NLLHGFNW LPN+V  E LNMEEIF
Sbjct  428   IDVKGHDFELLPFGAGRRMCPGYPLGIKVIQTSLANLLHGFNWTLPNNVKKEDLNMEEIF  487

Query  1695  GLSTPKKFPLTTVIEPRLPMHLYSV  1769
             GLSTPKK PL  V+EPRL  HLYS+
Sbjct  488   GLSTPKKIPLEIVVEPRLADHLYSL  512



>gb|AER39774.1| CYP92A44-4 [Festuca rubra subsp. commutata]
Length=516

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/520 (69%), Positives = 430/520 (83%), Gaps = 12/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S+    ++T+  L      R  RK +LPPGPK WP+IGNLNL+G+LPHRSI
Sbjct  1     MEFPQ--WASFLGVVLATVLFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS +YGP++QLQFGSFP VVGSS EMAK FLKT D++F DRPK A+GK+TTYNYSDIT
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQ--KPILLRDY  758
             WSPYG YWRQAR+MCLTELFSA+RL SYEYIRS+E+ +++R L+  ++A   + ++L+DY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDY  178

Query  759   MSTLSLNVISWMVLGKSYLNE-----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWI  923
             +ST+SLNVI+ MV+GK YL +     S   I +P+EF+ M+DELFLLNGVLNIGDSIPW+
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWL  238

Query  924   DFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLE  1103
             D++DLQGYIKRMK LSK FDRFLEHV+DEH+ RR  +G+SFVAKDMVD+LLQ A DP+LE
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRRDGESFVAKDMVDVLLQFASDPNLE  298

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             VKL R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F +AT+ELDRV+G+ RW+ E
Sbjct  299   VKLNRDGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWITE  358

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KDMP+LPY+ AIVKE MRLHPVAPMLVPRL RED  +AGYDIP GTRVLVSVW++ RDP 
Sbjct  359   KDMPSLPYVDAIVKETMRLHPVAPMLVPRLSREDTTIAGYDIPAGTRVLVSVWSIGRDPE  418

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             LWD P EF+P+RFIG  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W
Sbjct  419   LWDVPEEFMPERFIGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEW  478

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             KLP+ V   +LNMEEIFGLSTP+KFPL  V+EP+LP HLY
Sbjct  479   KLPDGV---ELNMEEIFGLSTPRKFPLEAVVEPKLPAHLY  515



>gb|AER39773.1| CYP92A44-3 [Festuca rubra subsp. commutata]
Length=516

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/520 (69%), Positives = 427/520 (82%), Gaps = 12/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S+    ++T+  L+     R  RK +LPPGPK WP+IGNLNLIG+LPHRSI
Sbjct  1     MEFPQ--WASFLGVVLATVLFLMAVLQRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS +YGP++QLQFGSFP VVGSS EMAK FLKT D+ F DRPK AAGK+TTYNYSDIT
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASS--AQKPILLRDY  758
             WSPYG YWRQAR+MCLTELFSA+RL+SYEYIRS+E+ ++LR L+  ++  A + ++L+DY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDY  178

Query  759   MSTLSLNVISWMVLGKSYLNE-----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWI  923
             +ST+SLNVI+ MV+GK YL +     S   I +P+EF+ M+DELFLLNGVLNIGDSIPW+
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWL  238

Query  924   DFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLE  1103
             D++DLQGYIKRMK LSK FDRFLEHV+DEH+ RR  E +SFVAKDMVD+LLQ A +P LE
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLE  298

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             VKL R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F +AT+ELDRV+G+ RWV E
Sbjct  299   VKLNREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTE  358

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KDMP+LPY+ AIVKE MRLHPVAPMLVPRL RE   + GYDIP GTRVLVSVWT+ RDP 
Sbjct  359   KDMPSLPYVDAIVKETMRLHPVAPMLVPRLSREVTTIGGYDIPAGTRVLVSVWTIGRDPE  418

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             LWD P EF+P+RF+G  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W
Sbjct  419   LWDAPEEFMPERFLGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEW  478

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             KLP+ V   +L+MEEIFGLSTP+KFPL  V+EP+LP HLY
Sbjct  479   KLPDGV---ELSMEEIFGLSTPRKFPLEAVVEPKLPAHLY  515



>ref|XP_004510480.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=511

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/483 (74%), Positives = 410/483 (85%), Gaps = 3/483 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPKPWP+IGN NLIG LPH+SIH L+ KYGP+M L+FGS PV+VGS+ ++A+ F
Sbjct  32    KYNLPPGPKPWPIIGNFNLIGPLPHQSIHGLTQKYGPMMYLRFGSKPVIVGSTVKIAQAF  91

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D     RP  +AGKYTTYNYSDITWS YGPYWRQARRMCL ELFSAKRLESYEYIR
Sbjct  92    LKTHDAALAGRPNLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIR  151

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              QEL+ +L  L+  +S  K ILL+D+++TLSLNVIS MVLGK YL E+E AI+SP+EF+K
Sbjct  152   KQELRVLLHGLF--NSKNKTILLKDHLTTLSLNVISRMVLGKKYLEETENAIISPDEFKK  209

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDELFLLNGVLNIGD IPWI FLDLQGY+KRMK L KKFDRF+EHVL+EH  RR    D
Sbjct  210   MLDELFLLNGVLNIGDFIPWIHFLDLQGYVKRMKTLGKKFDRFMEHVLEEHIERRKNVKD  269

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
              FVAKDMVD+LLQLADDP LEVKLERHGVKAF QDL+AGGTE+S V VEWAISEL+K+PE
Sbjct  270   -FVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELVKRPE  328

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             IFKKATDELD+VIG+ RWVEEKD+ NLPY+ AI KE MRLHPVAPMLVPR  REDC V G
Sbjct  329   IFKKATDELDKVIGKDRWVEEKDIVNLPYVYAIAKETMRLHPVAPMLVPRQAREDCNVDG  388

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKG+ +LV+ WT+ RD  +W+NP EF+P+RF+ KDIDVKG DFELLPFGAGRRMCPG
Sbjct  389   YDIPKGSLILVNTWTIGRDSNIWENPYEFMPERFLDKDIDVKGHDFELLPFGAGRRMCPG  448

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             Y LG+KVIQ+SL NLLHG+NWKLPN+V  E LNMEE+FGLSTPKK PL  V+EPRLP HL
Sbjct  449   YPLGIKVIQSSLANLLHGYNWKLPNNVKKEDLNMEEVFGLSTPKKIPLQVVVEPRLPHHL  508

Query  1761  YSV  1769
             YS+
Sbjct  509   YSL  511



>ref|XP_003578185.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=521

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/522 (69%), Positives = 430/522 (82%), Gaps = 12/522 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRW---RRKLHLPPGPKPWPVIGNLNLIGSLPH  395
             ME P   W S+    ++T+  L      R    +R  +LPPGPKPWP+IGNLNLIG+LPH
Sbjct  1     MELPQ--WASFLGVVLATVVFLKAVLRRRGGSPKRTYNLPPGPKPWPIIGNLNLIGTLPH  58

Query  396   RSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYS  575
             RSIH LS +YGP+MQLQFGSFPVVVGSS +MAK FLKT D+ F DRPKTAAGK+TTY+YS
Sbjct  59    RSIHALSKQYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKHTTYDYS  118

Query  576   DITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRD  755
             DITWSPYG YWRQAR++CLTELFSAKRLESYEYIR +E+ ++LR L+ AS   + ++L+D
Sbjct  119   DITWSPYGAYWRQARKICLTELFSAKRLESYEYIRGEEVLALLRDLHGASG--RVVVLKD  176

Query  756   YMSTLSLNVISWMVLGKSYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPW  920
             ++ST+SLNVI+ MV+GK YL     +E+   I +P+EF+ MLDELFLLNGVLNIGDSIPW
Sbjct  177   FLSTVSLNVITRMVMGKKYLEKEVKDEAGAVITTPDEFKWMLDELFLLNGVLNIGDSIPW  236

Query  921   IDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSL  1100
             +D++DLQGYIKRMK LSK FDRFLEHV+DEH+ R   EG+ FVAKDMVD+LLQ+A DP L
Sbjct  237   LDWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERCRREGEGFVAKDMVDVLLQVASDPDL  296

Query  1101  EVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVE  1280
             EVKL R GVKAF QD++AGGTE+S V VEWA+SELLKKPE+F KAT+ELDRV+G+ RWV 
Sbjct  297   EVKLNREGVKAFTQDMIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVT  356

Query  1281  EKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDP  1460
             EKDM +LPY++AIVKE MRLHPVAP+LVPRL RED  + G+DIP GTRVLVSVW++ RDP
Sbjct  357   EKDMASLPYVEAIVKETMRLHPVAPLLVPRLSREDTSIGGHDIPAGTRVLVSVWSIGRDP  416

Query  1461  ALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFN  1640
             ALWD P EF P+RF+G  IDVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF 
Sbjct  417   ALWDKPEEFAPERFLGSRIDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFA  476

Query  1641  WKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             W+LP+ VT E+L+MEEIFGLSTP+K PL  V+EP+LP  LY+
Sbjct  477   WRLPDGVTKEELSMEEIFGLSTPRKSPLEAVVEPKLPAQLYA  518



>emb|CDP12827.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/516 (69%), Positives = 427/516 (83%), Gaps = 6/516 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLL-LAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRS  401
             MES +  W + A  WV+T+ ++  L+KH   ++KL+LPPGP+ WP+IGNLNLIG+LPHRS
Sbjct  1     MESFSPNWAACALVWVATVVIITQLSKHFH-QKKLNLPPGPRQWPIIGNLNLIGTLPHRS  59

Query  402   IHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDI  581
             +H LS+ YGP+M LQFGSFPVVVGSS EMAK FLKTMD+ F  RPKTAAGKY TYNYSD+
Sbjct  60    LHHLSLTYGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDLTFAGRPKTAAGKYITYNYSDL  119

Query  582   TWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYM  761
              WSPYGPY  QAR++ LTELFSAKRLESYE+I+ +E+ S+L QL+ +S   KP++L+DY+
Sbjct  120   LWSPYGPYCCQARKIFLTELFSAKRLESYEHIQVEEMNSLLLQLFKSSG--KPVVLKDYL  177

Query  762   STLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             ST SLNVIS MVLGK+Y++ESE +IV+P EFR+M+DE FLL GV NIGD IPWIDFLDLQ
Sbjct  178   STGSLNVISRMVLGKTYIDESENSIVTPEEFRQMMDEFFLLTGVFNIGDFIPWIDFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GYIKRMK LSKKFDRFLEHVLDEHNA+R  E +  V+KD+VD+LL LADDP+LEVKLER 
Sbjct  238   GYIKRMKILSKKFDRFLEHVLDEHNAQRKDETNC-VSKDLVDVLLGLADDPTLEVKLERR  296

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
              VKA   DLL  GTE S + +EWAISELLK PEIF KA +ELDRVIGQ RWV+EKDMPNL
Sbjct  297   EVKALTLDLLTAGTETSAITIEWAISELLKNPEIFDKAGEELDRVIGQNRWVKEKDMPNL  356

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PYI+AIVKE MR+HP A +L PR  REDCKVAGYDI KGTRV V+VW++ RDP LW+ P 
Sbjct  357   PYIEAIVKETMRMHPAA-LLTPRCAREDCKVAGYDIQKGTRVAVNVWSIGRDPELWEKPE  415

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF PDRF+GKDID KG D + LPFGAGRRMCP YSLGLKV+Q+SL NLLHG+ WKLPND+
Sbjct  416   EFWPDRFMGKDIDFKGQDCKFLPFGAGRRMCPAYSLGLKVVQSSLANLLHGYRWKLPNDM  475

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              PE L+MEEIFG++TP+K PL  ++EPRLP +LYS+
Sbjct  476   KPEDLDMEEIFGITTPRKIPLVAIVEPRLPCNLYSL  511



>emb|CCP37679.1| cytochrome P450 [Lolium sp. CD-2012]
Length=519

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/522 (69%), Positives = 428/522 (82%), Gaps = 13/522 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S+ A  ++T+  L      R   K +LPPGPK WP+IGNLNLIG+LPHRSI
Sbjct  1     MELPQ--WASFLAVVLATVIFLKAVLRRRSSCKYNLPPGPKAWPIIGNLNLIGALPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS  YGP+MQLQFGSFP VVGSS +MAK FLKT D+ F DRPK AAGK+TTYNYSDIT
Sbjct  59    HALSKHYGPLMQLQFGSFPCVVGSSVDMAKFFLKTHDVVFTDRPKFAAGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY---TASSAQKPILLRD  755
             WSPYG YWRQAR+MCLTELFSA+RL+SYEYIRS+E+ ++LR L+   TA+ A + ++++D
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHNGATAAGAGRTLVIKD  178

Query  756   YMSTLSLNVISWMVLGKSYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPW  920
             Y+ST+SLNVI+ MV+GK YL     +ES   I +P+EF+ M+DELFLLNGVLNIGDSIP 
Sbjct  179   YLSTVSLNVITRMVMGKKYLEKEVRDESGALITTPDEFKWMIDELFLLNGVLNIGDSIPC  238

Query  921   IDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSL  1100
             +D++DLQGY+KRMK LSK FDRFLEHV+DEH+ +R  +G+SFVAKDMVD+LLQ A +P L
Sbjct  239   LDWMDLQGYMKRMKKLSKMFDRFLEHVVDEHSEQRRRDGESFVAKDMVDVLLQFASNPDL  298

Query  1101  EVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVE  1280
             EVKL R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F KAT+ELDRV+G+ RWV 
Sbjct  299   EVKLNREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRDRWVT  358

Query  1281  EKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDP  1460
             EKDMP+LPY+ AIVKE MRLHPVAPMLVPRL RED  + GYDIP GTR LVSVW++ RDP
Sbjct  359   EKDMPSLPYMDAIVKETMRLHPVAPMLVPRLSREDTSIGGYDIPAGTRGLVSVWSIGRDP  418

Query  1461  ALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFN  1640
              LWD P EF+P+RFIG  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF 
Sbjct  419   ELWDAPEEFMPERFIGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFE  478

Query  1641  WKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             WKLP+ V   +LNMEEIFGLSTP+KFPL  V+EP+LP HLY+
Sbjct  479   WKLPDGV---ELNMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>gb|AER39771.1| CYP92A44-1 [Festuca rubra subsp. commutata]
Length=516

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/520 (69%), Positives = 425/520 (82%), Gaps = 12/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S+    ++T+  L      R  RK +LPPGPK WP+IGNLNLIG+LPHRSI
Sbjct  1     MEFPQ--WASFLVVVLATVLFLKAVLRRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS +YGP++QLQFGSFP VVGSS EMAK FLKT D+ F DRPK AAGK+TTYNYSDIT
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASS--AQKPILLRDY  758
             WSPYG YWRQAR+MCLTELFSA+RL+SYEYIRS+E+ ++LR L+  ++  A + ++L+DY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDY  178

Query  759   MSTLSLNVISWMVLGKSYLNE-----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWI  923
             +ST+SLNVI+ MV+GK YL +     S   I +P+EF+ M+DELFLLNGVLNIGDSIPW+
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDGSGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWL  238

Query  924   DFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLE  1103
             D++DLQGYIKRMK LSK FDRFLEHV+DEH+ RR  E +SFVAKDMVD+LLQ A +P LE
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLE  298

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             VKL R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F +AT+ELDRV+G+ RWV E
Sbjct  299   VKLNREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTE  358

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KDMP+LPY+ AIVKE MRLHPVAPMLVPRL RE   + GYDIP GTRVLVSVWT+ RDP 
Sbjct  359   KDMPSLPYVDAIVKETMRLHPVAPMLVPRLSREVTTIGGYDIPAGTRVLVSVWTIGRDPE  418

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             LWD P EF+P+RF+G  +DVKG D+ELLPFG+GRRMCPGYS GLKVIQ SL NLLHGF W
Sbjct  419   LWDAPEEFMPERFLGSRLDVKGQDYELLPFGSGRRMCPGYSPGLKVIQVSLANLLHGFEW  478

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             KLP+ V   +L+MEEIFGLSTP+KFPL  V+EP+LP HLY
Sbjct  479   KLPDGV---ELSMEEIFGLSTPRKFPLEAVVEPKLPAHLY  515



>gb|AER39772.1| CYP92A44-2 [Festuca rubra subsp. commutata]
Length=516

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/520 (68%), Positives = 428/520 (82%), Gaps = 12/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S+    ++T+  L      R  RK +LPPGPK WP+IGNLNL+G+LPHRSI
Sbjct  1     MEFPQ--WASFLGVVLATVLFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSI  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS +YGP++QLQFGSFP VVGSS EMAK FLKT D++F DRPK A+GK+TTYNYSDIT
Sbjct  59    HALSKQYGPLLQLQFGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQ--KPILLRDY  758
             WSPYG YWRQAR+MCLTELFSA+RL SYEYIRS+E+ +++R L+  ++A   + ++L+DY
Sbjct  119   WSPYGAYWRQARKMCLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDY  178

Query  759   MSTLSLNVISWMVLGKSYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWI  923
             +ST+SLNVI+ MV+GK YL     +ES   I +P+EF+ M+DELFLLNGVLNIGDSIP +
Sbjct  179   LSTVSLNVITRMVMGKKYLEKEVRDESGAVITTPDEFKWMIDELFLLNGVLNIGDSIPCL  238

Query  924   DFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLE  1103
             D++DLQGYIKRMK LSK FDRFLEHV++EH+ RR  +G+SFVAKDMVD+LLQ A +P LE
Sbjct  239   DWMDLQGYIKRMKKLSKMFDRFLEHVVEEHSERRRRDGESFVAKDMVDVLLQFASNPDLE  298

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             VKL R GVKAF QDL+AGGTE+S V VEWA+SELLKKPE+F +AT+ELDRV+G+ RWV E
Sbjct  299   VKLNREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTE  358

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KDMP+LPY+ AIVKE MRLHPVAPMLVPRL RED  + GYDIP GTRVLVSVW++ RDP 
Sbjct  359   KDMPSLPYVDAIVKETMRLHPVAPMLVPRLSREDTSIGGYDIPAGTRVLVSVWSIGRDPE  418

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             LW+ P EF+P+RFIG  +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W
Sbjct  419   LWEAPEEFMPERFIGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEW  478

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             KLP+ V   +L+MEEIFGLSTP+KFPL  V+EP+LP HLY
Sbjct  479   KLPHGV---ELSMEEIFGLSTPRKFPLEAVLEPKLPAHLY  515



>ref|XP_011071969.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=507

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/506 (70%), Positives = 428/506 (85%), Gaps = 9/506 (2%)
 Frame = +3

Query  267   WVSTIALLL----LAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             W S ++L++    L K LR R KL+LPPGP+PWPVIGNLNLIG LPHRSIH+L+ KYGP+
Sbjct  6     WFSCLSLIVFVYVLTKVLR-REKLNLPPGPRPWPVIGNLNLIGPLPHRSIHELAQKYGPL  64

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             + L+FGS  VVVGS+ EMAK FLKTMD+NF  RP TAAGKYT YNY+DITW+PYGPYWRQ
Sbjct  65    IHLKFGSASVVVGSNVEMAKVFLKTMDVNFASRPVTAAGKYTGYNYTDITWAPYGPYWRQ  124

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             ARRMCL ELFSAKRLESYEYIR +E+ S+L+ ++      +PIL++DY+ST++LNVIS M
Sbjct  125   ARRMCLMELFSAKRLESYEYIRIEEMNSLLKNMFKCCG--QPILVKDYLSTVTLNVISRM  182

Query  795   VLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALS  971
             VLGK YL++  E  +V+P EF+KMLDELFLLNGV+N+GD IPWI FLDLQGY+KRMK + 
Sbjct  183   VLGKRYLDKDIENPVVAPQEFKKMLDELFLLNGVINVGDLIPWISFLDLQGYVKRMKIVH  242

Query  972   KKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLL  1151
             KKFD+FLEHVLDEH  RR +  + +V++DMVD+LL+LA+DP+LEVKLERHGVK  I DLL
Sbjct  243   KKFDKFLEHVLDEHQERRRSI-EGYVSRDMVDVLLELAEDPTLEVKLERHGVKGHILDLL  301

Query  1152  AGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEV  1331
             AGGTE+STV + WAISELLK+P+ FKKAT+ELDRVIG+ RWV+E+DMPNLPYIQAI+KE 
Sbjct  302   AGGTESSTVTIIWAISELLKQPKYFKKATEELDRVIGRNRWVKEQDMPNLPYIQAIMKET  361

Query  1332  MRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGK  1511
             MRLHP+AP+L PRL REDCKVAGYDI KGT+V V+VWT+  DP++W+NP EF PDRFI K
Sbjct  362   MRLHPIAPILTPRLAREDCKVAGYDIKKGTQVFVNVWTIGLDPSIWENPTEFNPDRFIKK  421

Query  1512  DIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEI  1691
              IDV+G DFELLPFGAGRRMCPGYSLGLKVI +SL NL+HGFNWKLP+ + PE LNMEE+
Sbjct  422   PIDVRGHDFELLPFGAGRRMCPGYSLGLKVILSSLANLIHGFNWKLPDPMKPEDLNMEEV  481

Query  1692  FGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             FGLS P+K PL  V EPRLP+ +Y++
Sbjct  482   FGLSVPRKVPLVAVPEPRLPLEVYNL  507



>ref|XP_004148565.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004165405.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=513

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/515 (72%), Positives = 432/515 (84%), Gaps = 6/515 (1%)
 Frame = +3

Query  231   SPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHD  410
              PT + +SY   W++T+A+LLL++ LR RRKL+LPPGPKPWPVIGNL+LIGSLPH+SIH 
Sbjct  2     QPTPSCLSYITPWIATLAILLLSRRLR-RRKLNLPPGPKPWPVIGNLDLIGSLPHQSIHQ  60

Query  411   LSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWS  590
             LS KYGPIM L+FGSFP+VVGSS EMAK FLKT D+NF  RPKT AGKYTTYN+S+ITWS
Sbjct  61    LSKKYGPIMHLRFGSFPIVVGSSVEMAKLFLKTQDLNFASRPKTTAGKYTTYNHSNITWS  120

Query  591   PYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTL  770
              YGPYW Q R+MCL ELFSA+RL+SYEYIR +E+  ++R++Y   S  + I ++DY+  +
Sbjct  121   QYGPYWGQLRKMCLMELFSARRLDSYEYIRKEEMNGLIREIY--KSCGEVIKVKDYLFAV  178

Query  771   SLNVISWMVLGKSYLNE-SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             SLNVIS MVLGK Y +E SE  IVSP+EFRKM+DELFLLNGVLNIGDSIPW+DFLDLQGY
Sbjct  179   SLNVISRMVLGKKYTDEPSESGIVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGY  238

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             +KRMK LSKK DRFLEHVLDEH  RR    +++VAKDMVD+LLQLADDP LEVKLERHGV
Sbjct  239   VKRMKGLSKKLDRFLEHVLDEHKERRKGV-ENYVAKDMVDVLLQLADDPDLEVKLERHGV  297

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAF QDLL GG E+STV VEW ISELLK PEI  KAT+EL++VIG++RWVEEKDM NLPY
Sbjct  298   KAFTQDLLGGGIESSTVTVEWTISELLKTPEILNKATEELNKVIGKERWVEEKDMINLPY  357

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI KE MRLHPVAPMLVPR+ REDC+VAGYDI KGTRVLV+VWT+ RD  +W NP+ F
Sbjct  358   INAIAKETMRLHPVAPMLVPRMAREDCQVAGYDIAKGTRVLVNVWTIGRDQTVWKNPHAF  417

Query  1488  IPDRFIGKD-IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
              PDRF+  + IDVKG DFELLPFG+GRRMCPGYSLGLKVI ++L NLLHGFNWKLP D+ 
Sbjct  418   DPDRFMENNCIDVKGEDFELLPFGSGRRMCPGYSLGLKVILSTLANLLHGFNWKLPGDME  477

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              E LNMEE FGLSTPKK+PL  V EPRLP HLYS+
Sbjct  478   KEDLNMEESFGLSTPKKYPLDAVAEPRLPPHLYSL  512



>gb|AGV54723.1| flavonoid 3'-monooxygenase-like protein [Phaseolus vulgaris]
Length=511

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/481 (74%), Positives = 410/481 (85%), Gaps = 4/481 (1%)
 Frame = +3

Query  327   HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLK  506
             +LPPGPKPWP+IGNLNLIG LPHRSIH+LS KYGPIM + FGS PVVVGSS +MAK FLK
Sbjct  35    NLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIMHVWFGSNPVVVGSSVDMAKAFLK  94

Query  507   TMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQ  686
             T D     RPK +AGKYTTYNY+DITWS YGPYWRQARRMCL ELFS KRLE YEYIR Q
Sbjct  95    THDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRKQ  154

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKML  866
             EL+ +L +L+   SA K ILL+D++S LSLNV+   V GK+YL +S+    SP EF++M+
Sbjct  155   ELRCLLNKLF--HSADKTILLKDHLSNLSLNVLCRKVFGKNYLEKSKTP-GSPEEFKRMI  211

Query  867   DELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSF  1046
             DELFLLNGV NIGD IPW+DFLDLQGYIKRMKALSKKFD F+EHVLDEH  R+    D +
Sbjct  212   DELFLLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHFERKKGVKD-Y  270

Query  1047  VAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIF  1226
             VAKDMVD+ LQLA+DP+LEVKLER GVKAF QDL+AGGTE+S V VEWAISELL++PEIF
Sbjct  271   VAKDMVDVFLQLAEDPTLEVKLERQGVKAFTQDLIAGGTESSAVTVEWAISELLRRPEIF  330

Query  1227  KKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYD  1406
             KKAT+ELDRVIG++RWVEEKD+ +LPY+ AIVKEVMRLHPVAPMLVPR+ REDC++ GYD
Sbjct  331   KKATEELDRVIGRERWVEEKDIVDLPYVNAIVKEVMRLHPVAPMLVPRMAREDCQIGGYD  390

Query  1407  IPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYS  1586
             IPKGT+VLV VW + RDPA+WD+PNEF P+RF+ K+IDVKG ++ELLPFGAGRRMCPGY 
Sbjct  391   IPKGTQVLVHVWAIGRDPAIWDSPNEFQPERFLAKEIDVKGHNYELLPFGAGRRMCPGYP  450

Query  1587  LGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LGLKVIQASL NLLHGFNW+LP +V  E LNMEEIFGLSTPKK PL TV+EPRLP HLYS
Sbjct  451   LGLKVIQASLANLLHGFNWRLPQNVQTEDLNMEEIFGLSTPKKIPLETVLEPRLPHHLYS  510

Query  1767  V  1769
             +
Sbjct  511   L  511



>ref|XP_004165407.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=516

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/515 (71%), Positives = 421/515 (82%), Gaps = 5/515 (1%)
 Frame = +3

Query  231   SPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHD  410
              P  + +SY    +     LLL      RRKL+LPPGPKPWP+IGNL+LIGSLPH+SIH 
Sbjct  4     QPIPSCLSYVTTSIIATLALLLLSRCLRRRKLNLPPGPKPWPIIGNLDLIGSLPHQSIHQ  63

Query  411   LSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWS  590
             LS KYGPIM L+FGSFPVVVGSS EMAK  LKT D+NFV RPKTAAGKYTTYNYS+ITWS
Sbjct  64    LSKKYGPIMHLRFGSFPVVVGSSVEMAKIVLKTQDLNFVWRPKTAAGKYTTYNYSNITWS  123

Query  591   PYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTL  770
              YGPYWRQ R+MCL ELFSA+RL+SYEYIR +E+  ++R++Y   S  + I ++DY+  L
Sbjct  124   QYGPYWRQLRKMCLMELFSARRLDSYEYIRKEEMNGLIREIY--KSCGEVIKVKDYLFAL  181

Query  771   SLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             SLNVIS MVLGK Y +ES E  IVSP+EFRKM+DELFLLNGVLNIGDSIPW+DFLDLQGY
Sbjct  182   SLNVISRMVLGKRYTDESSESGIVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGY  241

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             +KRMK LSKK DRFLEHVLDEH  RR    +++VAKDMVD+LLQLAD P LEVKLERHGV
Sbjct  242   VKRMKGLSKKLDRFLEHVLDEHKERRKGV-ENYVAKDMVDVLLQLADHPDLEVKLERHGV  300

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAF QDLL GGTE ST+ +EWA+SELLK P+IF KAT EL++VIG++RWVEEKDM NLPY
Sbjct  301   KAFTQDLLGGGTETSTITIEWAMSELLKNPKIFNKATIELNKVIGKERWVEEKDMINLPY  360

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI KE MRLHPV PMLVPR+  EDC++AGYDI KGTRVLV+VWT+ RD  +W NP+ F
Sbjct  361   INAIAKETMRLHPVVPMLVPRMAGEDCQIAGYDIAKGTRVLVNVWTIGRDQTVWKNPHAF  420

Query  1488  IPDRFI-GKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
              PDRFI    +DVKG DFELLPFG+GRRMCPGYSLGLKVI ++L NLLHGFNWKLP D+ 
Sbjct  421   DPDRFIENSRVDVKGQDFELLPFGSGRRMCPGYSLGLKVILSTLANLLHGFNWKLPGDME  480

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              E LNMEEIFGLSTPKK+PL  V EPRLP HLYS+
Sbjct  481   KEDLNMEEIFGLSTPKKYPLDAVAEPRLPPHLYSL  515



>ref|XP_010685305.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/517 (68%), Positives = 436/517 (84%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+PT  W +YAAAW+ +IAL++L+ HLR RRKL+LPPGPKPWP+IGN NLIGSLPHRS+
Sbjct  1     MEAPT--WAAYAAAWLVSIALVVLSHHLRRRRKLNLPPGPKPWPIIGNFNLIGSLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+L+  YGP+M L+FGS PV+VGSS +MAK FL+T D+ F  RPKT+AGKYTTYNYSDIT
Sbjct  59    HELTKTYGPLMMLKFGSVPVLVGSSVKMAKLFLRTYDVAFAGRPKTSAGKYTTYNYSDIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYWRQAR+MCL ELFS KRLES+EYIR +EL S+LR ++  +   +P++L+D++S
Sbjct  119   WSQYGPYWRQARKMCLMELFSVKRLESFEYIRVEELNSVLRAIFNTNG--EPMMLKDHLS  176

Query  765   TLSLNVISWMVLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             TLSLNVIS MV GK YL+E+  E  IV+P+EF+KMLDELFLLNGV N+GD IP + +LD+
Sbjct  177   TLSLNVISRMVFGKRYLDETNDEKPIVTPDEFKKMLDELFLLNGVFNLGDWIPCLKYLDV  236

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QGY+KRMK L+KKFDRF+EHVLDEHNAR+V E + +V KDMVD+LLQLADDP+LEVKLER
Sbjct  237   QGYVKRMKVLAKKFDRFMEHVLDEHNARKVKEKEDWVPKDMVDVLLQLADDPNLEVKLER  296

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              GVKAF QDL+AGGTE+S V VEWA++ELLKKP+I +KAT+ELDRVIG++RWVEEKD+ N
Sbjct  297   IGVKAFSQDLIAGGTESSAVTVEWAMAELLKKPDIIRKATEELDRVIGKERWVEEKDIQN  356

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI+AI KE MRLHPVAPMLVPR+ RE  K+  YDIPKG+ VLV+ +T+ RD  +++ P
Sbjct  357   LPYIRAISKETMRLHPVAPMLVPRMTREQVKIEDYDIPKGSLVLVNTFTIQRDLNVYEKP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
              EF P+RF+  +IDVKG DFELLPFG+GRRMCPGYSLGLKVI++SL NLLHGF WKLP +
Sbjct  417   EEFWPERFLATNIDVKGQDFELLPFGSGRRMCPGYSLGLKVIESSLANLLHGFIWKLPGN  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E ++MEEIFGLS PKK PL   +EPRLP ++Y +
Sbjct  477   MKVEDIDMEEIFGLSNPKKNPLMACVEPRLPHYMYHI  513



>gb|EMS57898.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=515

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/506 (70%), Positives = 416/506 (82%), Gaps = 11/506 (2%)
 Frame = +3

Query  270   VSTIALLLLAKHLRWRRKLH-LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQ  446
             V    +L L   LR RR+ H LPPGPKPWP+IGNLNLIG+LPHRSIH LS +YGP+MQLQ
Sbjct  12    VVLATVLFLKAVLRLRRRQHNLPPGPKPWPIIGNLNLIGTLPHRSIHALSKQYGPLMQLQ  71

Query  447   FGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYN-YSDITWSPYGPYWRQARR  623
             FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAG+ TTYN YSDITWSPYG YWRQAR+
Sbjct  72    FGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGRDTTYNNYSDITWSPYGAYWRQARK  131

Query  624   MCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLG  803
             MCLTELFSAKRLESYEYIR +E+ ++L  LY    A + ++L+DY+ST+SLNVI+ MV+G
Sbjct  132   MCLTELFSAKRLESYEYIRREEVLALLGDLYRGG-AGRVVVLKDYLSTVSLNVITRMVMG  190

Query  804   KSYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
             K YL     +E+   I +P EF+ M+DELFLLNGVLNIGDSIPW+D++DLQGYIKRMK L
Sbjct  191   KKYLEKEVRDEAGAVITTPEEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKL  250

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
             SK FDRFLEHV+DEH+ RR  EG+SFV  DMVD+LLQ A DP LEVKL R GVKAF QDL
Sbjct  251   SKMFDRFLEHVVDEHSERRRCEGESFVVNDMVDVLLQFASDPGLEVKLNREGVKAFTQDL  310

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
             +AGGTE+S V VEWA+SELLKKPE+  KAT+ELDRV+G+ RWV EKDMP+LPY+ AIVKE
Sbjct  311   IAGGTESSAVTVEWALSELLKKPEVLAKATEELDRVVGRGRWVTEKDMPSLPYVDAIVKE  370

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIG  1508
              MRLHPVAPMLVPRL RED  + GYDIP GTR LV VW++ RDP LW+ P EF+P+RF+G
Sbjct  371   TMRLHPVAPMLVPRLSREDTSINGYDIPAGTRGLVMVWSIGRDPELWEAPEEFMPERFLG  430

Query  1509  KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEE  1688
               +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ V   +L+MEE
Sbjct  431   SRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFTWRLPDGV---ELSMEE  487

Query  1689  IFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             IFGLSTP+K PL  V+EP+LP HLY+
Sbjct  488   IFGLSTPRKCPLEAVVEPKLPAHLYA  513



>ref|XP_006426678.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
 gb|ESR39918.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
Length=512

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/516 (72%), Positives = 430/516 (83%), Gaps = 5/516 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME    +W SY  AW++T+AL+LL+  LR RRKL+LPPGPKPWP+IGNL+LIGSLPHRS+
Sbjct  1     MELIHPSWASYLVAWLATLALVLLSLRLR-RRKLNLPPGPKPWPIIGNLHLIGSLPHRSL  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGPIMQL+FGSFPVVVGSSAEMAK  LKT D  F  RPKTAAGKYTT+NYSDIT
Sbjct  60    HALSEKYGPIMQLKFGSFPVVVGSSAEMAKVILKTQDALFSGRPKTAAGKYTTFNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR++C  ELFS KRLES+EYIR QEL   L +LY   S  KP +L+D++S
Sbjct  120   WSPYGPYWRQARKICSMELFSVKRLESFEYIRVQELNLFLNRLY--ESFGKPTILKDHLS  177

Query  765   TLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              LSL +IS MVLGK Y ++  E  +V+P EF  M+DELF+LNGVL++GDSIPW+ FLDLQ
Sbjct  178   DLSLAIISRMVLGKKYTDKQLENEVVTPQEFTAMVDELFMLNGVLDVGDSIPWLGFLDLQ  237

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             G IK+MKAL+K+FD+FLEHVLDEH+ARR    +++VAKDMVD+LLQLADDP+LEVK+ERH
Sbjct  238   GNIKKMKALAKRFDKFLEHVLDEHDARRKGV-ENYVAKDMVDVLLQLADDPTLEVKIERH  296

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVK F QDL+AGGTE+S V VEWAISEL+KKPEIF KAT+ELDRVIG++RWVEEKD+ NL
Sbjct  297   GVKGFTQDLIAGGTESSAVTVEWAISELMKKPEIFNKATEELDRVIGKERWVEEKDIVNL  356

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             P+I A+VKE MRLHPV   LVPR  R+D KVAGYDI KGTRVLVSVW + RDP LW+NPN
Sbjct  357   PFIDAVVKETMRLHPVGAFLVPRAARKDSKVAGYDIQKGTRVLVSVWAIGRDPGLWENPN  416

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
             EF P+RFIGK IDVKG DFELLPFGAGRRMCPGYSLGLKVIQ SL NLLHGF WKLP ++
Sbjct  417   EFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQTSLANLLHGFAWKLPGNM  476

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
               E+LNMEE FGLSTP+K PL  +  PRL  HLY++
Sbjct  477   RNEELNMEETFGLSTPRKIPLEVLAHPRLSPHLYNL  512



>gb|EAZ09260.1| hypothetical protein OsI_31533 [Oryza sativa Indica Group]
Length=518

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/511 (69%), Positives = 419/511 (82%), Gaps = 7/511 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALLLLAKHLRWRRKLH-LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             W+SY    ++TI L L    LR  R+++ LPPGPKPWP+IGNLNL+GSLPHRSIH LS K
Sbjct  6     WVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIHSLSKK  65

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+M L+FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAGK+TTYNYSD+TWSPYG 
Sbjct  66    YGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTWSPYGA  125

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR++CL ELFSAKR+ESYE+IR +E++++LR L+ AS   + + L+DY+S  SLNV
Sbjct  126   YWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSAASLNV  183

Query  783   ISWMVLGKSYLNES---EGAIVS-PNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             IS MVLGK YL      EG +V+ P  FR M+DELFLLNGVL+IGDSIPW+ +LDLQGYI
Sbjct  184   ISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLDLQGYI  243

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             +RMK LSK FD+FLE+VLDEH  R   EG+SFVAKDMVD LL +A DPSLEVK  R  VK
Sbjct  244   RRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDALLNVASDPSLEVKFSRDSVK  303

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
             AF QDL+AGGTE+S+  V+WAI+ELL+KPE+F KAT+ELDRV+G+ RWV EKD+P+LPYI
Sbjct  304   AFTQDLIAGGTESSSATVDWAIAELLRKPEVFAKATEELDRVVGRGRWVTEKDIPSLPYI  363

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AI+KE MR+HPVAPML PRL RED  V GYDIP GTRVLV VW++ RDP LWD P EF+
Sbjct  364   DAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKLWDAPEEFM  423

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGL+VIQ SL NLLHGF W+LP+ +T E
Sbjct  424   PERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWRLPDGMTKE  483

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +L+MEEIFGLSTP+KFPL  V+EP+LP  LY
Sbjct  484   QLSMEEIFGLSTPRKFPLEVVVEPKLPADLY  514



>dbj|BAD36162.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38067.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
Length=518

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/511 (69%), Positives = 419/511 (82%), Gaps = 7/511 (1%)
 Frame = +3

Query  246   WISYAAAWVSTIALLLLAKHLRWRRKLH-LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             W+SY    ++TI L L    LR  R+++ LPPGPKPWP+IGNLNL+GSLPHRSIH LS K
Sbjct  6     WVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIHSLSKK  65

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+M L+FGSFPVVVGSS EMAK FLKT D+ F DRPKTAAGK+TTYNYSD+TWSPYG 
Sbjct  66    YGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTWSPYGA  125

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQAR++CL ELFSAKR+ESYE+IR +E++++LR L+ AS   + + L+DY+S  SLNV
Sbjct  126   YWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSAASLNV  183

Query  783   ISWMVLGKSYLNES---EGAIVS-PNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             IS MVLGK YL      EG +V+ P  FR M+DELFLLNGVL+IGDSIPW+ +LDLQGYI
Sbjct  184   ISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLDLQGYI  243

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             +RMK LSK FD+FLE+VLDEH  R   EG+SFVAKDMVD+LL +A DPSLEVK  R  VK
Sbjct  244   RRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLEVKFSRDSVK  303

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
             AF QDL+AGGTE+S+  V+WAI+ELL+KPE+F K T+ELDRV+G+ RWV EKD+P+LPYI
Sbjct  304   AFTQDLIAGGTESSSATVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTEKDIPSLPYI  363

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AI+KE MR+HPVAPML PRL RED  V GYDIP GTRVLV VW++ RDP LWD P EF+
Sbjct  364   DAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKLWDAPEEFM  423

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGL+VIQ SL NLLHGF W+LP+ +T E
Sbjct  424   PERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWRLPDGMTKE  483

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +L+MEEIFGLSTP+KFPL  V+EP+LP  LY
Sbjct  484   QLSMEEIFGLSTPRKFPLEVVVEPKLPADLY  514



>gb|AET01782.2| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/483 (73%), Positives = 406/483 (84%), Gaps = 3/483 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPK WP+IGNLNLIGSLPH+S+H L+ KYGPIM L FGS PV+VGSS E+AK F
Sbjct  35    KYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVF  94

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D     RPK +AGKYTTYNYS+ITWS YGPYW+QAR+MCL ELFS KRLESYEY+R
Sbjct  95    LKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMR  154

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              QEL + L +L+  +S  K ILL+D++STLSLNVIS MVLGK YL +SE AI+SP EF+K
Sbjct  155   KQELHAFLHELF--NSKNKTILLKDHLSTLSLNVISRMVLGKKYLEKSENAIISPEEFKK  212

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDELFLLNGVLN+GD IPWI FLDLQGY+KRMK L KKFD F+EHVL+EH  RR    D
Sbjct  213   MLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERRKCVND  272

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
              +VAKDMVD+LL+LA++PSLEVKLERHGVKAF QDL+AGGT+ STV VEWAISEL+KKPE
Sbjct  273   -YVAKDMVDVLLKLAENPSLEVKLERHGVKAFTQDLIAGGTDTSTVTVEWAISELVKKPE  331

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             I K+AT+ELD+VIG+ RWVEEKD+ NLPY+ AI KE MRLHP AP+LVPR   EDC V G
Sbjct  332   IIKRATEELDKVIGRDRWVEEKDIVNLPYVFAIAKETMRLHPAAPLLVPREASEDCNVDG  391

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT +LV+ WT+ RDP +WDNP EFIP+RFIG +IDVKG D+ELLPFG GRRMCPG
Sbjct  392   YDIPKGTLILVNTWTIGRDPNVWDNPYEFIPERFIGNNIDVKGHDYELLPFGTGRRMCPG  451

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             Y LGLKVIQ+SL NLLHGFNW+LPND+  E LNMEEIFGL+TP+K PL  V+EPRLP HL
Sbjct  452   YPLGLKVIQSSLANLLHGFNWRLPNDMKKEDLNMEEIFGLTTPRKIPLEVVVEPRLPHHL  511

Query  1761  YSV  1769
             YS+
Sbjct  512   YSL  514



>emb|CDP17013.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/522 (67%), Positives = 425/522 (81%), Gaps = 27/522 (5%)
 Frame = +3

Query  210   NCFDSMESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSL  389
             +CF    +PT +  +YAA W++T+ + LL +    ++KL+LPPGPKPWP++GNLNLIG+L
Sbjct  3     SCF----TPTTSRAAYAATWLATMVIALLCRRFH-QKKLNLPPGPKPWPIVGNLNLIGTL  57

Query  390   PHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYN  569
             PHRSIH LS+ YGP+M L+FGSFPVVVGSS EMAK FLKTMD  F DRPKT AGKYT YN
Sbjct  58    PHRSIHQLSLTYGPLMHLRFGSFPVVVGSSVEMAKVFLKTMDATFADRPKTIAGKYTGYN  117

Query  570   YSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILL  749
             YS+I WSPYGPYWRQ R+MCL ELFSAKRLESYE+IR +E+ S+L  L+   S  KP+LL
Sbjct  118   YSNILWSPYGPYWRQVRKMCLMELFSAKRLESYEHIRVEEMNSLLLGLF--QSLGKPVLL  175

Query  750   RDYMSTLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWID  926
             +D+++T++LNVIS MVLGK YL++S + +IV+P EF KM+DEL LLNGV NIGDSIPW++
Sbjct  176   KDHLTTMTLNVISRMVLGKRYLDQSDQNSIVTPEEFVKMMDELLLLNGVFNIGDSIPWLN  235

Query  927   FLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD-SFVAKDMVDLLLQLADDPSLE  1103
             FLDLQGYIKR+KALSKKFD FLEHVLDEHNA R+A  + + V+KDMVD+LL LA+D +LE
Sbjct  236   FLDLQGYIKRLKALSKKFDWFLEHVLDEHNAARMANDEQNRVSKDMVDVLLDLAEDQTLE  295

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             VKLERHGVKAF  DLL GGTE+S + VEWAISELLKKPE+F+KA  ELDRVIGQ RWV E
Sbjct  296   VKLERHGVKAFTLDLLVGGTESSAMTVEWAISELLKKPELFEKAIQELDRVIGQNRWVTE  355

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KD+PNLPY++AIVKE +R+HPVAPMLVPR                   LV+VWT+ RDP 
Sbjct  356   KDIPNLPYVEAIVKETLRMHPVAPMLVPRF------------------LVNVWTIGRDPE  397

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             LW NP EF P RFIGK+IDVKG D+ELLPFG+GRR CPGYSLGLKV+Q++L NLLHG+NW
Sbjct  398   LWKNPQEFCPARFIGKEIDVKGQDYELLPFGSGRRKCPGYSLGLKVVQSTLANLLHGYNW  457

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             KLP D+ PE+L+M EIFGL+TP+KFPL  V+EPRLP HLYS+
Sbjct  458   KLPGDMNPEELDMGEIFGLTTPRKFPLVAVVEPRLPHHLYSL  499



>gb|EMT12959.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=549

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 429/528 (81%), Gaps = 13/528 (2%)
 Frame = +3

Query  210   NCFDSMESPTAT----WISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNL  377
             NC D+  S  +     W  + A  ++TI  L L    R +   +LPPGPKPWP+IGNLNL
Sbjct  23    NCSDATHSQISMELPPWAPFLAVVLATI--LFLKAVFRRKGTCNLPPGPKPWPIIGNLNL  80

Query  378   IGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKY  557
             IG+LPHRSIH LS +YGP+MQL+FGSFPVVVG+SAEMAK FLKT D+ F DRP+TAAGKY
Sbjct  81    IGTLPHRSIHALSRQYGPLMQLRFGSFPVVVGASAEMAKLFLKTHDVVFTDRPRTAAGKY  140

Query  558   TTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQK  737
             T Y+ S ITWSPY  +WRQARR+CL ELFSAKRLESY YIR +E+ ++L  L+  S   +
Sbjct  141   TGYDNSTITWSPYNAHWRQARRVCLAELFSAKRLESYAYIRREEMCALLCGLHETSG--R  198

Query  738   PILLRDYMSTLSLNVISWMVLGKSYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNI  902
              +LL+D++STLSLNVIS MVLG+ YL      E   AI++P EF+ M+DELF LNGVLNI
Sbjct  199   VVLLKDHLSTLSLNVISRMVLGRKYLEKQAVGEDGPAIMAPEEFKCMIDELFFLNGVLNI  258

Query  903   GDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQL  1082
             GDSIPW+D++DLQGY++RMK LSKKFD+FLEHVLD+HN RR  +G+SFV++DMVD+LL++
Sbjct  259   GDSIPWLDWMDLQGYVRRMKKLSKKFDQFLEHVLDDHNERRRLQGESFVSRDMVDVLLEI  318

Query  1083  ADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIG  1262
             A DP+LEVKL R+GVKAFIQDL+AGGTE + + VEWA+S++LKKPE+F KAT+ELDRV+G
Sbjct  319   ASDPNLEVKLHRNGVKAFIQDLIAGGTETTAITVEWAMSQMLKKPEVFSKATEELDRVVG  378

Query  1263  QKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVW  1442
             ++RWV E D+PNLPY++AIVKE MR+HPVAPML PRL RED  V GY+IP GTRVL++VW
Sbjct  379   RERWVTEDDIPNLPYVEAIVKETMRMHPVAPMLAPRLAREDASVGGYNIPVGTRVLINVW  438

Query  1443  TVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGN  1622
             ++ RDPA+WD+P EFIP+RF+G  ID+KG DFELLPFG+GRRMCPGYSLGLKVI  SL N
Sbjct  439   SIGRDPAVWDSPEEFIPERFVGSKIDIKGHDFELLPFGSGRRMCPGYSLGLKVIHVSLAN  498

Query  1623  LLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LLHGF  KLP+ V  ++L+MEEIFGLSTP+KFPL  V++P+L  HLY+
Sbjct  499   LLHGFVCKLPDGVATDQLSMEEIFGLSTPRKFPLQVVMKPKLQGHLYA  546



>ref|XP_006436412.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
 gb|ESR49652.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
Length=512

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/512 (70%), Positives = 413/512 (81%), Gaps = 6/512 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTI---ALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             +W S +A + S +    LLL     R RR L+LPPGP PWP+IGNLNL+GSLPHRSIH L
Sbjct  4     SWPSDSAMFYSILLVFPLLLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSL  63

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S KYGPIMQL+FGSFPVVVGSS EMAK FLKT D NF  RP+TAAGKYTTYNYSD+ W+ 
Sbjct  64    SQKYGPIMQLRFGSFPVVVGSSVEMAKLFLKTHDANFASRPRTAAGKYTTYNYSDMVWAT  123

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             YGPYWRQAR++ L E+FS KRLES+E+IR QE+K  L  LY +S+  KP+ L+D++S LS
Sbjct  124   YGPYWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLYKSSA--KPVHLKDHLSKLS  181

Query  774   LNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             LNVIS MVLGK+Y  E+E   V+P E+ +ML ELF LNGVL IGDSIPW+ FLDLQG+IK
Sbjct  182   LNVISRMVLGKNYTEETEQDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMKAL KK DRF E VL EHNA+R +    FVA DMVD+LLQLADDP+LE KLER  VKA
Sbjct  242   RMKALMKKLDRFYELVLHEHNAKRKS-STGFVASDMVDVLLQLADDPTLEFKLERDQVKA  300

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
              IQDLLAGGTE+STV +EWAISEL+KKPEIF KAT ELDRVIG+ R VEEKD+ +LPYI 
Sbjct  301   LIQDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYID  360

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AIVKE MRLHPVAPMLVPR  RE+CKVAGYDIPK TRVLV+VW + RDP +W+NPNEF P
Sbjct  361   AIVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRP  420

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF GK+IDVKG DFELLPFGAGRRMCPGY LGLKVIQ SL NLL  F WKLP D+  E 
Sbjct  421   ERFFGKEIDVKGHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKED  480

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEE FGLSTPKK PL  V +PRLP+H+YS+
Sbjct  481   LDMEESFGLSTPKKIPLLVVPQPRLPIHVYSM  512



>ref|XP_006465907.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/480 (73%), Positives = 403/480 (84%), Gaps = 4/480 (1%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGPKPWP+IGNL+LIGSLPHRS+H LS KYGPIMQL+FGSFPVVVGSSAEMAK  LKT 
Sbjct  36    PPGPKPWPIIGNLHLIGSLPHRSLHALSEKYGPIMQLKFGSFPVVVGSSAEMAKVILKTQ  95

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D  F  RPKTAAGKYTT+NYSDITWSPYGPYWRQAR++C  ELFS KRLES+EYIR QEL
Sbjct  96    DALFSGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKICSMELFSVKRLESFEYIRVQEL  155

Query  693   KSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES-EGAIVSPNEFRKMLD  869
                L +LY   S  KP +L+D++S LSL +IS MVLGK Y ++  E  +V+P EF  M+D
Sbjct  156   NLFLNRLY--ESFGKPTILKDHLSDLSLAIISRMVLGKKYTDKQLENEVVTPQEFTAMVD  213

Query  870   ELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV  1049
             ELF+LNGVL++GDSIPW+ FLDLQG IK+MKAL+KKFD+FLEHVLDEH+ARR    +++V
Sbjct  214   ELFMLNGVLDVGDSIPWLGFLDLQGNIKKMKALAKKFDKFLEHVLDEHDARRKGV-ENYV  272

Query  1050  AKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFK  1229
             AKDMVD+LLQLADDP+LEVK+ERHGVK F QDL+AGGTE+S V VEWAISEL+KKPEIF 
Sbjct  273   AKDMVDVLLQLADDPTLEVKIERHGVKGFTQDLIAGGTESSAVTVEWAISELMKKPEIFN  332

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDRVIG++RWVEEKD+ NLP+I AIVKE MRLHPV   LVPR  R+D KVAGYDI
Sbjct  333   KATEELDRVIGKERWVEEKDIVNLPFIDAIVKETMRLHPVGAFLVPRAARKDSKVAGYDI  392

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGTRVLVSVW + RDP LW+NP EF P+RFIGK IDVKG DFELLPFGAGRRMCPGYSL
Sbjct  393   QKGTRVLVSVWAIGRDPGLWENPIEFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSL  452

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             GLKVIQ SL NLLHGF WKLP ++  E+LNMEE FGLSTP+K PL  +  PRL  HLY++
Sbjct  453   GLKVIQTSLANLLHGFAWKLPGNMRNEELNMEETFGLSTPRKIPLEVLAHPRLSPHLYNL  512



>gb|KDO48981.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=512

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/512 (70%), Positives = 412/512 (80%), Gaps = 6/512 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTI---ALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             +W S +A + S +    LLL     R RR L+LPPGP PWP+IGNLNL+GSLPHRSIH L
Sbjct  4     SWPSDSAMFYSILLVFPLLLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSL  63

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S KYGPIMQL+FGSFPVVVGSS EMAK FLK  D NF  RP+TAAGKYTTYNYSD+ W+ 
Sbjct  64    SQKYGPIMQLRFGSFPVVVGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWAT  123

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             YGPYWRQAR++ L E+FS KRLES+E+IR QE+K  L  LY +S+  KP+ L+D++S LS
Sbjct  124   YGPYWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLYKSSA--KPVHLKDHLSKLS  181

Query  774   LNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             LNVIS MVLGK+Y  E+E   V+P E+ +ML ELF LNGVL IGDSIPW+ FLDLQG+IK
Sbjct  182   LNVISRMVLGKNYTEETEQDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMKAL KK DRF E VL EHNA+R +    FVA DMVD+LLQLADDP+LE KLER  VKA
Sbjct  242   RMKALMKKLDRFYELVLHEHNAKRKS-STGFVASDMVDVLLQLADDPTLEFKLERDQVKA  300

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
              IQDLLAGGTE+STV +EWAISEL+KKPEIF KAT ELDRVIG+ R VEEKD+ +LPYI 
Sbjct  301   LIQDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYID  360

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AIVKE MRLHPVAPMLVPR  RE+CKVAGYDIPK TRVLV+VW + RDP +W+NPNEF P
Sbjct  361   AIVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRP  420

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF GK+IDVKG DFELLPFGAGRRMCPGY LGLKVIQ SL NLL  F WKLP D+  E 
Sbjct  421   ERFFGKEIDVKGHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKED  480

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEE FGLSTPKK PL  V +PRLP+H+YS+
Sbjct  481   LDMEESFGLSTPKKIPLLVVPQPRLPIHVYSM  512



>gb|AAG44132.1|AF218296_1 cytochrome P450 [Pisum sativum]
Length=495

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/487 (72%), Positives = 406/487 (83%), Gaps = 6/487 (1%)
 Frame = +3

Query  264   AWVS---TIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             +WV+   T A+LLL      RR+ +LPPGPKPWP+IGN NLIG+LPH+S+H L+ KYGPI
Sbjct  10    SWVTLFTTFAILLLFSRRLRRRQYNLPPGPKPWPIIGNFNLIGTLPHQSLHGLTQKYGPI  69

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M L FGS  VVVGS+ EMAK FLKT D     RPK +AGKYTTYNYSDITWS YGPYWRQ
Sbjct  70    MHLWFGSKRVVVGSTVEMAKAFLKTHDATLAGRPKFSAGKYTTYNYSDITWSQYGPYWRQ  129

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             ARRMCL ELFSAKRLESYEYIR QEL   L +L+   S  K ILL+D++S+LSLNVIS M
Sbjct  130   ARRMCLLELFSAKRLESYEYIRKQELHVFLHELF--DSRNKTILLKDHLSSLSLNVISRM  187

Query  795   VLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSK  974
             VLG+ YL + E +I+SP+EF+ MLDELFLLNG+LNIGD IPWI FLD QGY+KRMK LSK
Sbjct  188   VLGRKYLEKVENSIISPDEFKNMLDELFLLNGILNIGDFIPWIHFLDFQGYVKRMKVLSK  247

