BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25744_g3_i1 len=988 path=[7816:0-13 7246:14-53 9093:54-175
4181:176-176 4182:177-201 10206:202-207 10212:208-213 6680:214-248
10234:249-255 4236:256-276 1707:277-329 10264:330-337 10272:338-340
1771:341-378 1809:379-407 10288:408-417 10298:418-432 10313:433-443
10324:444-463 1894:464-496 1927:497-536 1967:537-570 8012:571-571
8013:572-572 6919:573-596 10443:597-603 8044:604-633 2064:634-657
10473:658-663 2094:664-679 2110:680-799 9794:800-826 2257:827-899
2330:900-936 2367:937-966 10619:967-967 2398:968-987]

Length=988
                                                                      Score     E

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    501   8e-175   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    487   4e-169   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    469   5e-162   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    454   5e-156   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     452   3e-155   Vitis vinifera
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    448   6e-154   
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    442   2e-151   Vitis vinifera
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    437   2e-149   Vitis vinifera
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    436   4e-149   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     435   7e-149   Vitis vinifera
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    434   3e-148   Vitis vinifera
emb|CAN83014.1|  hypothetical protein VITISV_029725                     433   4e-148   Vitis vinifera
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    433   7e-148   Vitis vinifera
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   430   6e-147   Rosa bracteata [Macartny rose]
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   429   1e-146   Rosa banksiae
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   428   3e-146   Rosa hugonis
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   428   4e-146   Rosa woodsii var. ultramontana
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   427   6e-146   Rosa canina [dog briar]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   427   6e-146   Rosa majalis [cinnamon rose]
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                428   7e-146   
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   427   8e-146   Rosa gallica [apothecary rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   427   9e-146   Rosa marretii
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   426   2e-145   Rosa chinensis [China rose]
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   426   2e-145   Rosa beggeriana
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   426   2e-145   Rosa odorata [tea rose]
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   426   2e-145   Rosa odorata var. gigantea
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   426   2e-145   Rosa bracteata [Macartny rose]
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   426   3e-145   Rosa odorata var. gigantea
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   426   3e-145   Rosa rugosa [Japanese rose]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   425   4e-145   Rosa hybrid cultivar
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   425   5e-145   Rosa gallica [apothecary rose]
emb|CAH05089.1|  putative orcinol O-methyltransferase                   425   5e-145   Rosa odorata var. gigantea
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   425   5e-145   Rosa gallica [apothecary rose]
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   425   5e-145   Rosa odorata var. gigantea
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   425   6e-145   Rosa marretii
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   425   7e-145   Rosa canina [dog briar]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   424   8e-145   Rosa banksiae
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    425   8e-145   Vitis vinifera
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   424   9e-145   Rosa lucieae [memorial rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   424   9e-145   Rosa roxburghii [chestnut rose]
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   424   1e-144   Rosa odorata [tea rose]
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   424   1e-144   Rosa hugonis
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   424   1e-144   Rosa beggeriana
emb|CAH05079.1|  putative orcinol O-methyltransferase                   424   1e-144   Rosa gallica [apothecary rose]
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   424   2e-144   Rosa gallica [apothecary rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   424   2e-144   Rosa chinensis [China rose]
emb|CAH05082.1|  putative orcinol O-methyltransferase                   424   2e-144   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   424   2e-144   Rosa gallica [apothecary rose]
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   424   2e-144   Rosa rugosa [Japanese rose]
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   423   3e-144   Rosa chinensis var. spontanea
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   423   3e-144   Rosa beggeriana
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   423   4e-144   Rosa odorata [tea rose]
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   422   8e-144   Rosa beggeriana
emb|CAH05085.1|  orcinol O-methyltransferase 3                          422   8e-144   Rosa hybrid cultivar
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   422   9e-144   Rosa odorata var. gigantea
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   422   1e-143   Rosa chinensis var. spontanea
emb|CAH05087.1|  orcinol O-methyltransferase 4                          422   1e-143   Rosa hybrid cultivar
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   421   1e-143   Rosa gallica [apothecary rose]
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   421   2e-143   Rosa chinensis [China rose]
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   421   3e-143   Rosa canina [dog briar]
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   421   4e-143   Rosa marretii
emb|CDP15888.1|  unnamed protein product                                421   4e-143   
emb|CAH05083.1|  putative orcinol O-methyltransferase                   420   4e-143   Rosa hybrid cultivar
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   420   5e-143   Rosa odorata var. gigantea
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   421   6e-143   Rosa hybrid cultivar
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   420   6e-143   Rosa chinensis [China rose]
emb|CAH05091.1|  putative orcinol O-methyltransferase                   420   6e-143   Rosa odorata var. gigantea
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   420   7e-143   Rosa odorata var. gigantea
emb|CAD29555.1|  orcinol O-methyltransferase                            419   8e-143   Rosa hybrid cultivar
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   419   8e-143   Rosa chinensis var. spontanea
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    419   2e-142   Vitis vinifera
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   419   2e-142   Rosa chinensis [China rose]
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   419   2e-142   Rosa odorata var. gigantea
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   418   2e-142   Rosa chinensis var. spontanea
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   418   3e-142   Rosa odorata [tea rose]