Query  975   KFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLA  1154
             KFD F+EHVL+EH  RR    D +VAKDMVD+LLQLA+DP LEVKLERHGVKAF QDL+A
Sbjct  248   KFDGFMEHVLEEHIERRKGVKD-YVAKDMVDVLLQLAEDPDLEVKLERHGVKAFTQDLIA  306

Query  1155  GGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVM  1334
             GGTE+S V VEWAISEL++KPEIFKKAT+ELDRVIG++RWVEEKD+ NLPY+ AI KE M
Sbjct  307   GGTESSAVTVEWAISELIRKPEIFKKATEELDRVIGRERWVEEKDIANLPYVYAIAKETM  366

Query  1335  RLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD  1514
             RLHPVAPMLVPR  REDC + GYDIPKG+ +LV+ WT+ARD  +WDNPNEF+P+RF+GKD
Sbjct  367   RLHPVAPMLVPREAREDCNINGYDIPKGSLILVNTWTIARDSNVWDNPNEFMPERFLGKD  426

Query  1515  IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIF  1694
             IDVKG D+ELLPFGAGRRMCPGY LG+KVIQ+SL NLLHGFNW+L +DV  E LNMEEIF
Sbjct  427   IDVKGHDYELLPFGAGRRMCPGYPLGIKVIQSSLANLLHGFNWRLSDDVKKEDLNMEEIF  486

Query  1695  GLSTPKK  1715
             GLSTPKK
Sbjct  487   GLSTPKK  493



>ref|XP_006468115.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=536

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/512 (70%), Positives = 408/512 (80%), Gaps = 6/512 (1%)
 Frame = +3

Query  243   TWISYAAAWVSTI---ALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             +W S +A + S +    LLL     R RR L+LPPGP PWP+IGNLNL+GSLPHRSIH L
Sbjct  4     SWPSDSAMFYSILLVFPLLLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSL  63

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S KYGPIMQL+FGSFPVVVGSS EMAK FLK  D NF  RP+TAAGKYTTYNYSD+ W+ 
Sbjct  64    SQKYGPIMQLRFGSFPVVVGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWAT  123

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             YGPYWRQAR++ L E+FS KRLES+E+IR QE+K  L  LY +S+  KP+ L+D++S LS
Sbjct  124   YGPYWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLYKSSA--KPVHLKDHLSKLS  181

Query  774   LNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             LNVIS MVLGK+Y  E+E   V+P E+ +ML ELF LNGVL IGDSIPW+ FLDLQG+IK
Sbjct  182   LNVISRMVLGKNYTEETEQDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RM AL KK DRF E VL EHNA+R      FVA DMVD+LLQLADDP+LE KLER  VKA
Sbjct  242   RMIALMKKLDRFYELVLHEHNAKR-KSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKA  300

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
              IQDLLAGGTE+STV +EWAISEL+KKPEIF KAT ELDRVIG+ R VEEKD+ +LPYI 
Sbjct  301   LIQDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYID  360

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AIVKE MRLHPVAPMLVPR  RE+CKVAGYDIPK TRVLV+VW + RDP +W+NPNEF P
Sbjct  361   AIVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRP  420

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF GK+IDVKG DFELLPFGAGRRMCPGY LGLKVIQ SL NLL  F WKLP D+  E 
Sbjct  421   ERFFGKEIDVKGHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKED  480

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEE FGLSTPKK PL    +PRLP+H YS+
Sbjct  481   LDMEESFGLSTPKKIPLLVAPQPRLPIHAYSM  512



>ref|XP_010239382.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=522

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/488 (70%), Positives = 408/488 (84%), Gaps = 6/488 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             +R  +LPPGPKPWP+IGNLNLIG+LPH SIH L+ +YGP+MQL+FGSFPVVVGSS +MAK
Sbjct  32    QRTYNLPPGPKPWPIIGNLNLIGTLPHHSIHALAKQYGPLMQLRFGSFPVVVGSSVDMAK  91

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLKT D  F+DRPKTAAGK+T YNYSDITWSPYG YWRQAR+MCLTELFSAKRLESYEY
Sbjct  92    FFLKTHDAVFIDRPKTAAGKHTGYNYSDITWSPYGAYWRQARKMCLTELFSAKRLESYEY  151

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE-----GAIV  839
             IRS+E++++L  L+ AS   + + L+DY+STLSLNVI+ MV+GK Y  ++E     G++ 
Sbjct  152   IRSEEMRALLCGLHEASGLGRVVKLKDYLSTLSLNVITRMVMGKRYQQDNEVADQGGSVT  211

Query  840   SPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNA  1019
             +  E + MLDELFLL GVL IGDSIPW+ +LDLQGYIKRMK LSK FDRFLEHV+DEHN 
Sbjct  212   TLEELKSMLDELFLLEGVLVIGDSIPWLRWLDLQGYIKRMKKLSKVFDRFLEHVVDEHNE  271

Query  1020  RRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAIS  1199
             RR+ EG SF A DMVD+LL++A DP+LEVKL R+GVKA  QDL+AG  E S   VEWA+S
Sbjct  272   RRLLEGQSFKATDMVDVLLEVASDPNLEVKLNRYGVKAITQDLMAG-PETSATTVEWAVS  330

Query  1200  ELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCR  1379
             E+LKKP++F KAT+ELDRV+G+ RWV EKD+ +LPY++AIVKE +R+HP +P+L PRL R
Sbjct  331   EILKKPDVFGKATEELDRVVGRGRWVTEKDIRSLPYVEAIVKETLRMHPGSPLLSPRLSR  390

Query  1380  EDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGA  1559
             ED  VAGYDIP GTRVLV+ WT+ARDPALWD P EF+P+RF+G  IDVKG DFELLPFG+
Sbjct  391   EDASVAGYDIPAGTRVLVNAWTIARDPALWDAPEEFMPERFLGSKIDVKGQDFELLPFGS  450

Query  1560  GRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ VT E+L+MEEIFGLSTP+KFPL  V E
Sbjct  451   GRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGVTKEELSMEEIFGLSTPRKFPLEVVAE  510

Query  1740  PRLPMHLY  1763
             P+LP HLY
Sbjct  511   PKLPGHLY  518



>emb|CDP21484.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/513 (68%), Positives = 407/513 (79%), Gaps = 35/513 (7%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             MES + TW +YA AWV+T+ +  L+KH   ++KL+LPPGP+ WP+IGNLNLIG+LPHRS+
Sbjct  1     MESFSPTWAAYALAWVTTVVIAHLSKHFH-QQKLNLPPGPRQWPIIGNLNLIGTLPHRSL  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS+ YGP+M LQFGSFPVVVGSS EMAK FLKTMD  F  RPKTAAGKYT Y+ +++T
Sbjct  60    HQLSLTYGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDGTFAGRPKTAAGKYTAYDCTNMT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQAR++ LTELFSAKRLESYE+IR +E+ S+L QL+                
Sbjct  120   WSPYGPYWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQLF----------------  163

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
               +LNVIS MVLGK+Y++ESE +IV+P EFR+M+DE+FLL GV NIGD IPWIDFLDLQG
Sbjct  164   --NLNVISRMVLGKTYIDESENSIVTPEEFRQMMDEVFLLTGVFNIGDFIPWIDFLDLQG  221

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             YIKRMK LSKK DRFLEHVLDEHNARR  E D  V+KDM D+LL LADDP+LEVKLER G
Sbjct  222   YIKRMKILSKKVDRFLEHVLDEHNARRKDETDC-VSKDMADVLLDLADDPTLEVKLERRG  280

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKA   DLLAGGTE S   +EWAISELLK PEIF KA +ELDRVIGQ RWV EKDMPNLP
Sbjct  281   VKALTLDLLAGGTETSATTIEWAISELLKNPEIFNKAAEELDRVIGQNRWVNEKDMPNLP  340

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+A++KE MR+HPV P+LVPR  REDCKVAGYDI +GTRV+V+V               
Sbjct  341   YIEAVIKETMRMHPVVPLLVPRCAREDCKVAGYDIQRGTRVIVNV---------------  385

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F PDRF+GKDID KG D + LPFGAGRRMCPGYSLGLKVIQ+SL NLLHG+ WKLPND+ 
Sbjct  386   FCPDRFMGKDIDFKGQDCKFLPFGAGRRMCPGYSLGLKVIQSSLANLLHGYRWKLPNDMK  445

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             PE L+MEE FG++TP+K PL  ++EPRLP +LY
Sbjct  446   PEDLDMEERFGITTPRKIPLVAIVEPRLPRNLY  478



>gb|KHF98584.1| Cytochrome P450 [Gossypium arboreum]
Length=480

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/511 (70%), Positives = 413/511 (81%), Gaps = 34/511 (7%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             T +W SY   W++T+AL+LL+  L  RRKL+LPPGPKPWP+IGNLNL+GSLPH+SIH LS
Sbjct  3     TPSWFSYLTPWLATLALILLSLRLCRRRKLNLPPGPKPWPIIGNLNLVGSLPHQSIHALS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYGPIMQL+FGSFPVVV SS EMAK  LKT D+ F DRPK AAGKYTTYNYSDITWSPY
Sbjct  63    RKYGPIMQLKFGSFPVVVASSVEMAKAVLKTNDVIFTDRPKNAAGKYTTYNYSDITWSPY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR++CLTELF+AKRLESY+YIR +E+   L++LY +S  Q  I+L+D++S+LSL
Sbjct  123   GPYWRQARKICLTELFNAKRLESYQYIRREEMNLFLKRLYESSGTQ--IVLKDHLSSLSL  180

Query  777   NVISWMVLGKSYLNES-EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             NVIS MV GK Y   S E  IV+PNEF++MLDELFLLNGVL+IGDSIPW+ FLDLQGYIK
Sbjct  181   NVISRMVFGKKYTEGSGENEIVTPNEFKEMLDELFLLNGVLDIGDSIPWLTFLDLQGYIK  240

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMKALSKKFDRFLEHVLDEHNARR    D +VAKDMVD+LLQL++DP+LEVKLERH VKA
Sbjct  241   RMKALSKKFDRFLEHVLDEHNARREGAED-YVAKDMVDVLLQLSEDPNLEVKLERHSVKA  299

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
             F Q                              AT+ELD VIG++RWVEEKD+ NLPYI 
Sbjct  300   FTQ------------------------------ATEELDTVIGRERWVEEKDVVNLPYID  329

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             +I KE MRLHPVAPMLVPR+ R+DCK+AGYDIPKGTR  V+VWT+ RD +LWDNPNEF P
Sbjct  330   SIAKETMRLHPVAPMLVPRVARQDCKIAGYDIPKGTRAFVNVWTIGRDTSLWDNPNEFWP  389

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             DRF+GK IDVKG DFELLPFGAGRRMCPGY LG+KVIQASL N+LHGF WKLPN+ T E 
Sbjct  390   DRFMGKSIDVKGHDFELLPFGAGRRMCPGYPLGIKVIQASLANVLHGFTWKLPNNTTKED  449

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              NMEEIFGLSTPKK+PL  + EPRLP+H+YS
Sbjct  450   FNMEEIFGLSTPKKYPLEAIAEPRLPLHMYS  480



>gb|EMT01785.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=503

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/505 (69%), Positives = 409/505 (81%), Gaps = 21/505 (4%)
 Frame = +3

Query  270   VSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQF  449
             V +  +L L   LR RR+ +LPPGPKPWP+IGNLNLIG+LPHRSIH LS KYGP+MQLQF
Sbjct  12    VCSPPVLFLKAVLRRRRQYNLPPGPKPWPIIGNLNLIGTLPHRSIHALSKKYGPLMQLQF  71

Query  450   GSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMC  629
             GSFPVVVGSS EMAK FLKT D+ F DRPKTAAG+YTTYNYSDITWSPYG YWRQAR+MC
Sbjct  72    GSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGRYTTYNYSDITWSPYGAYWRQARKMC  131

Query  630   LTELFSAKRLESYEYIRSQELKSILRQLYTASS-AQKPILLRDYMSTLSLNVISWMVLGK  806
             LTELFSAKRLESYEYIR +E+ ++L  LY   + A + ++L+DY+ST+SLNVI+ MV+GK
Sbjct  132   LTELFSAKRLESYEYIRREEVLALLGDLYRGGAGASRVVVLKDYLSTVSLNVITRMVMGK  191

Query  807   SYL-----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALS  971
              YL     +E+   I +P+EF+ M+DELFLLNGVLNIGDSIPW+D++DLQGYIKRMK LS
Sbjct  192   KYLEKEVRDEAGAVITTPDEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKLS  251

Query  972   KKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLL  1151
             K FDRFLEHV+DEH+ RR  +G+SFV KDMVD+LLQ A DP LEVKL R GVKAF QDL+
Sbjct  252   KMFDRFLEHVVDEHSERRRRQGESFVVKDMVDVLLQFASDPGLEVKLNREGVKAFTQDLI  311

Query  1152  AGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEV  1331
             AGGTE+S V VEWA+SELLKKPE+  KAT+ELDRV+G+ RWV EKDM +LPY+ AIVKE 
Sbjct  312   AGGTESSAVTVEWALSELLKKPEVLAKATEELDRVVGRGRWVTEKDMSSLPYVDAIVKET  371

Query  1332  MRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGK  1511
             MRLHPVAPMLVPRL RED  + GY +P            AR   LW+ P EF+P+RF G 
Sbjct  372   MRLHPVAPMLVPRLSREDTSINGYALP------------ARPRVLWEAPEEFMPERFFGS  419

Query  1512  DIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEI  1691
              +DVKG D+ELLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF W+LP+ V   +L+MEEI
Sbjct  420   RLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFTWRLPDGV---ELSMEEI  476

Query  1692  FGLSTPKKFPLTTVIEPRLPMHLYS  1766
             FGLSTP+K+PL  V+EP+LP HLY+
Sbjct  477   FGLSTPRKYPLEAVVEPKLPAHLYA  501



>ref|XP_003627306.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
Length=505

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/473 (73%), Positives = 397/473 (84%), Gaps = 3/473 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPK WP+IGNLNLIGSLPH+S+H L+ KYGPIM L FGS PV+VGSS E+AK F
Sbjct  35    KYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVF  94

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D     RPK +AGKYTTYNYS+ITWS YGPYW+QAR+MCL ELFS KRLESYEY+R
Sbjct  95    LKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMR  154

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              QEL + L +L+  +S  K ILL+D++STLSLNVIS MVLGK YL +SE AI+SP EF+K
Sbjct  155   KQELHAFLHELF--NSKNKTILLKDHLSTLSLNVISRMVLGKKYLEKSENAIISPEEFKK  212

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDELFLLNGVLN+GD IPWI FLDLQGY+KRMK L KKFD F+EHVL+EH  RR    D
Sbjct  213   MLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERRKCVND  272

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
              +VAKDMVD+LL+LA++PSLEVKLERHGVKAF QDL+AGGT+ STV VEWAISEL+KKPE
Sbjct  273   -YVAKDMVDVLLKLAENPSLEVKLERHGVKAFTQDLIAGGTDTSTVTVEWAISELVKKPE  331

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             I K+AT+ELD+VIG+ RWVEEKD+ NLPY+ AI KE MRLHP AP+LVPR   EDC V G
Sbjct  332   IIKRATEELDKVIGRDRWVEEKDIVNLPYVFAIAKETMRLHPAAPLLVPREASEDCNVDG  391

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT +LV+ WT+ RDP +WDNP EFIP+RFIG +IDVKG D+ELLPFG GRRMCPG
Sbjct  392   YDIPKGTLILVNTWTIGRDPNVWDNPYEFIPERFIGNNIDVKGHDYELLPFGTGRRMCPG  451

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             Y LGLKVIQ+SL NLLHGFNW+LPND+  E LNMEEIFGL+TP+K PL  V+E
Sbjct  452   YPLGLKVIQSSLANLLHGFNWRLPNDMKKEDLNMEEIFGLTTPRKIPLEVVVE  504



>gb|KDO48980.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=506

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/512 (69%), Positives = 408/512 (80%), Gaps = 12/512 (2%)
 Frame = +3

Query  243   TWISYAAAWVSTI---ALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             +W S +A + S +    LLL     R RR L+LPPGP PWP+IGNLNL+GSLPHRSIH L
Sbjct  4     SWPSDSAMFYSILLVFPLLLFICGSRCRRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSL  63

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S KYGPIMQL+FGSFPVVVGSS EMAK FLK  D NF  RP+TAAGKYTTYNYSD+ W+ 
Sbjct  64    SQKYGPIMQLRFGSFPVVVGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWAT  123

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             YGPYWRQAR++ L E+FS KRLES+E+IR QE+K  L  LY +S+  KP+ L+D++S LS
Sbjct  124   YGPYWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLYKSSA--KPVHLKDHLSKLS  181

Query  774   LNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             LNVIS MVLGK+Y  E+E   V+P E+ +ML ELF LNGVL IGDSIPW+ FLDLQG+IK
Sbjct  182   LNVISRMVLGKNYTEETEQDFVTPQEYTEMLQELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKA  1133
             RMKAL KK DRF E VL EHNA+R +    FVA DMVD+LLQLADDP+LE KLER     
Sbjct  242   RMKALMKKLDRFYELVLHEHNAKRKS-STGFVASDMVDVLLQLADDPTLEFKLERD----  296

Query  1134  FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQ  1313
               QDLLAGGTE+STV +EWAISEL+KKPEIF KAT ELDRVIG+ R VEEKD+ +LPYI 
Sbjct  297   --QDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYID  354

Query  1314  AIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIP  1493
             AIVKE MRLHPVAPMLVPR  RE+CKVAGYDIPK TRVLV+VW + RDP +W+NPNEF P
Sbjct  355   AIVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRP  414

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF GK+IDVKG DFELLPFGAGRRMCPGY LGLKVIQ SL NLL  F WKLP D+  E 
Sbjct  415   ERFFGKEIDVKGHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKED  474

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L+MEE FGLSTPKK PL  V +PRLP+H+YS+
Sbjct  475   LDMEESFGLSTPKKIPLLVVPQPRLPIHVYSM  506



>dbj|BAJ96250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/500 (68%), Positives = 412/500 (82%), Gaps = 8/500 (2%)
 Frame = +3

Query  285   LLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPV  464
             L L     R R   +LPPGPKPWP+IGNLNL+G+LPHRSIHDLS +YGPIM L+FGSFPV
Sbjct  2     LFLKCVFRRSRHAHNLPPGPKPWPIIGNLNLMGALPHRSIHDLSKRYGPIMYLRFGSFPV  61

Query  465   VVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELF  644
             VVGSS EMAK FLKT D+ F+DRPK AAGK+TTYNYS+I W+PYG YWRQAR++CLTELF
Sbjct  62    VVGSSVEMAKFFLKTHDVVFIDRPKMAAGKHTTYNYSNIIWAPYGAYWRQARKVCLTELF  121

Query  645   SAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE-  821
             SAKRLESYEYIRS+E++++LR L+ AS   + ++L+DY+STLSLNVI+ M+LGK YL+  
Sbjct  122   SAKRLESYEYIRSEEMRALLRDLHEASG--RVVVLKDYLSTLSLNVITRMMLGKKYLHRP  179

Query  822   -----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDR  986
                    G+  +  EF+ M+DE FLLNGVLNIGD IPW+D++DLQGYIKRMK LS  FDR
Sbjct  180   MEGTDGGGSTTTMEEFKWMIDEWFLLNGVLNIGDPIPWLDWMDLQGYIKRMKKLSMMFDR  239

Query  987   FLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTE  1166
             FLEHV+DEHN RR  EG+SFV++DMVD+LL++A DP LEV+++R  VKAFIQDL+ GGTE
Sbjct  240   FLEHVVDEHNDRRRLEGESFVSRDMVDVLLEIASDPDLEVQIDRDSVKAFIQDLIVGGTE  299

Query  1167  NSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHP  1346
              S++ VEWAISELLKKPE+  KAT+ELDRV+G+ RWV E+D+P+LPY++AIVKE MRLHP
Sbjct  300   TSSITVEWAISELLKKPEVLAKATEELDRVVGRGRWVTEQDIPSLPYVEAIVKEAMRLHP  359

Query  1347  VAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVK  1526
             VAP+L PRL RE+  V GYDIP GTRV VSVW++ RDPALWD P EF P+RF+G  +DVK
Sbjct  360   VAPLLAPRLSREEASVGGYDIPAGTRVFVSVWSIGRDPALWDAPEEFTPERFLGSKMDVK  419

Query  1527  GCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLST  1706
             G DFELLPFG+GRRMCP +SLGLKVIQ SL NLLHGF W+LP+ V+  +L MEEIFGL+T
Sbjct  420   GQDFELLPFGSGRRMCPAHSLGLKVIQVSLANLLHGFAWRLPDGVSTAELGMEEIFGLTT  479

Query  1707  PKKFPLTTVIEPRLPMHLYS  1766
             P+KFPL  V +P+L  HLYS
Sbjct  480   PRKFPLEVVFKPKLLDHLYS  499



>ref|NP_001063284.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAD36157.1| putative cytochrome P450 monooxygenase CYP92A1 [Oryza sativa 
Japonica Group]
 dbj|BAF25198.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAG98103.1| unnamed protein product [Oryza sativa Japonica Group]
Length=525

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/526 (64%), Positives = 417/526 (79%), Gaps = 15/526 (3%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME    +W S     ++ +  LL       RR   LPPGP PWP+IGNLNLIG+LPHRSI
Sbjct  1     MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSI  60

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS +YGP+MQL+FGSFPVVVGSSAEMA+ FLK+ DI F DRP+TAAGK+TTYNY+DI 
Sbjct  61    HELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDIL  120

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MC+TELFSA+RLES+E+IR +E++++LR L+ A++   P+LLRDY+S
Sbjct  121   WSPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAA---PVLLRDYLS  177

Query  765   TLSLNVISWMVLGKSYLN------------ESEGAIVSPNEFRKMLDELFLLNGVLNIGD  908
             T +L VIS MVLGK Y+             E      +P EF+ M+DELFLL+GVLNIGD
Sbjct  178   TATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGD  237

Query  909   SIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLAD  1088
              IPW+D+LDLQGYI+RMK + KK DRF+EHVLDEH+  R  +GD F A+D+VD+LLQLAD
Sbjct  238   FIPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLAD  297

Query  1089  DPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQK  1268
             DP+LEV+L R  VKA  QDL+AGGT+ S + VEWAISELL+KPEI  KAT+ELDRV+G+ 
Sbjct  298   DPNLEVQLRRDNVKALTQDLIAGGTDTSAITVEWAISELLRKPEILAKATEELDRVVGRG  357

Query  1269  RWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTV  1448
             R V E DM +LPY++AIVKE MR+HPVAP+L P + RED  V GYDIP GTRVLV+VWT+
Sbjct  358   RLVTETDMTSLPYVEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTI  417

Query  1449  ARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLL  1628
             ARDPALWD+P EF+P+RFIG  IDVKG DF+LLPFG+GRR+CPG+SLGLKVIQ SL +LL
Sbjct  418   ARDPALWDSPEEFMPERFIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKVIQLSLASLL  477

Query  1629  HGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             HGF W+LP+ V+  +L+MEE+FGLSTP+K PL  V++P+LP HLY+
Sbjct  478   HGFEWRLPDGVSAGELSMEEVFGLSTPRKVPLEVVVKPKLPAHLYT  523



>ref|XP_006665049.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=525

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/519 (65%), Positives = 422/519 (81%), Gaps = 8/519 (2%)
 Frame = +3

Query  234   PTATWISYAAAWVSTIALL--LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIH  407
             P A+ +      ++TI  L   L++    R   +LPPGP+PWP+IGNL+L+G+LPHRSIH
Sbjct  5     PWASLLLLTGVTLATILFLAATLSRRGGRRASYNLPPGPRPWPIIGNLHLVGALPHRSIH  64

Query  408   DLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITW  587
              LS +YGP+M L+FGS  VVVGSSAE+A+ FLKT D  F DRP+TAAGKYTTYNYSD+TW
Sbjct  65    ALSERYGPLMHLRFGSQHVVVGSSAELARFFLKTHDAVFADRPRTAAGKYTTYNYSDMTW  124

Query  588   SPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQL-YTASSAQKPILLRDYMS  764
             SPYG YWRQAR++CLTELFSA+R++SYE+IRS E +++LR L   A+S ++ + L++++S
Sbjct  125   SPYGAYWRQARKICLTELFSARRIDSYEHIRSDETRALLRGLNAAAASGRRAVRLKEHLS  184

Query  765   TLSLNVISWMVLGKSYLNESE----GAIVS-PNEFRKMLDELFLLNGVLNIGDSIPWIDF  929
             T SLN+IS MVLG+ YL   E    G +V+ P +FR M+DELFLLNGVLNIGDSIPW++F
Sbjct  185   TASLNLISRMVLGRKYLEGGEVVHRGEVVTTPEQFRWMIDELFLLNGVLNIGDSIPWLNF  244

Query  930   LDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVK  1109
             LDLQGYI+RMK LSK FDRFLEHVLDEH  RR  EG++FVA+D+VD+LL++ADDP L+V+
Sbjct  245   LDLQGYIRRMKKLSKMFDRFLEHVLDEHETRRHHEGEAFVARDLVDVLLKVADDPCLQVE  304

Query  1110  LERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKD  1289
               R  VKAF QDL+AGGTE+S + +EWAISELLKKPE+F KAT+ELDRVIG+ RWV EKD
Sbjct  305   FTRDSVKAFTQDLIAGGTESSAMTIEWAISELLKKPEVFNKATEELDRVIGRGRWVTEKD  364

Query  1290  MPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALW  1469
             +P+L YI AI+KE MR+HPVAPML PR+ R D    GYDIP G+RVLVS W++ RDP LW
Sbjct  365   IPSLLYIDAILKETMRMHPVAPMLTPRMSRMDTSYNGYDIPAGSRVLVSTWSIGRDPKLW  424

Query  1470  DNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKL  1649
             D+P EF+P+RF+   ID+KG DF+LLPFG+GRRMCPGYSLGLKVIQ SL NLLHGF+W+L
Sbjct  425   DSPEEFMPERFVDSKIDIKGQDFKLLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWRL  484

Query  1650  PNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             P+ +T E+L+MEEIFGLS P+KFPL  V+EP+LP+HLY+
Sbjct  485   PDGMTREQLSMEEIFGLSMPRKFPLEVVVEPKLPVHLYT  523



>ref|XP_003627307.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|AET01783.1| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/511 (67%), Positives = 413/511 (81%), Gaps = 8/511 (2%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRW-RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
              W+++   +V    LLL    LR  RRK +LPPGPKPWP+IGN+NLIGSLPH+SIH L+ 
Sbjct  10    NWVTFCTTFV---ILLLFIHRLRLHRRKYNLPPGPKPWPIIGNMNLIGSLPHQSIHGLTK  66

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGPIM+L FGS  V+VGSS ++AK FLKT DI  V RPK A GKYTTYNYS+ITW+PYG
Sbjct  67    KYGPIMRLWFGSKLVIVGSSPDIAKAFLKTNDIVLVGRPKFACGKYTTYNYSNITWNPYG  126

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PY++QAR+M   ELFS K LESYEY+R +EL   L +L+  +S  K ILL+D++ST SLN
Sbjct  127   PYFQQARKMFQRELFSVKSLESYEYMRKEELHIFLHKLF--NSKNKTILLKDHLSTFSLN  184

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             +IS MVLGK YL +SE  I+SP EF++MLDELFLLNGV NIGD IPWI FLDLQGY+KRM
Sbjct  185   IISRMVLGKKYLEKSENVIISPEEFKEMLDELFLLNGVFNIGDFIPWIQFLDLQGYVKRM  244

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             KA  K+F+RF+EHVL+EH  RR    D +VAKDMVD+LLQLA++P+LEVK++R+GVKAF 
Sbjct  245   KACGKRFNRFMEHVLEEHIERRKDVKD-YVAKDMVDVLLQLAENPNLEVKIKRNGVKAFT  303

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGT+ S+VI+EWAISEL+K+PEI K+AT+ELDRVIG+ RWVEEKD+ NLPY+ AI
Sbjct  304   QDLIAGGTDTSSVIIEWAISELVKRPEIIKRATEELDRVIGRDRWVEEKDIVNLPYVFAI  363

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
              KE MRLHPV PMLVPR   E+C V GYDIPKGT +LV+ WT+ RD   WDNP EFIP+R
Sbjct  364   AKETMRLHPVTPMLVPREATENCNVDGYDIPKGTMILVNTWTIGRDSDSWDNPYEFIPER  423

Query  1500  FIGKDID-VKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             FI  DID +KG D+++LP GAGRRMCPGY LGLKV+Q+SL NLLHGFNW+LPND+  E L
Sbjct  424   FINNDIDIIKGHDYKMLPLGAGRRMCPGYPLGLKVVQSSLANLLHGFNWRLPNDMKKEDL  483

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NMEEIFGL+TPKK PL  V+EP+LP HLY +
Sbjct  484   NMEEIFGLTTPKKIPLEVVLEPKLPYHLYCL  514



>ref|XP_011036445.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/509 (66%), Positives = 416/509 (82%), Gaps = 7/509 (1%)
 Frame = +3

Query  252   SYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLI-GSLPHRSIHDLSVKYG  428
             ++AA  ++T+A++ L +HL  R KL+LPPGPKPWP+IGNLNL+ G LPHR++H L  KYG
Sbjct  5     TFAALLLATVAVITLFRHLT-RPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHALVQKYG  63

Query  429   PIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYW  608
             PIMQL+FGSFPVVVGSS EMA+  LKT D+   DRPK AAGKYTTYNYS+ITWS YGPYW
Sbjct  64    PIMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYW  123

Query  609   RQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVIS  788
             RQAR++CL E+FS KRL+ +E +R QEL ++LR+L+   SA KPI  RD  S LSL+VIS
Sbjct  124   RQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFV--SAGKPINARDNFSDLSLSVIS  181

Query  789   WMVLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMK  962
              +VLGK+Y  ++  +   +SP EF++M+DELFLLNGVL+IGDSIPW+ FLDLQGYIKRMK
Sbjct  182   RLVLGKNYTVKTGNQKEYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMK  241

Query  963   ALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQ  1142
             A+ + FD FLEH L+EH  RR    D +V +DM+D+LLQL+DDP+LEV+L+R  VKAF  
Sbjct  242   AVGRLFDGFLEHTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTM  300

Query  1143  DLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIV  1322
             DL+AGGTE+S V  EWA++ELLKKPE FK+A +ELDRVIG+ RWVEEKD+ NLP+I AI 
Sbjct  301   DLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWVEEKDIVNLPFINAIC  360

Query  1323  KEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRF  1502
             KE MRLHPV+P LVPRL RED ++ GYDIPKGTRV+V+VWT+ RD ++W+ P+EF P+RF
Sbjct  361   KETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWEKPHEFCPERF  420

Query  1503  IGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNM  1682
             IGK IDVKG +FELLPFGAGRRMC GYSLGLKVIQAS+ NLLHGF WKLP D+T E+LNM
Sbjct  421   IGKPIDVKGHNFELLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLPGDMTTEELNM  480

Query  1683  EEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +EIFGLSTPK+  L   +EPRLP H+YSV
Sbjct  481   QEIFGLSTPKQIALVAELEPRLPAHMYSV  509



>gb|EAZ09261.1| hypothetical protein OsI_31534 [Oryza sativa Indica Group]
Length=522

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/517 (63%), Positives = 411/517 (79%), Gaps = 8/517 (2%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
              A   S+ A  ++T+  L        RRK +LPPGPKPWP+IGNLNL+G+LPHRSIH+LS
Sbjct  3     VALCASFVAILLTTMLFLRAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              +YGP++ L+FGSFPVVVGSS EMA+ FLKT D  F+DRP+TAAGK+T YNY DITWSP 
Sbjct  63    RRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPC  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSA--QKPILLRDYMSTL  770
               YWRQARR+ LTELFSA+R+ESYE+IR +E+ ++LR L+ ASS+  ++ I+++DY+ST 
Sbjct  123   DAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTA  182

Query  771   SLNVISWMVLGKSYLN------ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFL  932
             SLN+I+ MV+GK Y+       E   A  +  +F+++L+ELF LNGV N+GD IPW+++L
Sbjct  183   SLNMITRMVMGKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWL  242

Query  933   DLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKL  1112
             DLQGY+KRMK +SK  D+ LEHV+DEH+ RR  EG+ FVA DMVD+LL+LADD SLEVKL
Sbjct  243   DLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEVKL  302

Query  1113  ERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDM  1292
              R  +KAF QDL+AGGTE+S+  +EWAISELL+KPE+F KAT+ELDR++G +RWV EKD+
Sbjct  303   SRDSIKAFTQDLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDI  362

Query  1293  PNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWD  1472
              +LPYI+AIVKE MRLHP+ P+L PRL RED  V GYDIP GTRV V+VW +ARDP LWD
Sbjct  363   LDLPYIEAIVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWD  422

Query  1473  NPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLP  1652
                EF+P+RF+GK IDVKG DFELLPFG+GRRMCPGY+LGLKVIQ S+ NLLHGF W+LP
Sbjct  423   ASEEFVPERFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLP  482

Query  1653  NDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              D+  E L+MEEIFGLS P+KFPL  V+EP+L  HLY
Sbjct  483   KDMVKEDLSMEEIFGLSMPRKFPLEVVVEPKLSSHLY  519



>ref|XP_006427726.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
 gb|ESR40966.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
Length=513

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/517 (65%), Positives = 419/517 (81%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLI-GSLPHRS  401
             ME    +W+S  AAW++T+A++L+  HL  RRKL+LPPGPK WP+IGNLNLI G  PHRS
Sbjct  1     MELTHHSWVSCWAAWLATLAVILIPLHLLRRRKLNLPPGPKSWPIIGNLNLIMGPAPHRS  60

Query  402   IHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDI  581
             +  L  KYGPI+QL+FGSFPVVV SS EMAK  LK+ D  F  RPK AAGKYT YN+S+I
Sbjct  61    VDALCKKYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNI  120

Query  582   TWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYM  761
             TWSPYGPY+ QAR++C  ELF+AKRL+SYEYIR +EL  +L+ LY +S   KPI L+D++
Sbjct  121   TWSPYGPYFNQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLYESSG--KPIALKDHL  178

Query  762   STLSLNVISWMVLGKSYLNESEGAI-VSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + +SLNVIS +VLGK Y NE +  I ++ +E ++M+DEL LLNGV +IGDSIPW+ FLDL
Sbjct  179   ADVSLNVISRVVLGKKYSNERQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDL  238

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG IKRMKA++KKFDRFLE V+DEHNARR    D++VAKDMVD+LL LADDP+LEV+L+R
Sbjct  239   QGNIKRMKAVAKKFDRFLEQVVDEHNARRKGI-DNYVAKDMVDVLLLLADDPTLEVRLDR  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
             H VK F  DL+AG TE ST+++EWA +EL+K PEI  KAT+ELDRVIG++RW EEKD+ N
Sbjct  298   HSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKATEELDRVIGKERWFEEKDIVN  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LP+I+AI+KE MRLH  APML+PR+ REDCKVA YDI KGT+VLV+ WT+ RDPALW+NP
Sbjct  358   LPFIEAIIKETMRLHG-APMLMPRMAREDCKVAAYDILKGTQVLVNTWTIERDPALWENP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RF+GK IDVKG DFELLPFGAGRRMCPGYS GLKVIQ+SL NLLHGF WKLP +
Sbjct  417   NEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSHGLKVIQSSLANLLHGFTWKLPGN  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             ++ ++LNMEE+F L+  KK PL  V +PRL  HLY++
Sbjct  477   MSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYNM  513



>dbj|BAD36163.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38068.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ44888.1| hypothetical protein OsJ_29529 [Oryza sativa Japonica Group]
Length=522

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/517 (63%), Positives = 410/517 (79%), Gaps = 8/517 (2%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
              A   S+ A  ++T+  L        RRK +LPPGPKPWP+IGNLNL+G+LPHRSIH+LS
Sbjct  3     VALCASFVAILLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              +YGP++ L+FGSFPVVVGSS EMA+ FLKT D  F+DRP+TAAGK+T YNY DITWSP 
Sbjct  63    RRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPC  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSA--QKPILLRDYMSTL  770
               YWRQARR+ LTELFSA+R+ESYE+IR +E+ ++LR L+ ASS+  ++ I+++DY+ST 
Sbjct  123   DAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTA  182

Query  771   SLNVISWMVLGKSYLN------ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFL  932
             SLN+I+ MV+GK Y+       E   A  +  +F+++L+ELF LNGV N+GD IPW+++L
Sbjct  183   SLNMITRMVMGKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWL  242

Query  933   DLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKL  1112
             DLQGY+KRMK +SK  D+ LEHV+DEH+ RR  EG+ FVA DMVD+LL+LADD SLEVKL
Sbjct  243   DLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEVKL  302

Query  1113  ERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDM  1292
              R  +KAF QDL+AGGTE+S+  +EWAISELL+KPE+F KAT+ELDR++G +RWV EKD+
Sbjct  303   SRDSIKAFTQDLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDI  362

Query  1293  PNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWD  1472
              +LPYI+AIVKE MRLHP+ P+L PRL RED  V GYDIP GTRV V+VW +ARDP LWD
Sbjct  363   LDLPYIEAIVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWD  422

Query  1473  NPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLP  1652
                EF+P+RF+GK IDVKG DFELLPFG+GRRMCPGY+LGLKVIQ S+ NLLHGF W+LP
Sbjct  423   ASEEFMPERFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLP  482

Query  1653  NDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              D+  E L+MEEIFGLS P+KFPL   +EP+L  HLY
Sbjct  483   KDMVKEDLSMEEIFGLSMPRKFPLEVAVEPKLSSHLY  519



>ref|XP_002303387.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
 gb|ABK96148.1| unknown [Populus trichocarpa]
 gb|EEE78366.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
Length=509

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/509 (66%), Positives = 415/509 (82%), Gaps = 7/509 (1%)
 Frame = +3

Query  252   SYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLI-GSLPHRSIHDLSVKYG  428
             ++AA  ++T+A++ L +HL  R KL+LPPGPKPWP+IGNLNL+ G LPHR++H L  KYG
Sbjct  5     TFAALLLATVAVITLFRHLT-RPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHALVQKYG  63

Query  429   PIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYW  608
             PIMQL+FGSFPVVVGSS EMA+  LKT D+   DRPK AAGKYTTYNYS+ITWS YGPYW
Sbjct  64    PIMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYW  123

Query  609   RQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVIS  788
             RQAR++CL E+FS KRL+ +E +R QEL ++LR+L+   SA KPI  RD  S LSL+VIS
Sbjct  124   RQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFV--SAGKPINARDEFSDLSLSVIS  181

Query  789   WMVLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMK  962
              +VLGK+Y  ++  +   +SP EF++M+DELFLLNGVL+IGDSIPW+ FLDLQGYIKRMK
Sbjct  182   RLVLGKNYTVKTGNQKQYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMK  241

Query  963   ALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQ  1142
             A+ + FD FLE+ L+EH  RR    D +V +DM+D+LLQL+DDP+LEV+L+R  VKAF  
Sbjct  242   AVGQLFDGFLEYTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTM  300

Query  1143  DLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIV  1322
             DL+AGGTE+S V  EWA++ELLKKPE FK+A +ELDRVIG+ RW+EEKD+ NLP+I AI 
Sbjct  301   DLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWIEEKDIVNLPFINAIC  360

Query  1323  KEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRF  1502
             KE MRLHPV+P LVPRL RED ++ GYDIPKGTRV+V+VWT+ RD ++W+ P+EF P+RF
Sbjct  361   KETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWEKPHEFCPERF  420

Query  1503  IGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNM  1682
             IGK IDVKG +FELLPFGAGRRMC GYSLGLKVIQAS+ NLLHGF WKLP D+  E+LNM
Sbjct  421   IGKSIDVKGHNFELLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLPGDMKTEELNM  480

Query  1683  EEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +EIFGLSTPK+  L   +EPRLP H+YS+
Sbjct  481   QEIFGLSTPKQIALVAELEPRLPAHMYSM  509



>ref|XP_006494828.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=513

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/517 (65%), Positives = 417/517 (81%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLI-GSLPHRS  401
             ME    +W+S   AW++T+A++L+  HL  RRKL+LPPGPK WP+IGNLNL  G  PHRS
Sbjct  1     MELTHHSWVSCWGAWLATLAVILIPLHLLRRRKLNLPPGPKSWPIIGNLNLFTGPAPHRS  60

Query  402   IHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDI  581
             +  L  KYGPI+QL+FGSFPVVV SS EMAK  LK+ D  F  RPK AAGKYT YN+S+I
Sbjct  61    VDALCKKYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNI  120

Query  582   TWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYM  761
             TWSPYGPY+ QAR++C  ELF+AKRL+SYEYIR +EL  +L+ LY +S   KPI L+D++
Sbjct  121   TWSPYGPYFSQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLYESSG--KPIALKDHL  178

Query  762   STLSLNVISWMVLGKSYLNESEGAI-VSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + +SLNVIS +VLGK Y NE +  I ++ +E ++M+DEL LLNGV +IGDSIPW+ FLDL
Sbjct  179   ADVSLNVISRVVLGKKYSNERQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDL  238

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG IKRMKA++KKFDRFLE V+DEHNARR    D++VAKDMVD+LL LADDP+LEVKL+R
Sbjct  239   QGNIKRMKAVAKKFDRFLEQVVDEHNARRKGI-DNYVAKDMVDVLLLLADDPTLEVKLDR  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
             H VK F  DL+AG TE ST+++EWA +EL+K PEI  KA +ELDRVIG++RW EEKD+ N
Sbjct  298   HSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVN  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LP+I+AI+KE MRLH  APML+PR+ REDCKVAGYDI KGT+VLV+ WT+ RDPALW+NP
Sbjct  358   LPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RF+GK IDVKG DFELLPFGAGRRMCPGYS GLKVIQ+SL NLLHGF WKLP +
Sbjct  417   NEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGN  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             ++ ++LNMEE+F L+  KK PL  V +PRL  HLY+V
Sbjct  477   MSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYNV  513



>ref|XP_011036443.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
 ref|XP_011036444.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/498 (67%), Positives = 408/498 (82%), Gaps = 7/498 (1%)
 Frame = +3

Query  285   LLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLI-GSLPHRSIHDLSVKYGPIMQLQFGSFP  461
             ++ L +HL  R KL+LPPGPKPWP+IGNLNL+ G LPHR++H L  KYGPIMQL+FGSFP
Sbjct  16    VITLFRHLT-RPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHALVQKYGPIMQLKFGSFP  74

Query  462   VVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTEL  641
             VVVGSS EMA+  LKT D+   DRPK AAGKYTTYNYS+ITWS YGPYWRQAR++CL E+
Sbjct  75    VVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWRQARKICLMEI  134

Query  642   FSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE  821
             FS KRL+ +E +R QEL ++LR+L+   SA KPI  RD  S LSL+VIS +VLGK+Y  +
Sbjct  135   FSPKRLDQFETVRVQELHALLRKLFV--SAGKPINARDNFSDLSLSVISRLVLGKNYTVK  192

Query  822   S--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLE  995
             +  +   +SP EF++M+DELFLLNGVL+IGDSIPW+ FLDLQGYIKRMKA+ + FD FLE
Sbjct  193   TGNQKEYMSPKEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKAVGRLFDGFLE  252

Query  996   HVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENST  1175
             H L+EH  RR    D +V +DM+D+LLQL+DDP+LEV+L+R  VKAF  DL+AGGTE+S 
Sbjct  253   HTLNEHQQRRKGVKD-YVPQDMMDILLQLSDDPNLEVQLDRTAVKAFTMDLIAGGTESSA  311

Query  1176  VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAP  1355
             V  EWA++ELLKKPE FK+A +ELDRVIG+ RWVEEKD+ NLP+I AI KE MRLHPV+P
Sbjct  312   VTTEWAMAELLKKPEYFKRANEELDRVIGRDRWVEEKDIVNLPFINAICKETMRLHPVSP  371

Query  1356  MLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCD  1535
              LVPRL RED ++ GYDIPKGTRV+V+VWT+ RD ++W+ P+EF P+RFIGK IDVKG +
Sbjct  372   FLVPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWEKPHEFCPERFIGKPIDVKGHN  431

Query  1536  FELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKK  1715
             FELLPFGAGRRMC GYSLGLKVIQAS+ NLLHGF WKLP D+T E+LNM+EIFGLSTPK+
Sbjct  432   FELLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLPGDMTTEELNMQEIFGLSTPKQ  491

Query  1716  FPLTTVIEPRLPMHLYSV  1769
              PL   +EPRLP H+YS+
Sbjct  492   IPLVAELEPRLPAHMYSM  509



>ref|XP_011039208.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=512

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/513 (65%), Positives = 416/513 (81%), Gaps = 6/513 (1%)
 Frame = +3

Query  237   TATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             T+TW+SYAA  ++TI L+LL + +R RRKLHLPPGPKPWP+IGNL+L+G LPHRS+  LS
Sbjct  4     TSTWVSYAAPLLATITLILLGRLIR-RRKLHLPPGPKPWPIIGNLDLMGELPHRSLEALS  62

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYG +MQ++FGS PVVVGSS EMA+  LKT D++   RPKTA+GKYTTYNY +ITW+ Y
Sbjct  63    KKYGSLMQVKFGSHPVVVGSSVEMARAILKTHDLSLAGRPKTASGKYTTYNYQNITWAQY  122

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GPYWRQAR++CL ELFS KRL+ +EYIR +E    L  L+      KP+ +RD+ S LS 
Sbjct  123   GPYWRQARKLCLMELFSPKRLDQFEYIRVEENLKFLNTLFQKRG--KPVSVRDHFSDLSF  180

Query  777   NVISWMVLGKSYLNESEGA--IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             +VIS +VLG+ Y+ ESE    ++S  EF+++LDE+FLLNGVL IGD IPW+ FLDLQGYI
Sbjct  181   SVISRLVLGRKYMAESEDEKDMLSLKEFKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYI  240

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             KRMKA++KK D F+EH L+EH+ARR    D +  +DM+D+LLQ+ADDP+LEVKL+R GVK
Sbjct  241   KRMKAVAKKMDMFMEHALEEHHARRKGLKD-YEPRDMLDILLQVADDPNLEVKLDRIGVK  299

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
             AF QDL+ GGTE+S V  EWA++E++KKPEIF KAT+ELDRVIG++RWV+E D+ NLP+I
Sbjct  300   AFTQDLINGGTESSAVTTEWALAEIMKKPEIFDKATEELDRVIGRERWVQENDIDNLPFI  359

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AIVKE MRLHPVAP+LVPRL RED ++AGYDIPKGTRVLV+   + RDP++WD P EF 
Sbjct  360   NAIVKETMRLHPVAPLLVPRLAREDIQIAGYDIPKGTRVLVNASAIGRDPSIWDKPKEFC  419

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RFIGK +DVKG DFELLPFGAGRR+CPGY LGLKVIQ S+ NLLHGF WKLP+++T +
Sbjct  420   PERFIGKSVDVKGHDFELLPFGAGRRICPGYPLGLKVIQTSVANLLHGFKWKLPDNMTAK  479

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              LNMEEIFGLS P+K PL  V+EPRLP  LYS+
Sbjct  480   DLNMEEIFGLSAPRKVPLVAVLEPRLPSELYSL  512



>ref|XP_008784472.1| PREDICTED: cytochrome P450 71A2-like [Phoenix dactylifera]
Length=776

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/472 (69%), Positives = 391/472 (83%), Gaps = 2/472 (0%)
 Frame = +3

Query  354   PVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDR  533
             PVIGNLNLI SLPHRS+H LS KYGP+M L FGSFPV+V SS + AK  LKT D+ F  R
Sbjct  307   PVIGNLNLISSLPHRSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGR  366

Query  534   PKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQL  713
             PKTAAGK+T YNYS+I WS YGPYWRQAR+MC+TELFSA+RL+SY+YIR +E+K++LR L
Sbjct  367   PKTAAGKWTAYNYSNIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDL  426

Query  714   YTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGV  893
             + +S   +P+ L D++S  SL++IS MVLGK YL++SE ++VSP EF+ MLDE  LLNGV
Sbjct  427   FNSSG--RPVNLSDHLSNASLSIISRMVLGKKYLDKSESSVVSPVEFKAMLDEFMLLNGV  484

Query  894   LNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLL  1073
             +NIGDSIPW+DFLDLQGYIKRMK + KKFDRFLEHVLDEH  RR  EG+ FV KDMVD+L
Sbjct  485   MNIGDSIPWLDFLDLQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTKDMVDVL  544

Query  1074  LQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDR  1253
             L LADDP+LEVKLER GVK F QDL+AGGT+   V +EW ISELLK+PEIFKKAT+ELDR
Sbjct  545   LLLADDPNLEVKLERRGVKGFTQDLIAGGTDTYAVTMEWVISELLKRPEIFKKATEELDR  604

Query  1254  VIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLV  1433
             VIG+ RWVEEK++ +LPYI+AI+KE MR+HPV PML+PR C EDC+VAGYDI  GTRVLV
Sbjct  605   VIGRSRWVEEKEVHHLPYIEAIMKETMRMHPVVPMLIPRQCMEDCRVAGYDIRAGTRVLV  664

Query  1434  SVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQAS  1613
             +VWT+ RDP +WD P EF P+RFIG  IDVKG DFELLPFG+GRRMCPGYSLGL  IQ S
Sbjct  665   NVWTIGRDPGIWDAPEEFRPERFIGSSIDVKGKDFELLPFGSGRRMCPGYSLGLMEIQLS  724

Query  1614  LGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             L NLLHGF W+LP+ +  E L+MEEIFG +TP+K PL  V+EP+LP HLY+V
Sbjct  725   LANLLHGFAWRLPDGMKVEDLSMEEIFGATTPRKVPLEVVVEPKLPAHLYAV  776


 Score =   402 bits (1034),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 245/307 (80%), Gaps = 5/307 (2%)
 Frame = +3

Query  225   MESPT-ATWISYAAAWVSTIALLLLAKHLRWRR--KLHLPPGPKPWPVIGNLNLIGSLPH  395
             ME P+ AT+++   A +  + LLL +   R RR  KL+LPPGPKP PVIGNLNLI SLPH
Sbjct  1     MELPSWATYLATLPASILLLLLLLKSLFCRRRRLCKLNLPPGPKPLPVIGNLNLISSLPH  60

Query  396   RSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYS  575
             RS+H LS KYGP+M L FGSFPV+V SS + AK  LKT D+ F  RPKTAAGK+T YNYS
Sbjct  61    RSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGRPKTAAGKWTAYNYS  120

Query  576   DITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRD  755
             +I WS YGPYWRQAR+MC+TELFSA+RL+SY+YIR +E+K++LR L+ +S   +P+ L D
Sbjct  121   NIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDLFNSSG--RPVNLSD  178

Query  756   YMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
             ++S  SL++IS MVLGK YL++SE ++VSP EF+ MLDE  LLNGV+NIGDSIPW+DFLD
Sbjct  179   HLSNASLSIISRMVLGKKYLDKSESSVVSPVEFKAMLDEFMLLNGVMNIGDSIPWLDFLD  238

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGYIKRMK + KKFDRFLEHVLDEH  RR  EG+ FV KDMVD+LL LADDP+LEVKLE
Sbjct  239   LQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTKDMVDVLLLLADDPNLEVKLE  298

Query  1116  RHGVKAF  1136
             R GVK F
Sbjct  299   RRGVKGF  305



>ref|XP_007012628.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY30247.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=512

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/513 (64%), Positives = 412/513 (80%), Gaps = 8/513 (2%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             +W   A  W++++A L      R R +L LPPGPKPWP+IGNLNLI SLPH+S+H LS K
Sbjct  4     SWFVVAITWLASLAFLSRIFTSR-RNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQK  62

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQL+FGS+PVVV SSA+MAK FLK  D NF  RP+TAAGK+TTYNY +ITW+PYGP
Sbjct  63    YGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYGP  122

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQ R++ L ELFS+KRLES+EYIR +E+++ + +LY  S   KP++L++++S  +L+V
Sbjct  123   YWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLSV  180

Query  783   ISWMVLGKSYLNES----EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             IS +VLGK Y +ES    E +IV+  EF+++LDELFLLNGVLNIGD IPW+DFLDLQGY+
Sbjct  181   ISRIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGYL  240

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             KRMKAL KK DRF EHV +EH +++  E   FV +DMVDLLLQLADDP ++VKL   GV+
Sbjct  241   KRMKALKKKLDRFHEHVFNEHKSKK-KELKDFVPQDMVDLLLQLADDPDIDVKLSYDGVR  299

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
              F QDL+AGGT+ S   VEWAISEL+K+P++ KKAT+ELDRVIG++RWVEEKD+P LPYI
Sbjct  300   GFTQDLVAGGTDTSATTVEWAISELIKQPQLIKKATEELDRVIGRERWVEEKDIPQLPYI  359

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AI+KE MR HPVA ML P L  EDC VAGYDI KGT V ++ W++ RDP+LW+ P +F 
Sbjct  360   DAIMKETMRKHPVAVMLAPHLALEDCLVAGYDIRKGTTVFINTWSMGRDPSLWEEPEDFR  419

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RF+GK IDVKG  FELLPFG+GRRMCPGYSLGLK+I++SL NLLHGFNWKLP++   E
Sbjct  420   PERFLGKKIDVKGQHFELLPFGSGRRMCPGYSLGLKMIRSSLANLLHGFNWKLPDNTKAE  479

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              L+MEE++GL+TP+KFPL  V+EPRLP+HLY +
Sbjct  480   DLSMEEVYGLATPRKFPLVAVLEPRLPLHLYKI  512



>emb|CDP21888.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/515 (65%), Positives = 400/515 (78%), Gaps = 47/515 (9%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             MES + TW +YA AWV+T+ +  L+KH   ++KL+LPPGP+ WP+IGNLNLIG+LPHRS+
Sbjct  1     MESFSPTWAAYALAWVATVVIAHLSKHFH-QQKLNLPPGPRQWPIIGNLNLIGTLPHRSL  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS+ YGP+M LQFG+FPVVVGSS EMAK FLKTMD+ F  RPKTA+GKY +Y+ +D+T
Sbjct  60    HQLSLTYGPLMHLQFGTFPVVVGSSVEMAKVFLKTMDVTFAGRPKTASGKYNSYDCTDMT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYWRQAR++ LTELFSAKRLESYE+IR +E+ S+L QL+ +S   KP++L+DY+S
Sbjct  120   WSAYGPYWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQLFKSSG--KPVVLKDYLS  177

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
             T SLNVIS MVLGK+Y++ESE +IV+P+EFR+M+DELFLL GV NIGD IPWIDFLDLQG
Sbjct  178   TGSLNVISRMVLGKTYIDESENSIVTPDEFRQMMDELFLLTGVFNIGDFIPWIDFLDLQG  237

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             YIKRMK LSKKFDRFLEHVLDEHNA+R  +  + V+KD+VD+LL LADDP+LEVKLER G
Sbjct  238   YIKRMKILSKKFDRFLEHVLDEHNAQR-KDDTNCVSKDLVDVLLGLADDPTLEVKLERRG  296

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKA   DLLAGGTE S   VEWAISELLK PEIF KA +ELDRVIGQ RWV EKDMPNLP
Sbjct  297   VKALTLDLLAGGTETSATTVEWAISELLKNPEIFNKAAEELDRVIGQNRWVNEKDMPNLP  356

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI+A+VKE MR+HP                                           P  
Sbjct  357   YIEAVVKETMRMHP-------------------------------------------PEL  373

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F PDRF+GKDID KG D + LPFGAGRRMCPGYSLGLKVIQ+SL NLLHG+ WKLPND+ 
Sbjct  374   FCPDRFMGKDIDFKGQDCKFLPFGAGRRMCPGYSLGLKVIQSSLANLLHGYRWKLPNDMM  433

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             PE L+MEEIFGL+TP+K PL  ++EPRLP +LYS+
Sbjct  434   PEDLDMEEIFGLTTPRKIPLVAIVEPRLPRNLYSL  468



>ref|XP_008463992.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=507

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/508 (66%), Positives = 411/508 (81%), Gaps = 8/508 (2%)
 Frame = +3

Query  246   WISYAAAWVSTIALLLLAKHLRW--RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             W+SY  A+++   L LL     +  R KL+L PGPKPWP+IGNLNL+G LPH+SIH LS 
Sbjct  6     WVSYTTAYIAIATLALLLLSRWFLLRPKLNLLPGPKPWPLIGNLNLMGPLPHQSIHQLSK  65

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             KYGPIMQL+FGSFPVVVGSS EMAK F KT D  F+ RP+  AGK+ +YNYS I WSPYG
Sbjct  66    KYGPIMQLRFGSFPVVVGSSVEMAKLFFKTHDSLFLSRPRITAGKHLSYNYSGILWSPYG  125

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PYW QAR++C TELFSAKRL+S+EY+R +E+ S+++ ++  +S  KPI L++++ST+SLN
Sbjct  126   PYWLQARKICSTELFSAKRLDSFEYMRKEEVNSMIKAIH--NSIGKPIQLKNHLSTMSLN  183

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             VI  MVLGK Y    E   V PNEF+KMLDE FLL+GVLNIGD IP I FLDLQGY+KRM
Sbjct  184   VICRMVLGKKY---EENTSVPPNEFKKMLDEFFLLSGVLNIGDYIPLISFLDLQGYVKRM  240

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             KALSKKFDR LE+VLDEHN RR    + +VAKD+VD+LLQLAD+ +LEVKLER+GVKA +
Sbjct  241   KALSKKFDRLLENVLDEHNERRKGV-EGYVAKDVVDVLLQLADNSNLEVKLERNGVKAIV  299

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QD++ GGT++S + VEWA+SELLKKPEIF KA++ELDRVIG++RWVEEKD+ NLPYI AI
Sbjct  300   QDIIIGGTQSSAITVEWAMSELLKKPEIFDKASEELDRVIGRERWVEEKDIVNLPYIDAI  359

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             VKE MRLHP APMLVPR+ REDC++ GY I KGTRV+V+VWT+ RDP +W NP  F P+R
Sbjct  360   VKETMRLHPAAPMLVPRMAREDCQIEGYHIEKGTRVVVNVWTIGRDPTVWKNPELFDPER  419

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             FIGKD++VKG +FE+LPFG+GRRMCPGY+LGLK+IQ +L NLLHGF WKL  D+  + LN
Sbjct  420   FIGKDVNVKGQNFEILPFGSGRRMCPGYNLGLKIIQTNLANLLHGFCWKLVEDMKEKDLN  479

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             MEE+ G+ST KKFPL  V +PRLP HLY
Sbjct  480   MEELAGISTLKKFPLHAVAKPRLPSHLY  507



>ref|XP_002278462.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=509

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/515 (64%), Positives = 408/515 (79%), Gaps = 8/515 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P+  W+  A AW++++ALL      R   K +LPPGP PWP+IGNLNLIG LPHRS+
Sbjct  1     MEAPS--WVVLALAWLASVALLSKVFSFRPPHKQNLPPGPTPWPIIGNLNLIGHLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYG IM+L+FGSFPVVV SS+EMAK FLKT D  F  RP TAAGKY TYNYS+IT
Sbjct  59    HKLSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPHTAAGKYITYNYSNIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             W+PYGPYWRQ R++ LTELFS+KRL SYEYIR +E ++ + +LY  S   KP++L++++S
Sbjct  119   WAPYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLS  176

Query  765   TLSLNVISWMVLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              ++L VIS +VLG+ Y +E E   ++++  E +KML ELFLLNGVLNIGD IPWI FLDL
Sbjct  177   RVTLGVISRIVLGEKYFSEFESGRSMLTVEECQKMLGELFLLNGVLNIGDWIPWIAFLDL  236

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QGY+KRMKAL  KFDRF +HVL++H ARR  E + FVAKDMVD+LL+LADDP +EVKL  
Sbjct  237   QGYVKRMKALRDKFDRFYDHVLEKHRARR--EAEDFVAKDMVDMLLRLADDPDVEVKLTT  294

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              G+K F QDL+AGGT+ S   +EWA+SE+L++P I KKAT+ELDRVIG+ RWVEEKD+  
Sbjct  295   DGIKGFTQDLIAGGTDTSATTLEWAMSEVLRQPNIAKKATEELDRVIGRDRWVEEKDIAQ  354

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI AIVKE MRLHP+  +L P L  +DC VAGYDI +GTRVLV+ W++ RDP +WD P
Sbjct  355   LPYIDAIVKETMRLHPIVVLLAPHLALQDCNVAGYDIRRGTRVLVNTWSIGRDPNIWDAP  414

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
              EF P+RF+GK IDVKG  FELLPFG+GRRMCPGYSLGLK+IQ+SL N+LHGF+WKLP D
Sbjct  415   EEFRPERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANMLHGFHWKLPWD  474

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +  E+LNMEE+FGL+TP+K PL  V+EPRL  HLY
Sbjct  475   MKTEELNMEEVFGLTTPRKVPLVAVMEPRLQNHLY  509



>emb|CAN82000.1| hypothetical protein VITISV_023195 [Vitis vinifera]
Length=509

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/515 (64%), Positives = 408/515 (79%), Gaps = 8/515 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME+P+  W+  A AW++++ALL      R   K +LPPGP PWP+IGNLNLIG LPHRS+
Sbjct  1     MEAPS--WVVLALAWLASVALLSKVFSFRPPHKQNLPPGPTPWPIIGNLNLIGHLPHRSL  58

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYG IM+L+FGSFPVVV SS+EMAK FLKT D  F  RP TAAGKY TYNYS+IT
Sbjct  59    HKLSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPXTAAGKYITYNYSNIT  118

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             W+PYGPYWRQ R++ LTELFS+KRL SYEYIR +E ++ + +LY  S   KP++L++++S
Sbjct  119   WAPYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLS  176

Query  765   TLSLNVISWMVLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              ++L VIS +VLG+ Y +E E   ++++  E +KML ELFLLNGVLNIGD IPWI FLDL
Sbjct  177   RVTLGVISRIVLGEKYFSEFESGRSMLTVEECQKMLGELFLLNGVLNIGDWIPWIAFLDL  236

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QGY+KRMKAL  KFDRF +HVL++H ARR  E + FVAKDMVD+LL+LADDP +EVKL  
Sbjct  237   QGYVKRMKALRDKFDRFYDHVLEKHRARR--EAEDFVAKDMVDMLLRLADDPDVEVKLTT  294

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              G+K F QDL+AGGT+ S   +EWA+SE+L++P I KKAT+ELDRVIG+ RWVEEKD+  
Sbjct  295   DGIKGFTQDLIAGGTDTSATTLEWAMSEVLRQPNIAKKATEELDRVIGRDRWVEEKDIAQ  354

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI AIVKE MRLHP+  +L P L  +DC VAGYDI +GTRVLV+ W++ RDP +WD P
Sbjct  355   LPYIDAIVKETMRLHPIVVLLAPHLALQDCNVAGYDIRRGTRVLVNTWSIGRDPNIWDAP  414

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
              EF P+RF+GK IDVKG  FELLPFG+GRRMCPGYSLGLK+IQ+SL N+LHGF+WKLP D
Sbjct  415   EEFRPERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANMLHGFHWKLPWD  474

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +  E+LNMEE+FGL+TP+K PL  V+EPRL  HLY
Sbjct  475   MKTEELNMEEVFGLTTPRKVPLVAVMEPRLXNHLY  509



>ref|XP_006465908.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=511

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/479 (72%), Positives = 400/479 (84%), Gaps = 7/479 (1%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGPKPWP+IGNLNLIG LP+RSIH LS KYGPIMQL+FGSFPVVVGSS EMA+ FLKT 
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D  F  RPK AAGKYTT+NYS+ITWS YGPYWRQ R++CL ELF+AKRL SYEYIR +E 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  693   KSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDE  872
                LR LY +S   KPI+L+D +  L+L V+S MVLGK Y NE    IV+ +EF++M DE
Sbjct  160   MLFLRNLYESSG--KPIILKDNLLDLNLEVMSRMVLGKKYTNE----IVARHEFKEMADE  213

Query  873   LFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVA  1052
             LF+L GVL+IGD IPW+ FLDLQGYIKRMK L+KKFDR  E+ LDEHNARR    D++ A
Sbjct  214   LFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDEHNARRKGV-DNYEA  272

Query  1053  KDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKK  1232
             KDM+D+LLQLADDP+LEVKLERH +KA  QDLLAGGTE+S V VEWAISEL+KKP++ KK
Sbjct  273   KDMMDVLLQLADDPTLEVKLERHSLKAVTQDLLAGGTESSAVTVEWAISELMKKPKLLKK  332

Query  1233  ATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIP  1412
             AT+ELDRV+G++RWVEEKD+ NLP+I AIVKE MRLHPV+P LVPR+  EDCKVAGYDIP
Sbjct  333   ATEELDRVVGKERWVEEKDIVNLPFIDAIVKETMRLHPVSPTLVPRMASEDCKVAGYDIP  392

Query  1413  KGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLG  1592
             KGTRVLV+VWT+ RDPALW+NPNEF P RF+GK IDVKG DFELLPFG GRR+CPG SLG
Sbjct  393   KGTRVLVNVWTIGRDPALWENPNEFYPQRFLGKSIDVKGHDFELLPFGTGRRICPGMSLG  452

Query  1593  LKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             LKV+Q+SL NLLHGF+WKLP  ++ ++LNMEE FGLSTPKKFPL  V +PRL  HLYS+
Sbjct  453   LKVVQSSLANLLHGFSWKLPGTMSNQELNMEETFGLSTPKKFPLEVVAQPRLSSHLYSL  511



>ref|XP_006426677.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
 gb|ESR39917.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
Length=511

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/479 (71%), Positives = 401/479 (84%), Gaps = 7/479 (1%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGPKPWP+IGNLNLIG LP+RSIH LS KYGPIMQL+FGSFPVVVGSS EMA+ FLKT 
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D  F  RPK AAGKYTT+NYS+ITWS YGPYWRQ R++CL ELF+AKRL SYEYIR +E 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  693   KSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDE  872
                LR LY +S   KPI+L+D +  L+L V+S MVLGK Y NE    IV+ +EF++M DE
Sbjct  160   MLFLRNLYESSG--KPIILKDNLLDLNLEVMSRMVLGKKYTNE----IVARHEFKEMADE  213

Query  873   LFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVA  1052
             LF+L GVL+IGD IPW+ FLDLQGYIKRMK L+KKFDR  E+ LD+HNARR    D++ A
Sbjct  214   LFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDDHNARRKGV-DNYEA  272

Query  1053  KDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKK  1232
             KDM+D+LLQLADDP+LEVKLERH +KA  QDLLAGGTE+S V VEWAISEL+KKP++ KK
Sbjct  273   KDMMDVLLQLADDPTLEVKLERHSLKAVTQDLLAGGTESSAVTVEWAISELMKKPKLLKK  332

Query  1233  ATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIP  1412
             AT+ELDRV+G++RWVEEKD+ NLP+I AIVKE MRLHPV+P LVPR+  EDCKVAGYDIP
Sbjct  333   ATEELDRVVGKERWVEEKDIVNLPFIDAIVKETMRLHPVSPTLVPRMASEDCKVAGYDIP  392

Query  1413  KGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLG  1592
             KGTRVLV+VWT+ RDPALW+NPNEF P RF+GK IDVKG DFELLPFG GRR+CPG SLG
Sbjct  393   KGTRVLVNVWTIGRDPALWENPNEFYPQRFLGKSIDVKGRDFELLPFGTGRRICPGMSLG  452

Query  1593  LKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             LKV+Q+SL NLLHGF+WKLP +++ ++LNMEE FGLSTPKKFPL  V +PRL  HLYS+
Sbjct  453   LKVVQSSLANLLHGFSWKLPGNMSNQELNMEETFGLSTPKKFPLEVVAQPRLSFHLYSL  511



>ref|XP_002462454.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
 gb|EER98975.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
Length=521

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/518 (63%), Positives = 408/518 (79%), Gaps = 10/518 (2%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRRKLHLP---PGPKPWPVIGNLNLIGSLPHRSIHD  410
             + W S +A  +ST+  L+ A H R RR+  +    PGPKPWPVIGN NL+G+LPHRS+  
Sbjct  4     SAWASLSAVVLSTVLFLIGAIHARRRRRPSISNSLPGPKPWPVIGNFNLLGALPHRSLDA  63

Query  411   LSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWS  590
             LS  +GP+M++QFGSFPVV+ SS +MA+ FLKT D  F+DRPK AAGKYTTYNYS+I WS
Sbjct  64    LSKLHGPLMRVQFGSFPVVIASSVDMARFFLKTHDSAFIDRPKMAAGKYTTYNYSNIAWS  123

Query  591   PYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTL  770
             PYG YWRQAR++C  ELFSA+RLES E++R +E+ ++LR L+  +  Q  + L++ +ST+
Sbjct  124   PYGAYWRQARKICADELFSARRLESLEHVRREEVHALLRDLHGTAPGQV-VQLKERLSTM  182

Query  771   SLNVISWMVLGK-----SYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
             SLN+I+ MVLG+       +    G++ +  EFR MLDELFLLNGVLN+GD IPW+ +LD
Sbjct  183   SLNIIARMVLGRKCVENEVVTSGGGSVTTWREFRWMLDELFLLNGVLNVGDWIPWVSWLD  242

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             LQGY++RMK + + FDRF+E+V++EHN RR+ EGD FV +DMVD LLQLADDPSL+VKL 
Sbjct  243   LQGYVRRMKRVGRMFDRFMENVVEEHNERRLREGDEFVPQDMVDRLLQLADDPSLDVKLT  302

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             R  VKAF QDL+AGGTE++ VIVEW ISEL+K P++F KAT+ELD VIG+ RWV EKDMP
Sbjct  303   RDSVKAFTQDLVAGGTESAAVIVEWGISELMKNPDVFAKATEELDGVIGRDRWVTEKDMP  362

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG-YDIPKGTRVLVSVWTVARDPALWD  1472
              LPY+ AIVKE MRLH V P+L PRL RED  V G YDIP GTRVL++ WT++RDPALWD
Sbjct  363   RLPYMDAIVKETMRLHMVVPLLSPRLSREDTSVGGRYDIPAGTRVLINAWTISRDPALWD  422

Query  1473  NPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLP  1652
              P EF P+RF+G  IDVKG DFELLPFG+GRRMCPGYSLGLKVIQ +L NLLHGF W+LP
Sbjct  423   APEEFWPERFVGSKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQVTLVNLLHGFAWRLP  482

Query  1653  NDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             + +T E+L+MEE+FGLSTP+KFPL  V+EP+LP  LY+
Sbjct  483   DGMTKEELSMEEVFGLSTPRKFPLQAVVEPKLPARLYT  520



>ref|XP_009413866.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/520 (63%), Positives = 407/520 (78%), Gaps = 11/520 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P++   +   A V    LL      R R KL+LPPGP+PWPVIGNLNLIG LP+RS+
Sbjct  1     MEIPSS---AIYLALVLVFTLLTGLYRGRRRHKLNLPPGPRPWPVIGNLNLIGPLPYRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
               LS K+GP+M L+FGSFPVVVGSS +MAK FLKT D++FV RPKT AGKYT YN+S+I+
Sbjct  58    AALSQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKTVAGKYTFYNHSNIS  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPYWRQARR+ + EL + KRL+SY+YIR +E++ +LR L+   S + P+LL DY+ 
Sbjct  118   WSPYGPYWRQARRILIMELLTPKRLDSYQYIRVEEVRGLLRDLF--RSTETPVLLNDYIF  175

Query  765   TLSLNVISWMVLGKSYLNESE------GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWID  926
             T++LN+IS +VLG+ Y  E         AIV   EF++M++EL LLNGV+N+GD IPW++
Sbjct  176   TVNLNIISRIVLGRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLN  235

Query  927   FLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEV  1106
             FLDLQGY+KRMK + K+FDRFLEHVLDEHN RR  EG +FV +D+VD+LL+LADD SLEV
Sbjct  236   FLDLQGYVKRMKMVGKRFDRFLEHVLDEHNERRRREGKAFVPRDLVDVLLELADDHSLEV  295

Query  1107  KLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEK  1286
             KLERH +KAFI D+ AGGT+ STV +EWA+SE+LK+PE F KAT+ELDRVIG+ RWVEE+
Sbjct  296   KLERHCLKAFILDMFAGGTDTSTVTIEWAVSEILKRPETFDKATEELDRVIGRGRWVEEE  355

Query  1287  DMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPAL  1466
             D+  LPYI+AIVKE MR+HPV P+LVPRL RE   V GYDIP GT VLV+VW + RDPA+
Sbjct  356   DVHRLPYIEAIVKETMRIHPVGPLLVPRLSREHTTVDGYDIPAGTGVLVNVWAIGRDPAV  415

Query  1467  WDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWK  1646
             WD P EF P+RF+G  IDVKG  FELLPFGAGRRMCPG SLGLK+++ SL NLLHGF W+
Sbjct  416   WDAPEEFRPERFVGSPIDVKGHHFELLPFGAGRRMCPGNSLGLKMVRLSLANLLHGFKWR  475

Query  1647  LPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LP  +T E+L M+EIFGL+TP+K  L  V+EP+LP HLY 
Sbjct  476   LPPGMTAEELKMDEIFGLTTPRKVRLQAVVEPKLPAHLYG  515



>ref|XP_002277926.2| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=508

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/483 (67%), Positives = 392/483 (81%), Gaps = 6/483 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPKPWP+IGNLNLIG LPH S+H LS KYG IMQLQFGSFPVVV SS EMAK F
Sbjct  30    KQNLPPGPKPWPIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMAKQF  89

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP+TAAGKYT YNYS+ITW+PYGPYWRQ R++  TELFS KRLESYEYI+
Sbjct  90    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPYWRQGRKIYHTELFSWKRLESYEYIQ  149

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG--AIVSPNEF  854
              +E ++ + +LY  S   KP++L++++S ++L+VIS +VLG+ Y NESE   +IV+  EF
Sbjct  150   VEERRAFISRLYALSG--KPVMLKEHLSRVTLSVISRIVLGEKYFNESESGRSIVTVKEF  207

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             ++MLDELFLLNGVLNIGD IPWI FLDLQGY+KRMK L  KFDRF +HVL++H ARR  E
Sbjct  208   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKVLRDKFDRFHDHVLEKHRARR--E  265

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
                FV KDMVD+LL+LADDP L+VKL   G+K F QDL+AGGT+ S   +EWA+SE+L++
Sbjct  266   VGDFVVKDMVDMLLRLADDPDLQVKLTTDGIKGFTQDLIAGGTDTSATTLEWAMSEVLRQ  325

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             P I  KAT+ELDRVIG+ RWVEEKD+P LPYI AIVKE MRLHPVA +L P L   DC V
Sbjct  326   PNIANKATEELDRVIGRNRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAPHLALHDCNV  385

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             AGYDI KGTRVL++ W++ RDP LWD P EF P+RF+GK IDVKG +FELLPFG+GRRMC
Sbjct  386   AGYDIRKGTRVLINTWSIGRDPNLWDAPEEFRPERFLGKAIDVKGQNFELLPFGSGRRMC  445

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGYSLGLK+I++SL N+LHGF+WKLP D+  E+LNMEE+FGL+TP+K PL  V+EPRLP 
Sbjct  446   PGYSLGLKMIRSSLANMLHGFHWKLPGDMKAEELNMEEVFGLATPRKVPLVAVMEPRLPN  505

Query  1755  HLY  1763
             HLY
Sbjct  506   HLY  508



>gb|EAZ07221.1| hypothetical protein OsI_29466 [Oryza sativa Indica Group]
Length=520

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/492 (65%), Positives = 407/492 (83%), Gaps = 7/492 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             RR  +LPPGP PWPVIGN NLIG+LPHRSIH+LS KYG +M L+FGSFPVVVGSS  MA+
Sbjct  29    RRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMAR  88

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
               LKT D  F+DRP+TA+GK+TTY Y+DITWSPYG YWRQARR+C+TELFSA+R+ S+E+
Sbjct  89    LVLKTHDAVFIDRPRTASGKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEH  148

Query  675   IRSQELKSILRQLYTASSAQKP---ILLRDYMSTLSLNVISWMVLGKSYLNE----SEGA  833
             IR+ E+++++R L+ A+S+ +     L RD++STLS+NVI+ MVLGK +  E    +EG 
Sbjct  149   IRADEVRALVRGLFAAASSGRSGAVYLNRDHLSTLSMNVITRMVLGKRFFGEGADAAEGP  208

Query  834   IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEH  1013
             + + +EF+ MLDEL LLNGVLN+GD IPW+D++DLQGY++RMK + K FD F+EHVLDEH
Sbjct  209   VSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLDEH  268

Query  1014  NARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWA  1193
             + RR  EG++FVA+DMVD+L+ LADDPSLE+KL R GVKAF QDL+AGGTE+S+V VEWA
Sbjct  269   SERRRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSSVTVEWA  328

Query  1194  ISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRL  1373
             +SEL K P IF  ATDELDRV+G+ RWV EKD+PNLPY+ AI+KE MR+HP+ P+L+PR+
Sbjct  329   LSELFKNPAIFATATDELDRVVGRGRWVTEKDIPNLPYLDAIMKETMRMHPIVPLLIPRV  388

Query  1374  CREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPF  1553
              R+D  VAGYDIPKG RVL++VWT+ RDP LWD   EF+P+RFIG  IDVKG DFELLPF
Sbjct  389   ARDDAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFELLPF  448

Query  1554  GAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV  1733
             G+GRRMCPGY+LGLKV+Q SL NLLHGF W+LP  +  E+L+M+E+FGLST +K+PL  V
Sbjct  449   GSGRRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYPLQVV  508

Query  1734  IEPRLPMHLYSV  1769
             +EPRLP+HLYS+
Sbjct  509   VEPRLPVHLYSL  520



>ref|XP_007012629.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY30248.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=539

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/540 (60%), Positives = 412/540 (76%), Gaps = 35/540 (6%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             +W   A  W++++A L      R R +L LPPGPKPWP+IGNLNLI SLPH+S+H LS K
Sbjct  4     SWFVVAITWLASLAFLSRIFTSR-RNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQK  62

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGP+MQL+FGS+PVVV SSA+MAK FLK  D NF  RP+TAAGK+TTYNY +ITW+PYGP
Sbjct  63    YGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYGP  122

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQ R++ L ELFS+KRLES+EYIR +E+++ + +LY  S   KP++L++++S  +L+V
Sbjct  123   YWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLSV  180

Query  783   ISWMVLGKSYLNES----EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             IS +VLGK Y +ES    E +IV+  EF+++LDELFLLNGVLNIGD IPW+DFLDLQGY+
Sbjct  181   ISRIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGYL  240

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             KRMKAL KK DRF EHV +EH +++  E   FV +DMVDLLLQLADDP ++VKL   GV+
Sbjct  241   KRMKALKKKLDRFHEHVFNEHKSKK-KELKDFVPQDMVDLLLQLADDPDIDVKLSYDGVR  299

Query  1131  AFIQ---------------------------DLLAGGTENSTVIVEWAISELLKKPEIFK  1229
              F Q                           DL+AGGT+ S   VEWAISEL+K+P++ K
Sbjct  300   GFTQKKEKKRAFCFAPLLLDDNFSCFVNRDQDLVAGGTDTSATTVEWAISELIKQPQLIK  359

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDRVIG++RWVEEKD+P LPYI AI+KE MR HPVA ML P L  EDC VAGYDI
Sbjct  360   KATEELDRVIGRERWVEEKDIPQLPYIDAIMKETMRKHPVAVMLAPHLALEDCLVAGYDI  419

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGT V ++ W++ RDP+LW+ P +F P+RF+GK IDVKG  FELLPFG+GRRMCPGYSL
Sbjct  420   RKGTTVFINTWSMGRDPSLWEEPEDFRPERFLGKKIDVKGQHFELLPFGSGRRMCPGYSL  479

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             GLK+I++SL NLLHGFNWKLP++   E L+MEE++GL+TP+KFPL  V+EPRLP+HLY +
Sbjct  480   GLKMIRSSLANLLHGFNWKLPDNTKAEDLSMEEVYGLATPRKFPLVAVLEPRLPLHLYKI  539



>ref|XP_006475100.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=509

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 393/485 (81%), Gaps = 4/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             RR L  P GPKPWP+IGNLNLIG LPH+S+H LS KYG IMQL+FGSFPVVV +SAEMAK
Sbjct  26    RRALKFPAGPKPWPIIGNLNLIGPLPHQSLHKLSQKYGQIMQLKFGSFPVVVAASAEMAK  85

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FL+T D  F  RP+TAAGK+TTYNY ++TW+PYGPYWRQ R++ L+ELFS+KRLESY+Y
Sbjct  86    QFLQTHDHIFSSRPQTAAGKHTTYNYLNLTWAPYGPYWRQGRKLYLSELFSSKRLESYQY  145

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES--EGAIVSPN  848
             IR +E ++ + +LY  S   KPI+L++++S ++L++IS  VLGK Y +ES  E +IV+  
Sbjct  146   IRVEEYRAFISRLYALSG--KPIVLKEHLSRVTLSIISRTVLGKKYFSESKAEDSIVTLE  203

Query  849   EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRV  1028
             EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRMKAL KKFDRF +HV DEH A R 
Sbjct  204   EFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRMKALKKKFDRFHDHVFDEHKANRK  263

Query  1029  AEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELL  1208
                  FV KDMVDLLLQ+ADDP+L+VKL    V+ F QDL+AGGT+ S   VEWA+SEL+
Sbjct  264   GNLKDFVPKDMVDLLLQMADDPNLDVKLNYDSVRGFTQDLIAGGTDTSATTVEWAMSELM  323

Query  1209  KKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDC  1388
             K+P++ KKAT+E+DRV+G++RWVEEKD+P LPYI AI+KE MR HPVA +L P L  EDC
Sbjct  324   KRPDLIKKATEEIDRVVGRQRWVEEKDIPQLPYIDAIMKETMRKHPVAVLLAPHLALEDC  383

Query  1389  KVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRR  1568
              VA +DI KGTRV ++ W++ RDP++WD P EF P+RF+ K  DVKG  FELLPFG+GRR
Sbjct  384   TVASFDIRKGTRVFINTWSIGRDPSVWDKPEEFRPERFLDKAFDVKGQHFELLPFGSGRR  443

Query  1569  MCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRL  1748
             MCPGYSLG+K+I++SL N+LHGFNWKLP  + PE ++M+E++GL+T +KFPL  V+EPRL
Sbjct  444   MCPGYSLGVKMIKSSLANMLHGFNWKLPAHMKPEHISMDEVYGLATIRKFPLVAVVEPRL  503

Query  1749  PMHLY  1763
             P+HLY
Sbjct  504   PLHLY  508



>ref|XP_004956936.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=516

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/519 (64%), Positives = 410/519 (79%), Gaps = 10/519 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P   W S  A  ++T+ L L A   R RR     PGPKPWPVIGN NL+G+LPHRS+
Sbjct  1     MELPA--WASVLAVVLATV-LFLRAVSGRRRRPCSSLPGPKPWPVIGNFNLLGALPHRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
               L+ ++GP+M++QFGSFPVV+ SS +MAK FLKT D  F+DRPK AAGKYTTYNYS+I 
Sbjct  58    DALAKRHGPLMRVQFGSFPVVIASSVDMAKFFLKTHDSAFIDRPKMAAGKYTTYNYSNIA  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR++C  ELFSA+RLES E++R +E++++LR L+ A+    P  L++ +S
Sbjct  118   WSPYGAYWRQARKICADELFSARRLESSEHVRREEVRALLRDLHGAAGQVVP--LKERLS  175

Query  765   TLSLNVISWMVLGKSYLNE-----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDF  929
             T+SLN+I+ MVLG+  ++        G++ +  EFR MLDELFLLNGVLNIGD IPW+ +
Sbjct  176   TMSLNMIARMVLGRKAVDREVVASGGGSVTTWKEFRWMLDELFLLNGVLNIGDWIPWLSW  235

Query  930   LDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVK  1109
             LDLQGY++RMK + K FDRF+E+V++EHN RR  EGD+FVAKDMVD LLQLADDP+LEVK
Sbjct  236   LDLQGYVRRMKRVGKMFDRFMENVVEEHNERRRREGDAFVAKDMVDRLLQLADDPNLEVK  295

Query  1110  LERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKD  1289
               R  VKAF QDL+AGGTE++ VIVEWAISELLK PE+F KAT+ELD VIG+ RWV EKD
Sbjct  296   FTRDSVKAFTQDLVAGGTESAAVIVEWAISELLKNPEVFAKATEELDSVIGRGRWVTEKD  355

Query  1290  MPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALW  1469
             M +LPY+ AIVKE MRLH V P+L PRL RED  V G+DIP GTRVLV+ W ++RDPALW
Sbjct  356   MAHLPYVDAIVKETMRLHMVVPLLSPRLSREDTSVGGHDIPAGTRVLVNAWIISRDPALW  415

Query  1470  DNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKL  1649
             + P EF P+RF+G  IDVKG DFE+LPFG+GRRMCPGYSLGLKVIQ +L NLLHGF W+L
Sbjct  416   EAPEEFRPERFVGSKIDVKGQDFEMLPFGSGRRMCPGYSLGLKVIQGTLANLLHGFAWRL  475

Query  1650  PNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             P+ +T E+L+MEE+FGLSTP+KFPL  V+EP+LP HLY+
Sbjct  476   PDGMTKEELSMEEVFGLSTPRKFPLQVVVEPKLPAHLYT  514



>ref|NP_001061964.2| Os08g0456200 [Oryza sativa Japonica Group]
 dbj|BAD10411.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ42966.1| hypothetical protein OsJ_27558 [Oryza sativa Japonica Group]
 dbj|BAF23878.2| Os08g0456200 [Oryza sativa Japonica Group]
Length=520

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/492 (65%), Positives = 405/492 (82%), Gaps = 7/492 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             RR  +LPPGP PWPVIGN NLIG+LPHRSIH+LS KYG +M L+FGSFPVVVGSS  MA+
Sbjct  29    RRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMAR  88

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
               LKT D  F+DRP+TA+ K+TTY Y+DITWSPYG YWRQARR+C+TELFSA+R+ S+E+
Sbjct  89    LVLKTHDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEH  148

Query  675   IRSQELKSILRQLYTASSAQKP---ILLRDYMSTLSLNVISWMVLGKSYLNE----SEGA  833
             IR+ E+++++R L+ A+S+ +     L RD++STLS+NVI+ MVLGK +  E    +EG 
Sbjct  149   IRADEVRALVRGLFAAASSGRSGAVHLNRDHLSTLSMNVITRMVLGKRFFGEGADAAEGP  208

Query  834   IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEH  1013
             + + +EF+ MLDEL LLNGVLN+GD IPW+D++DLQGY++RMK + K FD F+EHVLDEH
Sbjct  209   VSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLDEH  268

Query  1014  NARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWA  1193
             + RR  EG++FVA+DMVD+L+ LADDPSLE+KL R GVKAF QDL+AGGTE+S+V VEWA
Sbjct  269   SERRRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSSVTVEWA  328

Query  1194  ISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRL  1373
             +SEL K P IF  ATDELDRV+G+ RWV EKD+PNLPY+ AI+KE MR+HP+ P+L+PR+
Sbjct  329   LSELFKNPAIFATATDELDRVVGRCRWVTEKDIPNLPYLDAIMKETMRMHPIVPLLIPRV  388

Query  1374  CREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPF  1553
              R+D  VAGYDIPKG RVL++VWT+ RDP LWD   EF+P+RFIG  IDVKG DFELLPF
Sbjct  389   ARDDAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFELLPF  448

Query  1554  GAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV  1733
             G+GRRMCPGY+LGLKV+Q SL NLLHGF W+LP  +  E+L+M+E+FGLST +K+PL  V
Sbjct  449   GSGRRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYPLQVV  508

Query  1734  IEPRLPMHLYSV  1769
             +EPRLP+ LYS+
Sbjct  509   VEPRLPVQLYSL  520



>ref|XP_006369134.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
 gb|ERP65703.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
Length=513

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/517 (63%), Positives = 418/517 (81%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             M++P    I+Y AA ++T+ L+LL++ L + RKL LPPGPKPWP+IGN NLIG LPHRS+
Sbjct  1     MDNPPPPAITYTAAGLATVVLILLSRRL-FSRKLKLPPGPKPWPIIGNFNLIGPLPHRSL  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+L+ KYGPIMQ++FGS PVVVGSSAE+A+  LKT DI+  DRPK AAGKYTTYNYSDIT
Sbjct  60    HELAKKYGPIMQIKFGSIPVVVGSSAEVAEAILKTHDISLADRPKIAAGKYTTYNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYW   R+ C  E+FS KRL+ Y+++R +EL S+L+ LY  S    P   R+  S
Sbjct  120   WSQYGPYWSHLRKFCNMEIFSPKRLDFYQHVRVEELHSLLKSLYKTSGT--PFKTREKFS  177

Query  765   TLSLNVISWMVLGKSYLNESEGA--IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              LSL+VIS +VLG++Y  ESE    + +P+EF+K+LDELF+LNGVL IGD IPW+ + DL
Sbjct  178   DLSLSVISRLVLGRNYTLESEKGKGVYTPHEFKKILDELFVLNGVLEIGDWIPWLSYFDL  237

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG IK+MKA++KK DRF+EH L+EH+ARR     ++VAKDM+D+LLQL+DDPSL+V+  R
Sbjct  238   QGNIKKMKAVAKKVDRFIEHELEEHDARRNGV-KNYVAKDMMDILLQLSDDPSLDVEFGR  296

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              GVKA   DL+AGGTE++ V  EWA++ELLKKPEIF+KAT+ELDRVIG++RWVEEKD+ +
Sbjct  297   TGVKALTLDLIAGGTESTAVTAEWALAELLKKPEIFEKATEELDRVIGRERWVEEKDIVD  356

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPY+ AI+KE MRLH V+P+LVPR+ RED +++GYDIPKGT V+V+VWT+ RDP +WDNP
Sbjct  357   LPYVTAIMKETMRLHNVSPLLVPRVAREDVQISGYDIPKGTVVMVNVWTIGRDPKIWDNP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RF+G++I+V+G +F+L+PFGAG+R+C GY LGLK+IQ+S+ NLLHGFNWKLP  
Sbjct  417   NEFCPERFLGEEIEVEGQNFKLMPFGAGKRICVGYPLGLKIIQSSVANLLHGFNWKLPKG  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E L+MEEIF LSTPKK PL  V EPRLP HLYSV
Sbjct  477   MKKEDLDMEEIFALSTPKKNPLVAVAEPRLPPHLYSV  513



>ref|NP_001062713.1| Os09g0264400 [Oryza sativa Japonica Group]
 dbj|BAD38500.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF24627.1| Os09g0264400 [Oryza sativa Japonica Group]
 gb|EAZ43968.1| hypothetical protein OsJ_28589 [Oryza sativa Japonica Group]
 dbj|BAG94869.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/513 (62%), Positives = 406/513 (79%), Gaps = 4/513 (1%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             ++W ++ A  ++T+  LL A  LR RR   LPPGPKPWP+IGNLNLI SLPHRSIH++S 
Sbjct  5     SSWATFFAVVLATVVFLLRAVLLRRRRAYKLPPGPKPWPIIGNLNLISSLPHRSIHEISK  64

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             ++GPI+QL FGS PVVVGSS EMAK FL+T D  F DRP+TAAGKYT Y+ +DITWSPYG
Sbjct  65    RHGPIVQLWFGSCPVVVGSSVEMAKLFLQTNDAVFADRPRTAAGKYTAYDCTDITWSPYG  124

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
              YWRQAR+MC  ELFSA+RLES E+IR +E++++LR+L+ + +A   + LRD++S  +L 
Sbjct  125   AYWRQARKMCAAELFSARRLESLEHIRHEEVRALLRELHGSGAAGNAVQLRDHLSMAALG  184

Query  780   VISWMVLGKSYLNE----SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             VIS MVLGK Y+ +       A+ +P EF+ ML+ELFL+NGVLNIGD IPW+D+LDLQGY
Sbjct  185   VISRMVLGKKYVEKQPAGGGAAMTTPEEFKWMLEELFLMNGVLNIGDFIPWLDWLDLQGY  244

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             I+RMK +++   RFL+ VLDEH+ RR  +GD FVA+DMVD+LLQLADDP+L+V+L R+G+
Sbjct  245   IRRMKNVNRLIHRFLDRVLDEHDERRRLQGDGFVARDMVDILLQLADDPNLDVQLTRNGI  304

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             K   QDL+ GG + STV VEWA+SE+LK P I  KAT+ELD ++G  R V E D+P+LPY
Sbjct  305   KGITQDLVTGGADTSTVTVEWAMSEVLKNPAILAKATEELDTIVGVGRLVTEGDIPHLPY  364

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI+KE MR+HPV P+LVPR+ RED  VAGYD+P GTRVLV+ WT+ RDP++WD+P +F
Sbjct  365   IHAIMKETMRMHPVVPLLVPRMSREDASVAGYDVPAGTRVLVNTWTIGRDPSVWDSPEQF  424

Query  1488  IPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTP  1667
              P+RF+G  IDVKG DFELLPF +GRRMCPGY+LGLKVIQ +L NLLH F+W LP+ VT 
Sbjct  425   RPERFVGSGIDVKGRDFELLPFSSGRRMCPGYNLGLKVIQLTLANLLHAFSWCLPDGVTA  484

Query  1668  EKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +L+MEEIFGL+ P+K PL  V++PRLP HLY+
Sbjct  485   GELSMEEIFGLTMPRKIPLLAVVKPRLPDHLYA  517



>ref|XP_011035731.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=513

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/517 (63%), Positives = 418/517 (81%), Gaps = 6/517 (1%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             M++P    I+Y AA ++T+ L+LL++ L + RKL LPPGPKPWP+IGN NLIG LPHRS+
Sbjct  1     MDNPPPPAITYTAAGLATVVLILLSRRL-FGRKLKLPPGPKPWPIIGNFNLIGPLPHRSL  59

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+L+ KYGPIMQ++FGS PVVVGSS+E+A+  LKT DI+  DRPK AAGKYTTYNYSDIT
Sbjct  60    HELAKKYGPIMQIKFGSIPVVVGSSSEVAEAILKTHDISLADRPKIAAGKYTTYNYSDIT  119

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WS YGPYW   R+ C  E+FS KRL+ Y+++R +EL S+L+ LY  S    P   R+  S
Sbjct  120   WSQYGPYWSHLRKFCNMEIFSPKRLDFYQHVRVEELHSLLKSLYKTSGT--PFKTREKFS  177

Query  765   TLSLNVISWMVLGKSYLNESEGA--IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
              LSL+VIS +VLG++Y  ESE    + +P+EF+K+LDELF+LNGVL IGD IPW+ + DL
Sbjct  178   DLSLSVISRLVLGRNYTLESEKGKGVYTPHEFKKILDELFVLNGVLEIGDWIPWLSYFDL  237

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG IK+MKA++KK DRF+EH L+EH+ARR     ++VAKDM+D+LLQL+DDPSL+V+  R
Sbjct  238   QGNIKKMKAVAKKVDRFIEHELEEHDARRNGV-KNYVAKDMMDILLQLSDDPSLDVEFGR  296

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
              GVKA   DL+AGGTE++ V  EWA++ELLKKPEIF+KAT+ELDRVIG++RWVEEKD+ +
Sbjct  297   TGVKALTLDLIAGGTESTAVTAEWALAELLKKPEIFEKATEELDRVIGRERWVEEKDIVD  356

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPY+ AI+KE MRLH V+P+LVPR+ RED +++GYDIPKGT V+V+VWT+ RDP +WDNP
Sbjct  357   LPYVTAIMKETMRLHNVSPLLVPRVAREDVQISGYDIPKGTVVMVNVWTIGRDPKIWDNP  416

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RF+G++I+V+G +F+L+PFGAG+R+C GY LGLK+IQ+S+ NLLHGFNWKLP  
Sbjct  417   NEFCPERFLGEEIEVEGQNFKLMPFGAGKRICVGYPLGLKIIQSSVANLLHGFNWKLPKG  476

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +  E L+MEEIF LSTPKK PL  V EPRLP HLYSV
Sbjct  477   MKKEDLDMEEIFALSTPKKNPLVAVAEPRLPPHLYSV  513



>ref|XP_002516018.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46438.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/505 (63%), Positives = 397/505 (79%), Gaps = 12/505 (2%)
 Frame = +3

Query  279   IALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSF  458
             ++ L  ++H  + R L+LPPGPKPWP+IGN NLIG LPH+S+H LS K+GPIMQL+FGS+
Sbjct  19    LSKLFTSRHY-YNRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIMQLKFGSY  77

Query  459   PVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTE  638
             PVV+ SSAEMAK  L+T D  F  RP+TAAGKYTTYNYS++TW+PYG YWRQ R++ L E
Sbjct  78    PVVIVSSAEMAKQILRTNDHIFASRPQTAAGKYTTYNYSNVTWAPYGAYWRQGRKIYLHE  137

Query  639   LFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYL-  815
             LFS+KRL+SY  IR +E+++ + +++T S   KPILL+D++S  +L++IS +VLGK Y  
Sbjct  138   LFSSKRLDSYHDIRVEEMRAFVSRIHTLSVTGKPILLKDHLSRATLSIISRIVLGKKYFI  197

Query  816   ---------NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
                            I +  EF+K+LDELFLLNGV+NIGD IPW+ FLDLQGY+KRMKAL
Sbjct  198   TESESESLSESETSVITTLGEFQKILDELFLLNGVMNIGDWIPWLAFLDLQGYVKRMKAL  257

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
               K+DRF +HVL EH A++ AE  +FV KDMVDLLLQLADDP LEVKL    VK FIQDL
Sbjct  258   KVKWDRFHDHVLGEHKAKK-AEVKNFVPKDMVDLLLQLADDPELEVKLNNDSVKGFIQDL  316

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
             +AGGT+ S   VEWA+SELLK+P + KKAT+ELDRVIG++RWVEEKD+P LPYI AI+KE
Sbjct  317   IAGGTDTSATTVEWAMSELLKQPSLIKKATEELDRVIGKERWVEEKDIPQLPYIDAIMKE  376

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIG  1508
              MR HPVA ML P    ED KV G+DI KGT V ++ W++ RDP LWD+P EF P+RF+G
Sbjct  377   TMRKHPVAVMLAPHYALEDAKVNGHDIAKGTTVFINTWSIGRDPLLWDDPEEFRPERFLG  436

Query  1509  KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEE  1688
             K IDVKG  FELLPFG+GRRMCPGYSLGLK+IQ+SL NLLHGFNWKLP+D+ PE L+M+E
Sbjct  437   KAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANLLHGFNWKLPDDMKPEDLSMDE  496

Query  1689  IFGLSTPKKFPLTTVIEPRLPMHLY  1763
             ++GL+TP+KFPL  V EPRLP++LY
Sbjct  497   VYGLATPRKFPLVAVTEPRLPINLY  521



>ref|XP_002277972.1| PREDICTED: flavonoid 3'-monooxygenase-like [Vitis vinifera]
Length=509

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 386/483 (80%), Gaps = 6/483 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPKPW +IGNLNLIG LPH S+H LS KYG IMQLQFGSFPVVV SS EMA+ F
Sbjct  31    KQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMARQF  90

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP+TAAGKYT YNYS+ITW+PYGP WRQ R++  TELFS KRLES EYIR
Sbjct  91    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESCEYIR  150

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG--AIVSPNEF  854
              +E ++ + +LY  S   KP++L+D++S ++L+VIS +VLG+ Y NESE   +IV+  EF
Sbjct  151   VEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNESESGRSIVTVEEF  208

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             ++MLDELFLLNGVLNIGD IPWI FLDLQGY+KRMKAL  KFDR  +HV+++H ARR  E
Sbjct  209   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEKHRARR--E  266

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
                FVAKDMVD+LL+LADDP LEVKL   GVK    DLLAGGT+ S   +EWA+SE+L++
Sbjct  267   AADFVAKDMVDMLLRLADDPDLEVKLGTDGVKGLTLDLLAGGTDTSATTMEWAMSEILRQ  326

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             P I  KAT+ELDRVIG+ RWVEEKD+P LPYI AIVKE MRLHPVA +L P L  +DC V
Sbjct  327   PSIATKATEELDRVIGRDRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAPHLALQDCNV  386

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             +GYDI KGTRVLV+ W++ RDP +WD P EF P+RF+GK IDV G +FELLPFG+GRRMC
Sbjct  387   SGYDIRKGTRVLVNAWSIGRDPNIWDAPEEFRPERFLGKAIDVNGQNFELLPFGSGRRMC  446

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
              GY LGLK+IQ+SL N+LHGF+WKLP D+  E+LNMEE+FGL+TP+K PL  V+EPRLP 
Sbjct  447   VGYRLGLKMIQSSLSNMLHGFHWKLPGDMKTEELNMEEVFGLTTPRKVPLVAVMEPRLPS  506

Query  1755  HLY  1763
             HLY
Sbjct  507   HLY  509



>ref|XP_002310738.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
 gb|EEE91188.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
Length=487

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/487 (65%), Positives = 385/487 (79%), Gaps = 18/487 (4%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             RRKLHLPPGPKPWP+IGNLNL+G LPHRS+  LS KYG +MQ++FGS PVVVGSS EMA+
Sbjct  17    RRKLHLPPGPKPWPIIGNLNLMGELPHRSLEALSKKYGSLMQVKFGSHPVVVGSSVEMAR  76

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
               LKT D++   RPKTA+GKYTTYNY +ITW+PYGPYWRQAR++CL ELFS KRL+ +EY
Sbjct  77    AILKTHDLSLAGRPKTASGKYTTYNYQNITWAPYGPYWRQARKLCLIELFSPKRLDQFEY  136

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGA--IVSPN  848
             IR +E    L  L+      KPI +RD+ S LS +VIS +VLG+ Y+ ESE    ++S  
Sbjct  137   IRVEENLKFLNTLFQKRG--KPITVRDHFSDLSFSVISRLVLGRKYMAESEDEKDMLSLK  194

Query  849   EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRV  1028
             E +++LDE+FLLNGVL IGD IPW+ FLDLQGYIKRMKA++KK D F+EH  +       
Sbjct  195   ELKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRMKAVAKKMDMFMEHANE-------  247

Query  1029  AEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELL  1208
                     +DM+D+LLQ+ADDP+LEVKL+R GVKAF QDL+ GGTE+S V  EWA++E++
Sbjct  248   -------PRDMLDILLQVADDPNLEVKLDRIGVKAFTQDLINGGTESSAVTTEWALAEIM  300

Query  1209  KKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDC  1388
             KKPEIF KAT+ELDRVIG++RWV+E D+ NLP+I AIVKE MRLHPVAP+LVPRL RED 
Sbjct  301   KKPEIFDKATEELDRVIGRERWVQENDIDNLPFINAIVKETMRLHPVAPLLVPRLAREDI  360

Query  1389  KVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRR  1568
             ++AGYDIPKGTRVLV+   + RDP+LWD P EF P+RFIGK +DVKG DFELLPFGAGRR
Sbjct  361   QIAGYDIPKGTRVLVNASAIGRDPSLWDKPKEFCPERFIGKSVDVKGHDFELLPFGAGRR  420

Query  1569  MCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRL  1748
             +CPGY LGLKVIQ S+ NLLH F WKLPN++T + LNMEEI GLS P+K PL  V+EPRL
Sbjct  421   ICPGYPLGLKVIQTSVANLLHEFKWKLPNNMTAKDLNMEEILGLSAPRKVPLVAVLEPRL  480

Query  1749  PMHLYSV  1769
             P  LYS+
Sbjct  481   PSELYSL  487



>ref|XP_007203722.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
 gb|EMJ04921.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
Length=509

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/509 (62%), Positives = 399/509 (78%), Gaps = 7/509 (1%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLRW--RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVK  422
             ISYA   ++ +A L L   + +   +KL  PPGPKPWP+IGNLN IG LPH+S+H LS  
Sbjct  4     ISYAILTLALVATLALVSKIFFPQSQKLKFPPGPKPWPIIGNLNHIGPLPHQSLHKLSQI  63

Query  423   YGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGP  602
             YGPIMQL+FGS+PVV+ SSAEMA+ FL+T D  F  RP+TAAGKYTTYNYS++TW+P+GP
Sbjct  64    YGPIMQLKFGSYPVVIASSAEMARQFLRTHDHIFASRPQTAAGKYTTYNYSNLTWAPHGP  123

Query  603   YWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNV  782
             YWRQ R++ L+ LFS+K L+S EYIR +E ++ L +L   S   KP +L++++S L+L +
Sbjct  124   YWRQGRKIYLSHLFSSKILDSVEYIRVEENRAFLSRLCALSG--KPTMLKEHLSRLTLTI  181

Query  783   ISWMVLGKSYLNESEGAIV--SPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             IS +VLGK Y + SE      +  EF++MLDELFLLNGVLNIGD IPW+ F DLQG++KR
Sbjct  182   ISRIVLGKKYFSVSESESSIVTLEEFQEMLDELFLLNGVLNIGDWIPWVQFFDLQGFVKR  241

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MKAL KKFDRF +HV DEH A++    D FV KDMVDLLLQLA+DP +EVKL    VK F
Sbjct  242   MKALKKKFDRFHDHVFDEHRAKKEGVKD-FVPKDMVDLLLQLAEDPDIEVKLNYDSVKGF  300

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
              QDL+AGGT+ S   VEWA+SEL+K+P + +KAT+ELDRVIG+ RWVEEKD+P LPYI+A
Sbjct  301   TQDLIAGGTDTSATTVEWAMSELMKQPLLIEKATEELDRVIGRGRWVEEKDIPQLPYIEA  360

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPD  1496
             I+KE MR HPVA ML P L  EDC V GYDI KGTRV ++ W++ R+P+ WD P+EF PD
Sbjct  361   IMKETMRKHPVAVMLAPHLALEDCNVGGYDICKGTRVFINTWSMGREPSQWDAPDEFNPD  420

Query  1497  RFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
             RF+G+ IDVKG +FELLPFG+GRRMCPGYSLGLK+I++SL NLLHGFNWKLP ++ PE L
Sbjct  421   RFLGRSIDVKGQNFELLPFGSGRRMCPGYSLGLKMIRSSLANLLHGFNWKLPGNMKPEDL  480

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +MEE+FGL+TP+KFPL  V+EPRLP HLY
Sbjct  481   SMEEVFGLATPRKFPLVAVVEPRLPAHLY  509



>ref|XP_009359731.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=509

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/484 (65%), Positives = 393/484 (81%), Gaps = 5/484 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +KL LPPGPKPWP+IGNL+LIG LPH+S+H LS KYGPIM+L FGS+PVV+ SSAEMA+ 
Sbjct  29    QKLKLPPGPKPWPIIGNLSLIGPLPHQSLHKLSQKYGPIMKLMFGSYPVVIASSAEMARQ  88

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TAAGKYTTYNY ++TW+P+GPYWRQ R++ L+ LFS+K L+S EYI
Sbjct  89    FLKTHDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYI  148

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNE  851
             R +E ++ L +L   S   KP +L++++S L+L++IS +VLGK Y  ++ESE +IVS  E
Sbjct  149   RVEENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFSVSESETSIVSLEE  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F++ML+ELFLLNGVLNIGD IPW   LDLQGY+KRMKAL KKFDRF +HVLDEH A  + 
Sbjct  207   FQEMLNELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKAN-MN  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
             E   FV+KDMVDLL+QLA+DP +EVKL    VK F QDL+AGGT+ S   VEWA+SEL+K
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIEVKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSELMK  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P + +KAT+ELD VIG++RWVEEKD+  L YI AI+KE MR+HPVA ML P L  EDC 
Sbjct  326   QPHLIEKATEELDIVIGRERWVEEKDIAQLHYIDAIMKETMRMHPVAVMLAPHLALEDCN  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDI KGTRV ++ W++ RDP+ W+ P EF PDRF+GK IDVKG +FELLPFG+GRRM
Sbjct  386   VAGYDICKGTRVFINTWSMGRDPSQWNAPEEFNPDRFLGKAIDVKGQNFELLPFGSGRRM  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLGLK+I++SL NLLHGFNWKLP++ T E L+MEE+FGL+TP+KFPL  V+EPRLP
Sbjct  446   CPGYSLGLKMIRSSLANLLHGFNWKLPDNATTEDLSMEEVFGLATPRKFPLVAVLEPRLP  505

Query  1752  MHLY  1763
             ++LY
Sbjct  506   LYLY  509



>ref|XP_010064025.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW71323.1| hypothetical protein EUGRSUZ_F04405 [Eucalyptus grandis]
Length=510

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/516 (63%), Positives = 398/516 (77%), Gaps = 9/516 (2%)
 Frame = +3

Query  225   MESPTATWISYA--AAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             M++P+  W++Y       + + LLLL+ HLR RR+L LPPGPKPWP+IGNLNLIG LPHR
Sbjct  1     MDAPS--WVAYGIACLAAAFLLLLLLSGHLR-RRQLKLPPGPKPWPIIGNLNLIGPLPHR  57

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIHDLS  YGP+M+LQFG + VVVG SA+MAK  L+T    F  RP  AAGKYT YNYSD
Sbjct  58    SIHDLSRTYGPLMKLQFGYYDVVVGCSADMAKALLQTHGTVFAYRPNLAAGKYTAYNYSD  117

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             + WSPYGPY RQAR++ LT LFSA RL+S+EYIR +E + + R ++      +P+ L+D+
Sbjct  118   VLWSPYGPYLRQARKIFLTHLFSAARLQSFEYIRVEETRVLTRNMFEGKG--QPVNLKDH  175

Query  759   MSTLSLNVISWMVLGKSYLNESEGA-IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLD  935
             +S L+LNVIS MVLGK Y ++ E + IV P EF+KM+ E F+LNGV+NIGD  PW++FLD
Sbjct  176   LSDLTLNVISRMVLGKKYTDKFESSDIVLPEEFKKMIAEWFMLNGVVNIGDFAPWLNFLD  235

Query  936   LQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLE  1115
             L+GYIKRMKALSKKFDRFLEHV+DEH ARRV       AKDMVD+LLQ  DDP++EVK+E
Sbjct  236   LRGYIKRMKALSKKFDRFLEHVVDEHEARRVGL-KGHEAKDMVDVLLQHVDDPNVEVKIE  294

Query  1116  RHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             RHGVKA IQDL+ GGT  S + VEWAISELLK P ++ KAT EL+ +IG++RWV+E D+ 
Sbjct  295   RHGVKALIQDLIVGGTGTSAMSVEWAISELLKNPWVYDKATRELNSIIGRERWVQEADLS  354

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             NLPYI AIVKE MRLHP    L PR   +DCKVAGYD+P+GTRV+VS W++ RDP  WD 
Sbjct  355   NLPYINAIVKETMRLHPPGAFLAPRYASQDCKVAGYDVPRGTRVIVSAWSIMRDPKYWDE  414

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             P +F P+RF+GK IDVKG +FELLPFG+GRRMCPGY+ GLKVI  SL NL+HGF W+LP 
Sbjct  415   PEKFRPERFVGKAIDVKGQNFELLPFGSGRRMCPGYNFGLKVIPTSLANLIHGFTWRLPG  474

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             D+  E LNMEE+ GLS P+K PL  V EPRLP+HLY
Sbjct  475   DLMREDLNMEEVAGLSAPRKIPLVAVAEPRLPLHLY  510



>ref|XP_008337887.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=509

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/484 (65%), Positives = 390/484 (81%), Gaps = 5/484 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +KL LPPGPKPWPVIGNLNLIG LPH+S+H LS  YGPIM+L FGS+PVV+ SSAEMA+ 
Sbjct  29    QKLKLPPGPKPWPVIGNLNLIGPLPHQSLHKLSQTYGPIMKLMFGSYPVVIASSAEMARQ  88

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TAAGKYTTYNY ++TW+P+GPYWRQ R++ L+ LFS+K L+S EYI
Sbjct  89    FLKTHDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYI  148

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNE  851
             R +E ++ L +L   S   KP +L++++S L+L++IS +VLGK Y  ++ESE +IVS  E
Sbjct  149   RVEENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFSVSESETSIVSLEE  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F++MLDELFLLNGVLNIGD IPW   LDLQGY+KRMKAL KKFDRF +HVLDEH A  + 
Sbjct  207   FQEMLDELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKAN-MK  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
             E   FV+KDMVDLL+QLA+DP +EVKL    VK F QDL+AGGT+ S   VEWA+SEL+K
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIEVKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSELMK  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P + +KAT+ELD VIG++RWVEEKD+  L YI AI+KE MR+HPVA ML P L  EDC 
Sbjct  326   QPHLIEKATEELDIVIGRERWVEEKDIAQLHYIDAIMKETMRMHPVAVMLAPHLALEDCN  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDI KGTRV ++ W++ RDP+ W+   EF PDRF+GK IDVKG +FELLPFG+GRRM
Sbjct  386   VAGYDICKGTRVFINTWSMGRDPSQWNAAEEFNPDRFLGKAIDVKGQNFELLPFGSGRRM  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPG+SLGLK+I++SL NLLHGFNWKLP++ T E L MEE+FGL+TP+KFPL  V+EPRLP
Sbjct  446   CPGFSLGLKMIRSSLANLLHGFNWKLPDNATTEDLVMEEVFGLATPRKFPLVAVLEPRLP  505

Query  1752  MHLY  1763
             +HLY
Sbjct  506   LHLY  509



>gb|AGT17101.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=507

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/498 (62%), Positives = 398/498 (80%), Gaps = 15/498 (3%)
 Frame = +3

Query  291   LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVV  470
             L A H R RR  +  PGPKPWP+IGN NL+G+LPHRS+  LS ++GP+M++QFGSFPVV+
Sbjct  20    LGAVHARRRRACNSLPGPKPWPIIGNFNLLGALPHRSLDALSKRHGPLMRVQFGSFPVVI  79

Query  471   GSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSA  650
              SS +MAK FLKT D  F+DRPK AAGKYTTYNYS+I WSPYG YWRQAR++C  ELFSA
Sbjct  80    ASSVDMAKFFLKTHDSVFIDRPKMAAGKYTTYNYSNIAWSPYGAYWRQARKICADELFSA  139

Query  651   KRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE---  821
             +RLES+E++R +E+ ++LR L+   +A + + L++ +ST+SLN+I+ MVLG+  +++   
Sbjct  140   RRLESFEHVRQEEVHALLRTLH--GTAGQVVPLKECLSTMSLNIITRMVLGRKCVDKEVV  197

Query  822   --SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLE  995
                 G++ +  EFR MLDELFLLNGVLNIGD IPW+ +LDLQGY++RMK + + F++F+E
Sbjct  198   ASGGGSVTTWKEFRWMLDELFLLNGVLNIGDWIPWLSWLDLQGYVRRMKRVGRMFNQFME  257

Query  996   HVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENST  1175
             +V++EHN RR+ EGD+FV +DMVD LLQLADDPSL+VKL R  VKAF        T+++ 
Sbjct  258   NVVEEHNERRLREGDAFVPQDMVDRLLQLADDPSLDVKLTRDSVKAF--------TQSAA  309

Query  1176  VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAP  1355
             VIVEWAISELLK P++F KAT+ELD VIG+ RWV EKD+P+LPY+ AIVKE MRLH V P
Sbjct  310   VIVEWAISELLKNPDVFAKATEELDGVIGRDRWVTEKDIPHLPYMDAIVKETMRLHMVVP  369

Query  1356  MLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCD  1535
             +L PRL RED  V GYDIP GTRVL++ WT++RDPALWD P EF P+RF+G  IDVKG D
Sbjct  370   LLSPRLSREDTSVGGYDIPAGTRVLINAWTISRDPALWDAPEEFRPERFVGSKIDVKGQD  429

Query  1536  FELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKK  1715
             FELLPFG+GRRMCPGYSLGLKVIQ +L NLLHGF W+LP+ +T E+L+MEE+FGLSTP+K
Sbjct  430   FELLPFGSGRRMCPGYSLGLKVIQVTLVNLLHGFAWRLPDGMTEEELSMEEVFGLSTPRK  489

Query  1716  FPLTTVIEPRLPMHLYSV  1769
             FPL  V+EP+LP  +Y+ 
Sbjct  490   FPLQAVVEPKLPARMYTA  507



>ref|XP_011046010.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/509 (61%), Positives = 395/509 (78%), Gaps = 8/509 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLR-WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             + +  AWV   ALL L K  + WR  L+LPPGPKPWP+IGN +L+G LPH+S+H LS+KY
Sbjct  7     VVFVLAWV--FALLYLPKVFKSWRNPLNLPPGPKPWPIIGNFDLLGPLPHQSLHQLSLKY  64

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             G  MQLQFGS+PV V SS ++AK  LKT D  F  RP+TAAGKYTTY YSD+ W+PYGPY
Sbjct  65    GKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPY  124

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
             WRQ R++ LTELFSAKRLESYEY+R +E++   R+LY   +  K I L+DY+S  +L++I
Sbjct  125   WRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLY--RNCGKSIELKDYLSHYTLSII  182

Query  786   SWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             S +VLGK Y +  ESE  IV+  EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRM
Sbjct  183   SRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRM  242

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K L  +FDRF +HV+DEHNA+R A   ++  KDMVDLLLQLADDP LEVKL R  +K   
Sbjct  243   KELKVRFDRFHDHVIDEHNAKRKAT-KNWQPKDMVDLLLQLADDPELEVKLTRDNIKGLT  301

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGT+ +  + +W++SELLKKP++FK+ TDELDRVIG+ RWVEEKD+P LPYI+AI
Sbjct  302   QDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVIGRDRWVEEKDIPQLPYIEAI  361

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             +KE MR+HP A ML P L  +D KV GYDIPKGTR+ ++ W++ RDP LW++P +F P+R
Sbjct  362   MKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDLWEDPEDFRPER  421

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             F GK ID+KG +FELLPFG+GRRMCPGY LG K+I  SL N+LHGF W+LP  + PE + 
Sbjct  422   FFGKGIDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWELPPGMKPEDVK  481

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +E+FGL+T +K+P   V +PRLP+HLY+
Sbjct  482   RDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_002516270.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46272.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/520 (59%), Positives = 399/520 (77%), Gaps = 7/520 (1%)
 Frame = +3

Query  225   MESP-TATWISYAAAWVSTIALLLLAKHL--RWRRKLHLPPGPKPWPVIGNLNLIGSLPH  395
             M++P   +WI  A AW++   LL LAK         L LPPGPKPWP+IGNLNLIG LPH
Sbjct  2     MDAPLNQSWILSAMAWLAGAGLLFLAKLFISHHHSSLKLPPGPKPWPIIGNLNLIGPLPH  61

Query  396   RSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYS  575
             RS+H L+ +YG IMQL+FGSFPVVV SSAEMAK  LKT D  F  RPK AAGKYT YNYS
Sbjct  62    RSLHKLAQQYGHIMQLRFGSFPVVVASSAEMAKQILKTNDEIFASRPKFAAGKYTAYNYS  121

Query  576   DITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRD  755
             ++ W+PYG YWRQ R++ L ELF++KRL+SYEYIR +E+ + L  +++ S + K +LL+D
Sbjct  122   NVLWAPYGEYWRQGRKLYLNELFNSKRLQSYEYIRVEEMHNFLSGVHSLSCSGKAVLLKD  181

Query  756   YMSTLSLNVISWMVLGKSYLN---ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWID  926
             ++S  +L+++S +VLGK Y +   ES+  IV+P EF++MLDELF LNGV +IGD IPW+D
Sbjct  182   HLSHYTLSILSRIVLGKKYSSAESESQTNIVTPEEFQEMLDELFSLNGVFHIGDWIPWLD  241

Query  927   FLDLQGYIKRMKALSKKFDRFLEHVLDEHN-ARRVAEGDSFVAKDMVDLLLQLADDPSLE  1103
             FLDLQGY+KRMKAL  KFDRF +HV+ EH   R+ A  +    K++VD +LQLAD+P L+
Sbjct  242   FLDLQGYVKRMKALKIKFDRFHDHVISEHRIKRKGALLEDSAPKNIVDHMLQLADNPDLD  301

Query  1104  VKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEE  1283
             +KL    VK F Q+++ GG + +   VEWA+SEL+K P + KKATDELDRV+G++RWVEE
Sbjct  302   IKLNTDSVKGFSQEIIGGGKDTAAAAVEWAMSELMKHPNLVKKATDELDRVVGKQRWVEE  361

Query  1284  KDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPA  1463
             KD+PNLPYI AI+KE MR HPV  ML PRL  +DCKV GYDI KG+RV+++ W++ RDP+
Sbjct  362   KDIPNLPYIDAIMKETMRKHPVGTMLAPRLATKDCKVGGYDILKGSRVVINTWSMGRDPS  421

Query  1464  LWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNW  1643
             +WD P EF P+RF+ K IDVKG  FELLPFG+GRRMCPGYSLGLK+I++ L NLLHGFNW
Sbjct  422   IWDEPEEFRPERFLDKTIDVKGQSFELLPFGSGRRMCPGYSLGLKMIRSCLANLLHGFNW  481

Query  1644  KLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             KLP+++ PE L+M+E++GL+T +K PL  V EPRLP+HLY
Sbjct  482   KLPDNMKPEDLSMDEVYGLATLRKSPLVAVAEPRLPLHLY  521



>gb|EMT12610.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=513

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 385/489 (79%), Gaps = 3/489 (1%)
 Frame = +3

Query  306   LRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAE  485
              R  +K +LPPGPKPWP+IGN +LIG+LPHRSIH+LS KYGP+M L+FGSFP++V SS +
Sbjct  24    FRHGKKYNLPPGPKPWPIIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIVASSVD  83

Query  486   MAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLES  665
             MA+ FL+T DI +VDRPKTA+GKYTTYNY+DITWSPYG YWRQARR+CLT+LFS +RL  
Sbjct  84    MARFFLRTKDILYVDRPKTASGKYTTYNYADITWSPYGAYWRQARRICLTKLFSPRRLAL  143

Query  666   YEYIRSQELKSILRQLYTASSAQKPI-LLRDYMSTLSLNVISWMVLGKSYLNES--EGAI  836
               +IR  E+ +++R ++  S   + + L RD+MSTLSLNVI+ MV+GK    +   EG +
Sbjct  144   MAHIRVDEVHAMVRDIFAVSGPTRVVHLYRDHMSTLSLNVITRMVMGKRLFADGSLEGPV  203

Query  837   VSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHN  1016
              S   FR M+DELFLLNGVLNIGD IPW+D++DLQGY++RMK + K FD  +EHVLDEH+
Sbjct  204   PSMEVFRWMMDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKVGKMFDALMEHVLDEHS  263

Query  1017  ARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAI  1196
                    +   A+DMVD+L+ +ADDPSLEV L R GVKAF QDL+AGGTE+S   VEWA+
Sbjct  264   VGEHRRREGEAARDMVDVLMDIADDPSLEVPLGRIGVKAFTQDLIAGGTESSAATVEWAM  323

Query  1197  SELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLC  1376
             SELL++P+ F  AT ELDR++G+ RWV E+DMPNLPYI+A+VKE MR+HP+ P+L+PR+ 
Sbjct  324   SELLRRPDAFDVATKELDRIVGRGRWVMEEDMPNLPYIEAMVKETMRMHPIVPLLIPRVA  383

Query  1377  REDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFG  1556
             RED  V GYD+PKG RVL++VW + RDP LWD P EF P+RFIG  IDVKG D ELLPFG
Sbjct  384   REDAAVGGYDVPKGARVLINVWAMGRDPELWDAPEEFRPERFIGSKIDVKGQDLELLPFG  443

Query  1557  AGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVI  1736
             +GRRMCPGY+LGLK ++ SL NLLHGF W LP  ++ E+++MEE+FGL+T +K+PL  V 
Sbjct  444   SGRRMCPGYNLGLKEVRLSLANLLHGFTWTLPEGMSKEEVSMEEVFGLTTSRKYPLEVVA  503

Query  1737  EPRLPMHLY  1763
             +P+LP HLY
Sbjct  504   DPKLPTHLY  512



>ref|XP_006493371.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=556

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/518 (61%), Positives = 399/518 (77%), Gaps = 6/518 (1%)
 Frame = +3

Query  219   DSMESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             + M  P+ + I Y+  +   I L L   H ++ RKL+LPPGP+PWP+IGNLNLIG LPH 
Sbjct  43    NPMTGPSNSAIFYSILFFLPIVLFLF--HRQFSRKLNLPPGPRPWPLIGNLNLIGPLPHV  100

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH LS KYGP+M L+FG  PVVVGSSAE+A+  LKT DI+F  RP   AGKYTTYNYS 
Sbjct  101   SIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSG  160

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             +  +PYGPYWRQAR++CL EL SAKRL+ +EYIR +E  + L +L+   SA  P+ L+D 
Sbjct  161   MATAPYGPYWRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELF--KSASTPVHLKDR  218

Query  759   MSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + TL+L  I  MVLGK Y +E+E   V+P +F +M++ELFLL G+L+IGDSIPW+   DL
Sbjct  219   LYTLNLTSICRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDL  278

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG++KRMK +SKK D+F E +LDEH+ RR +  D +   DMVD+L+QLADDPSLEVKLER
Sbjct  279   QGHVKRMKDVSKKLDKFYEGILDEHHERRKSVKD-YGVHDMVDVLMQLADDPSLEVKLER  337

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
               +KA IQDLL  GT+ S + VEWA+SELLK PE  +KAT+ELDRVIG+ RWVEEKD+ N
Sbjct  338   EHIKALIQDLLTAGTDTSAISVEWAMSELLKNPEAIQKATEELDRVIGKDRWVEEKDIVN  397

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI+A+VKE MRLHPVAP+L+PR+ R+DC+VAGYDI + TRV+V+VW + RDP +W+ P
Sbjct  398   LPYIEALVKETMRLHPVAPLLLPRVARDDCRVAGYDILRNTRVVVNVWAIGRDPTMWEKP  457

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P RFIGK+IDVKG DF+LLPFG+GRR+CPGY LGLKV+Q++L NLL+GF WKLP D
Sbjct  458   NEFRPHRFIGKNIDVKGHDFQLLPFGSGRRICPGYGLGLKVVQSTLANLLYGFEWKLPGD  517

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLYSV  1769
             +  E L+ME+ FGL+ P+K PL  V  +PRL +HLYS 
Sbjct  518   MKNEDLDMEDRFGLTMPRKIPLVVVPSKPRLSLHLYSC  555



>ref|XP_004288989.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/513 (60%), Positives = 398/513 (78%), Gaps = 10/513 (2%)
 Frame = +3

Query  243   TWISYAAAWVSTIALLLLAKHL---RWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             +W     A V    L  L+K L     +  L  PPGPKPWP+IGNLNLIG LPH+S+H L
Sbjct  5     SWAISTLAVVIFATLTFLSKTLFPKSHKLNLKFPPGPKPWPIIGNLNLIGPLPHQSLHKL  64

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S  YGPIMQL+FGS+PVV+ SS EMAK   KT D  F  RP+TAAGKYTTYNY +ITW+P
Sbjct  65    SQTYGPIMQLKFGSYPVVIASSPEMAKQISKTHDHVFASRPQTAAGKYTTYNYLNITWAP  124

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             +GPYWRQ R+  L+ELF++KRL+S+EYIR +E ++ L +L   S   KP+ L++++S L+
Sbjct  125   HGPYWRQGRKFYLSELFNSKRLDSFEYIRVEENRAFLSRLCALSG--KPVTLKEHLSRLT  182

Query  774   LNVISWMVLGKSY--LNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             L++IS +VLGK Y  ++ESE +IV+ NEF++MLDELFLLNGVLNIGD IPW++  DLQGY
Sbjct  183   LSIISRIVLGKKYFSVSESETSIVTLNEFQEMLDELFLLNGVLNIGDWIPWLELFDLQGY  242

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEG-DSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             +KRMKAL KKFDRF +HV  EH A +  EG   +V KD+VD+LL+LADDP++EVKL    
Sbjct  243   VKRMKALKKKFDRFHDHVFGEHRANK--EGVKEYVPKDLVDVLLKLADDPNIEVKLNYDS  300

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VK F QDL+AGGT+ S   VEWA+SEL+K+P + +KAT+ELDRVIG++RWVEEKD+  LP
Sbjct  301   VKGFTQDLIAGGTDTSATTVEWAMSELMKQPHLIEKATEELDRVIGRERWVEEKDIAQLP  360

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             YI AI+KE MR HPVA ML P L  EDC V GYDI KGTRV ++ W++ R+ ++W+ P E
Sbjct  361   YIDAIMKETMRKHPVAVMLAPHLALEDCNVEGYDIRKGTRVFINTWSIGRNSSVWEAPEE  420

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F P+RF+G  IDVKG ++ELLPFG+GRRMCPGYSLGLK+I++S+ N+LHGFNWKLP ++ 
Sbjct  421   FKPERFLGNTIDVKGHNYELLPFGSGRRMCPGYSLGLKLIRSSIANMLHGFNWKLPENMK  480

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             PE L+M+E++GL+TP+KFPL  V+EPRLP HLY
Sbjct  481   PEDLSMDEVYGLATPRKFPLVAVVEPRLPNHLY  513



>ref|XP_006427642.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
 gb|ESR40882.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
Length=516

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/518 (60%), Positives = 401/518 (77%), Gaps = 6/518 (1%)
 Frame = +3

Query  219   DSMESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             +SM SP+ + I Y+  +   I L L  +  ++ RKL+LPPGP+PWP+IGNLNLIG LPH 
Sbjct  3     NSMTSPSNSAIFYSILFFLPIVLFLFRR--QFSRKLNLPPGPRPWPLIGNLNLIGPLPHV  60

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH LS KYGP+M L++G  PVVVGSSAE+A+  LKT DI+F  RP   AGKYTTYNYS 
Sbjct  61    SIHSLSQKYGPLMHLKYGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSA  120

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             ++ +PYGPYWRQAR++CL EL SAKRL+ +EYIR +E  + L +L+   SA  P+ L+D 
Sbjct  121   MSTAPYGPYWRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELF--KSASTPVHLKDR  178

Query  759   MSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + TL+L +I  MVLGK Y +E+E   V+P +F +M++ELFLL G+L+IGDSIPW+   DL
Sbjct  179   LYTLNLTLICRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDL  238

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG++KRMK +SKK D+F E +LDEH+ RR +    +   DMVD+L+QLADDPSLEVKLER
Sbjct  239   QGHVKRMKDVSKKLDKFYEGILDEHHERRKSV-KGYGVHDMVDVLMQLADDPSLEVKLER  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
               +KA IQDLL  GT+ S + VEWA+SELLK PE  +KAT+ELDRVIG+ RWVEEKD+ N
Sbjct  298   EHIKALIQDLLTAGTDTSAISVEWAMSELLKNPEAIQKATEELDRVIGKDRWVEEKDIVN  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPYI+AIVKE MRLHPVAP+L+PR+ R+DC+VAGYDI + TRV+V+VW + RDP +W+ P
Sbjct  358   LPYIEAIVKETMRLHPVAPLLLPRVARDDCRVAGYDILRNTRVVVNVWAIGRDPTMWEKP  417

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P RFI K+IDVKG DF+LLPFG+GRR+CPGY+LGLKVIQ++L NLL+GF WKLP D
Sbjct  418   NEFRPHRFIDKNIDVKGHDFQLLPFGSGRRICPGYALGLKVIQSTLANLLYGFEWKLPGD  477

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLYSV  1769
             +  E L+ME+ FGL+  +K PL  V  +PRL +HLYS 
Sbjct  478   MKNEDLDMEDRFGLTMSRKTPLVVVPSKPRLSLHLYSC  515



>gb|KGN58498.1| hypothetical protein Csa_3G651820 [Cucumis sativus]
Length=428

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/430 (73%), Positives = 359/430 (83%), Gaps = 5/430 (1%)
 Frame = +3

Query  486   MAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLES  665
             MAK FLKT D+NF  RPKT AGKYTTYN+S+ITWS YGPYW Q R+MCL ELFSA+RL+S
Sbjct  1     MAKLFLKTQDLNFASRPKTTAGKYTTYNHSNITWSQYGPYWGQLRKMCLMELFSARRLDS  60

Query  666   YEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE-SEGAIVS  842
             YEYIR +E+  ++R++Y   S  + I ++DY+  +SLNVIS MVLGK Y +E SE  IVS
Sbjct  61    YEYIRKEEMNGLIREIY--KSCGEVIKVKDYLFAVSLNVISRMVLGKKYTDEPSESGIVS  118

Query  843   PNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNAR  1022
             P+EFRKM+DELFLLNGVLNIGDSIPW+DFLDLQGY+KRMK LSKK DRFLEHVLDEH  R
Sbjct  119   PDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRMKGLSKKLDRFLEHVLDEHKER  178

Query  1023  RVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISE  1202
             R    +++VAKDMVD+LLQLADDP LEVKLERHGVKAF QDLL GG E+STV VEW ISE
Sbjct  179   RKGV-ENYVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLLGGGIESSTVTVEWTISE  237

Query  1203  LLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRE  1382
             LLK PEI  KAT+EL++VIG++RWVEEKDM NLPYI AI KE MRLHPVAPMLVPR+ RE
Sbjct  238   LLKTPEILNKATEELNKVIGKERWVEEKDMINLPYINAIAKETMRLHPVAPMLVPRMARE  297

Query  1383  DCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD-IDVKGCDFELLPFGA  1559
             DC+VAGYDI KGTRVLV+VWT+ RD  +W NP+ F PDRF+  + IDVKG DFELLPFG+
Sbjct  298   DCQVAGYDIAKGTRVLVNVWTIGRDQPVWKNPHAFDPDRFMENNCIDVKGEDFELLPFGS  357

Query  1560  GRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             GRRMCPGYSLGLKVI ++L NLLHGFNWKLP D+  E LNMEE FGLSTPKK+PL  V E
Sbjct  358   GRRMCPGYSLGLKVILSTLANLLHGFNWKLPGDMEKEDLNMEESFGLSTPKKYPLDAVAE  417

Query  1740  PRLPMHLYSV  1769
             PRLP HLYS+
Sbjct  418   PRLPPHLYSL  427



>gb|KCW71321.1| hypothetical protein EUGRSUZ_F04403, partial [Eucalyptus grandis]
Length=501

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/495 (65%), Positives = 392/495 (79%), Gaps = 7/495 (1%)
 Frame = +3

Query  282   ALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFP  461
             + LLL+ HLR RRKL LPPGPKPWP+IGNLNLI  L HRS+H+LS  YGPIM+LQ GS  
Sbjct  13    SFLLLSGHLR-RRKLKLPPGPKPWPIIGNLNLISPLLHRSLHELSRIYGPIMKLQLGSCN  71

Query  462   VVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTEL  641
             VVV SSA+MAK  LKT D  F  RP+ AAGKYT YNYS +TWSPYGPY++Q R++ L +L
Sbjct  72    VVVCSSADMAKAILKTHDAVFAYRPRNAAGKYTAYNYSGMTWSPYGPYFQQVRKIFLAQL  131

Query  642   FSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE  821
             FSA RL+S EYIR +E++ + R L+ A    + I L+D++S L+LNV+  MVLGK Y ++
Sbjct  132   FSAARLQSSEYIRVEEMRVLTRNLFEAKG--QSINLKDHLSDLNLNVVCRMVLGKKYTDK  189

Query  822   SEGA-IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEH  998
             SE + IVS  EFRKM+DELFLL GVLN+GD +P +DFLDLQGYIKRMKA++KKFDRFLEH
Sbjct  190   SENSNIVSAEEFRKMVDELFLLTGVLNLGDFLPLLDFLDLQGYIKRMKAVNKKFDRFLEH  249

Query  999   VLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTV  1178
             VL EH ARRV   + + AKD VD+LLQ  DDP+L VK+ERHGVKA  Q+L+AGGTE S  
Sbjct  250   VLGEHEARRV---EGYEAKDKVDVLLQHVDDPNLGVKIERHGVKALTQELIAGGTEGSAA  306

Query  1179  IVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPM  1358
              VEWA+ ELLK P  F KAT ELD +IG++RWV+E D+ NLPY+ A++KE+MRLHPV   
Sbjct  307   SVEWAMCELLKNPYTFNKATQELDNIIGRERWVQEADVTNLPYLNAVIKEMMRLHPVGAF  366

Query  1359  LVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDF  1538
             L  R   +DCKVAGYD+PKGTRVLVS W++ RDP LWD+P  F P+RFIGK IDVKG DF
Sbjct  367   LAHRFASQDCKVAGYDVPKGTRVLVSKWSIGRDPELWDDPENFRPERFIGKAIDVKGQDF  426

Query  1539  ELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKF  1718
             ELLPFG+GRRMCPGY+LGL++IQ SL NL+HGF+WKLP ++T E+LN+EE+ GLSTPKK 
Sbjct  427   ELLPFGSGRRMCPGYNLGLRMIQTSLANLIHGFSWKLPKNMTREELNIEEVPGLSTPKKI  486

Query  1719  PLTTVIEPRLPMHLY  1763
             PL  V EPRLP+HLY
Sbjct  487   PLVAVAEPRLPLHLY  501



>ref|XP_008242247.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=529

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 383/482 (79%), Gaps = 8/482 (2%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             LPPGPKPWP+IGNLNL+G LPH+S+H LS  YGP+MQL+FGS+PVVV SS EM K F KT
Sbjct  52    LPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPVMQLKFGSYPVVVASSPEMTKQFSKT  111

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D  F  RP+TAAGKY TY+Y ++TW+PYGPYWRQ R++ LTELFS+KRLES+ YIR +E
Sbjct  112   HDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLTELFSSKRLESFRYIRVEE  171

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNEFRKM  863
              ++   +LY  S   K ++L++++S L+L+++S +VLGK Y  L + E +I+S  EF+ M
Sbjct  172   NRAFASRLYALSG--KAVVLKEHLSRLNLSIMSRIVLGKEYFSLTDFESSIMSLKEFQDM  229

Query  864   LDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG-D  1040
             LDELFLLNGV NIGD IPW+DFLDLQGY+KRMKA+ KK DRF E VL EH AR+  EG  
Sbjct  230   LDELFLLNGVSNIGDWIPWLDFLDLQGYVKRMKAVKKKMDRFYEFVLHEHKARK--EGVQ  287

Query  1041  SFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
              FVAKDMVDLLLQL DDP+ LEVKL    +KAF QDL+AGGT+ S  ++EWA+SEL+K+P
Sbjct  288   EFVAKDMVDLLLQLVDDPNDLEVKLTYDSIKAFTQDLIAGGTDTSASLLEWAMSELIKQP  347

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
              + +KAT+ELDRVIG++RWVEEKD+ NLPY+ AI+KE MR HP   ML P L  EDC VA
Sbjct  348   NLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALEDCNVA  407

Query  1398  GYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCP  1577
             GYD+ KGT VLV++W++ RDP LWD P+EF P+RF+GK IDVKG  FELLPFG+GRRMCP
Sbjct  408   GYDVRKGTLVLVNLWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGRRMCP  467

Query  1578  GYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMH  1757
             GYSLGLK+I + L N+LHGFNWKLP +V  E L MEE++GL TP+KFPL  V EPRLP+H
Sbjct  468   GYSLGLKMIGSCLANVLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVAVTEPRLPIH  527

Query  1758  LY  1763
             LY
Sbjct  528   LY  529



>gb|EMT12612.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=510

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/484 (62%), Positives = 382/484 (79%), Gaps = 4/484 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +K +LPPGPKPWPVIGN +LIG+LPHRSIH+LS KYGP+M L+FGSFP+++GSS +MA+ 
Sbjct  28    QKYNLPPGPKPWPVIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIIGSSVDMARY  87

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT DI +VDRPKTA+GKYTTYNY+D+TWSPYG YWRQARR+CLT+LF+ +RL   E+I
Sbjct  88    FLKTQDILYVDRPKTASGKYTTYNYADMTWSPYGAYWRQARRICLTQLFNPRRLALLEHI  147

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE--SEGAIVSPNE  851
             R+ E+K+++  L+ A S     L RD+MS +S+NVI+ MV+GK    +  +EG + S   
Sbjct  148   RADEVKALMCDLF-AVSGHAVHLSRDHMSMVSMNVITRMVMGKRLFVDGVAEGPVPSLKV  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             FR MLDELFLLNGVLNIGD IPW+D++DLQGY++RMK + K FD F EHVLDEH+  R  
Sbjct  207   FRWMLDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKIGKLFDAFNEHVLDEHSGER-G  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
              G+   A+DM  +L++ A+D +LEV+  R GVKAF QDL+AGGTE+S V VEWA+SEL++
Sbjct  266   RGEGEAARDMGGVLMEKANDNALEVQYGRIGVKAFTQDLIAGGTESSAVTVEWAMSELMR  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P  F  AT+ELDRV+G+ RWV EKDMPNLPYI+AIVKE MR+HP+ P+L PRL RED  
Sbjct  326   RPATFDVATEELDRVVGRARWVTEKDMPNLPYIEAIVKESMRMHPIVPLLTPRLAREDAT  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             + GYDIPKG RVL++VW + RDP LWD P EF P+RF+G  + V G D ELLPFG+GRRM
Sbjct  386   IDGYDIPKGARVLINVWAIGRDPELWDAPEEFKPERFLGSKMGVIGQDLELLPFGSGRRM  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGY+LGLKV+  SL NLLHGF W+LP  V  E L+MEE+FGLST +K+PL  V +P+LP
Sbjct  446   CPGYNLGLKVVHLSLANLLHGFTWRLPEGVRKEDLSMEEVFGLSTGRKYPLQVVAKPKLP  505

Query  1752  MHLY  1763
              HLY
Sbjct  506   NHLY  509



>ref|XP_008678485.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
Length=533

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 393/524 (75%), Gaps = 10/524 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLA--KHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             ME  ++  +      V TI +L+L   K    RR   LPPGP+PWPVIGNLNL+G+LPHR
Sbjct  10    MELSSSPMLLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHR  69

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH+LS KYG +M L+FGS+ VVV SS EMA+ FLK  D+ F+DRP+TAAGK+TTYNY+D
Sbjct  70    SIHELSNKYGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYAD  129

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILL-RD  755
             ITWSPYG YWR ARR+C T+LFS  RL S+E +R++E++ ++R L+ AS  ++ + L +D
Sbjct  130   ITWSPYGAYWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKD  189

Query  756   YMSTLSLNVISWMVLGKSYLN-------ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSI  914
             ++ST S+NVI+ MVLGK + +        +EG + S  EF  M+DEL LLNGVLNIGD I
Sbjct  190   HLSTFSMNVITRMVLGKRFFDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWI  249

Query  915   PWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDP  1094
             PW+D LDLQGY++RMK ++ +FD FLEHVLD H  +R  EG+SF A+DMVD+L+QLADDP
Sbjct  250   PWLDCLDLQGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDP  309

Query  1095  SLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRW  1274
             + EV++ R GVKAF QDL+ GGTE  +  VEWA+SELL+KP +   A +ELDR +G+ RW
Sbjct  310   TSEVQIGRVGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDREVGRGRW  369

Query  1275  VEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVAR  1454
             V EKD+ +LP +QAIVKE MR+HP+AP+L P + RED  + GYDIPKGT VL++VW + R
Sbjct  370   VTEKDVAHLPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLINVWAIGR  429

Query  1455  DPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHG  1634
             DPALWD P EF P+RF+G   DVKG DFELLPFG+GRRMCPGYSLGL+ IQ SL NLLHG
Sbjct  430   DPALWDAPEEFRPERFVGSKTDVKGRDFELLPFGSGRRMCPGYSLGLQEIQLSLANLLHG  489

Query  1635  FNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             F W LP  +  E L M+E+FGLST +KFPL  V+ PRL   LY+
Sbjct  490   FTWTLPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLASELYA  533



>gb|AFW61881.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=557

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 393/524 (75%), Gaps = 10/524 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLA--KHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             ME  ++  +      V TI +L+L   K    RR   LPPGP+PWPVIGNLNL+G+LPHR
Sbjct  34    MELSSSPMLLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHR  93

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH+LS KYG +M L+FGS+ VVV SS EMA+ FLK  D+ F+DRP+TAAGK+TTYNY+D
Sbjct  94    SIHELSNKYGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYAD  153

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILL-RD  755
             ITWSPYG YWR ARR+C T+LFS  RL S+E +R++E++ ++R L+ AS  ++ + L +D
Sbjct  154   ITWSPYGAYWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKD  213

Query  756   YMSTLSLNVISWMVLGKSYLN-------ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSI  914
             ++ST S+NVI+ MVLGK + +        +EG + S  EF  M+DEL LLNGVLNIGD I
Sbjct  214   HLSTFSMNVITRMVLGKRFFDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWI  273

Query  915   PWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDP  1094
             PW+D LDLQGY++RMK ++ +FD FLEHVLD H  +R  EG+SF A+DMVD+L+QLADDP
Sbjct  274   PWLDCLDLQGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDP  333

Query  1095  SLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRW  1274
             + EV++ R GVKAF QDL+ GGTE  +  VEWA+SELL+KP +   A +ELDR +G+ RW
Sbjct  334   TSEVQIGRVGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDREVGRGRW  393

Query  1275  VEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVAR  1454
             V EKD+ +LP +QAIVKE MR+HP+AP+L P + RED  + GYDIPKGT VL++VW + R
Sbjct  394   VTEKDVAHLPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLINVWAIGR  453

Query  1455  DPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHG  1634
             DPALWD P EF P+RF+G   DVKG DFELLPFG+GRRMCPGYSLGL+ IQ SL NLLHG
Sbjct  454   DPALWDAPEEFRPERFVGSKTDVKGRDFELLPFGSGRRMCPGYSLGLQEIQLSLANLLHG  513

Query  1635  FNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             F W LP  +  E L M+E+FGLST +KFPL  V+ PRL   LY+
Sbjct  514   FTWTLPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLASELYA  557



>ref|XP_008242319.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=508

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 385/486 (79%), Gaps = 8/486 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             ++ +LPPGPKPWP+IGNLNLIG LP++S H LS  YGPIMQL+FGS+PVV+ SS EMAK 
Sbjct  27    KRPNLPPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQ  86

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TA GKY TY Y ++TW+PYGPYWRQAR++ LTELFS+K+LES++YI
Sbjct  87    FLKTHDHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKLESFQYI  146

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES--EGAIVSPNE  851
             R +E ++ + +LY  S   K ++L++++S L+L+++S +V GK Y   S  E +I+S  E
Sbjct  147   RVEENRAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFGMSKFESSIMSFKE  204

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+   DELFLL+GV NIGD IPW++FLDLQGY+KRMKAL+KK DRF E VLDEH AR+  
Sbjct  205   FQDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEHKARK--  262

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FVA DMVDLLL+LADDP+ LEVKL    VKA  QDL+ GG++ S  I+EW +SEL
Sbjct  263   EGVEKFVAGDMVDLLLRLADDPNDLEVKLTYDSVKALTQDLITGGSDTSANILEWTMSEL  322

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + KKAT+ELDRVIG++RWVEEKD+ NLPYI AI+KE MR HPV  ML PRL  ED
Sbjct  323   VKQPNLIKKATEELDRVIGKERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPRLALED  382

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGR  1565
             C VAGYDI KGT V V+ W++ RDP LWD P+EF P+RF+GK IDVKG  FE LPFG+GR
Sbjct  383   CNVAGYDIYKGTIVFVNAWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGR  442

Query  1566  RMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPR  1745
             RMCPGYSLGLKVI++ L N+LHGFNWKLP ++  E L+MEE++GL T +KFPL  ++EPR
Sbjct  443   RMCPGYSLGLKVIRSCLANMLHGFNWKLPENMKTEDLDMEEVYGLITSRKFPLLAIVEPR  502

Query  1746  LPMHLY  1763
             LP+HLY
Sbjct  503   LPIHLY  508



>gb|AGI98132.1| cytochrome P450 [Narcissus tazetta]
Length=505

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/484 (62%), Positives = 379/484 (78%), Gaps = 8/484 (2%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             RR+L+LPPGPKP+P++GNL  IG + HRSIHDLS+KYGPIMQL+FGS P+VVGSS E A+
Sbjct  30    RRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAAR  89

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLKT D+ F  RP++AAGKYT Y+YSDIT+SPYGPY RQ R++CL ELFS +RL+S EY
Sbjct  90    FFLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLEY  149

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEF  854
             IR +E++ +++ L+ +S  +  + ++D MSTL +NVIS MVLGK YL E EG      E 
Sbjct  150   IRVEEIRLLMQDLFRSSGER--VAVKDCMSTLGMNVISRMVLGKKYLGE-EG-----EEL  201

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             + M+DE F L    N GD  PW+ F D +G +K+MKALSK+F RF + VLDEHN RR  E
Sbjct  202   KGMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSKRFHRFWDRVLDEHNERRKEE  261

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
             G+ F AKDMVD+LLQ+ADDP LEVKL R  VKAF QDL+ GGTE S   +EWA +EL+K 
Sbjct  262   GERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSATTIEWATAELVKH  321

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             PEI +KAT+ELDRV+G+ RWVEEKD+ +LPY+++++KE MRLHPV P+L+PRL RED   
Sbjct  322   PEIIEKATEELDRVVGKTRWVEEKDIQSLPYLESVIKETMRLHPVLPLLIPRLAREDSTY  381

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
              GYDIP GTRV V+VW++ RDP++WD+P EF P+RFIGK+I +KG ++ELLPFGAGRRMC
Sbjct  382   EGYDIPAGTRVFVNVWSIGRDPSMWDDPEEFRPERFIGKEISLKGQNYELLPFGAGRRMC  441

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGY LGL+ IQ SL NLLHGF WKLP+ +T E+LNMEE FGL+TP+K PL  V+EPRL  
Sbjct  442   PGYPLGLREIQMSLANLLHGFVWKLPDGMTEEELNMEEGFGLATPRKVPLEVVLEPRLEA  501

Query  1755  HLYS  1766
              LY+
Sbjct  502   ELYA  505



>ref|XP_007204134.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
 gb|EMJ05333.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
Length=508

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/486 (62%), Positives = 388/486 (80%), Gaps = 8/486 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             ++ +LPPGPKPWP+IGNLNLIG LP++S H LS  YGPIMQL+FGS+PVV+ SS EMAK 
Sbjct  27    KRPNLPPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQ  86

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TA GKY TY Y ++TW+PYGPYWRQAR++ LTELFS+K+LES++YI
Sbjct  87    FLKTHDHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKLESFQYI  146

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNE  851
             R +E ++ + +LY  S   K ++L++++S L+L+++S +V GK Y  +++SE +I+S  E
Sbjct  147   RVEENRAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFGMSKSESSIMSFKE  204

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+   DELFLL+GV NIGD IPW++FLDLQGY+KRMKAL+KK D F E VLDEH AR+  
Sbjct  205   FQDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKVDHFYEFVLDEHKARK--  262

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FVA+DMVDLLL+LADDP+ LEVKL    VKA  QDL+ GG++ S   +EW +SEL
Sbjct  263   EGVEKFVAEDMVDLLLRLADDPNDLEVKLTYDSVKALTQDLITGGSDTSANTLEWTMSEL  322

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + KKAT+ELDRVIG++RWVEEKD+ NLPYI AI+KE MR HPV  ML PRL  ED
Sbjct  323   IKQPNLIKKATEELDRVIGKERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPRLALED  382

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGR  1565
             C VAGYDI KGT V V+ W++ RDP LWD P++F P+RF+GK IDVKG  FE LPFG+GR
Sbjct  383   CNVAGYDICKGTIVFVNTWSMGRDPTLWDAPDDFRPERFLGKAIDVKGQSFEFLPFGSGR  442

Query  1566  RMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPR  1745
             RMCPGYSLGLKVI++ L N+LHGFNWKLP ++  E L+MEE++GL TP+KFP+  ++EPR
Sbjct  443   RMCPGYSLGLKVIRSCLANMLHGFNWKLPENMKTEDLDMEEVYGLITPRKFPILAIVEPR  502

Query  1746  LPMHLY  1763
             LP+HLY
Sbjct  503   LPIHLY  508



>ref|XP_002324180.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
 gb|EEF02745.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
Length=510

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/509 (61%), Positives = 394/509 (77%), Gaps = 8/509 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLR-WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             I    AW+   ALL L K+ + W   L LPPGPKPWP+IGN NL+G LPH+S+H LS+KY
Sbjct  7     IVLVVAWL--FALLYLPKYFKSWLSPLKLPPGPKPWPIIGNFNLLGPLPHQSLHQLSLKY  64

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             G  MQL FGS+PV+V SS +MAK  LKT D  F  RP+TAAGKYTTY YSD+ W+PYGPY
Sbjct  65    GKTMQLHFGSYPVMVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPY  124

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
             WRQ R++ LTELFSAKRLESYEY+R +E++   R+LY   +  K I L+DY+S  +L++I
Sbjct  125   WRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLY--RNCGKSIELKDYLSHYTLSII  182

Query  786   SWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             S +VLGK Y +  ESE  IVS  EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRM
Sbjct  183   SRIVLGKKYFSASESEKEIVSLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRM  242

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K L  +FD+F +HV+DEHN RR     ++  KDMVDLLLQLADDP LEVKL R  +K   
Sbjct  243   KKLKVRFDKFHDHVIDEHNVRRKTT-KNWQPKDMVDLLLQLADDPELEVKLTRDNMKGLT  301

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGT+ +  + +W++SELLKKP++FK+ TDELDRV+G++RWVEEKD+P LPYI+AI
Sbjct  302   QDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEKDIPQLPYIEAI  361

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             +KE MR+HP A ML P L  +DCKV GYDIPKGTR+ ++ W++ RDP LW++P +F P+R
Sbjct  362   MKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTRIFINTWSMGRDPDLWEDPEDFRPER  421

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             FIGK +D+KG +FELLPFG+GRRMCPGY LG K+I  SL N+LHGF W+LP  + PE + 
Sbjct  422   FIGKGVDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWELPPGIKPEDVK  481

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +E+FGL+T +K+P   V +PRLP+HLY+
Sbjct  482   RDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_008242249.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/471 (62%), Positives = 375/471 (80%), Gaps = 5/471 (1%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             ++GNLNL+G LPH+ +H LS  YGP+MQL+FGS+PVV+ SSAEMAK FLKT D  F  RP
Sbjct  43    ILGNLNLMGPLPHQCLHKLSQTYGPLMQLKFGSYPVVIASSAEMAKQFLKTHDHVFASRP  102

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             +TAAGKY TYNY +ITW+P+GPYWRQ R++ ++ELFS+KRL S+EYIR +E+++   + Y
Sbjct  103   QTAAGKYLTYNYRNITWAPFGPYWRQGRKIFMSELFSSKRLASFEYIRVEEIRAFTSRFY  162

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE--GAIVSPNEFRKMLDELFLLNG  890
               S   KP++L++++S L+L+ +S +VLGK Y +ES+   + V+  EF+ MLDEL  L+G
Sbjct  163   ALSG--KPVILKEHISRLTLSTVSRIVLGKEYFSESQFVTSTVTLGEFQDMLDELVCLSG  220

Query  891   VLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDL  1070
             VLNIGD IPW+ F DLQGY+K+MKAL KKFD F +++LDEH AR+  E + FV KDMVDL
Sbjct  221   VLNIGDWIPWLKFFDLQGYVKQMKALKKKFDLFHDYILDEHKARKKEETN-FVPKDMVDL  279

Query  1071  LLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELD  1250
             LLQL DDP LEVKL R  VK F QDL+AGGT+ S   +EWA+SEL+++P + +KAT+ELD
Sbjct  280   LLQLVDDPDLEVKLNRDSVKGFTQDLIAGGTDTSATNLEWAMSELIRQPHLIEKATEELD  339

Query  1251  RVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVL  1430
             RVIG++RWVEEKD+ NLPYI AI+KE MR HPV  ML P L  +DCKV GYDI KGTRV 
Sbjct  340   RVIGRERWVEEKDLENLPYIDAIMKETMRKHPVVAMLAPHLALDDCKVEGYDICKGTRVF  399

Query  1431  VSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQA  1610
             ++ W++ RDP+LWD P EF P+RF+GK IDVKG  FELLPFG+GRRMCPGY LGLK+I+ 
Sbjct  400   INTWSIGRDPSLWDAPEEFNPERFLGKAIDVKGQSFELLPFGSGRRMCPGYGLGLKMIRC  459

Query  1611  SLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             SL N+LHGFNWKLP ++ PE L+MEE+ GLSTP+KFPL  V+EPRLP+HLY
Sbjct  460   SLANMLHGFNWKLPENIKPEDLSMEEVAGLSTPRKFPLVAVMEPRLPIHLY  510



>ref|XP_002445595.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
 gb|EES15090.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
Length=530

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/521 (59%), Positives = 400/521 (77%), Gaps = 19/521 (4%)
 Frame = +3

Query  261   AAWVSTIALLLLAKHLRWR---RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGP  431
              ++   +A+++  + L+ R   R   LPPGP PWPVIGN NLIG+LPHRSIH+LS KYG 
Sbjct  10    TSFAMVLAIVIFGRRLKGRPSRRVYRLPPGPSPWPVIGNFNLIGALPHRSIHELSKKYGE  69

Query  432   IMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWR  611
             +M L+FGS+ VVV SSAEMAK FLKT D+ F+DRP+TAAG++TTYNY DITWSPYG YWR
Sbjct  70    LMHLRFGSYTVVVASSAEMAKLFLKTHDLLFLDRPRTAAGRHTTYNYGDITWSPYGAYWR  129

Query  612   QARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILL-RDYMSTLSLNVIS  788
              ARR+C T+LF   RL S+E+IR+ E++S++R L+ AS++ + + L +D++ST S+NVI+
Sbjct  130   HARRICATQLFIPGRLASFEHIRADEVRSLVRGLFAASASGRAVRLGKDHLSTFSMNVIT  189

Query  789   WMVLGKSYLNESEGA-------IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
              MVLGK   + + G        + S  EF  M+DEL LLNGVLNIGD IPW+D LDLQGY
Sbjct  190   RMVLGKRLFDAAGGENAAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDRLDLQGY  249

Query  948   IKRMKALSKKFDRFLEHVLDEHNA----RRVAEGDSFVAK--DMVDLLLQLADDPSLEVK  1109
             ++RMK ++++FD FLEHVLD H+     R   +G+SFVA+  DMVD+L+QLADDP+ +V+
Sbjct  250   VRRMKRVAERFDAFLEHVLDAHSQHQQRRHERDGESFVARDMDMVDVLMQLADDPTFDVQ  309

Query  1110  LERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKD  1289
             + R GVKAF QDL+ GG+E++ V VEWA+SELL+ P +   A +ELDRV+G+ RWV EKD
Sbjct  310   IGRVGVKAFTQDLIVGGSESTAVTVEWAMSELLRNPSVLAMAAEELDRVVGRGRWVTEKD  369

Query  1290  MP-NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPAL  1466
             +  +LPY+QA++KE MR+HPVAP+L P + RED  +AGYDIPKGT VL++VWT+ RDPA+
Sbjct  370   VAHDLPYLQAVIKETMRVHPVAPLLPPHVAREDASIAGYDIPKGTHVLINVWTIGRDPAV  429

Query  1467  WDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWK  1646
             WD P EF P+RF+G  +DVKG DFELLPFG+GRRMCPGY+LGLK IQ SL NLLHGF W+
Sbjct  430   WDAPEEFRPERFVGSKVDVKGQDFELLPFGSGRRMCPGYNLGLKEIQLSLANLLHGFTWR  489

Query  1647  LPND-VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LP   V  E L+M+E+FGLST +KFPL  +++PRLP  LY+
Sbjct  490   LPEGMVKEEDLSMDELFGLSTTRKFPLEVIVQPRLPSELYA  530



>ref|XP_007204846.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
 gb|EMJ06045.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
Length=510

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/471 (63%), Positives = 374/471 (79%), Gaps = 5/471 (1%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             ++GNLNL+G LPH+ +H LS  YGP+MQL+FGS+PVV+ SSAEMAK FLKT D  F  RP
Sbjct  43    ILGNLNLMGPLPHQCLHKLSQTYGPLMQLKFGSYPVVIASSAEMAKQFLKTHDHVFASRP  102

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             +TAAGKY TYNY +ITW+P+GPYWRQ R++ ++ELFS+KRLES+EYIR +E+++   + Y
Sbjct  103   QTAAGKYLTYNYRNITWAPFGPYWRQGRKIFMSELFSSKRLESFEYIRVEEIRAFTSRFY  162

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE--GAIVSPNEFRKMLDELFLLNG  890
               S   KP++L++++S L+L+ +S +VLGK Y +ES+   + ++  EF+ MLDEL  L+G
Sbjct  163   ALSG--KPVMLKEHISRLTLSTVSRIVLGKEYFSESQFVTSTMTLREFQDMLDELVCLSG  220

Query  891   VLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDL  1070
             VLNIGD IPW+ F DLQGY+K+MKAL KKFD F +++LDEH AR+  E + FV KDMVDL
Sbjct  221   VLNIGDWIPWLKFFDLQGYVKQMKALKKKFDLFHDYILDEHKARKKEETN-FVPKDMVDL  279

Query  1071  LLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELD  1250
             LLQL DDP LEVKL R  VK F QDL+AGGT+ S   +EWA+SEL+++P +  KAT+ELD
Sbjct  280   LLQLVDDPDLEVKLNRDSVKGFTQDLIAGGTDTSATNLEWAMSELIRQPHLIGKATEELD  339

Query  1251  RVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVL  1430
             RVIG++RWVEEKD+ NLPYI AI+KE MR HPV  ML P L  EDCKV GYDI KGTRV 
Sbjct  340   RVIGRERWVEEKDLENLPYIDAIMKETMRKHPVVAMLAPHLALEDCKVEGYDICKGTRVF  399

Query  1431  VSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQA  1610
             ++ W++ RDP+LWD P EF P+RF+GK IDVKG  FELLPFG+GRRMCPGY LGLK+I+ 
Sbjct  400   INTWSIGRDPSLWDAPEEFNPERFLGKAIDVKGQSFELLPFGSGRRMCPGYGLGLKMIRC  459

Query  1611  SLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             SL N+LHGFNWKLP ++ PE L MEE+ GLSTP+KFPL  V+EPRLP+HLY
Sbjct  460   SLANMLHGFNWKLPENMKPEDLCMEEVAGLSTPRKFPLVAVMEPRLPIHLY  510



>ref|XP_007203042.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
 gb|EMJ04241.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
Length=510

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 379/486 (78%), Gaps = 8/486 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
              KL  PPGPKPWP+IGNLNLIG LPH+S H LS  YGPIMQL FGSFPVV+ SS EMAK 
Sbjct  29    HKLKYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLNFGSFPVVIASSPEMAKL  88

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLK  D  F  RP+TAAGKY TY++ ++TW+PYGPYWRQ R++ L+ELFS++RLES+EYI
Sbjct  89    FLKIHDHVFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSSRRLESFEYI  148

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES--EGAIVSPNE  851
             R +E  + + +LY  S  Q  I+L++++S L+L+++S +V GK Y   S  E +++S  E
Sbjct  149   RVEESHAFVSRLYALSGKQ--IMLKEHLSRLTLSIMSRIVFGKEYFGVSKFESSVMSLKE  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+  LDELFLL+GV NIGD IPW++FLDLQGY+KRMKAL+KK DRF E VLDEH  ++  
Sbjct  207   FQDTLDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKK--  264

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FV++DMVDLLL+L DDP+ LEVKL    VKA  QD +AGGT+ S   +EWA+SEL
Sbjct  265   EGVEEFVSEDMVDLLLRLVDDPNDLEVKLTYDSVKAITQDSVAGGTDTSATTLEWAMSEL  324

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + KKAT ELDRVIG++RWVEEKD+ NLPYI AI+KE MR HPV  ML P L  ED
Sbjct  325   IKQPNLIKKATQELDRVIGRERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPHLALED  384

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGR  1565
             C VAGYDI KGT V V+ W++ RDP LWD P+EF P+RFIGK IDVKG  FE LPFG+GR
Sbjct  385   CNVAGYDICKGTLVFVNTWSMGRDPTLWDAPDEFRPERFIGKAIDVKGQSFEFLPFGSGR  444

Query  1566  RMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPR  1745
             RMCPGYSLGLKVI++ L N+LHGFNWKL  +V  E L+MEE++GL TP+KFPL  V+EPR
Sbjct  445   RMCPGYSLGLKVIRSCLANMLHGFNWKLSENVKKEDLSMEEVYGLLTPRKFPLVAVVEPR  504

Query  1746  LPMHLY  1763
             LP++LY
Sbjct  505   LPIYLY  510



>ref|XP_011035092.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/509 (61%), Positives = 393/509 (77%), Gaps = 8/509 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLR-WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             I    AW+   ALL L K  + W   L LPPGPKPWP+IGN NL+G LPH+S+H LS+KY
Sbjct  7     IVLVVAWL--FALLYLPKFFKSWLNPLKLPPGPKPWPIIGNFNLLGPLPHQSLHQLSLKY  64

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             G  MQL FGS+PV+V SS +MAK  LKT D  F  RP+TAAGKYTTY YSD+ W+PYGPY
Sbjct  65    GKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPY  124

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
             WRQ R++ LTELFSAKRLESYEY+R +E++   R+LY   +  K I L+DY+S  +L++I
Sbjct  125   WRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLY--RNCGKSIELKDYLSHYTLSII  182

Query  786   SWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             S +VLGK Y +  ESE  IV+  EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRM
Sbjct  183   SRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRM  242

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K L  +FD+F +HV+DEHN RR     ++  KDMVDLLLQLADDP LEVKL R  +K   
Sbjct  243   KKLKVRFDKFHDHVIDEHNVRRKTT-KNWQPKDMVDLLLQLADDPELEVKLTRDNIKGLT  301

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGT+ +  + +W++SELLKKP++FK+ TDELDRV+G++RWVEEKD+P LPYI+AI
Sbjct  302   QDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEKDIPQLPYIEAI  361

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             +KE MR+HP A ML P L  +DCKV GYDIPKGTR+ ++ W++ RDP LW++P +F P+R
Sbjct  362   MKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTRIFINTWSMGRDPDLWEDPEDFRPER  421

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             FIGK +D+KG +FELLPFG+GRRMCPGY LG K+I  SL N+LHGF W+LP  + PE + 
Sbjct  422   FIGKGVDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWELPPGIKPEDVK  481

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +E+FGL+T +K+P   V +PRLP+HLY+
Sbjct  482   RDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>gb|AGI98131.1| cytochrome P450 CYP92 [Narcissus tazetta]
Length=505

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/483 (62%), Positives = 378/483 (78%), Gaps = 8/483 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             R+L+LPPGPKP+P++GNL  IG + HRSIHDLS+KYGPIMQL+FGS P+VVGSS E A+ 
Sbjct  31    RRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAARF  90

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D+ F  RP++AAGKYT Y+YSDIT+SPYGPY RQ R++CL ELFS +RL+S EYI
Sbjct  91    FLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLEYI  150

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFR  857
             R +E++ +++ L+ +S  +  + ++D MSTL ++VIS MVLGK YL E EG      E +
Sbjct  151   RVEEIRLLMQDLFRSSGER--VAVKDCMSTLGMDVISRMVLGKKYLGE-EG-----EELK  202

Query  858   KMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG  1037
              M+DE F L    N GD  PW+ F D +G +K+MKALS++F RF + VLDEHN RR  EG
Sbjct  203   GMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSERFHRFWDRVLDEHNERRKEEG  262

Query  1038  DSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
             + F AKDMVD+LLQ+ADDP LEVKL R  VKAF QDL+ GGTE S   +EWA +EL+K P
Sbjct  263   ERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSATTIEWATAELVKHP  322

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
             EI +KAT+ELDRV+G+ RWVEEKD+ +LPY+++I+KE MRLHPV P+L+PRL RED    
Sbjct  323   EIIEKATEELDRVVGKTRWVEEKDVQSLPYLESIIKETMRLHPVLPLLIPRLAREDSTYE  382

Query  1398  GYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCP  1577
             GYDIP GTRV V+VW++ RDP++WD+P EF P+RFIGK+I +KG ++ELLPFGAGRRMCP
Sbjct  383   GYDIPAGTRVFVNVWSIGRDPSMWDDPEEFRPERFIGKEISLKGQNYELLPFGAGRRMCP  442

Query  1578  GYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMH  1757
             GY LGL+ IQ SL NLLHGF WKLP+ +T E+LNMEE FGL+TP+K PL  V+EPRL   
Sbjct  443   GYPLGLREIQMSLANLLHGFVWKLPDGMTKEELNMEEGFGLATPRKVPLEVVLEPRLEAE  502

Query  1758  LYS  1766
             LY+
Sbjct  503   LYA  505



>ref|XP_008242245.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 377/486 (78%), Gaps = 8/486 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
              KL  PPGPKPWP+IGNLNLIG LPH+S H LS  YGPIMQL+FGS+PVV+ SS EMAK 
Sbjct  29    HKLKYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKL  88

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLK  D  F  RP+TAAGKY TY++ ++TW+PYGPYWRQ R++ L+ELFSA+RLES+EYI
Sbjct  89    FLKIHDHIFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSARRLESFEYI  148

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES--EGAIVSPNE  851
             R +E  + + +LY  S   K I+L++++S L+L+++S +V GK Y   S  E +I+S  E
Sbjct  149   RVEESHAFVSRLYALSG--KKIMLKEHLSRLTLSIMSRIVFGKEYFGVSKFESSIMSLKE  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+  LDELFLL+GV NIGD IPW+ FLDLQGY+KRMKAL+KK DRF E VLDEH  ++  
Sbjct  207   FQDTLDELFLLSGVFNIGDWIPWLKFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKK--  264

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FV++DMVDLLL+L DDP+ LEVKL    VKA  QD +AGGT+ S   +EWA+SEL
Sbjct  265   EGVEEFVSEDMVDLLLRLVDDPNDLEVKLTNDSVKAITQDSVAGGTDTSATTLEWAMSEL  324

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + +KAT ELD+VIG++RWVEEKD+ NLPY  AI+KE MR HPV  ML P L  ED
Sbjct  325   IKQPNLIEKATQELDKVIGRERWVEEKDLENLPYTDAIMKETMRKHPVVAMLPPHLALED  384

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGR  1565
             C VAGYDI KGT V V+ W++ RDP LWD P+EF P+RF+GK IDVKG  FE LPFG+GR
Sbjct  385   CNVAGYDICKGTLVFVNTWSMGRDPKLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGR  444

Query  1566  RMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPR  1745
             RMCPGYSLGLKVI++ L N+LHGFNWKL  +V  E L MEE++GL TP+KFPL  V+EPR
Sbjct  445   RMCPGYSLGLKVIRSCLANMLHGFNWKLSENVKKEDLGMEEVYGLLTPRKFPLVAVVEPR  504

Query  1746  LPMHLY  1763
             LP+HLY
Sbjct  505   LPIHLY  510



>ref|XP_004984305.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=536

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/492 (61%), Positives = 379/492 (77%), Gaps = 9/492 (2%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGP+PWPVIGNLNLIGSLPHRSIH+LS ++GP+M L+FGS PVVVG+S + A+  
Sbjct  43    KYNLPPGPRPWPVIGNLNLIGSLPHRSIHELSARHGPLMSLRFGSVPVVVGASVDAARFI  102

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D+ F+DRPK A+G+YT YN+SDI WSPYG YWRQAR++  T+LFSA++L S E++R
Sbjct  103   LKTHDVAFIDRPKMASGRYTAYNFSDIVWSPYGAYWRQARKLWQTKLFSARQLRSQEHVR  162

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE-SEGAIVSPNEFR  857
              +E++ +LR L+  +  +  + L++++  L+LNVIS M LG+ Y+ E + G+ VSP EFR
Sbjct  163   LEEVRDLLRGLHGLAEGRVAVALKEHLLMLNLNVISRMALGRKYVGEGTAGSPVSPAEFR  222

Query  858   KMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG  1037
              M+DELF+LNGV +IGD IPW++ LDLQGYI RMK L K FDRFLEHV+DEHN RR  EG
Sbjct  223   WMVDELFVLNGVFSIGDFIPWLNCLDLQGYIARMKRLGKMFDRFLEHVVDEHNERRRREG  282

Query  1038  DSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
             + FVAKDMVDLLL+LADDPSLEV +ER GVK F  DL+AGGT+ S V  EWA+SELL+ P
Sbjct  283   EGFVAKDMVDLLLELADDPSLEVPIERDGVKGFALDLIAGGTDTSAVATEWAMSELLRNP  342

Query  1218  EIFKKATDELDRVIGQKR-WVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK-  1391
             E+  KAT+ELD V+G  R  V E+D+P LPY++A+VKE  RLHPV P+L PRL RED   
Sbjct  343   EVMAKATEELDSVVGHGRLLVTEEDIPKLPYLEAVVKETFRLHPVTPLLAPRLSREDASS  402

Query  1392  -----VAGYDIPKGTRVLVSVWTVARDPALWDN-PNEFIPDRFIGKDIDVKGCDFELLPF  1553
                    GYDIP GT V V++WT+ RDPA+W     EF P+RF+G  +DVKG D ELLPF
Sbjct  403   TGGGGGGGYDIPAGTLVFVNIWTIGRDPAVWGRAAEEFRPERFVGSSVDVKGQDLELLPF  462

Query  1554  GAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV  1733
             G+GRRMCPGY+LGLK++Q +L NLLH F W+LP+ V  E+L+MEE FGL+ P+K PL  V
Sbjct  463   GSGRRMCPGYTLGLKMVQLTLANLLHAFAWRLPDGVAAEELSMEEKFGLAVPRKVPLEAV  522

Query  1734  IEPRLPMHLYSV  1769
              EPRLP HLY+ 
Sbjct  523   AEPRLPAHLYAT  534



>ref|XP_006381618.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
 gb|ERP59415.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
Length=510

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/504 (61%), Positives = 393/504 (78%), Gaps = 8/504 (2%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLR-WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQ  440
             AWVS  ALL L K  +  R  L LPPGPKPWP+IGN +L+G LPH+S+H LS+KYG  MQ
Sbjct  12    AWVS--ALLYLPKFFKSLRNPLKLPPGPKPWPIIGNFDLLGPLPHQSLHQLSLKYGKTMQ  69

Query  441   LQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQAR  620
             LQFGS+PV V SS ++AK  LKT D  F  RP+TAAGKYTTY YSD+ W+PYGPYWRQ R
Sbjct  70    LQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPYWRQGR  129

Query  621   RMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL  800
             ++ LTELFSAKRLESYEY+R +E++   R+LY   +  K I L+DY+S  +L++IS +VL
Sbjct  130   KIYLTELFSAKRLESYEYMRIEEMREFTRRLY--RNCGKTIELKDYLSHYTLSIISRIVL  187

Query  801   GKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSK  974
             GK Y +  ESE  IV+  EF++MLDELFLLNGVLNIGD IPW+DFLD+QGY+KRMK L  
Sbjct  188   GKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDMQGYVKRMKELKV  247

Query  975   KFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLA  1154
             +FDRF +HV+DEHNA+R A   ++  KDMVDLLLQLADDP LEVKL R  +K   QDL+A
Sbjct  248   RFDRFHDHVIDEHNAKRKAT-KNWQPKDMVDLLLQLADDPELEVKLTRDNIKGLTQDLIA  306

Query  1155  GGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVM  1334
             GGT+ +  + +W++SELLKKP++FK+ TDELDRV+G+ RWVEEKD+P LPYI+AI+KE M
Sbjct  307   GGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRDRWVEEKDIPQLPYIEAIMKEAM  366

Query  1335  RLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD  1514
             R+HP A ML P L  +D KV GYDIPKGTR+ ++ W++ RDP LW++P +F P+RFIGK 
Sbjct  367   RMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDLWEDPEDFRPERFIGKG  426

Query  1515  IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIF  1694
             ID+KG +FELLPFG+GRRMCPGY LG K+I  SL N+LHGF W+LP  + P+ +  +E+F
Sbjct  427   IDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWELPPGMKPQDVKRDEVF  486

Query  1695  GLSTPKKFPLTTVIEPRLPMHLYS  1766
             GL+T +K+P   V +PRLP+HLY+
Sbjct  487   GLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_011015794.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/509 (61%), Positives = 391/509 (77%), Gaps = 8/509 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLR-WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             I    AW+   ALL L K  + W   L LPPGPKPWP+IGN NL+G LPH+S+H LS+KY
Sbjct  7     IVLVVAWL--FALLYLPKFFKSWLNPLKLPPGPKPWPIIGNFNLLGPLPHQSLHQLSLKY  64

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             G  MQL FGS+PV+V SS +MAK  LKT D  F  RP+TAAGKYTTY YSD+ W+PYGPY
Sbjct  65    GKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAWAPYGPY  124

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVI  785
             WRQ R++ LTELFSAKRLESYEY+R +E++   R+LY   +  K I L+DY+S  +L++I
Sbjct  125   WRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLY--RNCGKSIELKDYLSHYTLSII  182

Query  786   SWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             S +VLGK Y +  ESE  IV+  EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRM
Sbjct  183   SRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRM  242

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K L  +FD+F +HV+DEHN RR     ++  KDMVDLLLQLADDP LEVKL R  +K   
Sbjct  243   KKLKVRFDKFHDHVIDEHNVRRKTT-KNWQPKDMVDLLLQLADDPELEVKLTRDNIKGLT  301

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
             QDL+AGGT+ +  + +W++SELLKKP++FK+ TDELDRV+G++RWVEEKD+P LPYI+AI
Sbjct  302   QDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEKDIPQLPYIEAI  361

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             +KE MR+HP A ML P L  +D KV GYDIPKGTR+ ++ W++ RDP LW++P +F P+R
Sbjct  362   MKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDLWEDPEDFRPER  421

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLN  1679
             F GK ID+KG +FELLPFG+GRRMCPGY LG K+I  SL N+LHGF W+LP  + PE + 
Sbjct  422   FFGKGIDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWELPPGIKPEDVK  481

Query  1680  MEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +E+FGL+T +K+P   V +PRLP+HLY+
Sbjct  482   RDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_006427644.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|ESR40884.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|KDO55336.1| hypothetical protein CISIN_1g010172mg [Citrus sinensis]
Length=516

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/516 (60%), Positives = 391/516 (76%), Gaps = 6/516 (1%)
 Frame = +3

Query  219   DSMESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             D + SP+ + I Y+  +   I L L  +  R+ RK++LPPGPKPWP IGNLNLIG LPH 
Sbjct  3     DPITSPSNSAIFYSILFFLPIVLFLFRR--RFSRKVNLPPGPKPWPFIGNLNLIGPLPHV  60

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH LS KYGP+M L+FG   VVVGSS E+A+  LKT DI+F  RP   AGKYTTYNYS 
Sbjct  61    SIHSLSQKYGPLMHLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSG  120

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             +  +PYGPYWRQAR++CL EL   KRL+ +EY+R +E  + L +L+ + S    + L+D+
Sbjct  121   MATAPYGPYWRQARKICLMELLGTKRLDQFEYMRVEERNAFLFELFKSVSTY--VHLKDH  178

Query  759   MSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + TL+   I  MVLGK Y +++E   V+P +F +ML+ELFLLNG+L+IGDSIPW+   DL
Sbjct  179   LYTLNHTSICRMVLGKRYTDKAEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDL  238

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG++KRMK +SKK D+F E +LDEH ARR +  D +   DMVD+LL LADDPSLEVKLER
Sbjct  239   QGHVKRMKDVSKKLDKFYEDILDEHYARRKSIKD-YGVHDMVDVLLHLADDPSLEVKLER  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
               +KA IQDLL  GT+ S + VEWA+SELLK PE  +KAT+ELDR IG+ RWVEEKD+ +
Sbjct  298   EHIKALIQDLLTAGTDTSAINVEWAMSELLKSPETIQKATEELDRAIGRDRWVEEKDIVS  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPY+QAIVKE MRLHPVAP+L PR+ REDCKVAGYDI K TRV+V+VW + RDP +W+ P
Sbjct  358   LPYLQAIVKETMRLHPVAPLLAPRVAREDCKVAGYDILKNTRVMVNVWAIGRDPTIWEKP  417

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RFIGK+IDVKG DF+LLPFG+GRRMC GY LGLKV+Q++L NLLHGF WKLP D
Sbjct  418   NEFRPERFIGKEIDVKGHDFQLLPFGSGRRMCIGYGLGLKVVQSTLANLLHGFEWKLPGD  477

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLY  1763
             +  E LNME+ FGL+  +K PL  V  +PRLP+HLY
Sbjct  478   MKNEDLNMEDRFGLTMSRKVPLVVVPSKPRLPLHLY  513



>ref|XP_006493374.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=516

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/516 (60%), Positives = 390/516 (76%), Gaps = 6/516 (1%)
 Frame = +3

Query  219   DSMESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             D + SP+ + I Y+  +   I L L  +  R+ RK++LPPGPKPWP IGNLNLIG LPH 
Sbjct  3     DPITSPSNSAIFYSILFFLPIVLFLFRR--RFSRKVNLPPGPKPWPFIGNLNLIGPLPHV  60

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH LS KYGP+M L+FG   VVVGSS E+A+  LKT DI+F  RP   AGKYTTYNYS 
Sbjct  61    SIHSLSQKYGPLMHLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSG  120

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDY  758
             +  +PYGPYWRQAR++CL EL   KRL  +EY+R +E  + L +L+ + S    + L+D+
Sbjct  121   MATAPYGPYWRQARKICLMELLGTKRLNQFEYMRVEERNAFLFELFKSVSTY--VHLKDH  178

Query  759   MSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDL  938
             + TL+   I  MVLGK Y +++E   V+P +F +ML+ELFLLNG+L+IGDSIPW+   DL
Sbjct  179   LHTLNHTSICRMVLGKRYTDKAEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDL  238

Query  939   QGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLER  1118
             QG++KRMK +SKK D+F E +LDEH ARR +  D +   DMVD+LL LADDPSLEVKLER
Sbjct  239   QGHVKRMKDVSKKLDKFYEDILDEHYARRKSIKD-YGVHDMVDVLLHLADDPSLEVKLER  297

Query  1119  HGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPN  1298
               +KA IQDLL  GT+ S + VEWA+SELLK PE  +KAT+ELDR IG+ RWVEEKD+ +
Sbjct  298   EHIKALIQDLLTAGTDTSAINVEWAMSELLKSPETIQKATEELDRAIGRDRWVEEKDIVS  357

Query  1299  LPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNP  1478
             LPY+QAIVKE MRLHPVAP+L PR+ REDCKVAGYDI K TRV+V+VW + RDP +W+ P
Sbjct  358   LPYLQAIVKETMRLHPVAPLLAPRVAREDCKVAGYDILKNTRVMVNVWAIGRDPTIWEKP  417

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             NEF P+RFIGK+IDVKG DF+LLPFG+GRRMC GY LGLKV+Q++L NLLHGF WKLP D
Sbjct  418   NEFRPERFIGKEIDVKGHDFQLLPFGSGRRMCIGYGLGLKVVQSTLANLLHGFEWKLPGD  477

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLY  1763
             +  E LNME+ FGL+  +K PL  V  +PRLP+HLY
Sbjct  478   MKNEDLNMEDRFGLTMSRKVPLVVVPSKPRLPLHLY  513



>ref|NP_001148045.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG29574.1| flavonoid 3-monooxygenase [Zea mays]
Length=525

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/524 (57%), Positives = 378/524 (72%), Gaps = 9/524 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWR----RKLHLPPGPKPWPVIGNLNLIGSLP  392
             ME P  +  S+    V   A L L   LR R    RK  LPPGP+PWPVIGNLNLIG LP
Sbjct  1     MELPAPSSASFFLVAVVAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLP  60

Query  393   HRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNY  572
             H S+H+LS +YGP+M L+FGSFPVVV SS + A+  LKT D+ F+DRP+TAAG+YTTYN 
Sbjct  61    HHSVHELSKRYGPLMSLRFGSFPVVVASSVDTARLILKTHDLAFIDRPQTAAGRYTTYNC  120

Query  573   SDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSA----QKP  740
             + + + PYG YWRQARR+C  ELFSA+RL S E++RS E++++L  L  ASSA       
Sbjct  121   AGLFYQPYGAYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAASSAPAGGHDA  180

Query  741   ILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPW  920
             + LR+++  ++L+V+S M+LGK Y+ E   +  +P EFR ++DE F LNGVLN+ D IPW
Sbjct  181   VTLREHLYMVNLSVVSRMLLGKKYVVEGSSSPATPEEFRWLIDEHFFLNGVLNVADMIPW  240

Query  921   IDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPS-  1097
             +  LD QGY+KRMK  +K  DRFLEHV+DEHN RR  EG+ FVA DM+D+LL+LADDPS 
Sbjct  241   LSPLDPQGYVKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDPSQ  300

Query  1098  LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWV  1277
             LEV + R  VK F  DL+ GGT+ S V VEWA+SELL+ PE+  KAT+ELDRV+G+ R V
Sbjct  301   LEVPITRDNVKGFTLDLMGGGTDTSAVTVEWAMSELLRNPEVLAKATEELDRVVGRDRLV  360

Query  1278  EEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARD  1457
              E D+P+LPY+ A+VKE +RLHPVAP+L PRLCRED  V GYDIP G RV V+ W + RD
Sbjct  361   AEGDIPSLPYLDAVVKETLRLHPVAPLLTPRLCREDVSVGGYDIPAGARVFVNAWAIGRD  420

Query  1458  PALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGF  1637
             PA+W+ P EF P+RF G  +DVKG  FELLPFG+GRRMCPG  L L+++   LGNLLH F
Sbjct  421   PAVWEAPLEFRPERFAGSSVDVKGQHFELLPFGSGRRMCPGMGLALRMVPTILGNLLHAF  480

Query  1638  NWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              W+LP+ V  E+L MEE FGL+ P+  PL  V EP+LP  LY+ 
Sbjct  481   AWRLPDGVAAEELGMEETFGLTVPRLVPLQAVAEPKLPARLYAA  524



>gb|ACF84248.1| unknown [Zea mays]
 tpg|DAA45476.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=525

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/524 (57%), Positives = 379/524 (72%), Gaps = 9/524 (2%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWR----RKLHLPPGPKPWPVIGNLNLIGSLP  392
             ME P  +  S+    V   A L L   LR R    RK  LPPGP+PWPVIGNLNLIG LP
Sbjct  1     MELPAPSSASFFLVAVVAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLP  60

Query  393   HRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNY  572
             H S+H+LS +YGP+M L+FGSFPVVV SS + A+  LKT D+ F+DRP+TAAG+YTTYN 
Sbjct  61    HHSVHELSKRYGPLMSLRFGSFPVVVASSIDTARLILKTHDLAFIDRPQTAAGRYTTYNC  120

Query  573   SDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSA----QKP  740
             + + + PYG YWRQARR+C  ELFSA+RL S E++RS E++++L  L  A+SA       
Sbjct  121   AGLFYQPYGAYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAAASAPAGGHDA  180

Query  741   ILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPW  920
             + LR+++  ++L+V+S M+LGK Y+ E   +  +P EFR ++DE F LNGVLN+ D IPW
Sbjct  181   VTLREHLYMVNLSVVSRMLLGKKYVVEGSSSPATPEEFRWLIDEHFFLNGVLNVADMIPW  240

Query  921   IDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPS-  1097
             +  LD QGY+KRMK  +K  DRFLEHV+DEHN RR  EG+ FVA DM+D+LL+LADDPS 
Sbjct  241   LSPLDPQGYVKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDPSQ  300

Query  1098  LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWV  1277
             LEV + R  VK F  DL+ GGT+ S V VEWA+SELL+ PE+  KAT+ELDRV+G+ R V
Sbjct  301   LEVPITRDNVKGFTLDLMGGGTDTSAVTVEWAMSELLRNPEVLAKATEELDRVVGRNRLV  360

Query  1278  EEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARD  1457
              E D+P+LPY+ A+VKE +RLHPVAP+L PRLCRED  V GYDIP G RV V+ W + RD
Sbjct  361   AEGDIPSLPYLDAVVKETLRLHPVAPLLTPRLCREDVSVGGYDIPAGARVFVNAWAIGRD  420

Query  1458  PALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGF  1637
             PA+W+ P EF P+RF G  +DVKG  FELLPFG+GRRMCPG  L L+++   LGNLLH F
Sbjct  421   PAVWEAPLEFRPERFAGSGVDVKGQHFELLPFGSGRRMCPGMGLALRMVPTILGNLLHAF  480

Query  1638  NWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
              W+LP+ V  E+L MEE FGL+ P+  PL  V EP+LP  LY+V
Sbjct  481   AWRLPDGVAAEELGMEETFGLTVPRLVPLQAVAEPKLPARLYAV  524



>ref|XP_002444467.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
 gb|EES13962.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
Length=512

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/527 (58%), Positives = 393/527 (75%), Gaps = 28/527 (5%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME P    +    A V  I +L      + RR   LPPGP+PWP+IGN NLIG+LPHRSI
Sbjct  1     MELPVPPLLLTCLAMVLAIVILRRTLKGKPRRVYRLPPGPRPWPIIGNFNLIGALPHRSI  60

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS KYG +M L+FGS+ VVVGSSA+MAK FLKT D+ F+DRPKTAAGK+TTYNY DIT
Sbjct  61    HELSKKYGELMHLRFGSYSVVVGSSADMAKLFLKTHDLLFLDRPKTAAGKHTTYNYGDIT  120

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPI-----LL  749
             WSPYG YWR ARR+C T+LFS  RL S+E+IR+ E++S++R L+ AS++         L 
Sbjct  121   WSPYGAYWRHARRICATQLFSPGRLASFEHIRADEVRSLVRGLFAASASASGSGCAVRLN  180

Query  750   RDYMSTLSLNVISWMVLGKSYLNE--------SEGAIVSPNEFRKMLDELFLLNGVLNIG  905
             +D++ TLS+NVI+ MVLGK   +         +EG + S  +F+ M+DEL L+NGVLNIG
Sbjct  181   KDHLYTLSMNVITRMVLGKRLFDGGGDDDDDVAEGPVSSLADFKWMMDELLLVNGVLNIG  240

Query  906   DSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLA  1085
             D IPW+D+LDLQGY++RMK + K+F  F++++LDEH+ RR  EG+SFVA+DMVD+L+QLA
Sbjct  241   DWIPWLDWLDLQGYMRRMKRIGKRFSEFIDYILDEHDDRRRREGESFVARDMVDVLMQLA  300

Query  1086  DDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQ  1265
             DDP+ +V++ R GVKAF QDL+ GG+E++ V VEWAISELL+KP +F  AT+ELDRV+G 
Sbjct  301   DDPTFDVQIGRVGVKAFTQDLIVGGSESTAVTVEWAISELLRKPSLFAMATEELDRVVGH  360

Query  1266  KRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWT  1445
              RWV EKD+ +LPY+Q+IVKE MRLHP+ P+L+PR+ RED  +AGYDIPKGT VL+    
Sbjct  361   GRWVTEKDIAHLPYLQSIVKETMRLHPIVPLLIPRVTREDASIAGYDIPKGTCVLI----  416

Query  1446  VARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNL  1625
                        NEF P+RF+G  IDVKG DFELLPFG+GRRMCPGY+LGLK IQ +L NL
Sbjct  417   -----------NEFRPERFVGSKIDVKGQDFELLPFGSGRRMCPGYNLGLKEIQLTLANL  465

Query  1626  LHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LHGF W LP  +  E L+M+E+FGLST +K PL  +++PRLP  LY+
Sbjct  466   LHGFTWSLPEGMAKEDLSMDEVFGLSTTRKLPLEVIVQPRLPAELYA  512



>ref|XP_009337219.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=514

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/515 (60%), Positives = 391/515 (76%), Gaps = 12/515 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALL----LLAKHLRWR-RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDL  413
             + ++ A + T+A L    L++K L  + +K   PPGPKPWP+IGNLNLIG LPH+S+H L
Sbjct  2     VYFSCAVILTLACLATLALVSKTLFPQLKKQKFPPGPKPWPIIGNLNLIGPLPHQSLHKL  61

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S  YGPIMQL+FGS PVVV SS EMAK FLKT D  F  RP TAAGKY TY+Y ++TWSP
Sbjct  62    SQTYGPIMQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPPTAAGKYLTYDYQNVTWSP  121

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             YGPYWRQ R++ L ELFS+KRLES+EYIR  E ++   +LY  + +  PI+L++++S L+
Sbjct  122   YGPYWRQGRKIFLYELFSSKRLESFEYIRVDENRAFTSRLYAIAKSGNPIVLKEHLSRLN  181

Query  774   LNVISWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             L+++S  VLGK Y +  E EG+I+S  EF+ M+DELF+L+GV NIGD IPW++FLDLQGY
Sbjct  182   LSIMSRTVLGKDYFSVAEYEGSIMSLEEFQDMIDELFVLSGVFNIGDWIPWLNFLDLQGY  241

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEG-DSFVAKDMVDLLLQLADDPS-LEVKLERH  1121
             IKRMKA+ KK +RF + VL+EH AR+  EG + FV KDMVDLLLQL D  S LEVKL   
Sbjct  242   IKRMKAIQKKINRFYDFVLNEHKARK--EGVEEFVPKDMVDLLLQLVDGSSDLEVKLNYD  299

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
              +KAFIQDL+AGGT+ S  ++EWA+SEL+K+P + KKAT+ELDRVIG++RWVEEKD+  L
Sbjct  300   SIKAFIQDLIAGGTDTSATVLEWAMSELIKQPNLIKKATEELDRVIGRERWVEEKDLAQL  359

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PYI AI+KE MR HP   +L P L  E+  VAGYD+ KGT V V+ W++ RDP LW+ P 
Sbjct  360   PYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPKLWEEPE  419

Query  1482  EFIPDRFIGKD-IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
             EF P RF+G   ID++G  FELLPFG+GRRMCPGY LGLK+I+  L N+LHGFNWKLP +
Sbjct  420   EFRPGRFLGNTGIDLQGQSFELLPFGSGRRMCPGYKLGLKMIRTCLANMLHGFNWKLPGN  479

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             V  E L MEE FGL TP+KFPL  V+EPRLP+HLY
Sbjct  480   VKVEDLGMEETFGLVTPRKFPLVAVMEPRLPVHLY  514



>gb|AGI97940.1| flavonoid 3'-monooxygenase-like protein [Narcissus tazetta]
Length=506

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/484 (61%), Positives = 377/484 (78%), Gaps = 9/484 (2%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             R+L+LPPGPKP+P++GNL  IG + HRSIHDLS+KYGPIMQL+FGS P+VVGSS E A+ 
Sbjct  31    RRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLSLKYGPIMQLKFGSRPIVVGSSVEAARF  90

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D+ F  RP++AAGKYT Y+YSDIT+SPYGPY RQ R++CL ELFS +RL+S EYI
Sbjct  91    FLKTHDVIFASRPESAAGKYTAYDYSDITFSPYGPYLRQIRKICLVELFSPRRLDSLEYI  150

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFR  857
             R +E++ +++ L+ +S  +  + ++D MSTL ++VIS MVLGK YL E EG      E +
Sbjct  151   RVEEIRLLMQDLFRSSGGR--VAVKDCMSTLGMDVISRMVLGKKYLGE-EG-----EELK  202

Query  858   KMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG  1037
              M+DE F L    N GD  PW+ F D +G +K+MKALS++F RF + VLDEHN RR  EG
Sbjct  203   GMIDEWFALTAAFNPGDLFPWLGFFDWRGVVKKMKALSERFHRFWDRVLDEHNERRKEEG  262

Query  1038  DSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
             + F AKDMVD+LLQ+ADDP LEVKL R  VKAF QDL+ GGTE S   +EWA +EL+K P
Sbjct  263   ERFEAKDMVDVLLQIADDPGLEVKLTRDSVKAFTQDLIGGGTETSATTIEWATAELVKHP  322

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
             EI +KAT+ELDRV+G+ RWVEEKD+ +LPY+++I+KE MRLHPV P+L+PRL RED    
Sbjct  323   EIIEKATEELDRVVGKTRWVEEKDVQSLPYLESIIKETMRLHPVLPLLIPRLAREDSTYE  382

Query  1398  GYDIPK-GTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMC  1574
             GYDIP  GTRV V+VW++ RDP++WD+P E  P+RFIGK+I +KG ++ELLPFGAGRRMC
Sbjct  383   GYDIPAGGTRVFVNVWSIGRDPSMWDDPEESRPERFIGKEISLKGQNYELLPFGAGRRMC  442

Query  1575  PGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPM  1754
             PGY LGL+ IQ SL NLLHGF WKLP+ +T E+LNMEE FGL+TP+K PL  V+EPRL  
Sbjct  443   PGYPLGLREIQMSLANLLHGFVWKLPDGMTKEELNMEEGFGLATPRKVPLEVVLEPRLEA  502

Query  1755  HLYS  1766
              LY+
Sbjct  503   ELYA  506



>gb|EAZ44883.1| hypothetical protein OsJ_29523 [Oryza sativa Japonica Group]
Length=469

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 378/514 (74%), Gaps = 47/514 (9%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             ME    +W S     ++ +  LL       RR   LPPGP PWP+IGNLNLIG+LPHRSI
Sbjct  1     MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSI  60

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS +YGP+MQL+FGSFPVVVGSSAEMA+ FLK+ DI F DRP+TAAGK+TTYNY+DI 
Sbjct  61    HELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDIL  120

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYG YWRQAR+MC+TELFSA+RLES+E+IR +E++++LR L+ A++   P+LLRDY+ 
Sbjct  121   WSPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAA---PVLLRDYL-  176

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
                         G +  + + GA                                   +G
Sbjct  177   ----------FHGDARRDIAHGA---------------------------------GQEG  193

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             YI+RMK + KK DRF+EHVLDEH+  R  +GD F A+D+VD+LLQLADDP+LEV+L R  
Sbjct  194   YIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLADDPNLEVQLRRDN  253

Query  1125  VKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLP  1304
             VKA  QDL+AGGT+ S + VEWAISELL+KPEI  KAT+ELDRV+G+ R V E DM +LP
Sbjct  254   VKALTQDLIAGGTDTSAITVEWAISELLRKPEILAKATEELDRVVGRGRLVTETDMTSLP  313

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNE  1484
             Y++AIVKE MR+HPVAP+L P + RED  V GYDIP GTRVLV+VWT+ARDPALWD+P E
Sbjct  314   YVEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEE  373

Query  1485  FIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
             F+P+RFIG  IDVKG DF+LLPFG+GRR+CPG+SLGLKVIQ SL +LLHGF W+LP+ V+
Sbjct  374   FMPERFIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKVIQLSLASLLHGFEWRLPDGVS  433

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
               +L+MEE+FGLSTP+K PL  V++P+LP HLY+
Sbjct  434   AGELSMEEVFGLSTPRKVPLEVVVKPKLPAHLYT  467



>ref|XP_004956935.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=518

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 368/491 (75%), Gaps = 8/491 (2%)
 Frame = +3

Query  309   RWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEM  488
             R RR  +LPPGPKPWP+IGN+NL+G LPH SIH+LS +YGP+MQL+FGS PVV+ +SAEM
Sbjct  27    RRRRAYNLPPGPKPWPIIGNMNLMGELPHSSIHELSKRYGPLMQLRFGSLPVVIAASAEM  86

Query  489   AKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESY  668
             AK  LK  D  F DRP+ A GKY  Y+ SDI WSPYGPY RQ RR+C  ELFS KRL+S+
Sbjct  87    AKHILKINDAAFSDRPRFAVGKYIAYDCSDILWSPYGPYLRQTRRICAAELFSTKRLQSF  146

Query  669   EYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE---SEGA--  833
             ++IR +E++ +LR L  AS   + + LRD +  L+L VIS +VLG+ Y+ E    EGA  
Sbjct  147   DHIRDEEVRVMLRDLRRASG--RTVRLRDTLQMLTLGVISRVVLGRKYVEEEAAGEGASP  204

Query  834   -IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDE  1010
              +++P  +R+M+DE F+L+G  NIGD IPW+D+LDLQGY++RMK LS  FDRFLEHVLD 
Sbjct  205   PVITPAGYREMVDEFFVLHGAFNIGDFIPWLDWLDLQGYVRRMKKLSAMFDRFLEHVLDV  264

Query  1011  HNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEW  1190
             HN RR  EG+ F AKDMVD+L  LADDP+LEV+L R  VKA  QDL+ G T+ S   +EW
Sbjct  265   HNERRRLEGERFAAKDMVDVLQDLADDPNLEVQLSRDNVKAITQDLIIGATDTSANTMEW  324

Query  1191  AISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPR  1370
             A+SELLK P+I  KATDEL+ VIG  R   EKD+P+LPYI AI+KE MR+HP APML P 
Sbjct  325   ALSELLKNPKILAKATDELNNVIGPDRLATEKDLPHLPYIDAILKETMRVHPAAPMLAPH  384

Query  1371  LCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLP  1550
             L RED +V GYDI  GT V ++VW++ RDPALWD P EF P+RF+ + ID++G DFELLP
Sbjct  385   LAREDTRVDGYDILAGTAVFINVWSIGRDPALWDAPEEFRPERFLERKIDMRGQDFELLP  444

Query  1551  FGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTT  1730
             FG+GRRMCPGYSL +KV+   L NLLHGF W+LP  +T E L+MEE F L+ P+KFPL  
Sbjct  445   FGSGRRMCPGYSLAMKVMALGLANLLHGFVWRLPEGMTVEDLSMEETFFLAMPRKFPLEA  504

Query  1731  VIEPRLPMHLY  1763
              +EPRLP HLY
Sbjct  505   TVEPRLPAHLY  515



>gb|KCW71322.1| hypothetical protein EUGRSUZ_F04404 [Eucalyptus grandis]
Length=502

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/514 (61%), Positives = 395/514 (77%), Gaps = 13/514 (3%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             M++P+  W     A ++  + LLL+ HLR RRKL LPPGPKPWP+IGNLNLI  L HRS+
Sbjct  1     MDAPS--WAVCGIACLAVASFLLLSSHLR-RRKLKLPPGPKPWPIIGNLNLISPLLHRSL  57

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H+LS  YGPIM+LQ GS  VVV SSA+MAK  LKT D  F  RPK+AAGKYT YNYS +T
Sbjct  58    HELSRIYGPIMKLQLGSGSVVVCSSADMAKAILKTHDAVFAYRPKSAAGKYTAYNYSGMT  117

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
             WSPYGPY+++ R++ L +LFSA RL+S EYIR +E++ + R L+ A    + I L+D++S
Sbjct  118   WSPYGPYFQEIRKIFLAQLFSAARLQSSEYIRVEEMRVLTRNLFDAKG--QSINLKDHLS  175

Query  765   TLSLNVISWMVLGKSYLNESEGA-IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
              L+LN+I  MVLGK Y ++SE + IVS   FRKM+DELFLL GVLN+GD +P +DFLDLQ
Sbjct  176   DLNLNMICRMVLGKKYSDKSENSNIVSAEGFRKMVDELFLLIGVLNLGDFLPLLDFLDLQ  235

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
                 RMKA++KKFDRFLE VL EH AR+V   + + AKDMVD+LLQ  +DP+L VK+ERH
Sbjct  236   ----RMKAVNKKFDRFLEDVLGEHEARKV---EGYEAKDMVDVLLQHVNDPNLGVKIERH  288

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
              VKA IQ+L+AGGTE S   VEWA+ ELLK P IF KAT ELD +IG++RWV+E  + NL
Sbjct  289   VVKALIQELIAGGTEGSAASVEWAMCELLKNPHIFNKATQELDNIIGRERWVQEAGVMNL  348

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PY+ A++KE+MRLHPV   +      +DC+VAGYDIPKGTRVLVS W++ RDP LWD+P 
Sbjct  349   PYLNAVIKEIMRLHPVGAFIAHHFASQDCEVAGYDIPKGTRVLVSKWSIGRDPELWDDPE  408

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDV  1661
              F P+RFIGK IDVKG DFELLPFG+GRRMCPGY+LGL++IQ +L NL+HGF+WKLP ++
Sbjct  409   NFRPERFIGKAIDVKGQDFELLPFGSGRRMCPGYNLGLRMIQTTLANLIHGFSWKLPENM  468

Query  1662  TPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             T E+LNMEE+ GLSTPKK P   V EPRLP+HLY
Sbjct  469   TREELNMEEVPGLSTPKKIPFIAVAEPRLPLHLY  502



>ref|XP_007202994.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
 gb|EMJ04193.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
Length=509

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 379/482 (79%), Gaps = 8/482 (2%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             LPPGPKPWP+IGNLNL+G LPH+S+H LS  YGPIMQL+FGS+PVVV SS EM K FLKT
Sbjct  32    LPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPIMQLKFGSYPVVVASSPEMTKQFLKT  91

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D  F  RP+TAAGKY TY+Y ++TW+PYGPYWRQ R++ L ELFS KRLES+ YIR +E
Sbjct  92    HDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLMELFSPKRLESFRYIRVEE  151

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNEFRKM  863
              ++   +LY  S   K ++L++++S LSL+++S +VLGK Y  L + E +I+S  EF+ M
Sbjct  152   NRAFASRLYALSG--KAVVLKEHLSRLSLSIMSRIVLGKEYFSLTDFESSIMSLKEFQDM  209

Query  864   LDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG-D  1040
             LDELFLLNGV NIGD IPW+DFLDLQGY+KRMK + KK D F E VL EH AR+  EG  
Sbjct  210   LDELFLLNGVFNIGDWIPWLDFLDLQGYVKRMKVVKKKMDWFYEFVLHEHKARK--EGVK  267

Query  1041  SFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
              FVAKDMVDLLLQL DDP+ LEVKL    +KAF QD++AGGT+ S  ++EWA+SEL+K+P
Sbjct  268   EFVAKDMVDLLLQLVDDPNDLEVKLTYDSIKAFTQDVIAGGTDTSASVLEWAMSELIKQP  327

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
              + +KAT+ELDRVIG++RWVEEKD+ NLPY+ AI+KE MR HP   ML P L  EDC VA
Sbjct  328   NLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALEDCNVA  387

Query  1398  GYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCP  1577
             GYD+ KGT V V++W++ RDP LWD P+EF P+RF+GK IDVKG  FELLPFG+GRRMCP
Sbjct  388   GYDVRKGTLVFVNIWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGRRMCP  447

Query  1578  GYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMH  1757
             GYSLGLK+I + L N+LHGFNWKLP +V  E L MEE++GL TP+KFPL  V EPRLP+H
Sbjct  448   GYSLGLKMIGSCLANMLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVVVTEPRLPIH  507

Query  1758  LY  1763
             LY
Sbjct  508   LY  509



>gb|EAY85957.1| hypothetical protein OsI_07321 [Oryza sativa Indica Group]
Length=537

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/512 (59%), Positives = 384/512 (75%), Gaps = 20/512 (4%)
 Frame = +3

Query  285   LLLLAKHLR----WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFG  452
             LL +A  LR     RRK ++PPGP+PWPVIGNLNLIG+LPHRSI DLS +YGP+M L+FG
Sbjct  25    LLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPHRSIRDLSQRYGPLMSLRFG  84

Query  453   SFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCL  632
             SFPVVVGSS +MA+ FL+  D+ F+DRP+TAAG+YT YNY+ + WS YG YWRQARR+ +
Sbjct  85    SFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYWRQARRLWV  144

Query  633   TELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY  812
             TEL SA+RL S E++R++E++++LR L   + A   ++L+++M  ++LNVIS MV GK Y
Sbjct  145   TELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVISRMVFGKKY  204

Query  813   LNESEGAIVSPN---EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFD  983
             + E EG   SP    EFR M++E+F LNGV NIGD +PW+ +LD QGYI RMK L   FD
Sbjct  205   IVE-EGEGSSPTTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMKRLGGMFD  263

Query  984   RFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGT  1163
             RFLEH+LDEH  RR  EGD F A+DMVDLLLQ ADDPSL+V ++R GVKAFI +L+ G T
Sbjct  264   RFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFILELITGST  323

Query  1164  ENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLH  1343
             + ++V VEWA+SE+L+ P +  +ATDELDRV+G++R V E D+PNLPY+ A+VKE MRLH
Sbjct  324   DTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYLDAVVKESMRLH  383

Query  1344  PVAPMLVPRLCREDC---KVAG----YDIPKGTRVLVSVWTVARDPALW-DNPNEFIPDR  1499
             PV P+LVPR+ RED     VAG    YDIP GTRVLV+VW + RDPA+W D+  EF P+R
Sbjct  384   PVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVWGDDAEEFRPER  443

Query  1500  FIG----KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTP  1667
             F        +DVKG DFELLPFG+GRRMCPG+ LGLK++Q +L NLLHGF W+LP     
Sbjct  444   FAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHGFAWRLPGGAAA  503

Query  1668  EKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             E+L+MEE FG+S  +   L  + EP+LP HLY
Sbjct  504   EELSMEEKFGISVSRLVQLKAIPEPKLPAHLY  535



>gb|EMT17908.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=429

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 354/431 (82%), Gaps = 10/431 (2%)
 Frame = +3

Query  486   MAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLES  665
             MAK FLKT D+ F DRPKTAAGKYTTYNYSDITWSPYG YWRQA +MCLTELFSAKRL+S
Sbjct  1     MAKFFLKTHDVVFTDRPKTAAGKYTTYNYSDITWSPYGAYWRQAGKMCLTELFSAKRLQS  60

Query  666   YEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES----EGA  833
             YEYIRS+E+ +++R L+  +S  + ++L+DY+ST SLNVI+ MVLGK YL +     +GA
Sbjct  61    YEYIRSEEVAALVRGLFGGAS--RVLVLKDYLSTASLNVITRMVLGKKYLEKEVRNVDGA  118

Query  834   IVS-PNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDE  1010
             +++ P EF+ MLDELF LNGV NIGDSIPW++++DLQGY+KRMK LSK FD+FLEHV+DE
Sbjct  119   VITTPEEFKWMLDELFFLNGVFNIGDSIPWLNWMDLQGYVKRMKKLSKMFDQFLEHVVDE  178

Query  1011  HNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEW  1190
             H+ RR  EG SF +KDMVDLLLQ A DP LEVKL R  VKAF QDL+AGGTE+S V VEW
Sbjct  179   HSERRRREGQSFESKDMVDLLLQYASDPGLEVKLNRDSVKAFTQDLIAGGTESSAVTVEW  238

Query  1191  AISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPR  1370
             AISELLKKP++F KAT+ELDRV+G+ RWV E+DM +LPY++AI KE MRLHPVAPMLVPR
Sbjct  239   AISELLKKPKLFTKATEELDRVVGRGRWVTEEDMRSLPYVEAITKETMRLHPVAPMLVPR  298

Query  1371  LCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLP  1550
             L RED  + GYDIP GT VLV+VW++ RDP LW+ P EF P+RF+   +DVKG D+ELLP
Sbjct  299   LSREDTSIDGYDIPSGTLVLVNVWSIGRDPELWEAPEEFTPERFLDSRLDVKGQDYELLP  358

Query  1551  FGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTT  1730
             FG+GRRMCPGY+LGLKVIQ SL NLLHGF W LP+D+   +L+MEEIFG STP+KFPL  
Sbjct  359   FGSGRRMCPGYNLGLKVIQLSLANLLHGFVWSLPDDM---ELSMEEIFGFSTPRKFPLEI  415

Query  1731  VIEPRLPMHLY  1763
             V+E +L  HLY
Sbjct  416   VVETKLQAHLY  426



>dbj|BAD23209.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD22905.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=537

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/512 (58%), Positives = 384/512 (75%), Gaps = 20/512 (4%)
 Frame = +3

Query  285   LLLLAKHLR----WRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFG  452
             LL +A  LR     RRK ++PPGP+PWPVIGNLNLIG+LP+RSI DLS +YGP+M L+FG
Sbjct  25    LLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDLSRRYGPLMSLRFG  84

Query  453   SFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCL  632
             SFPVVVGSS +MA+ FL+  D+ F+DRP+TAAG+YT YNY+ + WS YG YWRQARR+ +
Sbjct  85    SFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYWRQARRLWV  144

Query  633   TELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY  812
             TEL SA+RL S E++R++E++++LR L   + A   ++L+++M  ++LNVIS MV GK Y
Sbjct  145   TELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVISRMVFGKKY  204

Query  813   LNESEGAIVSPN---EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFD  983
             + E EG   SP    EFR M++E+F LNGV NIGD +PW+ +LD QGYI RMK L   FD
Sbjct  205   IVE-EGEGSSPTTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMKRLGGMFD  263

Query  984   RFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGT  1163
             RFLEH+LDEH  RR  EGD F A+DMVDLLLQ ADDPSL+V ++R GVKAFI +L+ G T
Sbjct  264   RFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFILELITGST  323

Query  1164  ENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLH  1343
             + ++V VEWA+SE+L+ P +  +ATDELDRV+G++R V E D+PNLPY+ A+VKE MRLH
Sbjct  324   DTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYLDAVVKESMRLH  383

Query  1344  PVAPMLVPRLCREDC---KVAG----YDIPKGTRVLVSVWTVARDPALW-DNPNEFIPDR  1499
             PV P+LVPR+ RED     VAG    YDIP GTRVLV+VW + RDPA+W D+  EF P+R
Sbjct  384   PVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVWGDDAEEFRPER  443

Query  1500  FIG----KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTP  1667
             F        +DVKG DFELLPFG+GRRMCPG+ LGLK++Q +L NLLHGF W+LP     
Sbjct  444   FAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHGFAWRLPGGAAA  503

Query  1668  EKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             E+L+MEE FG+S  +   L  + EP+LP HLY
Sbjct  504   EELSMEEKFGISVSRLVQLKAIPEPKLPAHLY  535



>ref|XP_009407098.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=539

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/453 (65%), Positives = 360/453 (79%), Gaps = 8/453 (2%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQL  443
             A V    LL      R RRKL+LPPGP+PWPVIGNLNLIG LP+RS+  L+ K+GP+M L
Sbjct  11    AIVLVFTLLTALAGGRRRRKLNLPPGPRPWPVIGNLNLIGRLPYRSLAALAQKHGPLMHL  70

Query  444   QFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARR  623
             +FGSFPVVVGSS +MAK FLKT D++FV R KTAAGKYT YNYSDI WSPYGPYWRQARR
Sbjct  71    RFGSFPVVVGSSVDMAKFFLKTHDLSFVSRRKTAAGKYTFYNYSDIGWSPYGPYWRQARR  130

Query  624   MCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLG  803
             +C+ ELF+ KRL+SY+YIR +E++ +L+ L+   SA+ P+LL+D++ T++LN++S MVLG
Sbjct  131   ICIMELFTTKRLDSYQYIRVEEVRCLLQDLF--RSAETPVLLKDHLFTINLNIMSRMVLG  188

Query  804   KSYLNESE------GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKA  965
             + Y  E         AIV   EF++M++EL LLNGV+N+GD IPW++FLDLQGY+KRMK 
Sbjct  189   RKYTQEQSLSSVAPTAIVPQEEFKEMVEELLLLNGVINVGDLIPWLNFLDLQGYVKRMKM  248

Query  966   LSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQD  1145
             L K+FDRFLEHVLDEHN RR  EG +FV +DM D+LL+LADD  LEVKLERH +KAFI D
Sbjct  249   LGKRFDRFLEHVLDEHNERRRREGKAFVPRDMADVLLELADDDGLEVKLERHCLKAFILD  308

Query  1146  LLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVK  1325
             +   GT+ ST+ +EWAISE+LK+PE F KAT+ELDRVIG+ RWVEE+D+  LPYI+AIVK
Sbjct  309   MFVAGTDTSTITIEWAISEILKRPETFDKATEELDRVIGRGRWVEEEDVHRLPYIEAIVK  368

Query  1326  EVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFI  1505
             E MR+HPVAP+L+PR  RE   V GYDIP  T VLV+VW + RDPA+WD P EF P+RF+
Sbjct  369   ETMRMHPVAPLLIPRFSREHTTVDGYDIPARTGVLVNVWAIGRDPAVWDAPEEFRPERFV  428

Query  1506  GKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVI  1604
             G  IDVKG  FELLPFGAGRRMCPGYSLGLK+I
Sbjct  429   GSPIDVKGHHFELLPFGAGRRMCPGYSLGLKLI  461



>ref|XP_011095827.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/488 (60%), Positives = 371/488 (76%), Gaps = 5/488 (1%)
 Frame = +3

Query  306   LRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAE  485
             LR   K + PPGPKPWPVIGNLNL+GS+PH+S+H LS KYG IMQL+FG FPVVV SS E
Sbjct  29    LRPHPKRNFPPGPKPWPVIGNLNLVGSIPHQSLHFLSQKYGDIMQLKFGKFPVVVASSPE  88

Query  486   MAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLES  665
             MAK FL+  D  F  RP  AAGKYT+YNYSD+TW+PYGP+WRQAR++ L+E+FSAK+LES
Sbjct  89    MAKQFLRVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLES  148

Query  666   YEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG--AIV  839
              E+IR +E  + L +LY+ S   KP++LR+++S  +L+ IS MVL   Y +ESE   ++V
Sbjct  149   LEHIRIEERHNFLARLYSLSG--KPVVLREHLSRYTLSNISRMVLSSKYFSESEHDKSVV  206

Query  840   SPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNA  1019
               +E ++MLDE FLLNGV NIGD IPW+ FLDLQGY+KRMKAL KKFDRF  +V+D+H  
Sbjct  207   KLDELQEMLDEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALYKKFDRFHNYVIDDHQT  266

Query  1020  RRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAIS  1199
             R   E DS    D+VD LLQLA+DP+LEVKL R GVK  +QDLLAGGT+ S   +EWAI 
Sbjct  267   RMATEKDS-APGDVVDALLQLAEDPNLEVKLTRDGVKGLLQDLLAGGTDTSATTIEWAIH  325

Query  1200  ELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCR  1379
             ELLK P + +KA +EL+RVIG+ RWVEE D PNLPYI AI+ E MRLHP+A  L P    
Sbjct  326   ELLKHPHVIEKAKEELNRVIGRNRWVEENDFPNLPYIDAIIMESMRLHPLATFLAPHYAM  385

Query  1380  EDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGA  1559
             EDCKVAGYDI KGT +L++ W++ RDP  WD PNEF+P+RF+GK+ID+ G +F LLPFG+
Sbjct  386   EDCKVAGYDISKGTTILINTWSIGRDPNSWDAPNEFLPERFVGKEIDLTGSNFALLPFGS  445

Query  1560  GRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             GRR CPGY+LGLK+++  L NLLHGF+ KL + + PE + M+E++GL+T  K PL  ++E
Sbjct  446   GRRRCPGYNLGLKIVRTILANLLHGFDLKLVDGMRPEDICMKELYGLTTHPKKPLAIIME  505

Query  1740  PRLPMHLY  1763
             P LP + Y
Sbjct  506   PILPKNFY  513



>ref|XP_004288987.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 376/502 (75%), Gaps = 7/502 (1%)
 Frame = +3

Query  270   VSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQF  449
             ++T+ALL        +  L  PPGPKPW +IGNLNLIG +PH+S+H LS  YGPIM L+F
Sbjct  15    LATLALLFNLVLFPRKEVLKSPPGPKPWLIIGNLNLIGPIPHQSLHKLSQTYGPIMHLKF  74

Query  450   GSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMC  629
             GS PVV+ SSAEMAK FLK  D  F  RP+TAAGKY TYNY D+TW+PYG YW Q R++ 
Sbjct  75    GSHPVVIASSAEMAKQFLKHHDHVFASRPQTAAGKYLTYNYLDVTWAPYGDYWSQGRKIF  134

Query  630   LTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKS  809
             +TELFS+KRLES+EYIR +E+++ L +L   S   KP++L++ +S L+L  +S +VLGK 
Sbjct  135   ITELFSSKRLESFEYIRVEEIRAFLSRLCALSG--KPVILKEQISRLTLTTVSRIVLGKD  192

Query  810   YLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFD  983
             Y +++  + ++V+   F+ MLDEL  L+GVLNIGD IPW+ FLDLQGY K+M  L +K D
Sbjct  193   YFSQTDIQTSVVTLKGFQDMLDELVSLSGVLNIGDWIPWLKFLDLQGYEKKMMDLKRKLD  252

Query  984   RFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGT  1163
              F +++L EH A+ +   ++FV KDMVDLLL+L D+P LEVKL   GVK F QDL+AGGT
Sbjct  253   SFHDYILAEHKAK-MKGVENFVPKDMVDLLLKLVDNPDLEVKLTLDGVKGFTQDLIAGGT  311

Query  1164  ENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLH  1343
             + S   +EWA+SEL+K+P + + AT+ELDRVIG++RWVEEKD+ NLPYI AI+KE MR H
Sbjct  312   DTSATNLEWAMSELIKQPHLIRNATEELDRVIGRERWVEEKDLENLPYIDAIMKETMRKH  371

Query  1344  PVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFI--GKDI  1517
             PV  ML P L  EDC V GY I KGTRV V+ W++ RDP LWD P EF PDRF+   K I
Sbjct  372   PVVSMLAPHLALEDCNVKGYHISKGTRVFVNTWSIGRDPLLWDAPEEFNPDRFLLRNKGI  431

Query  1518  DVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFG  1697
             DVKG  FELLPFG+GRRMCPGY LGLK+I+ SL N+LHGFNWKLP  +  E L+MEE+ G
Sbjct  432   DVKGQSFELLPFGSGRRMCPGYGLGLKMIRCSLANMLHGFNWKLPQSMKLEDLSMEEVSG  491

Query  1698  LSTPKKFPLTTVIEPRLPMHLY  1763
             LSTP+KFPL  V+EPRLP+HLY
Sbjct  492   LSTPRKFPLVAVVEPRLPIHLY  513



>ref|XP_004288988.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/513 (59%), Positives = 382/513 (74%), Gaps = 11/513 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHLRWRR----KLHLPPGPKPWPVIGNLNLI-GSLPHRSIHDL  413
             +S A   +S + LL L     + +    KL  PPGPKPWP+IGNLNLI G LPHRS+H L
Sbjct  5     VSSAVLTLSWLFLLALVSKFFFSQLQKLKLKFPPGPKPWPIIGNLNLINGPLPHRSLHKL  64

Query  414   SVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSP  593
             S  YGP+MQL+FGS+PVVV SSAEMAK FLKT+D  F  RP+TAAGKY TYNY +IT SP
Sbjct  65    SQTYGPLMQLKFGSYPVVVASSAEMAKQFLKTLDHVFASRPRTAAGKYITYNYLNITSSP  124

Query  594   YGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLS  773
             +GPYWRQ R++ L+ELFS+KRLES+ YIR +E ++ + +LY  S    P++L++ +S L+
Sbjct  125   HGPYWRQGRKIFLSELFSSKRLESFAYIRVEETRAFISRLYALSG--NPVMLKEQLSRLT  182

Query  774   LNVISWMVLGKSYLNESE--GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             L++++  V+GK Y  E E   +++   EF+ MLDELFLL+GV NIGD IPW++ LDLQGY
Sbjct  183   LSIMTRSVMGKEYFREPEFQRSVMKLEEFQDMLDELFLLHGVFNIGDWIPWLEVLDLQGY  242

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             +KRMK L KK + F ++VLDEH A      D +VAKDMVD LLQL DDP LEVKL    V
Sbjct  243   VKRMKDLKKKSEPFYDYVLDEHKAASQGRKD-YVAKDMVDSLLQLVDDPDLEVKLTVDSV  301

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAFIQDL+AGGT+ S   +EWA+SEL+K+P +  +AT+ELDRVIG+ RWVEE D+P LPY
Sbjct  302   KAFIQDLIAGGTDTSATTLEWAMSELIKQPNLIVRATEELDRVIGRDRWVEEDDIPQLPY  361

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI+KE MR HPV  +L P L  EDCKV G+DI +GTRV ++ W++ RD ++W+ P EF
Sbjct  362   IDAIMKETMRKHPVVVLLPPHLALEDCKVGGFDIRRGTRVFINTWSIGRDSSVWEAPEEF  421

Query  1488  IPDRFIG-KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
              P+RF+G K IDVKG  FELLPFG+GRRMCPGYSLGLKVI + L N+LHGFNWKLP ++ 
Sbjct  422   NPERFLGNKAIDVKGQSFELLPFGSGRRMCPGYSLGLKVIGSCLANMLHGFNWKLPENMK  481

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              E L M+E  GL T +KF L  V+EPRLP+HLY
Sbjct  482   IEDLGMDEACGLVTHRKFSLVAVMEPRLPIHLY  514



>ref|XP_004984304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=523

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/511 (59%), Positives = 385/511 (75%), Gaps = 9/511 (2%)
 Frame = +3

Query  264   AWVSTIALLLLA--KHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIM  437
             A V   AL L+A  +  R  RK +LPPGP+PWPVIGNLNLIG LPH SIHDLS +YGP+M
Sbjct  12    AVVLAAALFLVAILRQRRPTRKYNLPPGPRPWPVIGNLNLIGPLPHHSIHDLSARYGPLM  71

Query  438   QLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQA  617
              L+FGS PVVVGSS E A+ FLKT D+ F+DRP+TAAGK+TTYNYS + WSP+G YWRQ 
Sbjct  72    SLRFGSSPVVVGSSVETARFFLKTHDLAFIDRPRTAAGKHTTYNYSGLFWSPHGAYWRQG  131

Query  618   RRMCLTELFSAKRLESYEYIRSQELKSILRQL------YTASSAQKPILLRDYMSTLSLN  779
             RR+   ELF+A+RL S E++R +E++S+L  L        A      + LR+++  ++LN
Sbjct  132   RRLWQAELFNARRLASLEHVRGEEVRSMLNDLRASAAAAAAGGQHAAVALREHLYMVNLN  191

Query  780   VISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRM  959
             VIS MVLG+ Y+ +  G+ V+P EFR+M+DE F LNG LN+GD IPW+ +LD QGY++RM
Sbjct  192   VISRMVLGRKYVVDGAGSPVTPEEFRRMIDEHFSLNGALNVGDMIPWLSWLDPQGYVRRM  251

Query  960   KALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFI  1139
             K  +K FDRFLE+VLDEHN RR  EG  F+A DMVD+LL+LADDP+LEV + R GVK F 
Sbjct  252   KRSAKMFDRFLEYVLDEHNERRRREGKEFIATDMVDVLLELADDPNLEVPIGRDGVKGFT  311

Query  1140  QDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAI  1319
              DL+ GGT+ S+V VEWA+SE+L+ PE+  KA++EL+RVIG+ R V E+D+PNLPY++AI
Sbjct  312   LDLIGGGTDTSSVTVEWAMSEILRSPEVLAKASEELERVIGRDRLVAEQDIPNLPYMEAI  371

Query  1320  VKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDR  1499
             VKE MRLHPVAP++ PRL RED  +  YDIP GTRVL++VW + RDPA+W+ P EF P+R
Sbjct  372   VKETMRLHPVAPLMSPRLSREDVSMGRYDIPAGTRVLINVWAIGRDPAVWEAPMEFRPER  431

Query  1500  FIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND-VTPEKL  1676
             F+G  +DVKG DFELLPFG+GRRMCPG  LGL+++   L NLLH F W+LP      E+L
Sbjct  432   FVGSGVDVKGQDFELLPFGSGRRMCPGIGLGLRMVHMILANLLHAFAWRLPGGAAAAEEL  491

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +MEE F L+ P++ PL  V EP+LP HLY+V
Sbjct  492   SMEETFSLTVPRRVPLEAVAEPKLPDHLYAV  522



>ref|XP_002467824.1| hypothetical protein SORBIDRAFT_01g034710 [Sorghum bicolor]
 gb|EER94822.1| hypothetical protein SORBIDRAFT_01g034710 [Sorghum bicolor]
Length=537

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/501 (57%), Positives = 373/501 (74%), Gaps = 17/501 (3%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             R K  LPPGP+PWPVIGNLNLIG LPHRSIH+LS +YGP+M L+FGSFPVVVGSS + A+
Sbjct  35    RNKYRLPPGPRPWPVIGNLNLIGRLPHRSIHELSKRYGPLMSLRFGSFPVVVGSSVDTAR  94

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FL+T D+ F+DRP+TAAGKYTTYN   + + PYG YWRQ R++C  ELF+ +RL S E+
Sbjct  95    LFLRTHDLAFIDRPQTAAGKYTTYNCGGLFYQPYGAYWRQGRKLCQAELFNERRLTSLEH  154

Query  675   IRSQELKSILRQLYTASSAQKP-------------ILLRDYMSTLSLNVISWMVLGKSYL  815
             +R +E+++++R L+ A+SA                + L++++  ++L+VIS M+LGK Y+
Sbjct  155   VRGEEVRAMVRDLHAAASAAAAGCSGGGGGGGRAVVALKEHLYMVNLHVISRMLLGKKYI  214

Query  816   NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLE  995
              +  G+  +P EFR ++DE F LNGVLN+ D IPW+  LD  GYIKRMK  +K +DRFLE
Sbjct  215   VDGSGSPATPEEFRWLIDEHFFLNGVLNVADMIPWLSCLDPHGYIKRMKRSAKMWDRFLE  274

Query  996   HVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENST  1175
             HVLDEHN RR  EG  FVA DM+D+LL+LADDP+LEV ++R  VKAFI DL+ GGT+ S 
Sbjct  275   HVLDEHNRRRRREGKDFVAMDMMDVLLELADDPNLEVPIKRDNVKAFILDLMGGGTDTSA  334

Query  1176  VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAP  1355
             V VEWA+SELL+ P++  KAT+ELDRVIGQ R V E+D+PNLPY++AIVKE +RLHPVAP
Sbjct  335   VTVEWAMSELLRNPDVLAKATEELDRVIGQDRLVAERDIPNLPYMEAIVKETLRLHPVAP  394

Query  1356  MLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFI----GKDIDV  1523
             +L PRL RED    GYDIP GTRV V+ W++ RDPA+W+ P EF P+RF+    G  +D+
Sbjct  395   LLTPRLSREDVSAGGYDIPAGTRVFVNTWSIGRDPAVWEAPMEFRPERFVVGSRGGGVDL  454

Query  1524  KGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLS  1703
             KG  FELLPFG+GRRMCPG  L L+++   L NLLH F W+LP+ V  E+L+MEE FG++
Sbjct  455   KGQHFELLPFGSGRRMCPGMGLALRMVPMILANLLHAFAWRLPDGVAAEELSMEETFGIT  514

Query  1704  TPKKFPLTTVIEPRLPMHLYS  1766
              P+  PL  + EP+LP  LY+
Sbjct  515   VPRLVPLEAIAEPKLPARLYA  535



>ref|XP_006493375.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=506

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/484 (62%), Positives = 378/484 (78%), Gaps = 4/484 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +K +LPPGPKPWP+IGNLNLIG LPH SIH LS KYGP+M L+FG   VVVGSS E+A+ 
Sbjct  26    KKPNLPPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAEL  85

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
              LKT D++F  RP+  AGKY TY+Y+ +  +PY PYWRQAR++C+ EL S KRL+ +EY+
Sbjct  86    LLKTHDLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYM  145

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFR  857
             R +E K  L  ++ + S  KP+ L+D +  L+L+ +S MVLGK Y  E E  IV+P EF 
Sbjct  146   RVEERKLFLHDMFKSCS--KPVQLKDRLYMLNLSTMSRMVLGKRYTEEDENNIVTPKEFT  203

Query  858   KMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG  1037
             +ML+ELFL++G L+IGD+IPW+  LDLQG++KRMK +++K DRF EH+LDE  AR+ +  
Sbjct  204   EMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEHILDERYARKKSGK  263

Query  1038  DSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
             D  V  DMVD+L+Q ADDP+LEVKLERH +KA IQDLL  GT+ S + VEWA+S LLK P
Sbjct  264   DQGV-NDMVDVLVQFADDPTLEVKLERHQLKAIIQDLLTAGTDTSALNVEWAMSLLLKNP  322

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
             E  +KAT+ELDRVIG+ RWV+EKD+ NLPYIQAIVKE MRLHPV P+L+PR+ REDCKVA
Sbjct  323   EAIQKATEELDRVIGRDRWVQEKDIVNLPYIQAIVKETMRLHPVVPLLIPRVAREDCKVA  382

Query  1398  GYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCP  1577
             GYDI K +RVL+++WT+ RD  +W+ PNEF PDRFIGK+IDVKG D+ELLPFG+GRRMC 
Sbjct  383   GYDILKNSRVLINIWTIGRDSTIWEKPNEFWPDRFIGKEIDVKGHDYELLPFGSGRRMCL  442

Query  1578  GYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPM  1754
             GY LGLK++Q+SL NLLHGF WKLP D+  + L+MEE FGL+T KK PL  V  +PRLP 
Sbjct  443   GYGLGLKLVQSSLANLLHGFEWKLPGDMKRQDLDMEERFGLTTCKKNPLVVVPTKPRLPH  502

Query  1755  HLYS  1766
             HLYS
Sbjct  503   HLYS  506



>ref|XP_008354562.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/513 (58%), Positives = 386/513 (75%), Gaps = 12/513 (2%)
 Frame = +3

Query  255   YAAAWVSTIALL----LLAKHLRWR-RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             ++ A + T+A L    L++K L  + +K    PGPKPWP+IGNLNLIG LPH+S+H LS 
Sbjct  4     FSCAAILTLACLATLALVSKTLFPQLKKQKFLPGPKPWPIIGNLNLIGPLPHQSLHKLSQ  63

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
              YGPIMQL+FGS PVVV SS EMAK FLKT D  F  RP+TAAGKY TY+Y ++TWSPYG
Sbjct  64    IYGPIMQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYG  123

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PYWRQ R++ L ELFS+KRLES+EYIR+ E ++   +LY  + +  PI+L++++S L+L+
Sbjct  124   PYWRQGRKIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLSRLNLS  183

Query  780   VISWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             ++S  VLGK Y +  E EG+I+S  EF+ M+DELF+LNGV NIGD +PW++FLDLQGYIK
Sbjct  184   IMSRTVLGKDYFSVAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIK  243

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGV  1127
             RMKA+ KK +RF + VL+EH A++  EG + FV KDMVDLLLQL D  + LEVKL    +
Sbjct  244   RMKAMQKKINRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSI  301

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAF QDL+AGGT+ S   +EWA+SEL+K+P + KKAT+ELDRVIG++RWVEEKD+  LPY
Sbjct  302   KAFTQDLIAGGTDTSATNLEWAMSELIKQPXLIKKATEELDRVIGRERWVEEKDLXQLPY  361

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI+KE MR HP   +L P L  E+  VAGYD+ KGT V V+ W++ RD  LW+ P  F
Sbjct  362   IDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTXVFVNTWSMGRDXKLWEEPEXF  421

Query  1488  IPDRFIGK-DIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
              P+RF+G   ID++G  FELLPFG+GRRMCPGY LGL +I+  L N+LHGFNWKLP +V 
Sbjct  422   RPERFLGNXGIDLQGQSFELLPFGSGRRMCPGYKLGLXMIRTCLANMLHGFNWKLPGNVK  481

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              E L MEE +G+ T +KFPL  V++PRLP+HLY
Sbjct  482   VEDLGMEEAYGMXTTRKFPLVAVMDPRLPVHLY  514



>ref|XP_006427648.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
 gb|ESR40888.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
Length=506

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/484 (61%), Positives = 378/484 (78%), Gaps = 4/484 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +K +LPPGPKPWP+IGNLNLIG LPH SIH LS KYGP+M L+FG   VVVGSS E+A+ 
Sbjct  26    KKPNLPPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAEL  85

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
              LKT D++F  RP+  AGKY TY+Y+ +  +PY PYWRQAR++C+ EL S KRL+ +EY+
Sbjct  86    LLKTHDLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYM  145

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFR  857
             R +E K  L  ++ + S  KP+ L+D +  L+L+ +S MVLGK Y  E E  IV+P EF 
Sbjct  146   RVEERKLFLHDMFKSCS--KPVQLKDRLYMLNLSTMSRMVLGKRYTEEDENNIVTPKEFT  203

Query  858   KMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG  1037
             +ML+ELFL++G L+IGD+IPW+  LDLQG++KRMK +++K DRF E +LDE  AR+ +  
Sbjct  204   EMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEQILDERYARKKSGK  263

Query  1038  DSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKP  1217
             D  V  DMVD+L+Q ADDP+LEVK+ERH +KA IQDLL  GT+ S + VEWA+S LLK P
Sbjct  264   DQGV-NDMVDVLVQFADDPTLEVKIERHQLKAIIQDLLTAGTDTSALNVEWAMSLLLKNP  322

Query  1218  EIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVA  1397
             E  +KAT+ELDRVIG+ RWV+EKD+ NLPYIQAIVKE MRLHPV P+L+PR+ REDCKVA
Sbjct  323   EAIQKATEELDRVIGRDRWVQEKDIVNLPYIQAIVKETMRLHPVVPLLIPRVAREDCKVA  382

Query  1398  GYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCP  1577
             GYD+ K +RVL+++WT+ RDP +W+ PNEF PDRFIGK+IDVKG D+ELLPFG+GRRMC 
Sbjct  383   GYDLLKNSRVLINIWTIGRDPTIWEKPNEFWPDRFIGKEIDVKGHDYELLPFGSGRRMCL  442

Query  1578  GYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPM  1754
             GY LGLK++Q+SL NLLHGF WKLP D+  + L+MEE FGL+T KK PL  V  +PRLP 
Sbjct  443   GYGLGLKLVQSSLANLLHGFEWKLPGDMKRQDLDMEERFGLTTCKKNPLVVVPTKPRLPH  502

Query  1755  HLYS  1766
             HLYS
Sbjct  503   HLYS  506



>ref|XP_009413943.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/460 (63%), Positives = 363/460 (79%), Gaps = 11/460 (2%)
 Frame = +3

Query  249   ISYAAAWVSTIALLLLAKHL---RWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             I  +A +++ + +  L   L   R R+KL+LPPGP+PWPVIGNLNLIG LP+RS+  LS 
Sbjct  3     IPSSAIYLALVLVFTLLTGLYGGRRRQKLNLPPGPRPWPVIGNLNLIGPLPYRSLAALSQ  62

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             K+GP+M L+FGSFPVVVGSS +MAK FLKT D++FV RPK+ AG+YT YNYS I WSPYG
Sbjct  63    KHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKSVAGEYTFYNYSSIGWSPYG  122

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PYWRQARR+ + EL + KRL+SY+YIR +E++ +LR L+ ++    P+LL+D++ T+ LN
Sbjct  123   PYWRQARRILIMELLTPKRLDSYQYIRVEEVRGLLRDLFRSTGT--PVLLKDHIFTVILN  180

Query  780   VISWMVLGKSYLNESE------GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             +IS +VLG+ Y  E         AIV   EF++M++EL LLNGV+N+GD IPW++FLDLQ
Sbjct  181   IISRIVLGRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLNFLDLQ  240

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GY+KRMK + K+FDRFLE VLD+HN RR  EG +FV +D+VD+LL+LADD  LEVKLERH
Sbjct  241   GYVKRMKMVGKRFDRFLERVLDKHNERRRREGKAFVPRDLVDVLLELADDHGLEVKLERH  300

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
              VKAFI D+ AGGT+  TV +EWA+SE+LK+PE F KAT+ELDRVIG+ RWVEE+D+  L
Sbjct  301   CVKAFILDIFAGGTDTYTVTIEWAVSEILKRPETFDKATEELDRVIGRGRWVEEEDVHRL  360

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPN  1481
             PYI+AIVKE MR+HPVAP+LVPRL RE   V GYDIP GTRVLV+VW + RDPA+WD P 
Sbjct  361   PYIEAIVKETMRIHPVAPLLVPRLSREHTTVDGYDIPAGTRVLVNVWAIGRDPAVWDAPE  420

Query  1482  EFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKV  1601
             EF P+RF+G  IDVKG  FELLPFGAGRRMCPG SLGLK+
Sbjct  421   EFRPERFVGSPIDVKGHHFELLPFGAGRRMCPGNSLGLKM  460



>ref|XP_010090165.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB38962.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=449

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/449 (65%), Positives = 362/449 (81%), Gaps = 9/449 (2%)
 Frame = +3

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             MQL+FGSFPVVV SSA+MAK FLKT D  F  RP+ AAGKYTTYNYS+ITW+PYGPYWRQ
Sbjct  1     MQLKFGSFPVVVASSADMAKLFLKTYDHIFASRPQLAAGKYTTYNYSNITWAPYGPYWRQ  60

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
              R++ L ELFS+KRLESYEYIR +E+++ + +L++ S   KP++L++++S ++L+VIS +
Sbjct  61    GRKIYLAELFSSKRLESYEYIRVEEMRAFMSRLFSLSG--KPVVLKEHLSRVTLSVISRI  118

Query  795   VLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
             VLGK Y +ES  E +IV+  EF++MLDELFLLNGV NIGD IPW+ FLDLQGY +RMKAL
Sbjct  119   VLGKKYFSESKSERSIVTLEEFQEMLDELFLLNGVFNIGDWIPWLRFLDLQGYERRMKAL  178

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
              K+FDRF +HVLDEH A+R A  D FVAKDMVDLLL+L D+P LEVKL    VK F+QDL
Sbjct  179   KKRFDRFHDHVLDEHKAKRKAVKD-FVAKDMVDLLLELGDNPDLEVKLTCDSVKGFLQDL  237

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
             +AGGT+ S   VEWA+SELLK+P++  KAT+ELDRVIG+ RWV EKD+P LPYI AI+KE
Sbjct  238   IAGGTDTSATTVEWAMSELLKQPKLIDKATEELDRVIGKNRWVSEKDIPQLPYINAIMKE  297

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFI-  1505
              MR HPVA +L P L  EDC+V+GYDI KGT V ++ W++  D ++WD P EF P+RF+ 
Sbjct  298   TMRKHPVAVLLAPHLALEDCQVSGYDIRKGTLVFINTWSIGSDQSVWDAPKEFRPERFLG  357

Query  1506  --GKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKL-PNDVTPEKL  1676
               GKDIDVKG  F+LLPFG+GRRMCPGYSLGLK+I ASL NLLHGFNWKL   + TPE L
Sbjct  358   KAGKDIDVKGQCFKLLPFGSGRRMCPGYSLGLKMISASLANLLHGFNWKLGGTNQTPEDL  417

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +MEE++GL+T +KFPL  V+EPRLP+HLY
Sbjct  418   DMEELYGLATIRKFPLVAVMEPRLPVHLY  446



>ref|XP_009388239.1| PREDICTED: flavonoid 3'-monooxygenase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 350/435 (80%), Gaps = 8/435 (2%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             R KL+LPPGP+PWPVIGNLNLIG LP+RS+  +S K+GP+M L+FGSFPVVVGSS +MAK
Sbjct  28    RHKLNLPPGPRPWPVIGNLNLIGPLPYRSLAAISQKHGPLMHLRFGSFPVVVGSSVDMAK  87

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FLKT D++FV RPKT AGKYT  NYS+I WSPYGPYWRQARR+ + ELF+ KRL+SY+Y
Sbjct  88    FFLKTHDLSFVSRPKTVAGKYTANNYSNINWSPYGPYWRQARRIFIMELFTPKRLDSYQY  147

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE------GAI  836
             IR +E++ +LR L+   S + PI+L+D + T++LN+IS +VLG+ Y  E         AI
Sbjct  148   IRVEEVRGLLRDLF--RSTETPIVLKDRIFTVNLNIISRIVLGRKYTQEQSVSSGAPAAI  205

Query  837   VSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHN  1016
             V   EF++M+ EL LLNGV+N+GD IPW++FLDLQGY+KRMK + K+FDRFLEHVLDEHN
Sbjct  206   VPQEEFKEMMGELMLLNGVINVGDLIPWLNFLDLQGYVKRMKMVGKRFDRFLEHVLDEHN  265

Query  1017  ARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAI  1196
              RR  EG +FV +D+VD+LL+LADD  LEVKLERH +KAFI D+ AG T+  TV +EWA+
Sbjct  266   ERRRREGKAFVPRDLVDVLLELADDHGLEVKLERHCLKAFILDMFAGSTDTVTVTIEWAV  325

Query  1197  SELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLC  1376
             SE+LK+PE F KAT+ELDRVIG+ RWVEE+D+  LPYI+AIVKE MR+HPVAP+LVPRL 
Sbjct  326   SEILKRPETFDKATEELDRVIGRGRWVEEEDVHRLPYIEAIVKETMRIHPVAPLLVPRLS  385

Query  1377  REDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFG  1556
             RE   V GYDIP GT VLV+VW + RDPA+WD P EF P+RF+G  IDVKG  FELLPFG
Sbjct  386   REHTTVDGYDIPAGTGVLVNVWAIGRDPAVWDAPEEFRPERFVGSPIDVKGHHFELLPFG  445

Query  1557  AGRRMCPGYSLGLKV  1601
             AGRRMCPG SLGLK+
Sbjct  446   AGRRMCPGNSLGLKM  460



>ref|XP_002467827.1| hypothetical protein SORBIDRAFT_01g034740 [Sorghum bicolor]
 gb|EER94825.1| hypothetical protein SORBIDRAFT_01g034740 [Sorghum bicolor]
Length=531

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 375/496 (76%), Gaps = 13/496 (3%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             R+  LPPGP+PWPVIGNLNL+GSLPHRSIH LS ++GP M L+FGS PVVVGSS + A+ 
Sbjct  36    REYRLPPGPRPWPVIGNLNLLGSLPHRSIHALSARHGPFMSLRFGSVPVVVGSSVDAARF  95

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D +F+DRPK A+GK+T Y+YSDI WSPYG YWRQAR++    LF+ ++L S E++
Sbjct  96    FLKTNDASFIDRPKMASGKHTAYDYSDIVWSPYGAYWRQARKLWKANLFNDRQLRSLEHV  155

Query  678   RSQELKSILRQLYTASSAQKP----------ILLRDYMSTLSLNVISWMVLGKSYLNE--  821
             RS+EL+ +LR L   S +             + L++++  LSLNVIS M LG  Y+ E  
Sbjct  156   RSEELRVLLRDLRALSLSSSSSASAGRGGGVVALKEHLLMLSLNVISRMALGGKYVGEGG  215

Query  822   SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHV  1001
             + G+ +SP EFR M+DELFLLNGV  +GD IPW+ +LD+ GY+ RMK L K FDRFLEH+
Sbjct  216   TAGSPISPAEFRWMVDELFLLNGVFCVGDFIPWLSWLDIHGYVGRMKKLGKMFDRFLEHM  275

Query  1002  LDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVI  1181
             ++EH+ RR  EGD FVA DMVDLLL+LADDP LEV ++R GVK F  DL+AGGT++S V 
Sbjct  276   VEEHSQRRRREGDKFVAADMVDLLLELADDPKLEVPIKRDGVKGFALDLIAGGTDSSAVT  335

Query  1182  VEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPML  1361
             +EWA+SELL+ P++  KAT+ELD V+G++R V E+D+PNLPY++AIVKE  RLHPV P+L
Sbjct  336   IEWAMSELLRNPDVLSKATEELDGVVGRERLVTEQDIPNLPYLEAIVKEAFRLHPVTPLL  395

Query  1362  VPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI-PDRFIGKDIDVKGCDF  1538
              PRLCRED     YDIP+GT V V+VWT+ RDPA+W +  EF  P+RF+G  +DVKG D 
Sbjct  396   APRLCREDASTGSYDIPRGTLVFVNVWTIGRDPAVWGDDAEFFRPERFVGSGVDVKGQDL  455

Query  1539  ELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKF  1718
             ELLPFG+GRRMCPGY LGLK++Q +L NLLH F W+LP+ V PEKL+M+E FGL+ P+  
Sbjct  456   ELLPFGSGRRMCPGYVLGLKMVQVTLANLLHAFAWRLPDGVAPEKLSMQEKFGLAVPRFV  515

Query  1719  PLTTVIEPRLPMHLYS  1766
             PL  V  PRLP HLY+
Sbjct  516   PLEAVAVPRLPAHLYA  531



>ref|XP_002467826.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
 gb|EER94824.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
Length=529

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/516 (59%), Positives = 384/516 (74%), Gaps = 18/516 (3%)
 Frame = +3

Query  270   VSTIALLLLAKHLRWRRK--------LHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKY  425
             V   ALL++A  LR R++          LPPGP+PWP+IGNLNLIG+LPHRSIH LS +Y
Sbjct  13    VLATALLVVAA-LRHRKRSSTSTSKHRRLPPGPRPWPIIGNLNLIGALPHRSIHALSARY  71

Query  426   GPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPY  605
             GP M L+FGS PVVVGSS + A+ FLKT D +F+DRPK A+GK+T Y+YSDI WSPYG Y
Sbjct  72    GPFMSLRFGSVPVVVGSSVDAARFFLKTNDASFIDRPKMASGKHTAYDYSDIVWSPYGAY  131

Query  606   WRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKP-----ILLRDYMSTL  770
             WRQAR++    LFS ++L S E++RS+EL+++LR L  +SSA        ++L++++   
Sbjct  132   WRQARKLWKAHLFSDRQLRSQEHVRSEELRALLRDLSLSSSAAAGRGGVVVVLKEHLLMF  191

Query  771   SLNVISWMVLGKSYLNES---EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQ  941
             SLNVIS M LG  Y+ E     G+ +SP EFR M+DELFLLNGV  +GD IPW+ +LD+Q
Sbjct  192   SLNVISRMALGGKYVGEGGTDAGSPISPAEFRWMVDELFLLNGVFCVGDFIPWLSWLDIQ  251

Query  942   GYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERH  1121
             GY+ RMK L K FDRFLEHV++EH+ RR  EGD FVA DMVDLLL+LADDP LEV ++R 
Sbjct  252   GYVGRMKRLGKMFDRFLEHVVEEHSQRRRREGDKFVAADMVDLLLELADDPKLEVPIKRD  311

Query  1122  GVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNL  1301
             GVK F  DL+AGGT++S V +EWA+SELL+KPE+  KA +ELD VIG  R V E+D+ +L
Sbjct  312   GVKGFALDLIAGGTDSSAVTIEWAMSELLRKPEVLAKAVEELDGVIGHGRLVTEQDIRSL  371

Query  1302  PYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALW-DNP  1478
             PY++AIVKE MRLHPV P+L PRLCRED     YDIP+GT V V+VW + RDPA+W  + 
Sbjct  372   PYVEAIVKETMRLHPVTPLLAPRLCREDASTGSYDIPRGTLVFVNVWAIGRDPAVWGGDA  431

Query  1479  NEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPND  1658
              EF P+RF G  +DVKG D ELLPFG+GRRMCPGY LGLK++Q +L NLLH F W+LP+ 
Sbjct  432   EEFRPERFAGSAVDVKGQDLELLPFGSGRRMCPGYVLGLKMVQVTLANLLHAFAWRLPDG  491

Query  1659  VTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             V PEKL+M+E FGL+ P+  PL  V  PRLP HLY+
Sbjct  492   VAPEKLSMQEKFGLAVPRVVPLEAVAVPRLPAHLYA  527



>ref|XP_002462453.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
 gb|EER98974.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
Length=522

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/524 (57%), Positives = 379/524 (72%), Gaps = 16/524 (3%)
 Frame = +3

Query  225   MESPT-ATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRS  401
             ME  T A +       V  +   LL  H   RR  + PPGPKPWP+IGNLNLIG LPHRS
Sbjct  1     MEQATLAAFFGIVLCAVFFLRTFLLRGH---RRAYNPPPGPKPWPIIGNLNLIGELPHRS  57

Query  402   IHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDI  581
             IH+LS +YGP+MQL+FGS PVVVG+SAE+AK FLK  D  F DRP+ A GKYT Y+ SDI
Sbjct  58    IHELSKRYGPLMQLRFGSLPVVVGASAEIAKLFLKVNDAAFSDRPRFAVGKYTAYDCSDI  117

Query  582   TWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYM  761
              WSP+GPY RQARR+C TELFSAKRLES+E+IR +E++ +LRQL  AS   + + LRDY+
Sbjct  118   LWSPFGPYLRQARRICATELFSAKRLESFEHIRDEEVRVLLRQLRQASG--RAVRLRDYL  175

Query  762   STLSLNVISWMVLGKSYLNES-----EG-----AIVSPNEFRKMLDELFLLNGVLNIGDS  911
               L+L VIS +VLGK Y+ E+     EG      +++ +EFR+M+ E F L+GV N+GD 
Sbjct  176   QMLTLGVISRIVLGKKYVQEAAAGDGEGDSSAPTVITADEFREMVGEYFELHGVFNVGDF  235

Query  912   IPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADD  1091
             IPW+D LDLQGY+ RMK ++ +FDRFLEHVLD HN RR  EG SFV KDM+D+LLQLADD
Sbjct  236   IPWLDCLDLQGYVARMKRMNARFDRFLEHVLDVHNERRRREGGSFVPKDMLDVLLQLADD  295

Query  1092  PSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKR  1271
               LEV+L R  VKA  QDL+ G T+ +   VEWAISELLK  +I  KA +EL+ V+G  R
Sbjct  296   TDLEVQLSRDNVKAITQDLIVGATDTTANTVEWAISELLKNSKIIAKAMEELNNVVGPDR  355

Query  1272  WVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVA  1451
              V E D+P LPY++A++KE MR+HP AP+L P + RED  V GYD+  GT V V+VW + 
Sbjct  356   LVTESDLPRLPYLEALLKETMRVHPPAPLLAPHVAREDTSVDGYDVLAGTVVFVNVWAIG  415

Query  1452  RDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLH  1631
              DPALWD P EF P+RF+   ID++G DF+L+PFG+GRRMCPG++L LKV+   L NLLH
Sbjct  416   HDPALWDAPGEFRPERFLESKIDMRGQDFQLVPFGSGRRMCPGFNLALKVVALGLANLLH  475

Query  1632  GFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             GF W+LP+  T  +L+MEE+F L+ P+KFPL  V+EPRLP  LY
Sbjct  476   GFQWRLPDGETAAELSMEEVFVLAMPRKFPLKAVVEPRLPARLY  519



>emb|CDP21012.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/511 (57%), Positives = 376/511 (74%), Gaps = 8/511 (2%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRR-KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             +TW+  A A   T+AL  L+K L  +R KL+ PPGPKPWP+IGNLNL+GS+PH+S+H L 
Sbjct  3     STWLLLALA--GTVALAFLSKALTHKRLKLNHPPGPKPWPIIGNLNLLGSIPHQSLHLLF  60

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYG IMQL+FGS PVVV SS EMAK FL+T D  F  RP TAA KYT+YN S + W+PY
Sbjct  61    QKYGEIMQLKFGSSPVVVASSPEMAKEFLQTHDNIFASRPATAAAKYTSYNCSGMLWAPY  120

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GP+WRQAR++ LT++FS K+L+ +E  R +E ++ + +LY  S   KP+++RD++  LSL
Sbjct  121   GPHWRQARKIYLTQIFSPKQLDFFESTRIEERRAFISRLYAQSG--KPVVMRDHLMRLSL  178

Query  777   NVISWMVLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             +  S MVL   Y  +SEG  ++V+  EF++M+D  FLL GV NIGD IPW+D  DLQGY+
Sbjct  179   STASQMVLSNKYFAQSEGDGSLVTFEEFQEMIDTWFLLGGVFNIGDWIPWLDRFDLQGYV  238

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             K+MK L KKFD+F  HVLD+H ARR  E D F+ KDMVD+LLQ A+DP L+VKL R  +K
Sbjct  239   KQMKELYKKFDKFHNHVLDDHQARRKTEKD-FIPKDMVDILLQYAEDPDLQVKLTRDQIK  297

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
               IQDLL GGT+ S   VEWA++ELLK P + +KAT+ELDRVIG+ +WVEE  +  LP++
Sbjct  298   GLIQDLLVGGTDTSASTVEWAMNELLKHPHLIEKATEELDRVIGRDKWVEEAVLSKLPFL  357

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
              AI+KE  RLHP+A +L P    EDC VAGY I KGT V ++ W++ R+   WD+P EFI
Sbjct  358   GAIIKETFRLHPLATLLPPHYALEDCTVAGYHIAKGTTVFINTWSMGRNSKYWDSPEEFI  417

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RF+GKDID+KG DFELLPFG+GRRMCPGY L LK++   L NLLHGFNWKLP+ + PE
Sbjct  418   PERFLGKDIDIKGHDFELLPFGSGRRMCPGYVLALKLVGTMLANLLHGFNWKLPHGMKPE  477

Query  1671  KLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             ++ MEE +GLS   +  L  + EPRLP++LY
Sbjct  478   EICMEEHYGLSIHPRISLAMIPEPRLPVNLY  508



>dbj|BAK04187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/524 (55%), Positives = 382/524 (73%), Gaps = 14/524 (3%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALL--LLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHR  398
             ME P   W       ++T   L  +L +H +  RK ++PPGP+PWPVIGNLNLIG LPHR
Sbjct  6     MEVP---WAPSLVVLLATAVFLVAILRRHRQQSRKYNIPPGPRPWPVIGNLNLIGPLPHR  62

Query  399   SIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSD  578
             SIH LS +YGP+M L+FGSFP+VVGSS E A+ FL+T D+ F+DRP+ A GKYT YNYS 
Sbjct  63    SIHVLSSRYGPLMSLRFGSFPIVVGSSLEAAEFFLRTHDLAFLDRPRMACGKYTVYNYSG  122

Query  579   ITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY------TASSAQKP  740
             + WS YGPYWR  R++ LTEL S ++L   E+IR +E++++LR L+       ++S  + 
Sbjct  123   MLWSHYGPYWRLLRKLWLTELLSTRQLRLTEHIRGEEVRAMLRDLHPSTSTAASTSTGRA  182

Query  741   ILLRDYMSTLSLNVISWMVLGKSYLNESEGAI--VSPNEFRKMLDELFLLNGVLNIGDSI  914
             ++L+D++  ++LNVIS MVLGK Y+ E  G+   V P +FR M++E+F LNG  +IGD I
Sbjct  183   VVLKDHLLMVTLNVISRMVLGKKYVGEGAGSASAVKPEQFRWMIEEIFFLNGAPHIGDMI  242

Query  915   PWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDP  1094
             PW+ +LD QGY+ RMK L K FDRF+EHVL EHN RR+ EG +FV KDMVDLLLQLADDP
Sbjct  243   PWLSWLDPQGYVGRMKRLGKMFDRFIEHVLREHNERRLQEGKAFVPKDMVDLLLQLADDP  302

Query  1095  SLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRW  1274
             +LEV +   GVKA + +L+AG T+ S V VEWA+SELL+KP +  K T+ELDRVIG+ R 
Sbjct  303   TLEVPISGDGVKASVLELIAGATDTSAVTVEWAMSELLRKPHVLAKVTEELDRVIGRDRL  362

Query  1275  VEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVAR  1454
             V E D+ +LPY++A+VKE +RLHPV P+L+PR+ RE   +AGY+IP GTRVLV+VW + R
Sbjct  363   VAEGDISSLPYLEAVVKETLRLHPVVPLLIPRVSREHTSIAGYEIPVGTRVLVNVWAIGR  422

Query  1455  DPALW-DNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLH  1631
             DP +W +   EF P+RF+G  +DVKG D ELLPFGAGRRMCP + LGLK++Q  L NLLH
Sbjct  423   DPTVWGETAAEFQPERFLGSKVDVKGHDLELLPFGAGRRMCPAHGLGLKMVQLVLANLLH  482

Query  1632  GFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             G+ W+LP+ +  E+L+MEE FG+S  +   L  + EP+L  HLY
Sbjct  483   GYAWRLPDGMAAEELSMEEKFGISVSRMHHLHAIPEPKLMDHLY  526



>ref|XP_008388825.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/487 (61%), Positives = 375/487 (77%), Gaps = 7/487 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +K   PPGPKPWP+IGNLNLIG LPH+S+H LS  YGPIMQL+FGS PVVV +S EMAK 
Sbjct  30    KKRKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQTYGPIMQLRFGSRPVVVATSPEMAKQ  89

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TAAGKY TY+Y ++TWSPYGPYWRQ R++ L ELFS+KRLES+EYI
Sbjct  90    FLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGRKIFLYELFSSKRLESFEYI  149

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLN--ESEGAIVSPNE  851
             R+ E+++   +L   + +  PI+L++++S L+L+++S  VLGK Y +  E EG+I+S  E
Sbjct  150   RADEIRAFTSRLCAIAKSGNPIVLKEHLSRLNLSIMSRTVLGKDYFSVAEYEGSIMSLKE  209

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+ M+DELF+L+GV NIGD IPW++FLDLQGYIKRMKA+ KK DRF + VL+EH A++  
Sbjct  210   FQDMIDELFVLSGVFNIGDWIPWLNFLDLQGYIKRMKAIKKKVDRFYDFVLNEHKAQK--  267

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FV KDMVDLLLQL D  + LEVKL    +KAF QDL+AGGT+ S   +EWA+SEL
Sbjct  268   EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDLIAGGTDTSATNLEWAMSEL  327

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + KKAT+ELDRVIG++RWVEEKD+  LPYI AI+KE MR HP   +L P L  E+
Sbjct  328   IKQPNLIKKATEELDRVIGRERWVEEKDLAQLPYIDAIMKETMRRHPAVVILPPHLAVEN  387

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD-IDVKGCDFELLPFGAG  1562
               VAGYD+ KGT V V+ W++ RDP LW+ P EF P+RF+G   ID++G  FELLPFG+G
Sbjct  388   SNVAGYDVCKGTIVFVNTWSMGRDPKLWEEPEEFRPERFLGNTGIDLQGQSFELLPFGSG  447

Query  1563  RRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEP  1742
             RRMCPGY LGLK+I+  L N+LHGF WKLP +V  E L MEE +GL T +KFPL  V+EP
Sbjct  448   RRMCPGYKLGLKMIRTCLANMLHGFXWKLPGNVKVEDLGMEEAYGLVTTRKFPLVAVMEP  507

Query  1743  RLPMHLY  1763
             RLP+HLY
Sbjct  508   RLPVHLY  514



>ref|XP_008344040.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/513 (59%), Positives = 388/513 (76%), Gaps = 12/513 (2%)
 Frame = +3

Query  255   YAAAWVSTIALL----LLAKHLRWR-RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             ++ A + T+A L    L++K L  + +K    PGPKPWP+IGNLNLIG LPH+S+H LS 
Sbjct  4     FSCAAILTLACLATLALVSKTLFPQLKKQKFXPGPKPWPIIGNLNLIGPLPHQSLHKLSQ  63

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
              YGPIMQL+FGS PVVV SS EMAK FLKT D  F  RP+TAAGKY TY+Y ++TWSPYG
Sbjct  64    IYGPIMQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYG  123

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLN  779
             PYWRQ R++ L ELFS+KRLES+EYIR+ E ++   +LY  + +  PI+L++++S L+L+
Sbjct  124   PYWRQGRKIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLSRLNLS  183

Query  780   VISWMVLGKSYLN--ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIK  953
             ++S  VLGK Y +  E EG+I+S  EF+ M+DELF+LNGV NIGD +PW++FLDLQGYIK
Sbjct  184   IMSRTVLGKDYFSVAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIK  243

Query  954   RMKALSKKFDRFLEHVLDEHNARRVAEG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGV  1127
             RMKA+ KK +RF + VL+EH A++  EG + FV KDMVDLLLQL D  + LEVKL    +
Sbjct  244   RMKAMQKKINRFYDFVLNEHKAQK--EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSI  301

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPY  1307
             KAF QDL+AGGT+ S   +EWA+SEL+K+P + KKAT+ELDRVIG++RWVEEKD+  LPY
Sbjct  302   KAFTQDLIAGGTDTSATNLEWAMSELIKQPNLIKKATEELDRVIGRERWVEEKDLEQLPY  361

Query  1308  IQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEF  1487
             I AI+KE MR HP   +L P L  E+  VAGYD+ KGT V V+ W++ RDP LW+ P EF
Sbjct  362   IDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPKLWEEPEEF  421

Query  1488  IPDRFIGKD-IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVT  1664
              P+RF+G   ID++G  F LLPFG+GRRMCPGY LGL++I+  L N+LHGFNWKLP +V 
Sbjct  422   RPERFLGNTGIDLQGQSFXLLPFGSGRRMCPGYKLGLRMIRTCLANMLHGFNWKLPGNVK  481

Query  1665  PEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              E L MEE +GL T +KFPL  V+EPRLP+HLY
Sbjct  482   VEDLGMEEAYGLVTTRKFPLVAVMEPRLPVHLY  514



>gb|AAL66767.1| cytochrome P450 monooxygenase CYP92A1 [Zea mays subsp. mays]
 tpg|DAA40164.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/477 (59%), Positives = 358/477 (75%), Gaps = 9/477 (2%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             +IGNLNL+G LPHRS+++LS +YGP+MQL+FGS PV+VG+S EMAK FLKT D  F DRP
Sbjct  41    IIGNLNLMGELPHRSMNELSKRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSDRP  100

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             + A GKYT Y++SD+ W+P GPY RQARR+C TELFSA RLES+E+IR +E++ +LRQL 
Sbjct  101   RFAIGKYTAYDFSDLLWAPSGPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQLR  160

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE----SEG---AIVSPNEFRKMLDEL  875
              A  A + + LRDY+  L+L VIS +VLG  Y+ E     EG     ++P EFR+M+DE 
Sbjct  161   QA--AGRTVRLRDYLQMLALGVISRIVLGNKYVMEEVADGEGDSAPAITPAEFREMVDEF  218

Query  876   FLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAK  1055
             F L+G  NIGD IPW+D+LDLQGY+ RMK +  +F RFLE VLD HN RR+ EG +FVAK
Sbjct  219   FALHGAFNIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFVAK  278

Query  1056  DMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKA  1235
             DM+D+LLQLADD SLEV+L R  VKA  QDL+  GT+++   +EWA+SELLK P+I  KA
Sbjct  279   DMLDVLLQLADDTSLEVQLSRDNVKAITQDLIIAGTDSNANTLEWAVSELLKNPKILAKA  338

Query  1236  TDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPK  1415
              +EL+ VIG  R V E D+P LPYI+A++KE MR+HP APML P + RED  V GYD+  
Sbjct  339   MEELNHVIGPDRLVTESDLPRLPYIEAVLKETMRVHPAAPMLAPHVAREDTSVDGYDVLA  398

Query  1416  GTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGL  1595
             GT + ++VW + RDP LWD P EF P+RF+   IDV+G DF+LLPFG+GRRMCPG +L L
Sbjct  399   GTVLFINVWAIGRDPGLWDAPEEFRPERFVESKIDVRGHDFQLLPFGSGRRMCPGINLAL  458

Query  1596  KVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             KV+  SL NLLHGF W+LP+ VT E+L+M+E F L+ P+KFPL  V EPRLP  LY+
Sbjct  459   KVMALSLANLLHGFEWRLPDGVTAEELSMDEAFKLAVPRKFPLMVVAEPRLPARLYT  515



>ref|NP_001151318.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG42367.1| flavonoid 3-monooxygenase [Zea mays]
Length=524

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/511 (58%), Positives = 375/511 (73%), Gaps = 12/511 (2%)
 Frame = +3

Query  270   VSTIALLLLAKHLRWR---RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQ  440
             V   A+LL+A   R R   RK  +P GP+PWPVIGNLNLIG+LPHRSIH LS ++G  M 
Sbjct  12    VLATAVLLVAVLRRKRGSSRKYKMPSGPRPWPVIGNLNLIGALPHRSIHALSARHGAFMS  71

Query  441   LQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQAR  620
             L+FGS PVVVGSS E A+ FL+T D +F+DRP+ AAGKYT Y+YSDI WSP G YWRQAR
Sbjct  72    LRFGSVPVVVGSSVEAARFFLRTSDTSFIDRPRMAAGKYTAYDYSDIVWSPCGAYWRQAR  131

Query  621   RMCLTELFSAKRLESYEYIRSQELK------SILRQLYTASSAQKPILLRDYMSTLSLNV  782
             ++    LFS ++L S E++RS+EL+      S       A   ++ + L++++   SLNV
Sbjct  132   KLWKAHLFSDRQLRSQEHVRSEELRVLLRALSSSSSAGAAGRGRRAVALKEHLLMYSLNV  191

Query  783   ISWMVLGKSYLNE--SEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKR  956
             IS M LG  Y+ E  + G+ +SP EF  M+DELFLLNGV  +GD IPW+ +LDLQGY+ R
Sbjct  192   ISRMALGGKYVGEGGTAGSPISPAEFSWMVDELFLLNGVFCVGDFIPWLGWLDLQGYVGR  251

Query  957   MKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAF  1136
             MK L K FDRFLEHV+DEH+ RR  EG  FV  DMVDLLL+LADDP LEV +ER GVK F
Sbjct  252   MKRLGKMFDRFLEHVVDEHDQRRRREGGGFVPADMVDLLLELADDPKLEVPIERDGVKGF  311

Query  1137  IQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQA  1316
               DL+AGGT+++ V +EWA+SELL+KPE+  K T+ELD VIG  R V E+D+P+LPY++A
Sbjct  312   ALDLIAGGTDSTAVTIEWAMSELLRKPEVLAKVTEELDGVIGHGRLVTEQDIPDLPYLEA  371

Query  1317  IVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWD-NPNEFIP  1493
             +VKE +RLHPV P+L PRLCRED     YDIP+GT V V+VW + RDPA+W  +  EF P
Sbjct  372   VVKETLRLHPVTPLLAPRLCREDASTGSYDIPRGTLVFVNVWAIGRDPAVWGHDAEEFRP  431

Query  1494  DRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEK  1673
             +RF+G  +DVKG D ELLPFG+GRRMCPGY LGLK++Q +L NLLH F+W+LP+ V PEK
Sbjct  432   ERFVGSAVDVKGHDLELLPFGSGRRMCPGYVLGLKMVQVTLANLLHAFSWRLPDSVAPEK  491

Query  1674  LNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LNM+E FGL+ P+  PL  V  PRLP HLY+
Sbjct  492   LNMQEKFGLAVPRLVPLEAVAVPRLPPHLYA  522



>emb|CDP18923.1| unnamed protein product, partial [Coffea canephora]
Length=483

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/486 (57%), Positives = 369/486 (76%), Gaps = 8/486 (2%)
 Frame = +3

Query  240   ATWISYAAAWVSTIALLLLAKHLRWRR-KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLS  416
             +TW+  A A +  +AL  L+K    +R KL+ PPGPKPWP+IGNLNL+GS+PH+S+H LS
Sbjct  3     STWLLLALAGI--VALAFLSKPSTHKRLKLNHPPGPKPWPIIGNLNLLGSIPHQSLHLLS  60

Query  417   VKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPY  596
              KYG IMQL+FGS PVVV SS EMAK FL+T D+NF  RP TAAGKYT+YN SD+TW+PY
Sbjct  61    QKYGAIMQLKFGSSPVVVASSPEMAKEFLQTHDVNFASRPATAAGKYTSYNCSDMTWAPY  120

Query  597   GPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSL  776
             GP+WRQAR++ LT++F+ KRL+ +E IR +E ++ + +LY  S   KP+++RD++  L+L
Sbjct  121   GPFWRQARKLYLTQIFNPKRLDFFESIRIEERRAFISRLYALSG--KPVVMRDHLMRLTL  178

Query  777   NVISWMVLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYI  950
             +    MVL   Y  +SEG  ++V+  EF++M+D  F L GV NIGD IPW+D  DLQGYI
Sbjct  179   SSACQMVLSNKYFAQSEGDGSLVTFEEFQEMIDTWFWLGGVFNIGDWIPWLDRFDLQGYI  238

Query  951   KRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVK  1130
             K+MK L KKFDRF  HVLD+H ARR  E D F+ KDMVD+LLQ A+DP L+VKL R  +K
Sbjct  239   KQMKELYKKFDRFHNHVLDDHQARRKTEKD-FIPKDMVDILLQYAEDPDLQVKLTRDQIK  297

Query  1131  AFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYI  1310
               IQDLLAGGT+ S   VEWA++ELLK P + +KA +ELDRVIG+ +WVEE D   LP++
Sbjct  298   GLIQDLLAGGTDTSATTVEWAMNELLKHPRLIRKAAEELDRVIGKDKWVEEADFSKLPFL  357

Query  1311  QAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFI  1490
             +AI+KE +RLHP+A +L PR   EDC VAGY I KGT V ++ W++ R+   WD+P EFI
Sbjct  358   EAIIKETLRLHPLATLLAPRYAIEDCTVAGYHIAKGTTVFINTWSIGRNSKYWDSPEEFI  417

Query  1491  PDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPE  1670
             P+RF+ KDID+KG +F LLPFG+GRR CPGY+LG+K+++++L NLLHGFNWKLP+ + PE
Sbjct  418   PERFLEKDIDMKGQNFALLPFGSGRRRCPGYNLGIKLVRSTLANLLHGFNWKLPHGMKPE  477

Query  1671  KLNMEE  1688
             ++ MEE
Sbjct  478   EICMEE  483



>ref|NP_001151053.1| cytochrome P450 12 [Zea mays]
 gb|ACG41431.1| flavonoid 3-monooxygenase [Zea mays]
Length=517

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 357/477 (75%), Gaps = 9/477 (2%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             +IGNLNL+G LPHRS+++LS +YGP+MQL FGS PVVVG+SAEMAK FLKT D  F DRP
Sbjct  41    IIGNLNLMGELPHRSMNELSKRYGPLMQLWFGSLPVVVGASAEMAKLFLKTNDAAFSDRP  100

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             + A GKYT Y+ S + W+P+ PY RQARR+C TELFSA RLES+E+IR +E++ +LRQL 
Sbjct  101   RFAVGKYTAYDCSGLLWAPFEPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQLR  160

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE----SEG---AIVSPNEFRKMLDEL  875
              A  A + + LRDY+  L+L VIS +VLGK Y+ E     EG     ++P EFR+M+DE 
Sbjct  161   QA--AGRTVRLRDYLQMLALGVISRIVLGKKYVMEEAADGEGDSAPAITPAEFREMVDEF  218

Query  876   FLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAK  1055
             F L+G  NIGD IPW+D+LDLQGY+ RMK +  +F RFLE VLD HN RR+ EG +FVAK
Sbjct  219   FALHGAFNIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFVAK  278

Query  1056  DMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKA  1235
             DM+D+LLQLADD SLEV+L R  VKA  QDL+  GT+++   +EWA+SELLK P+I  KA
Sbjct  279   DMLDVLLQLADDTSLEVQLSRDNVKAITQDLIIAGTDSNANTLEWAVSELLKNPKILAKA  338

Query  1236  TDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPK  1415
              +EL+ VIG  R V E D+P LPYI+A++KE MR+HP APML P + RED  V GYD+  
Sbjct  339   MEELNHVIGPDRLVTESDLPRLPYIEAVLKETMRVHPAAPMLAPHVAREDTSVDGYDVLA  398

Query  1416  GTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGL  1595
             GT + ++VW + RDP LWD P EF P+RF+   IDV+G DF+LLPFG+GRRMCPG +L L
Sbjct  399   GTVLFINVWAIGRDPGLWDAPEEFRPERFVESKIDVRGHDFQLLPFGSGRRMCPGINLAL  458

Query  1596  KVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             KV+  SL NLLHGF W+LP+ VT E+L+M+E F L+ P+KFPL  V EPRLP  LY+
Sbjct  459   KVMALSLANLLHGFEWRLPDGVTAEELSMDEAFKLAVPRKFPLMVVAEPRLPARLYT  515



>ref|XP_008354460.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/487 (60%), Positives = 372/487 (76%), Gaps = 7/487 (1%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             +K   PPGPKPWP+IGNLNLIG LPH+S+H LS  YGPIMQL+FGS PVVV +S EMAK 
Sbjct  30    KKRKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQXYGPIMQLRFGSRPVVVATSPEMAKQ  89

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TAAGKY TY+Y ++TWSPYGPYWRQ R++ L ELFS+KRLES+EYI
Sbjct  90    FLKTHDHVFSSRPQTAAGKYLTYDYQNVTWSPYGPYWRQGRKIFLYELFSSKRLESFEYI  149

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLN--ESEGAIVSPNE  851
             R+ E ++   +L   + +  PI+L++++S L+L+++S  VLGK Y +  E EG+I+S  E
Sbjct  150   RADEXRAFTSRLXAIAKSGNPIVLKEHLSRLNLSIMSRTVLGKDYFSVAEYEGSIMSLKE  209

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+ M+DELF+LNGV NIGD +PW++FLDLQGYIKRMKA+ KK +RF + VL+EH A++  
Sbjct  210   FQDMIDELFVLNGVFNIGDWMPWLNFLDLQGYIKRMKAMQKKINRFYDFVLNEHKAQK--  267

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG + FV KDMVDLLLQL D  + LEVKL    +KAF QDL+AGGT+ S   +EWA+SEL
Sbjct  268   EGVEEFVPKDMVDLLLQLVDGSNDLEVKLNYDSIKAFTQDLIAGGTDTSATNLEWAMSEL  327

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + KKAT+ELDRVIG++RWVEEKD+  LPYI AI+KE MR HP   +L P L  E+
Sbjct  328   IKQPNLIKKATEELDRVIGRERWVEEKDLEQLPYIDAIMKETMRRHPAVVILPPHLAVEN  387

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD-IDVKGCDFELLPFGAG  1562
               VAGYD+ KGT V V+ W++ RDP LW+ P EF P+RF+G   ID++G  F LLPFG+G
Sbjct  388   SNVAGYDVCKGTVVFVNTWSMGRDPKLWEEPEEFRPERFLGNTGIDLQGQSFXLLPFGSG  447

Query  1563  RRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEP  1742
             RRMCPGY LGL +I+  L N+LHGF WKLP +V  E L MEE +GL T +KFPL  V+EP
Sbjct  448   RRMCPGYKLGLXMIRTCLANMLHGFXWKLPGNVKVEDLGMEEAYGLVTTRKFPLVAVMEP  507

Query  1743  RLPMHLY  1763
             RLP+HLY
Sbjct  508   RLPVHLY  514



>gb|KDP33920.1| hypothetical protein JCGZ_07491 [Jatropha curcas]
Length=441

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 358/449 (80%), Gaps = 14/449 (3%)
 Frame = +3

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             MQL+FGSFPV+V SS+E+AK  LK+ D  F  RP+TAAGKYTTYNYS+ITW+PYGPYWRQ
Sbjct  1     MQLKFGSFPVIVASSSEIAKQILKSNDQIFASRPQTAAGKYTTYNYSNITWAPYGPYWRQ  60

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
              R++ LTELFS+KRL+SYEYIR +E+++ L ++ + SS  KPI+L+D++S ++L++IS +
Sbjct  61    GRKIYLTELFSSKRLQSYEYIRVEEIRAFLARINSLSS--KPIILKDHLSRVTLSIISRI  118

Query  795   VLGKSYL--NESEGA-IVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKA  965
             VLGK Y   NESE   IV+  EF++MLDELF LNGVLNIGD IPW++FLDLQGY+KRMKA
Sbjct  119   VLGKKYFSTNESENEEIVTLEEFQEMLDELFWLNGVLNIGDWIPWLNFLDLQGYVKRMKA  178

Query  966   LSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQD  1145
             L  KFDRF +HVL EH  ++  E      +DMVDLLL+L+++P L+VKL    VK F QD
Sbjct  179   LKIKFDRFHDHVLGEHKEKKAGE------EDMVDLLLKLSNNPDLDVKLNSDSVKGFTQD  232

Query  1146  LLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVK  1325
             L+AGGT+ S   VEWA+SEL+K+P + KKAT+ELDRVIG+ RWVEEKD+P LPYI AI+K
Sbjct  233   LIAGGTDTSATTVEWAMSELMKQPHLIKKATEELDRVIGKDRWVEEKDIPQLPYIDAIMK  292

Query  1326  EVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFI  1505
             E MR HPVA ML P L  ED K+AGYDI KGTRV ++ W++ RD ++WD P EF P+RF+
Sbjct  293   ETMRKHPVAVMLAPHLALEDTKLAGYDIAKGTRVFINTWSMGRDSSMWDEPEEFRPERFL  352

Query  1506  ---GKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKL  1676
                G +IDVKG   ELLPFG+GRRMCPGYSLGLK+I +SL NLLHGFNW+LP+++ PE L
Sbjct  353   SDKGSNIDVKGQSLELLPFGSGRRMCPGYSLGLKMIGSSLANLLHGFNWELPDNMKPEDL  412

Query  1677  NMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +M+E++GL+TP+KFPL  + +PRL +HLY
Sbjct  413   SMDEVYGLATPRKFPLVAIPKPRLQIHLY  441



>ref|XP_006493372.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=511

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/519 (57%), Positives = 377/519 (73%), Gaps = 17/519 (3%)
 Frame = +3

Query  225   MESPTATWISYAAAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSI  404
             M SP+ + I Y+  +   I L L  +  ++ RKL+LPPGP PWP IGNLNLIG LPH SI
Sbjct  5     MTSPSNSAIFYSILFFLPIVLFLFRR--QFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSI  62

Query  405   HDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDIT  584
             H LS KYGP+M L+FG  PVVVGSSAE+A+  LKT DI+F  RP   AGKYTTYNYS + 
Sbjct  63    HSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSGMA  122

Query  585   WSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMS  764
              +PYGPYWRQAR++CL EL SAKRL+ +EYIR +E  + L +L+   SA  P+ L+D + 
Sbjct  123   TAPYGPYWRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELF--KSASTPVHLKDRLY  180

Query  765   TLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQG  944
             TL+L  I  MVLGK Y +E+E   V+P +F +M++ELFLL G+L+IGDSIPW+   DLQG
Sbjct  181   TLNLTSICRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQG  240

Query  945   YIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHG  1124
             ++KRMK +SKK D+F E +LDEH+ RR +  D +   DMVD+L+QLADDPSLEVKLER  
Sbjct  241   HVKRMKDVSKKLDKFYEGILDEHHERRKSVKD-YGVHDMVDVLMQLADDPSLEVKLEREH  299

Query  1125  VKAFIQDLLAGGTENST---VIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMP  1295
             +KA IQ  L  G    T   V   +  + +   P I    T      +G+ RWVEEKD+ 
Sbjct  300   IKALIQVNLKFGVLVKTREMVTFNYCNTAV---PYIRLGRT-----AVGKDRWVEEKDIV  351

Query  1296  NLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDN  1475
             NLPYI+A+VKE MRLHPVAP+L+PR+ R+DC+VAGYDI + TRV+V+VW + RDP +W+ 
Sbjct  352   NLPYIEALVKETMRLHPVAPLLLPRVARDDCRVAGYDILRNTRVVVNVWAIGRDPTMWEK  411

Query  1476  PNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPN  1655
             PNEF P RFIGK+IDVKG DF+LLPFG+GRR+CPGY LGLKV+Q++L NLL+GF WKLP 
Sbjct  412   PNEFRPHRFIGKNIDVKGHDFQLLPFGSGRRICPGYGLGLKVVQSTLANLLYGFEWKLPG  471

Query  1656  DVTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLYSV  1769
             D+  E L+ME+ FGL+ P+K PL  V  +PRL +HLYS 
Sbjct  472   DMKNEDLDMEDRFGLTMPRKIPLVVVPSKPRLSLHLYSC  510



>ref|XP_011095838.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Sesamum 
indicum]
Length=509

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/488 (57%), Positives = 363/488 (74%), Gaps = 5/488 (1%)
 Frame = +3

Query  306   LRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAE  485
              R   K +LPPGPKPWPVIGNLNL+GS+PHRS+H LS KYG IMQL+FG FPVVV SS E
Sbjct  25    FRRHPKPNLPPGPKPWPVIGNLNLLGSIPHRSLHLLSQKYGDIMQLKFGKFPVVVASSPE  84

Query  486   MAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLES  665
             MAK FLK  D  F  RP  AAGKYT+YNYSD+TW+PYGP+WRQAR++ L+E+FSAK+LES
Sbjct  85    MAKQFLKVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLES  144

Query  666   YEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE--GAIV  839
             +E+IR +E  + L +LY+ S   KP++LR ++   +L+ IS MVL   Y +ESE   ++V
Sbjct  145   WEHIRIEERHNFLARLYSLSG--KPVILRPHLYRYNLSSISRMVLSSKYFSESEHDKSVV  202

Query  840   SPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNA  1019
               +E ++M++E FLLNGV NIGD IPW+ FLDLQGY+KRMKAL KK D+F  +V+++H  
Sbjct  203   KLDELQEMVEEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALQKKLDKFFSYVINDHQT  262

Query  1020  RRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAIS  1199
             R   E D  V  D+VD LLQLA+DP+LEVKL    +K  +Q L+  GT+ +  I+EW I 
Sbjct  263   RIATEKDP-VQGDVVDALLQLAEDPNLEVKLTSDRIKGLLQGLVGAGTDTAATIIEWTIH  321

Query  1200  ELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCR  1379
             EL+K P + +K  +ELDRVIG+ RWVEE D  NLPYI AI+ E MRLHP++ +L P    
Sbjct  322   ELVKNPHVIEKGKEELDRVIGRNRWVEENDSSNLPYIDAIIMESMRLHPLSTILAPHYAM  381

Query  1380  EDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGA  1559
             EDCKVAGYDI KGT +L++ W++ RDP  WD PNEF+P+RF+GK+ID  G +F LLPFG+
Sbjct  382   EDCKVAGYDISKGTAILINTWSIGRDPNSWDAPNEFLPERFVGKEIDPTGSNFALLPFGS  441

Query  1560  GRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             GRR CPGY+LGLK+++ +  NLLHGFN+KL + + P+ + MEE++GL+ P K PL  ++E
Sbjct  442   GRRRCPGYNLGLKLVRTTFANLLHGFNFKLVDGMRPKDVCMEELYGLTAPPKEPLALIME  501

Query  1740  PRLPMHLY  1763
             P LP + Y
Sbjct  502   PILPKNFY  509



>gb|ABK24537.1| unknown [Picea sitchensis]
Length=514

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/488 (58%), Positives = 365/488 (75%), Gaps = 3/488 (1%)
 Frame = +3

Query  303   HLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSA  482
             ++R R  + LPPGP+ WP+IGNLNL+G LPHRS+  LS  YGP+M ++ GS P VV SSA
Sbjct  24    YMRLRPSVKLPPGPRAWPIIGNLNLMGKLPHRSLDRLSKTYGPLMYIRLGSIPCVVASSA  83

Query  483   EMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLE  662
             EMA+ FL+T D+ F  RP+ A+GKYTTYNYSDITWSPYG Y+R AR++CL ELFSAKRLE
Sbjct  84    EMAREFLQTHDLTFSSRPQVASGKYTTYNYSDITWSPYGDYFRLARKVCLMELFSAKRLE  143

Query  663   SYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVS  842
             S+EYIR +E+  +L  ++       P+ +R     +S N+IS M LG+ Y ++  G ++ 
Sbjct  144   SFEYIRVEEVARMLGSVFETCQRGLPVEIRKETYGVSNNIISRMALGRRYFDKEAGNMMR  203

Query  843   PNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNAR  1022
               E ++ML+E FLLNGV NI D IPW+ +LDLQGY+ RMK LS++ D FLE V++EH+ R
Sbjct  204   LEELKEMLEEFFLLNGVFNIVDFIPWLGWLDLQGYVGRMKKLSERLDVFLEEVVEEHDRR  263

Query  1023  RVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISE  1202
             R    +++VAKDM+D+LL+ ADDP L   L R  VKAF  D++AGGTE S  +VEW +SE
Sbjct  264   RKGV-ENYVAKDMMDVLLKQADDPQL--NLSRIKVKAFTLDIIAGGTETSATLVEWGLSE  320

Query  1203  LLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRE  1382
             LLKKPE+ ++AT ELDRV+G++RWVEEKDM  L Y+Q IVKE MRLHPVAP+LVP L  +
Sbjct  321   LLKKPEMLERATKELDRVVGRERWVEEKDMGGLEYVQWIVKETMRLHPVAPLLVPHLSTQ  380

Query  1383  DCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAG  1562
              C++AGYDIP  TRV V+VW++ RD   W+NPNEF P+RF G  +DV G D+ELLPFG+G
Sbjct  381   RCRIAGYDIPANTRVFVNVWSIGRDDQSWENPNEFRPERFKGSTVDVMGRDYELLPFGSG  440

Query  1563  RRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEP  1742
             RRMCPG SLGLKV+Q +L NL+HGF WKLP+  +P+ L+M EIFGLST K  PL  +  P
Sbjct  441   RRMCPGNSLGLKVVQIALANLIHGFQWKLPDGQSPKDLDMGEIFGLSTSKTCPLVAMARP  500

Query  1743  RLPMHLYS  1766
             RLP HLY+
Sbjct  501   RLPSHLYN  508



>gb|ABC69418.1| CYP92B3 [Nicotiana tabacum]
Length=508

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/503 (56%), Positives = 376/503 (75%), Gaps = 7/503 (1%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLRW-RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQ  440
             A    + L+ L+K L   RRK +LPPGPKPWP++GN++L+GS PHRS+H+L+ +YG +M 
Sbjct  9     ALTGLLTLVFLSKFLHSPRRKQNLPPGPKPWPIVGNIHLLGSTPHRSLHELAKRYGDLML  68

Query  441   LQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQAR  620
             L+FGS  V++ SS +MA+ FLKT D  +  RP+ AAGKYT YNY D+TW+ YGP+WRQAR
Sbjct  69    LKFGSRNVLILSSPDMAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWARYGPFWRQAR  128

Query  621   RMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL  800
             R+ L E+F+ KRL+S+EYIR +E  +++ +L+  S   KPILLRD+++  +L  IS  VL
Sbjct  129   RIYLNEIFNPKRLDSFEYIRIEERHNLISRLFVLSG--KPILLRDHLTRYTLTSISRTVL  186

Query  801   GKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSK  974
                Y +ES G  ++++  + + MLD+ FLLNGV+NIGD IPW+ FLDLQGY+K+MK L +
Sbjct  187   SGKYFSESPGQNSMITLKQLQDMLDKWFLLNGVINIGDWIPWLAFLDLQGYVKQMKELHR  246

Query  975   KFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLA  1154
              FD+F   VLD+H A R  +  +FV +DMVD+LLQ A+DP+LEVKL    VK  +QDLLA
Sbjct  247   NFDKFHNFVLDDHKANRGEK--NFVPRDMVDVLLQQAEDPNLEVKLTNDCVKGLMQDLLA  304

Query  1155  GGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVM  1334
             GGT+ S   VEWA  ELL++P+I KKA  ELD VI Q RWV+EKD   LPYI++I+KE +
Sbjct  305   GGTDTSATTVEWAFYELLRQPKIMKKAQQELDLVISQDRWVQEKDYTQLPYIESIIKETL  364

Query  1335  RLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKD  1514
             RLHPV+ ML PR+  EDC VAGYDIPKGT ++V+ W++ R+   W++P EF+P+RF GK+
Sbjct  365   RLHPVSTMLPPRIALEDCHVAGYDIPKGTILIVNTWSIGRNSQHWESPEEFLPERFEGKN  424

Query  1515  IDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIF  1694
             I V G  F LLPFGAGRR CPGYSLG+++I+A+L NLLHGFNW+LPN ++PE ++MEEI+
Sbjct  425   IGVTGQHFALLPFGAGRRKCPGYSLGIRIIRATLANLLHGFNWRLPNGMSPEDISMEEIY  484

Query  1695  GLSTPKKFPLTTVIEPRLPMHLY  1763
             GL T  K  L  ++EPRLP HLY
Sbjct  485   GLITHPKVALDVMMEPRLPNHLY  507



>ref|XP_009766074.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=508

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/479 (58%), Positives = 358/479 (75%), Gaps = 6/479 (1%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             LPPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS PV+V SSAEMAK FLK 
Sbjct  33    LPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSKPVLVASSAEMAKQFLKI  92

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR+ L E+F+ KRL+S+EYIR +E
Sbjct  93    HDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNEIFTPKRLDSFEYIRVEE  152

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLD  869
              ++++ QL   S A KP  L+D++S  SL  ++ MVL   Y  ES    V   + + ++D
Sbjct  153   RQTLISQL--NSLAGKPFFLKDHLSRFSLCSMTRMVLSNKYFGES---TVRVEDLQHLVD  207

Query  870   ELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV  1049
             + FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   VLD+H A++  E  +FV
Sbjct  208   QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAKK-NEEKNFV  266

Query  1050  AKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFK  1229
              KDMVD+LL++A+DP+LEVKL    VK  +QDLL GGT++ T  V+WA  ELL++P + +
Sbjct  267   PKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTAAVQWAFQELLRQPRVIE  326

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDRV+G++RWVEEKD   L YI+AI+KE +RLHP+  ML P    EDC VAGYDI
Sbjct  327   KATEELDRVVGKERWVEEKDCSQLSYIEAILKETLRLHPLGTMLAPHCAIEDCNVAGYDI  386

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGT VLV+VWT+ +DP  WD   EF+P+RF+ KDID+ G +F  LPFG+GRR CPGYSL
Sbjct  387   QKGTTVLVNVWTIGKDPKYWDRSEEFLPERFLEKDIDMDGHNFAFLPFGSGRRRCPGYSL  446

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             GLKVI+A+L N+LHGFNWKLP  + PE +++EE +GL+T  K P+  ++EPRL  +LYS
Sbjct  447   GLKVIRATLANMLHGFNWKLPEGMKPEDISVEEHYGLTTHPKLPVPVILEPRLSSNLYS  505



>ref|XP_011095822.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/489 (55%), Positives = 366/489 (75%), Gaps = 5/489 (1%)
 Frame = +3

Query  303   HLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSA  482
             + R   K   PPGPKPWPVIGNL+L+GS PHRS H LS KYG IMQL++G FPVVV SS 
Sbjct  28    NFRQHPKRKFPPGPKPWPVIGNLHLVGSHPHRSFHVLSQKYGDIMQLKYGKFPVVVASSP  87

Query  483   EMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLE  662
             EMAK FL+  D  F  RP  AAGKYT+++YSD+TW+PYGP+WRQAR++ L+E+F+AK+LE
Sbjct  88    EMAKQFLRLHDKVFASRPALAAGKYTSFDYSDVTWAPYGPHWRQARKIYLSEVFNAKKLE  147

Query  663   SYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNES--EGAI  836
             S+EYIR +E +++L +L++ S   KP++L+D++S  SL++IS MV G  Y++ES    +I
Sbjct  148   SFEYIRIEERRNLLSRLHSLSG--KPVVLKDHLSRYSLSIISRMVFGDGYISESGPNKSI  205

Query  837   VSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHN  1016
             V+ +E  ++LDE FLLNGV N GD IPW++FLDLQG +K+MK L +K DRFL +V+D+H 
Sbjct  206   VTLDELHELLDEWFLLNGVFNFGDWIPWLNFLDLQGCVKKMKGLYQKLDRFLNYVIDDHQ  265

Query  1017  ARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAI  1196
              RR    DS +  D VD+LLQLA+D +LE+KL R  +K  IQDLL GG + ++  +EWAI
Sbjct  266   TRRAIGKDS-IQGDAVDMLLQLAEDDNLEIKLTRDRIKGLIQDLLGGGADTASTTLEWAI  324

Query  1197  SELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLC  1376
              E+L+ P + +KA  ELDRVIG+ RWVEE+D   LPYI  I+ E MRLHP+  +L+P   
Sbjct  325   HEILRNPRVIEKAKVELDRVIGRNRWVEEEDTSKLPYIDGIIMESMRLHPLGTLLIPHYA  384

Query  1377  REDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFG  1556
              EDCKVAGYDI KGT +L++ W++ R+P +WD P EF+P+RF+ KD DV G +F LLPFG
Sbjct  385   MEDCKVAGYDISKGTTILINTWSMGRNPNIWDAPEEFLPERFLDKDFDVTGGNFSLLPFG  444

Query  1557  AGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVI  1736
             +GRR CPGY+LGLK+++ +L NLLHGFNW L + + PE +++EE +GL+T  K P+T ++
Sbjct  445   SGRRRCPGYNLGLKMVRPTLANLLHGFNWNLVDGMRPEDVSVEEFYGLATQPKKPVTIIM  504

Query  1737  EPRLPMHLY  1763
              P LP HLY
Sbjct  505   NPALPDHLY  513



>ref|XP_004250647.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum lycopersicum]
Length=501

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/496 (57%), Positives = 360/496 (73%), Gaps = 11/496 (2%)
 Frame = +3

Query  285   LLLLAKHLRWRRKLH--LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSF  458
             L  L K    RR ++  LPPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS 
Sbjct  13    LAFLCKVSTCRRPVNRKLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSR  72

Query  459   PVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTE  638
             PV+V SSAEMAK FLK  D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR+ L E
Sbjct  73    PVLVASSAEMAKQFLKIHDANFASRPLLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNE  132

Query  639   LFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLN  818
             +F+ KRLES+EYIR +E ++ + QL   S A K   L+D++S  SL  ++ MVL   Y  
Sbjct  133   IFTPKRLESFEYIRVEERQTFISQL--NSLAGKTFFLKDHLSRFSLCSMTRMVLSNKYFG  190

Query  819   ESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEH  998
             ES    V   + + ++D+ FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   
Sbjct  191   ES---TVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNI  247

Query  999   VLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTV  1178
             VLD+H A++    ++FV KDMVD+LLQ+A DP+LEVKL    VK  +QDLL GGT++ T 
Sbjct  248   VLDDHRAKK----NAFVPKDMVDVLLQMAQDPNLEVKLTDDCVKGLMQDLLTGGTDSLTA  303

Query  1179  IVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPM  1358
              V+WA  ELL++P +  KA  ELD+V+G++RWVEE+D   L YI+AI+KE +RLHP+  M
Sbjct  304   AVQWAFQELLRQPRVIDKAIQELDQVVGKERWVEERDCSQLSYIEAILKETLRLHPLGTM  363

Query  1359  LVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDF  1538
             L P    EDCKVAGYDI KGT VLV+VWT+ RDP  WD   EF+P+RF+ KDID+ G +F
Sbjct  364   LAPHCAIEDCKVAGYDIEKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLEKDIDMDGHNF  423

Query  1539  ELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKF  1718
               LPFG+GRR CPGYSLGLKVI+A+L N+LHGFNWKLP  V  E +++EE +GL+T  KF
Sbjct  424   SFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFNWKLPQGVNTESVSVEEQYGLTTHPKF  483

Query  1719  PLTTVIEPRLPMHLYS  1766
             P+  ++EPRL  HLYS
Sbjct  484   PVPVILEPRLSSHLYS  499



>gb|EMT08550.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=531

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/530 (56%), Positives = 390/530 (74%), Gaps = 30/530 (6%)
 Frame = +3

Query  258   AAAWVSTIALLLLAKHLRWRRKL------HLPPGPKPWPVIGNLNLIGSLPHRSIHDLSV  419
             A AW S +A++L+   +  R +        LPPGPKPWPVIGNLNLIG+LPHRSIH+LS 
Sbjct  5     AWAWASFLAVVLVVLTILRRGRGSQPQGNRLPPGPKPWPVIGNLNLIGALPHRSIHELSK  64

Query  420   KYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYG  599
             +YGP+MQL+FGSFPVVVGSSAEMA+ FLKT D  F DRP+TAAGK+TTYNYSD+ W+PY 
Sbjct  65    QYGPLMQLRFGSFPVVVGSSAEMARFFLKTHDKVFADRPRTAAGKHTTYNYSDVLWAPYN  124

Query  600   PYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTA--SSAQKPILLRDYMSTLS  773
              ++R+ARR+  TELFSA RL+SY++IR +E+ ++LR L  A   ++ + + LR ++   +
Sbjct  125   AHFRRARRLFATELFSAARLKSYKHIRHEEVSALLRDLAAAAHGASGRAVPLRGHLFAAT  184

Query  774   LNVISWMVLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
               +IS +VLGK Y  +  G  A ++  +   +++E FLLNGV+N+GD IPW D+LDLQGY
Sbjct  185   NGIISRVVLGKKYAEKEAGGSAAMALEDLSGLIEEFFLLNGVINVGDFIPWFDWLDLQGY  244

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             ++RMK  SKK DRFLEHVL+EH  RR  +G+ FVA+DMVD+LLQLAD+P+   +L+R  V
Sbjct  245   VRRMKKYSKKMDRFLEHVLEEHEERRRVKGEQFVARDMVDVLLQLADNPN---RLDRDTV  301

Query  1128  KA-----------------FIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRV  1256
             KA                 +I  ++   ++ S+V +EWA+SE+L+ PE+  KAT ELDRV
Sbjct  302   KALTQVRTPSLILPYFQPGYIYTIVDQDSDTSSVTMEWAMSEVLRNPEVLGKATKELDRV  361

Query  1257  IGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVS  1436
             +G+ R V EKD+P+LPYI+AIVKE MR+HPV+PML P L RED  V G+DIP GT VLV+
Sbjct  362   VGRDRMVMEKDIPDLPYIEAIVKEAMRMHPVSPMLAPHLAREDASVNGHDIPAGTLVLVN  421

Query  1437  VWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASL  1616
             VW + RDP  WD P EF P+RF+G  IDVKG D ELLPFGAGRRMCPGYSLGLKV+Q  +
Sbjct  422   VWAIGRDPTYWDAPEEFRPERFMGSKIDVKGQDMELLPFGAGRRMCPGYSLGLKVVQLIV  481

Query  1617  GNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              NLLHGF W LP+  T E+LNMEEI+GL+T +KFPL  V+EP+L  H++S
Sbjct  482   ANLLHGFTWGLPDGTTMEQLNMEEIYGLTTARKFPLEAVVEPKLQEHVFS  531



>gb|ACN27918.1| unknown [Zea mays]
Length=470

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 351/470 (75%), Gaps = 9/470 (2%)
 Frame = +3

Query  378   IGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKY  557
             +G LPHRS+++LS +YGP+MQL+FGS PV+VG+S EMAK FLKT D  F DRP+ A GKY
Sbjct  1     MGELPHRSMNELSKRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSDRPRFAIGKY  60

Query  558   TTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQK  737
             T Y++SD+ W+P GPY RQARR+C TELFSA RLES+E+IR +E++ +LRQL  A  A +
Sbjct  61    TAYDFSDLLWAPSGPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQLRQA--AGR  118

Query  738   PILLRDYMSTLSLNVISWMVLGKSYLNE----SEG---AIVSPNEFRKMLDELFLLNGVL  896
              + LRDY+  L+L VIS +VLG  Y+ E     EG     ++P EFR+M+DE F L+G  
Sbjct  119   TVRLRDYLQMLALGVISRIVLGNKYVMEEVADGEGDSAPAITPAEFREMVDEFFALHGAF  178

Query  897   NIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLL  1076
             NIGD IPW+D+LDLQGY+ RMK +  +F RFLE VLD HN RR+ EG +FVAKDM+D+LL
Sbjct  179   NIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFVAKDMLDVLL  238

Query  1077  QLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRV  1256
             QLADD SLEV+L R  VKA  QDL+  GT+++   +EWA+SELLK P+I  KA +EL+ V
Sbjct  239   QLADDTSLEVQLSRDNVKAITQDLIIAGTDSNANTLEWAVSELLKNPKILAKAMEELNHV  298

Query  1257  IGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVS  1436
             IG  R V E D+P LPYI+A++KE MR+HP APML P + RED  V GYD+  GT + ++
Sbjct  299   IGPDRLVTESDLPRLPYIEAVLKETMRVHPAAPMLAPHVAREDTSVDGYDVLAGTVLFIN  358

Query  1437  VWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASL  1616
             VW + RDP LWD P EF P+RF+   IDV+G DF+LLPFG+GRRMCPG +L LKV+  SL
Sbjct  359   VWAIGRDPGLWDAPEEFRPERFVESKIDVRGHDFQLLPFGSGRRMCPGINLALKVMALSL  418

Query  1617  GNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              NLLHGF W+LP+ VT E+L+M+E F L+ P+KFPL  V EPRLP  LY+
Sbjct  419   ANLLHGFEWRLPDGVTAEELSMDEAFKLAVPRKFPLMVVAEPRLPARLYT  468



>ref|XP_002459381.1| hypothetical protein SORBIDRAFT_02g003780 [Sorghum bicolor]
 gb|EER95902.1| hypothetical protein SORBIDRAFT_02g003780 [Sorghum bicolor]
Length=679

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/522 (55%), Positives = 378/522 (72%), Gaps = 24/522 (5%)
 Frame = +3

Query  270   VSTIALLLLA-----KHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPI  434
             V  IAL LL+     +H     K +LPPGP+PWPVIGNLNLIG LPHRS+H+LS +YG +
Sbjct  15    VLAIALFLLSILHRRRHPSGNSKYNLPPGPRPWPVIGNLNLIGPLPHRSVHELSKRYGSL  74

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M L+FGS PVVV SS +MA+ FLKT D+ F+DRP+TA+G+YT YNYSD+ WSPYG YWRQ
Sbjct  75    MSLRFGSLPVVVASSVDMARFFLKTHDLAFIDRPRTASGRYTGYNYSDMLWSPYGAYWRQ  134

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
             AR+ C  E+FSA RL S E++R+ E++++LR LY A  A  P+ L D++  L++NVIS M
Sbjct  135   ARKFCKAEVFSAARLRSQEHVRAAEVRAMLRDLYAAGPAAAPVRLMDHLFQLTINVISLM  194

Query  795   VLGKSYL---------NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGY  947
             VLG+ +              G   +P  F+ M++E FLL+G L++GD IPW+ +LD  G+
Sbjct  195   VLGEKHAVAVDGDGRSAAGGGLPATPEAFKWMIEEFFLLSGRLDVGDMIPWLRWLDPHGH  254

Query  948   IKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGV  1127
             ++R+K L + FD FL++V+DEH+ RR  EGD+FVA D VDLLL+LADDP+LEV ++R G+
Sbjct  255   VRRLKRLREMFDHFLDNVVDEHSERRWREGDAFVAMDAVDLLLELADDPNLEVPIQRDGI  314

Query  1128  KAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRW-VEEKDMPNLP  1304
             KAF  +LL G  + ++V VEWA+SELL+ P+    AT+ELDRV+G++R  V E D+P+LP
Sbjct  315   KAFTLNLLVGLPDTTSVTVEWAMSELLRNPDALATATEELDRVVGRERLVVTEGDIPSLP  374

Query  1305  YIQAIVKEVMRLHPVAPMLVPRLCRED--------CKVAGYDIPKGTRVLVSVWTVARDP  1460
             Y++A+VKE MRLHPV+P+L PRL RED            G+DIP GT V V+VW +ARDP
Sbjct  375   YMEAVVKETMRLHPVSPLLTPRLSREDVVVSVGGHGHGHGHDIPAGTLVFVNVWAIARDP  434

Query  1461  ALWD-NPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGF  1637
             A+W     EF P+RF+G  +DVKG D ELLPFG+GRRMCPG SLGL+++Q  L NL+HG+
Sbjct  435   AVWGRTAGEFRPERFVGSGVDVKGQDLELLPFGSGRRMCPGVSLGLRMVQVILANLVHGY  494

Query  1638  NWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
              WKLP+ V  E+L+MEE FGLS P+K  L  V EPRLP HLY
Sbjct  495   AWKLPDGVAGEELSMEETFGLSMPRKVRLDAVAEPRLPAHLY  536



>ref|XP_006452810.1| hypothetical protein CICLE_v10008392mg [Citrus clementina]
 gb|ESR66050.1| hypothetical protein CICLE_v10008392mg [Citrus clementina]
Length=425

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/422 (63%), Positives = 341/422 (81%), Gaps = 4/422 (1%)
 Frame = +3

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             MQL+FGSFPVVV +SAEMAK FL+T D  F  RP+TAAGK+TTYNY ++TW+PYGPYWRQ
Sbjct  1     MQLKFGSFPVVVAASAEMAKQFLQTHDHIFASRPQTAAGKHTTYNYLNLTWAPYGPYWRQ  60

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
              R++ L+ELFS+KRLESY+YIR +E ++ + +LY  S   KP++L++++S ++L++IS  
Sbjct  61    GRKLYLSELFSSKRLESYQYIRVEEYRAFISRLYALSG--KPVVLKEHLSRVTLSIISRT  118

Query  795   VLGKSYLNES--EGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
             VLGK Y +ES  E +IV+  EF++MLDELFLLNGVLNIGD IPW+DFLDLQGY+KRMKAL
Sbjct  119   VLGKKYFSESKAEDSIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRMKAL  178

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
              KKFDRF +HV DEH A R      FV KDMVDLLLQ+ADDP+L+VKL    V+ F QDL
Sbjct  179   KKKFDRFHDHVFDEHKANRKGNLKDFVPKDMVDLLLQMADDPNLDVKLNYDSVRGFTQDL  238

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
             +AGGT+ S   VEWA+SEL+K+P++ KKAT+E+DRV+G++RWVEEKD+P LPYI AI+KE
Sbjct  239   IAGGTDTSATTVEWAMSELMKRPDLIKKATEEIDRVVGRQRWVEEKDIPQLPYIDAIMKE  298

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIG  1508
              MR HPVA +L P L  EDC VAG+DI KGTRV ++ W++ RDP++WD P EF  +RF+ 
Sbjct  299   TMRKHPVAVLLAPHLALEDCTVAGFDIRKGTRVFINTWSIGRDPSVWDKPEEFRRERFLD  358

Query  1509  KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEE  1688
             K  DVKG  FELLPFG+GRRMCPGYSLG+K+I++SL N+LHGFNWKLP  + PE ++M+E
Sbjct  359   KAFDVKGQHFELLPFGSGRRMCPGYSLGVKMIKSSLANMLHGFNWKLPAHMKPEHISMDE  418

Query  1689  IF  1694
             +F
Sbjct  419   VF  420



>gb|KDO46294.1| hypothetical protein CISIN_1g015436mg [Citrus sinensis]
Length=407

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/410 (67%), Positives = 340/410 (83%), Gaps = 5/410 (1%)
 Frame = +3

Query  543   AAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTA  722
             AAGKYT YN+S+ITWSPYGPY+ QAR++C  ELF+AKRL+SYEYIR +EL  +L+ LY +
Sbjct  2     AAGKYTGYNFSNITWSPYGPYFNQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLYES  61

Query  723   SSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAI-VSPNEFRKMLDELFLLNGVLN  899
             S   KPI L+D+++ +SLNVIS +VLGK Y NE +  I ++ +E ++M+DEL LLNGV +
Sbjct  62    SG--KPIALKDHLADVSLNVISRVVLGKKYSNERQNGIEITRHELKEMIDELILLNGVFD  119

Query  900   IGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQ  1079
             IGDSIPW+ FLDLQG IKRMKA++KKFDRFLE V+DEHNARR    D++VAKDMVD+LL 
Sbjct  120   IGDSIPWLGFLDLQGNIKRMKAVAKKFDRFLEQVVDEHNARRKG-IDNYVAKDMVDVLLL  178

Query  1080  LADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVI  1259
             LADDP+LEV+L+RH VK F  DL+AG TE ST+++EWA +EL+K PEI  KAT+ELDRVI
Sbjct  179   LADDPTLEVRLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKATEELDRVI  238

Query  1260  GQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSV  1439
             G++RW EEKD+ NLP+I+AI+KE MRLH  APML+PR+ REDCKVA YDI KGT+VLV+ 
Sbjct  239   GKERWFEEKDIVNLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAAYDILKGTQVLVNT  297

Query  1440  WTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLG  1619
             WT+ RDPALW+NPNEF P+RF+GK IDVKG DFELLPFGAGRRMCPGYS GLKVIQ+SL 
Sbjct  298   WTIERDPALWENPNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLA  357

Query  1620  NLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             NLLHGF WKLP +++ ++LNMEE+F L+  KK PL  V +PRL  HLY++
Sbjct  358   NLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYNM  407



>ref|XP_006477116.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=532

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/533 (56%), Positives = 382/533 (72%), Gaps = 19/533 (4%)
 Frame = +3

Query  219   DSMESPTATWISYAAAWVSTIA------LLLLAKHLRWRRKLHL--PPGPKPWPVIGNLN  374
             D   S TA   S +  W S +A      LLL  +H+  R K++L  PPGPKPW +IGNLN
Sbjct  3     DPASSATADNPSNSTMWYSILAFFLPVLLLLYYRHIS-RNKINLLPPPGPKPWHLIGNLN  61

Query  375   LIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGK  554
             LIG   H S+  LS KYGP+MQL+FG   VVVGSSAE+A+  LKT D+ F  RP   A K
Sbjct  62    LIGQHLHVSLQSLSQKYGPLMQLKFGLETVVVGSSAEVAELLLKTHDVTFASRPPLLAWK  121

Query  555   YTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY-----T  719
             +  YNY  +  +PYGP+WRQ R++ +T+L S K L  +EYIR +E K++L +LY     +
Sbjct  122   HANYNYLVMPGAPYGPHWRQTRKIYMTQLLSPKSLAQFEYIRIEERKALLFKLYKSSTSS  181

Query  720   ASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLN  899
             +SS+  P+ L++ +   +L ++S M+ GK Y  E E  IV+P +F +++DELFLL GVL+
Sbjct  182   SSSSSTPVHLKERLFMFNLAIMSRMLFGKRYTEEDENNIVTPKQFTEIVDELFLLPGVLD  241

Query  900   IGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEH---NARRVAEGDSFVAKDMVDL  1070
             IGD+IPW+ FLDLQG IKRMKA+ KK D+F EHVL EH     R++ +       D+VD+
Sbjct  242   IGDAIPWLAFLDLQGNIKRMKAVKKKIDKFYEHVLHEHERHGKRKLFKEHG--TNDIVDV  299

Query  1071  LLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELD  1250
             LLQLADDP+LEVKLER  +KA +QDLL GG E S V +EW +SELLK PE+ +KATDELD
Sbjct  300   LLQLADDPTLEVKLERDHIKASMQDLLVGGIETSAVTLEWTMSELLKNPEVIQKATDELD  359

Query  1251  RVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVL  1430
             RVIG+ +WVEEKD+ NLPYIQAIVKEVMRLHP   +L P   RE+CKVAG +I K +RV+
Sbjct  360   RVIGRNKWVEEKDIVNLPYIQAIVKEVMRLHPPLTLLAPHKARENCKVAGSNILKNSRVI  419

Query  1431  VSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQA  1610
             V+VW + RDP LW+ PNEF P+RF+GK+IDV G +FELLPFG+GRRMC GY+LGLK++Q+
Sbjct  420   VNVWAIGRDPTLWEKPNEFCPERFVGKEIDVVGHNFELLPFGSGRRMCVGYALGLKIVQS  479

Query  1611  SLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             +L NLLHGF WKLP D+  E L+MEE FG  T +K PL  V +PRLP+ LYS+
Sbjct  480   TLANLLHGFEWKLPGDMKKEDLDMEERFGGRTSRKNPLLVVPKPRLPLDLYSL  532



>gb|ABC69388.1| CYP92B2v2 [Nicotiana tabacum]
Length=508

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 355/479 (74%), Gaps = 6/479 (1%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             +PPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS PV+V SSAEMAK FLK 
Sbjct  33    IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFLKV  92

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR+ L ++F+ KRL+S+EYIR +E
Sbjct  93    HDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTPKRLDSFEYIRVEE  152

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLD  869
              ++++ QL   S A KP  L+D++S  SL  ++ MVL   Y  ES    V   + + ++D
Sbjct  153   RQALISQL--NSLAGKPFFLKDHLSRFSLCSMTRMVLSNKYFGES---TVRVEDLQYLVD  207

Query  870   ELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV  1049
             + FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   VLD+H A++ AE + FV
Sbjct  208   QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAKKNAEKN-FV  266

Query  1050  AKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFK  1229
              KDMVD+LL++A+DP+LEVKL    VK  +QDLL GGT++ T  V+WA  ELL++P + +
Sbjct  267   PKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTAAVQWAFQELLRQPRVIE  326

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDR++G++RWVEEKD   L Y++AI+KE +RLHP+  ML P    EDC VAGYDI
Sbjct  327   KATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPLGTMLAPHCAIEDCNVAGYDI  386

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGT  LV+VWT+ RDP  WD   EF+P+RF+  DID+ G +F  LPFG+GRR CPGYSL
Sbjct  387   QKGTTFLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDGHNFAFLPFGSGRRRCPGYSL  446

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             GLKVI+ +L N+LHGFNWKLP  + PE +++EE +GL+T  KFP+  ++E RL   LYS
Sbjct  447   GLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTHPKFPVPVILESRLSSDLYS  505



>ref|XP_006492022.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=528

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/477 (59%), Positives = 365/477 (77%), Gaps = 9/477 (2%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             +IGNLNL+G LPH S+  LS  YGP+MQL+FG   VVVGSSA++A+  LKT D +F  RP
Sbjct  55    LIGNLNLMGHLPHVSLQSLSQIYGPLMQLKFGLDTVVVGSSAQVAELILKTHDTSFASRP  114

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
                AGK+  YNYS +  +PYGPY RQAR++ +TEL + KRL  +EY+R +E K+ L +LY
Sbjct  115   ALLAGKHANYNYSVLATAPYGPYLRQARKIYITELLNPKRLAEFEYMRVEERKAFLCKLY  174

Query  717   TASS-AQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGV  893
              +SS +  PI LRD +  L+L ++S M+LGK Y  E E  +V+P EF +++DELFL++GV
Sbjct  175   KSSSNSSMPIHLRDRLYMLTLAIMSRMLLGKRYTEEDENNVVTPKEFTEIVDELFLISGV  234

Query  894   LNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLD--EHNARR--VAEGDSFVAKDM  1061
             L+IGD+IPW+ FLDLQG +KRMKA+ KK ++F E+VLD  EH+ARR  V E     A DM
Sbjct  235   LDIGDAIPWLSFLDLQGNVKRMKAVKKKANKFYEYVLDDHEHHARRKWVKEHG---ANDM  291

Query  1062  VDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATD  1241
             VD+LLQLADDP+LEVKLER  +KA  QDLL  G + S++ +EWA++ELLKKPE+ +KAT 
Sbjct  292   VDVLLQLADDPTLEVKLERDHIKASNQDLLLAGIDTSSITIEWAMTELLKKPEVIQKATK  351

Query  1242  ELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGT  1421
             ELD  IG+ +WVEEKD+ NLPY+QAIVKEVMRLHP A +LVPRL R++CK+ GYDI K +
Sbjct  352   ELDTAIGRNKWVEEKDIANLPYVQAIVKEVMRLHPAATLLVPRLARKNCKLDGYDIIKNS  411

Query  1422  RVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKV  1601
             RV+++VW + RDP +W+ P+EF P+R IGK+IDV G +FELLPFG GRRMC GY+LGLK 
Sbjct  412   RVIINVWAIGRDPTIWEKPDEFCPERLIGKEIDVVGHNFELLPFGVGRRMCAGYALGLKT  471

Query  1602  IQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTV-IEPRLPMHLYSV  1769
             +Q++L NLLHGF WKLP D+  E L+MEE FGL+T KK PL  +  +PRLP+HLYS+
Sbjct  472   VQSTLANLLHGFEWKLPGDMKKEDLDMEERFGLTTSKKNPLLVIPNKPRLPLHLYSL  528



>ref|XP_009605293.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 355/479 (74%), Gaps = 6/479 (1%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             +PPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS PV+V SSAEMAK FLK 
Sbjct  33    IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFLKV  92

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR+ L ++F+ KRL+S+EYIR +E
Sbjct  93    HDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTPKRLDSFEYIRVEE  152

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLD  869
              ++++ QL   S A KP  L+D++S  SL  ++ MVL   Y  ES    V   + + ++D
Sbjct  153   RQALISQL--NSLAGKPFFLKDHLSRFSLCSMTRMVLSNKYFGES---TVRVEDLQYLVD  207

Query  870   ELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV  1049
             + FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   VLD+H A++ AE + FV
Sbjct  208   QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAKKNAEKN-FV  266

Query  1050  AKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFK  1229
              KDMVD+LL++A+DP+LEVKL    VK  +QDLL GGT++ T  V+WA  ELL++P + +
Sbjct  267   PKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTAAVQWAFQELLRQPRVIE  326

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDR++G++RWVEEKD   L Y++AI+KE +RLHP+  ML P    EDC VAGYDI
Sbjct  327   KATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPLGTMLAPHCAIEDCNVAGYDI  386

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGT VLV+VWT+ RDP  WD   EF+P+RF+  DID+ G +F  LPF +GRR CPGYSL
Sbjct  387   QKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDGHNFAFLPFSSGRRRCPGYSL  446

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             GLKVI+ +L N+LHGFNWKLP  + PE +++EE +GL+T  KFP+  ++E RL   LYS
Sbjct  447   GLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTHPKFPVPVILESRLSSDLYS  505



>gb|ABC69387.1| CYP92B2v3 [Nicotiana tabacum]
Length=508

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 355/479 (74%), Gaps = 6/479 (1%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             +PPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS PV+V SSAEMAK FLK 
Sbjct  33    IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFLKV  92

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQE  689
              D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR+ L ++F+ KRL+S+EYIR +E
Sbjct  93    HDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTPKRLDSFEYIRVEE  152

Query  690   LKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLD  869
              ++++ QL   S A KP  L+D++S  SL  ++ MVL   Y  ES    V   + + ++D
Sbjct  153   RQALISQL--NSLAGKPFFLKDHLSRFSLCSMTRMVLSNKYFGES---TVRVEDLQYLVD  207

Query  870   ELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV  1049
             + FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   VLD+  A++ AE + FV
Sbjct  208   QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDRRAKKNAEKN-FV  266

Query  1050  AKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFK  1229
              KDMVD+LL++A+DP+LEVKL    VK  +QDLL GGT++ T  V+WA  ELL++P + +
Sbjct  267   PKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTAAVQWAFQELLRRPRVIE  326

Query  1230  KATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDI  1409
             KAT+ELDR++G++RWVEEKD   L Y++AI+KE +RLHP+  ML P    EDC VAGYDI
Sbjct  327   KATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPLGTMLAPHCAIEDCNVAGYDI  386

Query  1410  PKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSL  1589
              KGT VLV+VWT+ RDP  WD   EF+P+RF+  DID+ G +F  LPFG+GRR CPGYSL
Sbjct  387   QKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDGHNFAFLPFGSGRRRCPGYSL  446

Query  1590  GLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             GLKVI+ +L N+LHGFNWKLP  + PE +++EE +GL+T  KFP+  ++E RL   LYS
Sbjct  447   GLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTHPKFPVPVILESRLSSDLYS  505



>ref|XP_006363444.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=506

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/502 (54%), Positives = 360/502 (72%), Gaps = 7/502 (1%)
 Frame = +3

Query  261   AAWVSTIALLL-LAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIM  437
              +W+  +A +L L  H     K  LPPGPKPWP+IGNLNL+GSLPH S H LS KYG +M
Sbjct  11    GSWLLALAFVLKLFNH----PKRKLPPGPKPWPIIGNLNLLGSLPHVSFHHLSKKYGDLM  66

Query  438   QLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQA  617
              L+FGS PV+V SS EMAK  LKT D  F  RP+ AAGKYT+Y YSD+TW+PYG YWRQA
Sbjct  67    LLKFGSKPVLVASSPEMAKEILKTHDTIFASRPELAAGKYTSYYYSDMTWAPYGAYWRQA  126

Query  618   RRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMV  797
             R++ LTE+FS KRL+S+EYIR +E ++++  L+  S   KP+LL+D++   +L  IS +V
Sbjct  127   RKIYLTEIFSPKRLDSFEYIRVEEGQTLISGLFPLSG--KPVLLKDHLPRFTLRTISRLV  184

Query  798   LGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKK  977
             +   Y +    +I++    ++MLDE F+L GV+NIGD IPW+ + DLQGY+K+MK L K 
Sbjct  185   MSDKYYSSHASSIITLETLQQMLDEWFILGGVINIGDWIPWLSWFDLQGYVKQMKTLGKN  244

Query  978   FDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAG  1157
             F  F ++V+++H A +    + +V KDMVD LL LADDP+LEVKL    +   + DL++G
Sbjct  245   FKEFFKYVIEDHKAIKTQIEEDYVPKDMVDTLLHLADDPNLEVKLTSDRLMGLMHDLISG  304

Query  1158  GTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMR  1337
             GT+ S   +EWA  ELL++P I  KA  ELDR IG++RWVEE+D   LPYI AI+KE  R
Sbjct  305   GTDTSAATIEWAFQELLRRPNIMDKAHQELDRAIGKERWVEEEDFSKLPYIDAIIKETFR  364

Query  1338  LHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDI  1517
             LHP+  +L P    EDC VAGYDIPKGT V V+ W++ R+P  WD   EFIP+RFI  +I
Sbjct  365   LHPLCALLPPHYSIEDCNVAGYDIPKGTIVYVNAWSLGRNPKYWDRAEEFIPERFIENNI  424

Query  1518  DVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFG  1697
             D+KG +F LLPFG+GRR CPGY+LG+KV++ ++ NLLHGFNWKL  D+ PE ++MEEI+G
Sbjct  425   DIKGQNFALLPFGSGRRRCPGYNLGMKVVRTTMANLLHGFNWKLAGDMRPEDISMEEIYG  484

Query  1698  LSTPKKFPLTTVIEPRLPMHLY  1763
             L+T  K P++ ++EPRLP HLY
Sbjct  485   LTTHPKKPISVIMEPRLPFHLY  506



>ref|NP_001151273.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG42190.1| flavonoid 3-monooxygenase [Zea mays]
Length=510

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/477 (58%), Positives = 353/477 (74%), Gaps = 18/477 (4%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             +IGNLNL+G LPHRS+++LS +YGP+MQL+FGS PVVVG+S EMAK FLKT D  F DRP
Sbjct  43    IIGNLNLVGELPHRSMNELSKRYGPLMQLRFGSLPVVVGASVEMAKLFLKTNDAAFSDRP  102

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             + A GKY  Y++S++         RQARR+C TELFSA RLES+E+IR +E++ +L+QL 
Sbjct  103   RFAVGKYIAYDFSEV---------RQARRICATELFSATRLESFEHIRDEEVRVMLQQLR  153

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE----SEG---AIVSPNEFRKMLDEL  875
              A  A + +LLRDY+  L+L VIS +VLGK Y+ E     EG     ++P EF +M+DE 
Sbjct  154   QA--AGRTVLLRDYLQMLTLGVISRIVLGKKYVQEEAADGEGDSAPAMTPAEFGEMVDEF  211

Query  876   FLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAK  1055
              +L+GV NIGD IPW+D+LDLQGY+ RMK +  +F R LE +LD HN RR+ EG +FVAK
Sbjct  212   LVLHGVFNIGDYIPWLDWLDLQGYVARMKRMKARFGRLLERLLDVHNERRLREGGNFVAK  271

Query  1056  DMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKA  1235
             DM+D+LLQLADD SLEV+L R  VKA  QDL+ GGT+ S   +EWA+SELLK P++  KA
Sbjct  272   DMLDVLLQLADDTSLEVQLNRDNVKAITQDLIIGGTDTSAKALEWAVSELLKNPKVLAKA  331

Query  1236  TDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPK  1415
             T+ELD VIG  R V E D+P LPYI+A++KE +RLHP APML P + RED  V GYD+  
Sbjct  332   TEELDHVIGPDRLVTESDLPRLPYIEAVLKETLRLHPAAPMLAPHVAREDTSVDGYDVLA  391

Query  1416  GTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGL  1595
             GT V ++VW + RDPALWD P EF P+RF    I V+G DF+LLPFG+GRRMCPG +L L
Sbjct  392   GTVVFINVWAIGRDPALWDAPEEFRPERFFESKIGVRGHDFQLLPFGSGRRMCPGINLAL  451

Query  1596  KVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             KV+  +L NLLHGF W+LP+ VT E+L+MEE F L+ P+KFPL  V+EPRLP  LY+
Sbjct  452   KVMALTLANLLHGFKWRLPDGVTAEELSMEEAFQLTVPRKFPLEAVVEPRLPDRLYT  508



>ref|XP_006465159.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=528

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/476 (59%), Positives = 361/476 (76%), Gaps = 9/476 (2%)
 Frame = +3

Query  360   IGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPK  539
             IGNLNLIG LPH S+H LS KYGP++QL+FG   VVVGSSAE+A+  LKT D++F  RP 
Sbjct  54    IGNLNLIGQLPHVSLHSLSQKYGPLIQLKFGLDTVVVGSSAEVAELILKTHDLSFASRPA  113

Query  540   TAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY-  716
               AGK+  +N+  +  +PYGP+WRQ R+   T++ S KRL  +EYIR +E K++L ++Y 
Sbjct  114   LLAGKHANFNHLVMATAPYGPHWRQTRKTFKTQILSPKRLGQFEYIRVEERKALLFKMYK  173

Query  717   ---TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLN  887
                ++S +  P+ L+D +   +L  +S M+LGK Y  + E  IV+  EF +++DE+FL++
Sbjct  174   SSSSSSPSSTPVHLKDRLYMFNLATMSRMLLGKRYTEDDENNIVTAKEFTEIVDEVFLIS  233

Query  888   GVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFV---AKD  1058
             G+L+IGD+IPW+ FLDLQG +KRMKA+ KK D+F EHVLDEH   R A+  SF     KD
Sbjct  234   GILDIGDAIPWLAFLDLQGNVKRMKAVKKKADKFYEHVLDEHE--RHAKRKSFNEHGTKD  291

Query  1059  MVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKAT  1238
             MVD+LLQLADDP+LEVK+ER  +KA IQDLL GG E S +  EWA+SELLK P + +KAT
Sbjct  292   MVDVLLQLADDPTLEVKVERDHIKAAIQDLLLGGIETSAITTEWAMSELLKNPRVIQKAT  351

Query  1239  DELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKG  1418
             +ELDRVIG+ +WVEEKD+ NLPYIQAIVKEVMRLHP A +LVPRL  E+CKVAGYDI K 
Sbjct  352   EELDRVIGRNKWVEEKDIVNLPYIQAIVKEVMRLHPPATLLVPRLAGENCKVAGYDIIKN  411

Query  1419  TRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLK  1598
             +RV+V+VW + RDP LW+ PNEF P+RFIGK+IDV G +FELLPFGAGRRMC GY+LGL 
Sbjct  412   SRVIVNVWAIGRDPTLWEKPNEFCPERFIGKEIDVVGHNFELLPFGAGRRMCVGYALGLI  471

Query  1599  VIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
              +Q++L NLLHGF WKLP +V  E L+MEE FG++T +K PL  V +PRLP+ LYS
Sbjct  472   TVQSTLANLLHGFEWKLPGNVRKEDLDMEERFGVTTSRKNPLLVVPKPRLPLDLYS  527



>ref|XP_006355423.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=500

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/503 (55%), Positives = 358/503 (71%), Gaps = 12/503 (2%)
 Frame = +3

Query  264   AWVSTIALLLLAKHLRWRRKLH--LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIM  437
             A    + L  L K    RR ++  LPPGPKPWP+IGNLNL+G +PH+S   LS KYG +M
Sbjct  6     ALAGLVVLAFLCKITTSRRPVNRKLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELM  65

Query  438   QLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQA  617
              L+FGS PV+V SSAEMAK FLK  D NF  RP  A GKYT+YNY D+TW+PYGPYWRQA
Sbjct  66    LLKFGSRPVLVASSAEMAKQFLKIHDANFASRPLLAGGKYTSYNYCDMTWAPYGPYWRQA  125

Query  618   RRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMV  797
             RR+ L E+F+ KRL+S+EYIR +E ++ + QL   S A KP  L+D++S  SL  ++ MV
Sbjct  126   RRIYLNEIFTPKRLDSFEYIRVEERQTFISQL--NSLAGKPFFLKDHLSRFSLCSMTRMV  183

Query  798   LGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKK  977
             L   Y  ES    V   + + ++D+ FLLNG  NIGD IPW+  LDLQGY+K+MKAL + 
Sbjct  184   LSNKYFGES---TVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSLLDLQGYVKQMKALKRS  240

Query  978   FDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAG  1157
             FD+F   VLD+H A++ AE      KDMVD+LLQ+A DP+LEVKL    VK  +QDLL G
Sbjct  241   FDKFHNIVLDDHRAKKNAE-----KKDMVDVLLQMAQDPTLEVKLTDDCVKGLMQDLLTG  295

Query  1158  GTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMR  1337
             GT++ T  V+WA  ELL++P +  KA  ELD+V+G++RWVEE+D   L YI+AI+KE +R
Sbjct  296   GTDSLTAAVQWAFQELLRQPRVIDKAIQELDQVVGKERWVEERDCSQLLYIEAILKETLR  355

Query  1338  LHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDI  1517
             LHP+  ML P    EDC VAGYDI KGT VLV+VWT+ RDP  WD   EF+P+RF+ KDI
Sbjct  356   LHPLGTMLAPHCAIEDCNVAGYDIEKGTTVLVNVWTIGRDPKYWDRAEEFLPERFLEKDI  415

Query  1518  DVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFG  1697
             D+ G +F  LPFG+GRR CPGYSLGLKVI+A+L N+LHGF WKLP  +  E +++EE +G
Sbjct  416   DMDGHNFSFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFIWKLPQGMNTESISVEEHYG  475

Query  1698  LSTPKKFPLTTVIEPRLPMHLYS  1766
             L+T  KFP+  ++EPRL  HLYS
Sbjct  476   LTTHPKFPVPVILEPRLSSHLYS  498



>ref|XP_008242317.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=517

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/475 (59%), Positives = 354/475 (75%), Gaps = 9/475 (2%)
 Frame = +3

Query  351   WPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVD  530
             WP+IGNLNL+G LPH+S H  S  YGPIMQ++ GS PVVV SS EMAK FLKT D  F  
Sbjct  48    WPIIGNLNLVGPLPHQSAHKWSQIYGPIMQIKLGSCPVVVASSPEMAKQFLKTHDRIFAS  107

Query  531   RPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQ  710
             RP+TAAGKY  Y Y  +T +PYGPYWRQ R++  +ELFS K LES+ YIR +E ++ + +
Sbjct  108   RPQTAAGKYLNYGYQSVTHAPYGPYWRQGRKILTSELFSPKSLESFRYIRVEENRTFISR  167

Query  711   LYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNEFRKMLDELFLL  884
             LY  S   K ++L+ ++S L+L+V+  +VLGK +  L +S+ + +S  E + M DEL+LL
Sbjct  168   LYAMSG--KAVVLKQHLSRLTLSVLCRVVLGKDHFSLTKSKSSTISLKESQDMTDELYLL  225

Query  885   NGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEG-DSFVAKDM  1061
              GV NIGD IPW+D  DLQGY+KRMKAL KK D+F E VL+EH AR+  EG + FVAKDM
Sbjct  226   AGVANIGDWIPWLDVFDLQGYVKRMKALQKKLDQFYEFVLNEHKARK--EGVEEFVAKDM  283

Query  1062  VDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKAT  1238
             VDLLLQ  DDP+ LEVKL    VKAF QDL+ GG++NS   +EWA+SEL+K+P + +KAT
Sbjct  284   VDLLLQQVDDPNDLEVKLTYDTVKAFTQDLVIGGSDNSATTLEWAMSELIKQPNLIEKAT  343

Query  1239  DELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKG  1418
             +ELDRVIG++RWVEE+D+ NLPYI AI+KE MR HPV  + +P L  EDC VAGYD+ KG
Sbjct  344   EELDRVIGRERWVEEEDLENLPYIDAIMKEAMRKHPVI-VFLPHLALEDCNVAGYDVCKG  402

Query  1419  TRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLK  1598
             T VLV++W++ RDP LWD P+EF P+RF+GK IDVKG  FE LPFG+GRRMCPGY   LK
Sbjct  403   TLVLVNIWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGRRMCPGYGHALK  462

Query  1599  VIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLY  1763
             ++ + L N+LHGF WKLP +V  E L MEE +GL T +KFPL  V EPRLP+ LY
Sbjct  463   MVGSCLANMLHGFTWKLPENVKTEDLGMEETYGLLTHRKFPLVVVTEPRLPIRLY  517



>gb|ABC69386.1| CYP92B2v1 [Nicotiana tabacum]
Length=509

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 356/480 (74%), Gaps = 7/480 (1%)
 Frame = +3

Query  330   LPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKT  509
             +PPGPKPWP+IGNLNL+G +PH+S   LS KYG +M L+FGS PV+V SSAEMAK FLK 
Sbjct  33    IPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFLKV  92

Query  510   MDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARR-MCLTELFSAKRLESYEYIRSQ  686
              D NF  RP  A GKYT+YNY D+TW+PYGPYWRQARR + L ++F+ KRL+S+EYIR +
Sbjct  93    HDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRRIYLNQIFTPKRLDSFEYIRVE  152

Query  687   ELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKML  866
             E ++++ QL   S A KP  L+D++S  SL  ++ MVL   Y  ES    V   + + ++
Sbjct  153   ERQALISQL--NSLAGKPFFLKDHLSRFSLCSMTRMVLSNKYFGES---TVRVEDLQYLV  207

Query  867   DELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSF  1046
             D+ FLLNG  NIGD IPW+ FLDLQGY+K+MKAL + FD+F   VLD+H A++ AE + F
Sbjct  208   DQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAKKNAEKN-F  266

Query  1047  VAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIF  1226
             V KDMVD+LL++A+DP+LEVKL    VK  +QDLL GGT++ T  V+WA  ELL++P + 
Sbjct  267   VPKDMVDVLLKMAEDPNLEVKLTNDCVKGLMQDLLTGGTDSLTAAVQWAFQELLRQPRVI  326

Query  1227  KKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYD  1406
             +KAT+ELDR++G++RWVEEKD   L Y++AI+KE +RLHP+  ML P    EDC VAGYD
Sbjct  327   EKATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPLGTMLAPHCAIEDCNVAGYD  386

Query  1407  IPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYS  1586
             I KGT VLV+VWT+ RDP  WD   EF+P+RF+  DID+ G +F  LPFG+GRR CPGYS
Sbjct  387   IQKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDGHNFAFLPFGSGRRRCPGYS  446

Query  1587  LGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             LGLKVI+ +L N+LHGFNWKLP  + PE +++EE +GL+T  KFP+  ++E RL   LYS
Sbjct  447   LGLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTHPKFPVPVILESRLSSDLYS  506



>tpg|DAA40165.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=543

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/477 (58%), Positives = 353/477 (74%), Gaps = 18/477 (4%)
 Frame = +3

Query  357   VIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRP  536
             +IGNLNL+G LPHRS+++LS +YGP+MQL+FGS PVVVG+S EMAK FLKT D  F DRP
Sbjct  76    IIGNLNLVGELPHRSMNELSKRYGPLMQLRFGSLPVVVGASVEMAKLFLKTNDAAFSDRP  135

Query  537   KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY  716
             + A GKY  Y++S++         RQARR+C TELFSA RLES+E+IR +E++ +L+QL 
Sbjct  136   RFAVGKYIAYDFSEV---------RQARRICATELFSATRLESFEHIRDEEVRVMLQQLR  186

Query  717   TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE----SEG---AIVSPNEFRKMLDEL  875
              A  A + +LLRDY+  L+L VIS +VLGK Y+ E     EG     ++P EF +M+DE 
Sbjct  187   QA--AGRTVLLRDYLQMLTLGVISRIVLGKKYVQEEAADGEGDSAPAMTPAEFGEMVDEF  244

Query  876   FLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGDSFVAK  1055
              +L+GV NIGD IPW+D+LDLQGY+ RMK +  +F R LE +LD HN RR+ EG +FVAK
Sbjct  245   LVLHGVFNIGDYIPWLDWLDLQGYVARMKRMKARFGRLLERLLDVHNERRLREGGNFVAK  304

Query  1056  DMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKA  1235
             DM+D+LLQLADD SLEV+L R  VKA  QDL+ GGT+ S   +EWA+SELLK P++  KA
Sbjct  305   DMLDVLLQLADDTSLEVQLNRDNVKAITQDLIIGGTDTSAKALEWAVSELLKNPKVLAKA  364

Query  1236  TDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPK  1415
             T+ELD VIG  R V E D+P LPYI+A++KE +RLHP APML P + RED  V GYD+  
Sbjct  365   TEELDHVIGPDRLVTESDLPRLPYIEAVLKETLRLHPAAPMLAPHVAREDTSVDGYDVLA  424

Query  1416  GTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGL  1595
             GT V ++VW + RDPALWD P EF P+RF    I V+G DF+LLPFG+GRRMCPG +L L
Sbjct  425   GTVVFINVWAIGRDPALWDAPEEFRPERFFESKIGVRGHDFQLLPFGSGRRMCPGINLAL  484

Query  1596  KVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYS  1766
             KV+  +L NLLHGF W+LP+ VT E+L+MEE F L+ P+KFPL  V+EPRLP  LY+
Sbjct  485   KVMALTLANLLHGFKWRLPDGVTAEELSMEEAFQLTVPRKFPLEAVVEPRLPDRLYT  541



>ref|XP_006477121.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=533

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/528 (55%), Positives = 383/528 (73%), Gaps = 15/528 (3%)
 Frame = +3

Query  222   SMESPTATWISYAA-AWVSTIALLLLAKHLRWRRKLHL--PPGPKPWPVIGNLNLIGSLP  392
             + ++P+ +  SY+  A+   + LLL  +H+ +R K++L  PPGPKPW +I NLNLIG   
Sbjct  9     TADNPSNSTRSYSILAFFLPVLLLLYYRHI-FRNKINLLPPPGPKPWHLIVNLNLIGQNL  67

Query  393   HRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNY  572
             H S+  LS KYGP+MQL+FG   VVVGSSAE+A+  LKT D+ F  RP   A K+  YNY
Sbjct  68    HVSLQSLSQKYGPLMQLKFGLETVVVGSSAEVAELLLKTHDVTFASRPPLLAWKHANYNY  127

Query  573   SDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQLY------TASSAQ  734
               +  +PYGP+WRQ R++ +T+L S K L  +EYIR +E K++L +LY      ++SS+ 
Sbjct  128   LVMPGAPYGPHWRQTRKIYMTQLLSPKSLAQFEYIRIEERKALLFKLYKSSTSSSSSSSS  187

Query  735   KPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSI  914
              P+ L++ +   +L ++S M+LGK Y  E E  IV+P +F +++DELFLL GVL+IGD+I
Sbjct  188   TPVHLKERLFMFNLAIMSRMLLGKRYTEEDENNIVTPKQFTEIVDELFLLPGVLDIGDAI  247

Query  915   PWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEH---NARRVAEGDSFVAKDMVDLLLQLA  1085
             PW+ FLDLQG IKRMKA+ KK D+F EHVL EH     R++ +       D+VD+LLQLA
Sbjct  248   PWLAFLDLQGNIKRMKAVKKKIDKFYEHVLHEHERHGKRKLFKEHG--TNDIVDVLLQLA  305

Query  1086  DDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQ  1265
             DDP+LEVKLER  +KA +QDLL GG   S V +EW +SELLK PE+ +KATDELDRVIG+
Sbjct  306   DDPTLEVKLERDHIKASMQDLLVGGIGTSAVTLEWTMSELLKNPEVIQKATDELDRVIGR  365

Query  1266  KRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWT  1445
               WVEEKD+ NLPYIQAIVKEVMRLHP   +L P   RE+CKVAGY+I K +RV+V+VW 
Sbjct  366   NNWVEEKDIVNLPYIQAIVKEVMRLHPPLTLLAPHKARENCKVAGYNILKNSRVIVNVWA  425

Query  1446  VARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNL  1625
             + RDP LW+ PNEF P+RFIGK+IDV G +FELLPFG+GRRMC GY+LGLK++Q++L NL
Sbjct  426   IGRDPTLWEKPNEFCPERFIGKEIDVVGHNFELLPFGSGRRMCVGYALGLKIVQSTLANL  485

Query  1626  LHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHLYSV  1769
             LHGF WKLP D+  E L+MEE F   T +K PL  V +PRLP+ LYS+
Sbjct  486   LHGFEWKLPGDMKKEDLDMEERFSGRTSRKNPLLVVPKPRLPLDLYSL  533



>ref|XP_003581159.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=600

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/555 (51%), Positives = 382/555 (69%), Gaps = 27/555 (5%)
 Frame = +3

Query  186   KSHSIN*TNCFDSMES--PTATWISYAAAWVSTIALLLLAKHLR--WRRKLHLPPGPKPW  353
             +  S + T  F SME   P A   S+ A  ++T  LLL+ +H R   R +  LPPGPKPW
Sbjct  42    RYQSFSLTMQFKSMELALPAAWASSFLAVLMATAILLLVLRHGRNSHRHRYRLPPGPKPW  101

Query  354   PVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDR  533
             P+IGNL+L+G+LPHRS+ +LS +YGP++QL+ GSFPVVVGSSAE A+ FLKT D     R
Sbjct  102   PIIGNLHLLGALPHRSLRELSKRYGPLIQLRLGSFPVVVGSSAETARFFLKTHDAASAGR  161

Query  534   PKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQELKSILRQL  713
             P+TAAG++T YNYSD+ WSPYG +WR+ RR+CL ELFSA RL S+E+IR  E++++LR L
Sbjct  162   PRTAAGRHTAYNYSDMLWSPYGAHWRRLRRVCLAELFSAARLGSFEHIRRDEVRALLRGL  221

Query  714   YTASSAQKPIL--LRDYMSTLSLNVISWMVLGKSYLNE--SEGAIVSPNEFRKMLDELFL  881
             + AS    P++  +++++   +L +IS MVLG  Y+ +    G+ + P EF ++++E F 
Sbjct  222   HDASGIGMPVVVKVKEHLFAATLGMISRMVLGNKYVGKDAGSGSAMEPEEFMRVMEEFFF  281

Query  882   LNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD-SFVAKD  1058
             LNG LN+GD +PW+ +LDLQGY+ RMK ++   D F+E VLDEH+ARR  EGD SFVAKD
Sbjct  282   LNGALNVGDFVPWLGWLDLQGYVGRMKNVAWALDAFMERVLDEHDARRRLEGDGSFVAKD  341

Query  1059  MVDLL-----LQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPEI  1223
             M D+L      Q+         LER  VKA   DL+AGGT  + V +EWA+SELL+ P  
Sbjct  342   MADVLRLQQRRQIESGDEEGEPLERDSVKALAMDLIAGGTNTNAVTLEWAMSELLRNPAA  401

Query  1224  FKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV---  1394
                A +EL RV+G+ R V E D+ +LPY++A+VKE +RLHPV  +L P   +ED  V   
Sbjct  402   MDAAGEELGRVVGRGRLVREDDIQSLPYLRAVVKETLRLHPVGTLLAPHEAQEDATVPAF  461

Query  1395  -----AGYDIPKGTRVLVSVWTVARDPALWD-NPNEFIPDRFI----GKDIDVKGCDFEL  1544
                    YD+P GTRVLV+VW +ARDPALW   P EF P+RF+       +DV G D EL
Sbjct  462   VSGNGVSYDVPAGTRVLVNVWAIARDPALWGPKPEEFRPERFLEGGGNSGVDVVGQDMEL  521

Query  1545  LPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPL  1724
             LPFGAGRRMCPGY LG+KV+Q  L NL+HGF W+LP+ V  E+L M+E+FGL+T +KFPL
Sbjct  522   LPFGAGRRMCPGYGLGIKVVQICLANLIHGFAWRLPDGVAAEELGMDEVFGLTTSRKFPL  581

Query  1725  TTVIEPRLPMHLYSV  1769
               V+EP+LP HLY++
Sbjct  582   EAVLEPKLPAHLYTL  596



>emb|CAN82001.1| hypothetical protein VITISV_023196 [Vitis vinifera]
Length=421

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/445 (62%), Positives = 340/445 (76%), Gaps = 26/445 (6%)
 Frame = +3

Query  435   MQLQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQ  614
             M+L+FGSFPVVV SS+EM K FLKT D  F  RP TAAGKYT YNYS+ITW+PYGPYWRQ
Sbjct  1     MELRFGSFPVVVASSSEMXKQFLKTNDHLFASRPHTAAGKYTNYNYSNITWAPYGPYWRQ  60

Query  615   ARRMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWM  794
              R++ LTE+FS+KRLESYEYI  +E ++ + +LY  S   KP++L++++S ++L+VIS +
Sbjct  61    GRKIFLTEMFSSKRLESYEYIXVEERQAFISRLYALSG--KPVMLKEHLSRVTLSVISRI  118

Query  795   VLGKSYLNESEG--AIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
             VLG  Y +E E   ++V+  E +KML EL LLNGVLNIG  IPWI FLDLQGY+KRMKAL
Sbjct  119   VLGXKYFSEFESGRSMVTVEECQKMLVELLLLNGVLNIGXWIPWIAFLDLQGYVKRMKAL  178

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
               KFDRF +HVL++H ARR  E + FVAKDMVD+LL+LADDP +EVKL   G+K F Q  
Sbjct  179   RHKFDRFYDHVLEKHRARR--EXEDFVAKDMVDMLLRLADDPDIEVKLTTDGIKGFTQ--  234

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
                               +L++P I  KAT+ELDRVIG+ RWVEEKD+P LPYI AIVKE
Sbjct  235   ------------------VLRQPNIANKATEELDRVIGRNRWVEEKDIPQLPYIDAIVKE  276

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIG  1508
              MRLHPVA +L P L  +DC VAGYDI KGTRVL++ W++ RDP LWD P EF P+RF+G
Sbjct  277   TMRLHPVAVLLAPHLALQDCHVAGYDIRKGTRVLINTWSIGRDPNLWDAPEEFFPERFLG  336

Query  1509  KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEE  1688
             K IDVKG +FELLPFG+GRRMCPGYSL LK+I +SL N+LHGF+WKLP D+ PE+LN+EE
Sbjct  337   KAIDVKGQNFELLPFGSGRRMCPGYSLALKMIGSSLANMLHGFHWKLPGDMKPEELNIEE  396

Query  1689  IFGLSTPKKFPLTTVIEPRLPMHLY  1763
             +FGL+TP+K PL   +EPRLP HLY
Sbjct  397   VFGLTTPRKVPLVAFMEPRLPSHLY  421



>ref|XP_011070722.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=504

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/491 (55%), Positives = 360/491 (73%), Gaps = 8/491 (2%)
 Frame = +3

Query  279   IALLLLAKHLRWRR--KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFG  452
             +ALL     + ++R  +  LPPGPKPWP+IGNLNLIGSLPH+S+H LS KYG IMQL+FG
Sbjct  13    VALLTFLSKIIYKRCPERKLPPGPKPWPIIGNLNLIGSLPHQSLHLLSQKYGEIMQLKFG  72

Query  453   SFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCL  632
              FPVVV SS EMAK FLK  D+ F  RP  AAGKYT +NYSD+ W+ YGP+WRQAR++ L
Sbjct  73    KFPVVVASSPEMAKQFLKVHDMAFAGRPALAAGKYTGFNYSDMAWASYGPFWRQARKIFL  132

Query  633   TELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY  812
              ++FSAK+LES+E IR ++ ++   +L++ S   KP++L+D++   +L+ +S MVLG  Y
Sbjct  133   IQVFSAKKLESFEDIRVEKRRNFFSRLHSLSG--KPVVLKDHLFRHTLSTMSRMVLGSKY  190

Query  813   LNESE---GAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFD  983
              +ESE    +IV  ++ + MLDE FLLNGV NIGD IPW+ FLDLQGY+KRMKAL K++D
Sbjct  191   FSESEDDKSSIVKLDDLQAMLDEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALYKRYD  250

Query  984   RFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGT  1163
             +F  +V+D+H  RR  + DS + +D+VD+LLQ A+DP L+VKL R  +K  + +LLAGGT
Sbjct  251   KFHNYVIDDHQTRRAKDKDS-IPRDVVDVLLQQAEDPDLDVKLTRDHIKGLLHNLLAGGT  309

Query  1164  ENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLH  1343
             + +   +EWAI ++LK P +  KA +ELDRVIG+ RWVEE D   LPYI AI+ E MRLH
Sbjct  310   DTAAATIEWAIHDILKNPRVIGKAKEELDRVIGRNRWVEEDDFSRLPYIDAIIMESMRLH  369

Query  1344  PVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDV  1523
             P+   L+P    EDCKVAGYDI KGT +L++ W++ RDP  WD P EF+P+RF+GK ID+
Sbjct  370   PLGTFLIPHSAMEDCKVAGYDISKGTMILINTWSIGRDPNSWDAPEEFLPERFLGKAIDI  429

Query  1524  KGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLS  1703
              G +F LLPFG+GRR CPGY LGLK+++  L NLLHGFN KL +D+ PE + MEE +GL+
Sbjct  430   TGSNFALLPFGSGRRRCPGYDLGLKMVRTMLANLLHGFNLKLVDDMRPEDVCMEESYGLT  489

Query  1704  TPKKFPLTTVI  1736
             T  +   T ++
Sbjct  490   THCQTTFTELV  500



>emb|CDP20032.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/485 (56%), Positives = 355/485 (73%), Gaps = 5/485 (1%)
 Frame = +3

Query  315   RRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAK  494
             R KL+ PPGPKPWP+IGNLNL+GS PH+S+H LS KYG IMQL+FGS PVVV SS EMAK
Sbjct  27    RLKLNHPPGPKPWPIIGNLNLLGSNPHQSLHLLSQKYGEIMQLKFGSSPVVVASSPEMAK  86

Query  495   TFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEY  674
              FL+T D  F  RP TAA KYT+YN S + W+PYGP+WRQAR++CLT++FS KRL+ YE 
Sbjct  87    EFLQTHDNIFASRPTTAAAKYTSYNCSGMLWAPYGPHWRQARKICLTQIFSPKRLDRYES  146

Query  675   IRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG--AIVSPN  848
             IR +E  + + +LY  S   KP+LLRD++   +L+    MVL   Y  +SEG  ++V+  
Sbjct  147   IRIEERHAFMSRLYALSG--KPVLLRDHLIRFTLSAACQMVLSNKYFAQSEGDGSVVTFE  204

Query  849   EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRV  1028
             E ++M+D  F L GV NIGD IPW+D  DLQG +K+MK L KKFDRF  HVLD+H A+R 
Sbjct  205   ELQEMIDTWFSLGGVFNIGDWIPWLDRFDLQGCVKQMKELYKKFDRFHNHVLDDHRAKRK  264

Query  1029  AEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELL  1208
              E D F+ KDMVD+LLQ A+DP L+VKL    +K  I DLLAGGT+ S   VEWA++ELL
Sbjct  265   TEKD-FIPKDMVDILLQYAEDPDLQVKLTGDQMKGLILDLLAGGTDTSASTVEWAMNELL  323

Query  1209  KKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDC  1388
             K P + +KAT+ELDRVIG+ +WVEE D   LP+++AI+KE  RLHP+A +L P    ED 
Sbjct  324   KHPHLIEKATEELDRVIGRDKWVEEADFSKLPFLEAIIKETFRLHPIATLLPPHHAIEDG  383

Query  1389  KVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRR  1568
              VAGY IPKGT V ++  ++ R+   WD+P EF+P+R++ KDID+KG +F LLPFG+GRR
Sbjct  384   TVAGYHIPKGTVVFINTRSIGRNSKYWDSPEEFMPERYLEKDIDMKGQNFALLPFGSGRR  443

Query  1569  MCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRL  1748
             MCPGY L LK++   L NLLHGFNWKLP+ + PE++ MEE++G  T  + P+  + EPRL
Sbjct  444   MCPGYVLALKLVGTMLANLLHGFNWKLPHGMKPEEICMEELYGFITHPRTPVAMIPEPRL  503

Query  1749  PMHLY  1763
             P++LY
Sbjct  504   PVNLY  508



>ref|XP_004237819.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/501 (54%), Positives = 361/501 (72%), Gaps = 5/501 (1%)
 Frame = +3

Query  261   AAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQ  440
              +W+   A +L  K L    K  LPPGPKPWP+IGNLNL+GSLPH S+H LS KYG +M 
Sbjct  11    GSWLFAFAFVL--KILNHPAKRKLPPGPKPWPIIGNLNLLGSLPHVSLHHLSQKYGDLML  68

Query  441   LQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQAR  620
             L+FGS PV+V SS EMAK  LKT D  F  RP+ AAGKYT+YNYSD+TW+PYG +WRQAR
Sbjct  69    LKFGSKPVLVASSPEMAKEILKTHDAIFASRPELAAGKYTSYNYSDMTWAPYGAHWRQAR  128

Query  621   RMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL  800
             R+ LTE+FS KRL+S+E+IR +E ++++ +L+  S   KP+LL+D++   +L  IS +V+
Sbjct  129   RIYLTEIFSPKRLDSFEHIRVEEGRTLISRLFPLSG--KPVLLKDHLPRFTLRTISRLVM  186

Query  801   GKSYLNESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKF  980
                Y N+ + +I++    ++MLDE FLL GV+NIGD IPW+ + DLQGY+K+MK L K F
Sbjct  187   SDKYYNDDQ-SIITLETLQQMLDEWFLLGGVINIGDWIPWLSWFDLQGYLKQMKTLGKNF  245

Query  981   DRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGG  1160
               F  +V+++H A +    + +VAKDMVD LL  ADDP+L+VKL    +   I DL++G 
Sbjct  246   TIFFNYVIEDHKATKREIEEDYVAKDMVDTLLHFADDPNLDVKLTSDRLMGLIHDLISGA  305

Query  1161  TENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRL  1340
             T+ S   +EWA  ELL+ P I +KA  ELDR IG++RWVEE+D   LPYI AI+KE  RL
Sbjct  306   TDTSAATIEWAFQELLRSPNITEKAQQELDRAIGRERWVEEEDFSKLPYIDAIIKETFRL  365

Query  1341  HPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDID  1520
             HP+  +L P    EDC VAGYDIPKGT V V+ W++ R+   WD   EFIP+RFI  +ID
Sbjct  366   HPLCALLPPHYSIEDCNVAGYDIPKGTIVYVNAWSLGRNSKYWDRAQEFIPERFIENNID  425

Query  1521  VKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGL  1700
             +KG +F LLPFG+GRR CPGYSLG+KV++ ++ NLLHGFNWKL  D+ PE ++M+EI+GL
Sbjct  426   IKGQNFALLPFGSGRRKCPGYSLGMKVVRTTMANLLHGFNWKLGGDMRPEDISMDEIYGL  485

Query  1701  STPKKFPLTTVIEPRLPMHLY  1763
             +T    P++ ++EPRLP+HLY
Sbjct  486   TTHPNKPVSVIMEPRLPLHLY  506



>ref|XP_002467849.1| hypothetical protein SORBIDRAFT_01g035150 [Sorghum bicolor]
 gb|EER94847.1| hypothetical protein SORBIDRAFT_01g035150 [Sorghum bicolor]
Length=514

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 347/488 (71%), Gaps = 14/488 (3%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGP+PWPVIGNLNLIG LPHRS+H+LS +YGP+M L+FGS P+VVGSS +MAK F
Sbjct  31    KYKLPPGPRPWPVIGNLNLIGHLPHRSMHELSTRYGPLMSLRFGSCPIVVGSSVDMAKFF  90

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D+ F+DRP  A G+Y  YNYSD+  + YGPYWRQ R++   EL SA R++SY + R
Sbjct  91    LKTHDLAFLDRPAIATGRYIFYNYSDVLMASYGPYWRQGRKLFQNELLSAGRMKSYPH-R  149

Query  681   SQELKSILRQLYTASSAQKP-----ILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSP  845
                L +    +              + L+D++S  +LN++S M LG  Y+ +  G+++ P
Sbjct  150   GGALHAAGDVVVGGGGIPHGGAVVVLKLKDHLSMATLNMVSRMALGNKYVFDGAGSLMPP  209

Query  846   NEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARR  1025
              EFR M+ E F LNGV+ +GD IPW+ FLD QGYIKRMK LSK FD FLEHVL EH+ RR
Sbjct  210   EEFRWMMQEFFFLNGVVTVGDVIPWLSFLDPQGYIKRMKRLSKMFDAFLEHVLREHSDRR  269

Query  1026  VAEGDS-FVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISE  1202
               +G+  FV +DMVD LLQLADD SLE  +ER G+K FI D++A G E S V +EWA+SE
Sbjct  270   RRQGEGRFVPRDMVDQLLQLADDASLEAPIERDGIKGFILDIIAAGAETSAVAIEWALSE  329

Query  1203  LLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRE  1382
             LL+ PE   KATDELDRV+G  R V E DMP LPY++A+VKE +R+HP+AP+LVPRL RE
Sbjct  330   LLRNPEAMAKATDELDRVVGGSRLVSEADMPCLPYLEAVVKETLRVHPLAPLLVPRLSRE  389

Query  1383  DCKVAGYDIPKGTRVLVSVWTVARDPALW-DNPNEFIPDRFIGKDIDVKGCDFELLPFGA  1559
             D        P GTRV V+VW +ARDPA+W D   EF P+RF+G  +DVKG D E LPFG+
Sbjct  390   DTS------PAGTRVFVNVWAIARDPAVWGDAAEEFRPERFVGSTVDVKGHDLEFLPFGS  443

Query  1560  GRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIE  1739
             GRRMCPG  LG+K++Q +L NLLH F W+LP+ V  + L+MEE FG+S P+  PL  V E
Sbjct  444   GRRMCPGLGLGMKMVQLTLANLLHAFAWRLPDGVGVDDLSMEEKFGMSIPRAVPLEAVPE  503

Query  1740  PRLPMHLY  1763
             P+LP HLY
Sbjct  504   PKLPAHLY  511



>ref|XP_006648650.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=518

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/487 (56%), Positives = 353/487 (72%), Gaps = 31/487 (6%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             RK ++PPGP+PWPVIGNLNLIG LPHRSIH LS ++GP+M L+FGSFPVVV SS +MA+ 
Sbjct  48    RKHNIPPGPRPWPVIGNLNLIGPLPHRSIHALSARHGPLMSLRFGSFPVVVASSVDMARY  107

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D+ F+DRP+TAAGKYT YN++ + WS YG YWRQAR++ +TEL SA+RL S E++
Sbjct  108   FLKTNDLAFLDRPRTAAGKYTVYNFTGMLWSHYGEYWRQARKVWVTELLSARRLASAEHV  167

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG----AIVSP  845
             R++E++++LR                            MVLGK Y+ E       A  +P
Sbjct  168   RAEEVRAMLRVA--------------------------MVLGKKYIVEGADPAAAAAATP  201

Query  846   NEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARR  1025
              +FR M++E+F LNGV N+GD +PW+ +LD QGYI RMK L K FDRFLE VL+EH+ RR
Sbjct  202   EQFRWMIEEIFFLNGVFNVGDMVPWLAWLDPQGYIGRMKRLGKMFDRFLEDVLEEHDERR  261

Query  1026  VAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
                G + VA DMVDLLLQ ADDP+L+V ++R GVKAFI +L+ G T+ S+V VEWA+SE+
Sbjct  262   RRGGAAVVAADMVDLLLQFADDPNLKVPIQRDGVKAFIPELITGSTDTSSVSVEWAMSEV  321

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             L+ P +  K T+ELDRV+G+ R V E D+ +LPY++A+VKE MRLHPV P+LVPR+ RED
Sbjct  322   LRTPRVLAKVTEELDRVVGRGRLVAEADIASLPYLEAVVKESMRLHPVVPLLVPRVSRED  381

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALW-DNPNEFIPDRFIGKDIDVKGCDFELLPFGAG  1562
               VAGYD+P GTRVLV+VW + RDPA+W D        RF+G  +DV+G DF LLPFG+G
Sbjct  382   ASVAGYDVPAGTRVLVNVWAIGRDPAVWGDAAXXXXXXRFVGSGVDVRGQDFGLLPFGSG  441

Query  1563  RRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEP  1742
             RRMCPG +LGLK++  +L NLLH F W+LP  + PE+L++EE FG+S  +K  L  + EP
Sbjct  442   RRMCPGLALGLKMVHLALANLLHAFAWRLPGGMAPEELSVEEKFGISVSRKLQLEAIPEP  501

Query  1743  RLPMHLY  1763
             RLP HLY
Sbjct  502   RLPAHLY  508



>ref|XP_004238495.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=510

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 358/505 (71%), Gaps = 9/505 (2%)
 Frame = +3

Query  261   AAWVSTIALLLLAKHLRWRRKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQ  440
              AW+  ++L+ L+K      K  LPPGPKPWP+IGNLNLIGSLPH S H LS KYG +M 
Sbjct  11    GAWL--LSLVFLSKKFN-HSKRKLPPGPKPWPIIGNLNLIGSLPHVSFHHLSQKYGDLML  67

Query  441   LQFGSFPVVVGSSAEMAKTFLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQAR  620
             L+FGS PV+V SS EMAK  LKT D  F  RP  A GK+T++NYSD+ W+ Y  YWRQAR
Sbjct  68    LKFGSKPVLVASSPEMAKEILKTHDTIFASRPSLAVGKHTSFNYSDMVWASYCAYWRQAR  127

Query  621   RMCLTELFSAKRLESYEYIRSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL  800
             ++ LTE+FS KRL+  EY+R +E K+++  L+  S   KPI L+D++   +L  I+ +V+
Sbjct  128   KIYLTEIFSPKRLDYLEYVRIEERKTLISCLFAHSG--KPIFLKDHLPRFTLRTINRLVM  185

Query  801   GKSYL----NESEGAIVSPNEFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKAL  968
               +Y     N+S+ +IV+    + MLDE F+L GV+NIGD IPW+ + DLQGY++RMKAL
Sbjct  186   SDNYCSDQSNDSDTSIVTLERLQWMLDEWFILGGVINIGDWIPWLSWFDLQGYVRRMKAL  245

Query  969   SKKFDRFLEHVLDEHNARRVAEGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDL  1148
              K    F ++VLD+HNA+R+ +   FV KDMVD LL LA+DP+ EVKL    +   I +L
Sbjct  246   GKNMTEFYKYVLDDHNAKRIQKSGDFVPKDMVDALLHLANDPNREVKLTSDRMMGLIHNL  305

Query  1149  LAGGTENSTVIVEWAISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKE  1328
             +AGGT+ S   +EWA  ELL+ P I +KA  ELDR IG++ WVEE+D   LPYI AI+KE
Sbjct  306   VAGGTDTSAATIEWAFQELLRSPNIMEKAQQELDRAIGKEGWVEEEDFSKLPYIDAIIKE  365

Query  1329  VMRLHPVAPMLVPRLCREDCKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIG  1508
               RLHP+  +L P    EDC VAGYDIPKGT V V+ W++ R+P  WD P EFIP+RFI 
Sbjct  366   TFRLHPLCALLAPHYSLEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRPEEFIPERFIE  425

Query  1509  KDIDVKGCDFELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEE  1688
               ID+KG +F LLPFG+GRR CPGYSLG+KV++ ++ NLLHGFNWKL  D+ PE ++M+E
Sbjct  426   NGIDIKGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGFNWKLAGDMKPEHISMDE  485

Query  1689  IFGLSTPKKFPLTTVIEPRLPMHLY  1763
             I+GL+T  K P++ ++EPRL +HLY
Sbjct  486   IYGLTTHPKKPISVIMEPRLRLHLY  510



>ref|XP_006363443.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=506

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 348/481 (72%), Gaps = 2/481 (0%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  +PPGPKPWP+IGNLNL+GSLPH S H LS KYG +M L+FGS PV+V SS EMAK  
Sbjct  28    KRKVPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLLKFGSKPVLVASSPEMAKEI  87

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP  AAGKYT++NYSD+ W+PYG +WRQAR++ +T +FS++RL+S+EYIR
Sbjct  88    LKTHDAIFASRPALAAGKYTSFNYSDMAWAPYGAHWRQARKIFMTHIFSSRRLDSFEYIR  147

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              +E ++++ +L+  S   KPILLRD++   +L  IS +V+   Y +    +I++    ++
Sbjct  148   VEEGRTLISRLFPLSG--KPILLRDHLRRFTLRTISRLVMSDKYYSSHASSIITLETLQQ  205

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDE F+L GV+NIGD +PW+ + DLQGY+KRMKAL K    F ++V+++H A +     
Sbjct  206   MLDEWFILGGVINIGDWVPWLSWFDLQGYVKRMKALGKNMTEFYKYVIEDHKAIKRQIEK  265

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
               V KDMVD LL LADDP+LEVKL    +   I DL+AGGT+ S   +EWA  ELL++P 
Sbjct  266   ECVPKDMVDSLLHLADDPNLEVKLTSDSLMGLIHDLIAGGTDTSAATIEWAFQELLRRPN  325

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             I  KA  ELDR IG++ WVEE+D   LPYI AI+KE +RLHP+  +L PR   EDC VAG
Sbjct  326   IIDKAHHELDRAIGREGWVEEEDFSKLPYIDAIIKETLRLHPLGALLPPRYSIEDCNVAG  385

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT V V+ W++ R+P  WD   +FIP+RFI  +ID+KG +F LLPFG+GRR CPG
Sbjct  386   YDIPKGTTVFVNAWSLGRNPKYWDRAEDFIPERFIENNIDIKGQNFALLPFGSGRRKCPG  445

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             YSLG+KV++ ++ NLLHGFNWKL  D+  E ++MEEI+GL+T    P++ +IEPRLP HL
Sbjct  446   YSLGMKVVRTTMANLLHGFNWKLAGDMKAEDISMEEIYGLTTHPNKPISVIIEPRLPFHL  505

Query  1761  Y  1763
             Y
Sbjct  506   Y  506



>ref|XP_007201979.1| hypothetical protein PRUPE_ppa004832mg [Prunus persica]
 gb|EMJ03178.1| hypothetical protein PRUPE_ppa004832mg [Prunus persica]
Length=489

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 359/486 (74%), Gaps = 28/486 (6%)
 Frame = +3

Query  318   RKLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKT  497
             ++  LPPGPKPWP +                       I  L+FGS+PVVV SS EM K 
Sbjct  28    KRPKLPPGPKPWPKLAT--------------------SISLLKFGSYPVVVASSPEMTKQ  67

Query  498   FLKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYI  677
             FLKT D  F  RP+TAAGKY TY+Y ++TW+PYGPYWRQ R++ L ELFS KRLES+ YI
Sbjct  68    FLKTHDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLMELFSPKRLESFRYI  127

Query  678   RSQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSY--LNESEGAIVSPNE  851
             R +E ++   +LY  S   K ++L++++S LSL+++S +VLGK Y  L + E +I+S  E
Sbjct  128   RVEENRAFASRLYALSG--KAVVLKEHLSRLSLSIMSRIVLGKEYFSLTDFESSIMSLKE  185

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
             F+ MLDELFLLNGV NIGD IPW+DFLDLQGY+KRMK + KK D F E VL EH AR+  
Sbjct  186   FQDMLDELFLLNGVFNIGDWIPWLDFLDLQGYVKRMKVVKKKMDWFYEFVLHEHKARK--  243

Query  1032  EG-DSFVAKDMVDLLLQLADDPS-LEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISEL  1205
             EG   FVAKDMVDLLLQL DDP+ LEVKL    +KAF QD++AGGT+ S  ++EWA+SEL
Sbjct  244   EGVKEFVAKDMVDLLLQLVDDPNDLEVKLTYDSIKAFTQDVIAGGTDTSASVLEWAMSEL  303

Query  1206  LKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCRED  1385
             +K+P + +KAT+ELDRVIG++RWVEEKD+ NLPY+ AI+KE MR HP   ML P L  ED
Sbjct  304   IKQPNLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALED  363

Query  1386  CKVAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGR  1565
             C VAGYD+ KGT V V++W++ RDP LWD P+EF P+RF+GK IDVKG  FELLPFG+GR
Sbjct  364   CNVAGYDVRKGTLVFVNLWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGR  423

Query  1566  RMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPR  1745
             RMCPGYSLGLK+I + L N+LHGFNWKLP +V  E L MEE++GL TP+KFPL  V EPR
Sbjct  424   RMCPGYSLGLKMIGSCLANMLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVVVTEPR  483

Query  1746  LPMHLY  1763
             LP+HLY
Sbjct  484   LPIHLY  489



>ref|XP_009591954.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana tomentosiformis]
Length=507

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/484 (55%), Positives = 358/484 (74%), Gaps = 8/484 (2%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGP+ WP+IGNLNL+GSLPH S+H L  KYG +M L+FGS PV+V SS EMAK F
Sbjct  29    KRKLPPGPRQWPIIGNLNLLGSLPHESLHHLLQKYGDLMFLKFGSKPVLVASSPEMAKEF  88

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D +F  RP  +AGKYT+YNYSD+TW+PYG +WRQAR++ LTE+F+ KRLES++YIR
Sbjct  89    LKTHDASFASRPALSAGKYTSYNYSDMTWAPYGAFWRQARKIYLTEIFNPKRLESFKYIR  148

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL-GKSYLNESEG--AIVSPNE  851
              +E ++++  L+T S   KP+ L+D++   +L+ +S MV+ GK Y +ES+   +IVS  +
Sbjct  149   VEETRTLISSLHTLSG--KPVFLKDHLPRFTLSTMSRMVMSGKYYSDESKSNTSIVSLEK  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
              + MLDE FLLNGV+N+GD +P + + D QGY+KRMKAL K F  F + VL++H A+   
Sbjct  207   LQWMLDEFFLLNGVINLGDWVPLLSWFDSQGYVKRMKALGKSFVEFHKSVLEDHKAK---  263

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
               ++ V KDMVD++LQLADDP+LEVKL +  +   I DLLAGGT+ S   VEWA  ELL+
Sbjct  264   AKENSVPKDMVDVILQLADDPNLEVKLTKDHLMGLIHDLLAGGTDTSAAAVEWAFQELLR  323

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
              P++ +KA  EL+RVIG++RWVEE+D   LPYI AI+KE  RLHP+  +L P    EDC 
Sbjct  324   NPKVIEKANQELNRVIGKERWVEEEDFCRLPYIDAIIKETFRLHPLCTLLPPHYSIEDCN  383

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDIPKGT V V+ W++ R+P  WD P EFIP+RF+  DID+KG +F LLPF +GRR 
Sbjct  384   VAGYDIPKGTTVFVNAWSLGRNPKYWDRPEEFIPERFLENDIDIKGQNFTLLPFSSGRRR  443

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CP YSLG+KV++ ++ NLLHGFNWKL   +  E ++MEEI+GL+T  K P + ++EPRL 
Sbjct  444   CPRYSLGIKVVRTTIANLLHGFNWKLTGGMKAEDISMEEIYGLTTHPKKPTSMIMEPRLS  503

Query  1752  MHLY  1763
             +HLY
Sbjct  504   IHLY  507



>emb|CAN82002.1| hypothetical protein VITISV_023197 [Vitis vinifera]
Length=461

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/414 (66%), Positives = 327/414 (79%), Gaps = 6/414 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K +LPPGPKPW +IGNLNLIG LPH S+H LS KYG IMQLQFGSFPVVV SS EMA+ F
Sbjct  31    KQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMARQF  90

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP+TAAGKYT YNYS+ITW+PYGP WRQ R++  TELFS KRLES EYIR
Sbjct  91    LKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESCEYIR  150

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEG--AIVSPNEF  854
              +E ++ + +LY  S   KP++L+D++S ++L+VIS +VLG+ Y NESE   +IV+  EF
Sbjct  151   VEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNESESGRSIVTVEEF  208

Query  855   RKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAE  1034
             ++MLDELFLLNGVLNIGD IPWI FLDLQGY+KRMKAL  KFDR  +HV+++H ARR  E
Sbjct  209   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEKHRARR--E  266

Query  1035  GDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKK  1214
                FVAKDMVD+LL+LADDP LEVKL   GVK    DLLAGGT+ S   +EWA+SE+L++
Sbjct  267   AADFVAKDMVDMLLRLADDPDLEVKLGTDGVKGLTLDLLAGGTDTSATTMEWAMSEILRQ  326

Query  1215  PEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKV  1394
             P I  KAT+ELDRVIG+ RWVEEKD+P LPYI AIVKE MRLHPVA +L P L  +DC V
Sbjct  327   PSIATKATEELDRVIGRDRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAPHLALQDCNV  386

Query  1395  AGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFG  1556
             +GYDI KGTRVLV+ W++ RDP +WD P EF P+RF+GK IDV G +FELLPFG
Sbjct  387   SGYDIRKGTRVLVNAWSIGRDPNIWDAPEEFRPERFLGKAIDVNGQNFELLPFG  440



>ref|XP_009626729.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=507

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/484 (55%), Positives = 358/484 (74%), Gaps = 8/484 (2%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGPKPWP+IGNLNLIGS+P  S+H+LS KYG +M L+FGS PV++ SS EMAK  
Sbjct  29    KTKLPPGPKPWPIIGNLNLIGSIPRESLHNLSQKYGDLMHLKFGSRPVLIASSPEMAKEI  88

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP  AAGKY ++NYSD++W+PYG  W Q R++ +TE+F+ KRL+S++YIR
Sbjct  89    LKTHDAIFASRPALAAGKYLSFNYSDMSWAPYGAKWGQGRKIYITEIFNPKRLDSFKYIR  148

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVL-GKSYLNESEG--AIVSPNE  851
              +E ++++ +L+  S   KPI L+D++   +L  IS MV+ GK Y ++SE    IV+  +
Sbjct  149   VEEGRNLISRLFALSG--KPIFLKDHLPQFTLCTISRMVMSGKYYCDKSESNDTIVTLEK  206

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
              + ML+E F+L GV+NIGD IPW+++LDLQGY+KRMKAL K    F  +VL++H A+  A
Sbjct  207   LQWMLEEWFILGGVVNIGDWIPWLNWLDLQGYVKRMKALEKTMVEFHNYVLEDHKAK--A  264

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
             + +S    DMVD+LLQLADDP+LEVKL  + +   I DLLAGGT+ S   VEWA  EL++
Sbjct  265   KENSH-PTDMVDVLLQLADDPNLEVKLTTNHLMGLILDLLAGGTDTSATTVEWAFQELMR  323

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
              P+I +KA  ELD+ IG++RWVEE+D+  LPYI+AI+KE  RLHP+  +L P    EDC 
Sbjct  324   NPKIIEKANQELDKAIGKERWVEEEDLSQLPYIEAIIKETFRLHPLTTLLAPHYSIEDCN  383

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDIPKGT V V+ W++ R+P  WD P +FIP+RF+  DID+KG +F LLPFG+GRR 
Sbjct  384   VAGYDIPKGTTVFVNTWSLGRNPKCWDRPEKFIPERFLENDIDIKGQNFTLLPFGSGRRR  443

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLG+K++Q +L NLLHGFNWKL  D+ PE ++MEEI+GL+T  K P + ++EP+L 
Sbjct  444   CPGYSLGIKLVQTTLANLLHGFNWKLSGDMKPEDISMEEIYGLTTHPKKPTSMIMEPKLS  503

Query  1752  MHLY  1763
              HLY
Sbjct  504   PHLY  507



>ref|XP_004237820.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=509

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/484 (55%), Positives = 348/484 (72%), Gaps = 5/484 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGPKPWP+IGNLNL+GSLPH S H LS KYG +M L+FGS PV+V SS EMAK  
Sbjct  28    KRKLPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLLKFGSKPVLVVSSPEMAKEI  87

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP  AAGKYT++NYSD+TW+PYG YW QAR++ LTE+FS K+L S EYIR
Sbjct  88    LKTHDAIFASRPVLAAGKYTSFNYSDMTWAPYGAYWHQARKIYLTEIFSPKKLHSLEYIR  147

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE---SEGAIVSPNE  851
              +E ++++ +LY  S   KPI LRD++   SL  IS +V+   Y ++   S+ +IV+   
Sbjct  148   IEERQTLISRLYPHSG--KPIFLRDHLPRFSLRTISRLVMSDKYFSDQSNSDTSIVTLER  205

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
              + MLDE FLL GV+N+GD IP + + DLQGYIKRMK   K F +F ++VLD+HNA ++ 
Sbjct  206   LQWMLDEWFLLAGVINLGDWIPCLSWFDLQGYIKRMKDSGKNFTQFYKYVLDDHNAIKMQ  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
             +   FV KDMVD LL LA+DP+ EV+L    +   +  LLAG T+ S   +EW   EL++
Sbjct  266   KSGDFVPKDMVDALLHLANDPNREVQLTSDRMMGLMHSLLAGATDTSAATIEWTFQELMR  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P I +KA  EL+R IG++RWVEE+D   LPYI AI+KE  RLHP+  +L PR   EDC 
Sbjct  326   RPNIMEKAHHELERAIGKERWVEEEDFSKLPYIDAIIKETFRLHPLCAVLPPRYSTEDCN  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDIPKGT V V+ W++ R+P  WD   EFIP+RFI  +ID+KG +F LLPFG+GRR 
Sbjct  386   VAGYDIPKGTTVYVNAWSLGRNPKYWDRAEEFIPERFIENNIDIKGQNFALLPFGSGRRK  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLG+KV++ ++ NL+HGFNWKL  D  PE ++M+EI+GL+T  K P++ ++EPRL 
Sbjct  446   CPGYSLGMKVVRTTMANLMHGFNWKLGGDTKPEDISMDEIYGLTTHPKEPISLIMEPRLS  505

Query  1752  MHLY  1763
             +HLY
Sbjct  506   LHLY  509



>ref|NP_001146066.1| uncharacterized protein LOC100279597 [Zea mays]
 gb|ACL53141.1| unknown [Zea mays]
Length=547

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/496 (55%), Positives = 368/496 (74%), Gaps = 19/496 (4%)
 Frame = +3

Query  333   PPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTFLKTM  512
             PPGP+PWPVIGNLNL+G+LPHRSIH+LS +YGP+M L+FGSFPVVVGSS E+A+  L+T 
Sbjct  49    PPGPRPWPVIGNLNLLGALPHRSIHELSARYGPLMSLRFGSFPVVVGSSVEVAEVVLRTQ  108

Query  513   DINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIRSQEL  692
             D+ ++DRP+ A GKYT YNYS + WS YGPYWRQ R++ +TEL SA++L   E +R++E+
Sbjct  109   DLAYLDRPRMACGKYTVYNYSGMLWSHYGPYWRQLRKLWVTELLSARQLRLTERVRAEEV  168

Query  693   KSILRQLY----TASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESE----GAIVSPN  848
             +++LR L+    T++++   ++L++ +  ++LNVIS MVLGK Y+ E +    GA  +P 
Sbjct  169   RAMLRDLHPHPATSTTSTAAVVLKERLLMVTLNVISRMVLGKKYVGEDDAGGPGAAATPE  228

Query  849   EFRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRV  1028
             EFR M++E+F LNG L++GD +PW+ +LD  GY+ RMK L+ KFDRF+EHVL EH  RR 
Sbjct  229   EFRWMIEEIFFLNGALHVGDMVPWLGWLDAHGYVGRMKRLAGKFDRFIEHVLREHGERRR  288

Query  1029  AEGDSFVAKDMVDLLLQLADDPS------LEVKLERHGVKAFIQDLLAGGTENSTVIVEW  1190
              EG +FV  DMVDLLLQLADD        LEV L+R GVKA + +L+ GGT+ S+V VEW
Sbjct  289   REGAAFVPGDMVDLLLQLADDGDGGPGGLLEVPLDRDGVKASVLELVTGGTDTSSVTVEW  348

Query  1191  AISELLKKPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPR  1370
             A+SE+L++P +  K T+ELDRV+G+ R V E D+P LPY+ A+VKE MRLHPV P+L+PR
Sbjct  349   AMSEVLREPRVLCKVTEELDRVVGRDRLVGEGDIPGLPYLDAVVKESMRLHPVVPLLIPR  408

Query  1371  LCREDCKVAGYDIPKGTRVLVSVWTVARDPALWD-NPNEFIPDRFIG----KDIDVKGCD  1535
             + RE   VAGYD+P GTRVLV+VW + RDP +W  +  EF P+RF+       +DV+G D
Sbjct  409   VAREHTTVAGYDVPAGTRVLVNVWAIGRDPNVWGPDAGEFRPERFLDGSKRSKVDVRGQD  468

Query  1536  FELLPFGAGRRMCPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKK  1715
              ELLPFGAGRRMCP + LGL+++Q  L NLLHG+ W+LP  + PE+L+MEE FG+S  + 
Sbjct  469   LELLPFGAGRRMCPAHGLGLRMVQLVLANLLHGYVWRLPGGMAPEELSMEEKFGISVSRM  528

Query  1716  FPLTTVIEPRLPMHLY  1763
               L  + +PRLP H+Y
Sbjct  529   HQLKAIPDPRLPHHVY  544



>ref|XP_006367943.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=509

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/484 (56%), Positives = 350/484 (72%), Gaps = 5/484 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  +PPGPKPWP+IGNLNL+GSLPH S+H LS KYG +M L+FGS PV+V SS EMAK  
Sbjct  28    KRKVPPGPKPWPIIGNLNLLGSLPHESLHHLSQKYGDLMLLKFGSKPVLVASSPEMAKEI  87

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP  AAGKYT +NYSD+ W+ YG YWRQAR++CLTE+FS KRL+S EYIR
Sbjct  88    LKTHDTIFASRPPLAAGKYTGFNYSDMLWASYGAYWRQARKICLTEIFSPKRLDSLEYIR  147

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE---SEGAIVSPNE  851
              +E ++++ +L+  S   KPILL+D++S  +L  IS M +   Y ++   S+ +I +   
Sbjct  148   IEERQTLISRLFPHSG--KPILLKDHLSRFTLRTISRMAMSDKYCSDQSNSDTSIATLER  205

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
              + MLDE F+L GV+N+GD IP   + DLQGY+KRMKAL K F  F ++VLD+HNA ++ 
Sbjct  206   LQWMLDEWFVLGGVMNLGDWIPLFSWFDLQGYVKRMKALGKNFTEFYKYVLDDHNATKMQ  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
                 FV KDMVD LL L++DP+LEVKL    +   I +LLAGGT  +   +EW   ELL+
Sbjct  266   TTGDFVPKDMVDALLHLSNDPNLEVKLTSDHMMGLINNLLAGGTGTAAATIEWTFQELLR  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P I  KA  ELD+ IG++RWVEE+D   LPYI AI+KE  RLHP+  +L P    EDC 
Sbjct  326   RPNIMDKAHHELDKAIGRERWVEEEDFSKLPYIDAIIKESFRLHPLGALLPPHYSIEDCN  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDIPKGT V V+VW++ R+   WD   EFIP+RFI  +IDVKG +F LLPFG+GRR 
Sbjct  386   VAGYDIPKGTTVFVNVWSLGRNSKYWDRAEEFIPERFIENNIDVKGQNFALLPFGSGRRR  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLG+KV++ ++ NLLHGFNWKL  D+ PE ++MEEI+GL+T  K P++ ++EPRLP
Sbjct  446   CPGYSLGMKVVRTTMANLLHGFNWKLAGDMRPEDISMEEIYGLTTHPKKPISVIMEPRLP  505

Query  1752  MHLY  1763
             +HLY
Sbjct  506   LHLY  509



>ref|XP_006350345.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=502

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 355/481 (74%), Gaps = 10/481 (2%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K ++PPGP+PWP+IGNLNLIGSLPH S+H+LS KYG +M L+FGS PV++ SS EMAK  
Sbjct  32    KRNVPPGPRPWPIIGNLNLIGSLPHESLHNLSQKYGDLMLLKFGSKPVLIASSPEMAKEI  91

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP   AGKY ++NYSD++W+PYG +WRQ+R++  TE+FS KRLES+EYIR
Sbjct  92    LKTHDAIFSSRPALTAGKYISFNYSDVSWAPYGAHWRQSRKIYQTEIFSPKRLESFEYIR  151

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              +E ++++ +L+  S   K I LR +++  +L++IS MV+  +Y  +      S    + 
Sbjct  152   VEERRNLISRLHVLSG--KKIFLRHHLTEFTLSIISRMVMSGTYHRDE-----SIENLQG  204

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             MLDE F+L GV+NIGD IPW+++LDLQGYIKRMKAL KK   F ++VL++H A+   + D
Sbjct  205   MLDEWFILGGVINIGDWIPWLNWLDLQGYIKRMKALDKKLREFFKYVLEDHKAK--GKED  262

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
             S   KDMVD+LLQL DDP+LEVK+    +   I DLLAGGT+ S   VEWA  EL++ P 
Sbjct  263   S-APKDMVDVLLQLVDDPNLEVKITTDNLMGLILDLLAGGTDTSATTVEWAFQELVRNPN  321

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             + +KA +ELDR IG+ RWVEE+D+  LPYI+AI+KE  RLHP+ P++ P    E+C V G
Sbjct  322   VIEKANEELDRTIGKGRWVEEEDLSQLPYIEAIIKETFRLHPLTPLIPPHYSIEECNVVG  381

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT   V++W++ R+P  WD P EFIP+RF+  DI++KG +F +LPFG+GRR CPG
Sbjct  382   YDIPKGTMAFVNIWSLGRNPNYWDRPQEFIPERFLENDINIKGKNFTMLPFGSGRRRCPG  441

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             YSLG+K++  +L NLLHGF+W+L  D+ PE+++M+EI+GL+T  +  ++ ++EPR P+HL
Sbjct  442   YSLGIKLVGTTLANLLHGFHWRLTGDINPEEISMKEIYGLTTHPEKSISMIVEPRFPLHL  501

Query  1761  Y  1763
             Y
Sbjct  502   Y  502



>ref|XP_006363445.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Solanum 
tuberosum]
Length=509

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/484 (54%), Positives = 347/484 (72%), Gaps = 5/484 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGPKPWP+IGNLNL+GSLPH S H LS KYG +M L+FGS PV+V SS EMAK  
Sbjct  28    KRKLPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLLKFGSKPVLVASSPEMAKEI  87

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT D  F  RP  AAGKYT++NYSD+ W+PYG YWRQAR++ LTE+FS KRL+S EYIR
Sbjct  88    LKTHDAIFASRPPLAAGKYTSFNYSDMLWAPYGAYWRQARKIYLTEIFSPKRLDSLEYIR  147

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNE---SEGAIVSPNE  851
              +E ++++ +L+  S   KPILL+D++   +L  IS M +   Y ++   S+ +I +   
Sbjct  148   VEEGRTLISRLFPHSG--KPILLKDHLPRFTLRTISRMAMSDKYCSDQSNSDTSIATLER  205

Query  852   FRKMLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVA  1031
              + MLDE  +L GV+N+GD IP   + DLQGY++RMKAL K F +F ++V+D+HNA ++ 
Sbjct  206   LQWMLDEWLVLGGVMNLGDWIPLFSWFDLQGYVRRMKALGKNFTQFYKYVIDDHNATKMQ  265

Query  1032  EGDSFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLK  1211
                 FV KDMVD LL L+DDP+L V+L    +   + +LLAG T+ S   +EW   ELL+
Sbjct  266   TTGDFVPKDMVDALLHLSDDPNLNVQLTSDRMMGLMHNLLAGATDTSAATIEWTFQELLR  325

Query  1212  KPEIFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCK  1391
             +P I  KA  ELDR IG++RWVEE+D   LPYI AI+KE  RLHP+  +L P    EDCK
Sbjct  326   RPNIIDKARQELDRAIGKERWVEEEDFSKLPYIDAIIKESFRLHPLCALLPPHYSIEDCK  385

Query  1392  VAGYDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRM  1571
             VAGYDIPKGT V V+ W++ R+   W+   EFIP+RFI  +ID+ G +F LLPFG+GRR 
Sbjct  386   VAGYDIPKGTIVYVNAWSIGRNSKYWERAEEFIPERFIENNIDMTGQNFALLPFGSGRRR  445

Query  1572  CPGYSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLP  1751
             CPGYSLG+KV++ ++ NLLHGFNWKL  D+ PE ++MEE++GLST  K P++ ++EPRLP
Sbjct  446   CPGYSLGMKVVRTTMANLLHGFNWKLTGDMRPEDISMEEMYGLSTHPKKPISVIMEPRLP  505

Query  1752  MHLY  1763
             +HLY
Sbjct  506   LHLY  509



>ref|XP_010320112.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum lycopersicum]
Length=504

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 353/481 (73%), Gaps = 4/481 (1%)
 Frame = +3

Query  321   KLHLPPGPKPWPVIGNLNLIGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSAEMAKTF  500
             K  LPPGPKPWP+IGNLNL+GSLPH+S+H LS KYG +M L+FGS PV++ SS EMAK  
Sbjct  28    KRKLPPGPKPWPIIGNLNLLGSLPHKSLHHLSQKYGDLMLLKFGSKPVLIASSPEMAKEI  87

Query  501   LKTMDINFVDRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSAKRLESYEYIR  680
             LKT DI+F  RP  AAGKY ++NYSD+TW+ YGP+WRQ R++ LT L +   L S EYIR
Sbjct  88    LKTHDISFASRPPLAAGKYISFNYSDMTWASYGPHWRQTRKISLTGLLNPTTLNSLEYIR  147

Query  681   SQELKSILRQLYTASSAQKPILLRDYMSTLSLNVISWMVLGKSYLNESEGAIVSPNEFRK  860
              +E ++++ +L+  S   KPILL+  ++  +L  I+ +++ ++Y + S+ ++V+    + 
Sbjct  148   VEERQTLISRLFPLSG--KPILLKHRLARFTLRTINRLIMSETYCS-SDASVVTHERLQW  204

Query  861   MLDELFLLNGVLNIGDSIPWIDFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRVAEGD  1040
             M DE F+L+G++NIGD IPW+ + DLQGY+KRMKAL K    F E+VL++H A+R  E +
Sbjct  205   MFDEWFVLSGLINIGDWIPWLSWFDLQGYVKRMKALRKNMTEFYEYVLEDHKAKRQKE-E  263

Query  1041  SFVAKDMVDLLLQLADDPSLEVKLERHGVKAFIQDLLAGGTENSTVIVEWAISELLKKPE  1220
             ++  KDMVD +L LADDP+LE+KL    +   I DL+ GGT+ +   +EWA  ELLK+P 
Sbjct  264   NYSPKDMVDAMLHLADDPNLEIKLTTDTMMGLIHDLVGGGTDTAATTIEWAFQELLKRPN  323

Query  1221  IFKKATDELDRVIGQKRWVEEKDMPNLPYIQAIVKEVMRLHPVAPMLVPRLCREDCKVAG  1400
             I +KA  ELDR IG++ WV+E+D   LPYI AI+KE  RLHP+  ++ P    EDC VAG
Sbjct  324   IMEKAQQELDRAIGREGWVKEEDFSKLPYIDAIIKETFRLHPLCALIPPHYSTEDCNVAG  383

Query  1401  YDIPKGTRVLVSVWTVARDPALWDNPNEFIPDRFIGKDIDVKGCDFELLPFGAGRRMCPG  1580
             YDIPKGT V V+ W++ R+P  WD P EFIP+RFI  +ID+KG +F LLPFG+GRR CPG
Sbjct  384   YDIPKGTTVYVNAWSLGRNPKYWDRPEEFIPERFIENNIDIKGQNFGLLPFGSGRRKCPG  443

Query  1581  YSLGLKVIQASLGNLLHGFNWKLPNDVTPEKLNMEEIFGLSTPKKFPLTTVIEPRLPMHL  1760
             YSLG+K+++ ++ NLLHGF+WKL  D+ PE ++M+EI+GL+T  K P++ ++EPRLP+HL
Sbjct  444   YSLGIKIVRTTMANLLHGFDWKLAGDMKPEDISMDEIYGLTTHPKNPISLIMEPRLPLHL  503

Query  1761  Y  1763
             Y
Sbjct  504   Y  504



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5707078619816