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   418   3e-142   Rosa chinensis var. spontanea
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   417   4e-142   Rosa odorata [tea rose]
emb|CAH05090.1|  putative orcinol O-methyltransferase                   417   4e-142   Rosa odorata var. gigantea
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    418   5e-142   Vitis vinifera
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   417   5e-142   Rosa odorata [tea rose]
emb|CAH05086.1|  orcinol O-methyltransferase 4                          417   5e-142   Rosa hybrid cultivar
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    418   6e-142   
emb|CAH05084.1|  orcinol O-methyltransferase 3                          417   6e-142   Rosa hybrid cultivar
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   417   6e-142   Rosa odorata [tea rose]
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   417   7e-142   Rosa chinensis var. spontanea
emb|CAH05088.1|  putative orcinol O-methyltransferase                   417   8e-142   Rosa odorata var. gigantea
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    417   8e-142   
emb|CAD29556.1|  orcinol O-methyltransferase                            417   1e-141   Rosa hybrid cultivar
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   417   1e-141   Rosa odorata [tea rose]
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   416   1e-141   Rosa odorata var. gigantea
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    417   1e-141   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    417   1e-141   
emb|CAH05080.1|  putative orcinol O-methyltransferase                   416   2e-141   Rosa gallica [apothecary rose]
emb|CAN78992.1|  hypothetical protein VITISV_005827                     416   2e-141   Vitis vinifera
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   416   2e-141   Rosa odorata var. gigantea
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    418   3e-141   
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    416   3e-141   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   416   5e-141   Rosa hybrid cultivar
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    415   9e-141   
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   414   1e-140   Rosa odorata var. gigantea
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             414   2e-140   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   413   2e-140   Rosa odorata [tea rose]
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   413   2e-140   Rosa chinensis var. spontanea
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   413   3e-140   Rosa odorata [tea rose]
emb|CAQ76879.1|  resveratrol O-methyltransferase                        413   3e-140   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                     413   3e-140   
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   412   5e-140   Rosa chinensis [China rose]
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    413   5e-140   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    412   8e-140   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             412   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    412   2e-139   Vitis vinifera
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    411   3e-139   
emb|CDP19840.1|  unnamed protein product                                411   4e-139   
gb|ABZ89567.1|  O-methyltransferase 3                                   411   4e-139   Humulus lupulus [common hop]
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   410   4e-139   Rosa woodsii var. ultramontana
emb|CAN79968.1|  hypothetical protein VITISV_043678                     410   8e-139   Vitis vinifera
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             409   2e-138   
gb|AFX68805.1|  O-metyltransferase                                      409   2e-138   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           409   2e-138   
ref|XP_002517827.1|  o-methyltransferase, putative                      409   2e-138   Ricinus communis
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             408   6e-138   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    407   9e-138   
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    407   1e-137   Vitis vinifera
gb|ABQ02270.2|  O-methyltransferase                                     407   1e-137   Vitis vinifera
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    407   1e-137   
emb|CDP21787.1|  unnamed protein product                                407   2e-137   
emb|CDP21836.1|  unnamed protein product                                407   2e-137   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    405   3e-137   
ref|NP_001267963.1|  O-methyltransferase                                405   4e-137   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           405   7e-137   
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   1e-136   
emb|CDP21661.1|  unnamed protein product                                404   2e-136   
gb|AAB71213.1|  methyltransferase                                       403   2e-136   Prunus armeniaca
emb|CDP17644.1|  unnamed protein product                                401   1e-135   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    400   3e-135   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    400   4e-135   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    400   5e-135   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    402   1e-134   
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             399   2e-134   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              398   5e-134   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   8e-134   
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    395   3e-133   Vitis vinifera
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   394   1e-132   Rosa odorata var. gigantea
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             392   1e-131   
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    390   2e-131   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             390   5e-131   
ref|XP_002525159.1|  o-methyltransferase, putative                      389   2e-130   Ricinus communis
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    389   2e-130   
ref|XP_002525160.1|  o-methyltransferase, putative                      388   2e-130   Ricinus communis
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    388   3e-130   
emb|CAA11131.1|  O-methyltransferase                                    386   1e-129   Prunus dulcis [sweet almond]
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             385   3e-129   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             385   6e-129   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    384   1e-128   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   2e-128   
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   380   6e-128   
gb|AFK40900.1|  unknown                                                 382   9e-128   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    381   1e-127   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     381   2e-127   Vitis vinifera
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   5e-127   
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   377   9e-127   
ref|XP_003615966.1|  O-methyltransferase                                378   2e-126   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   3e-126   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   5e-126   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   6e-126   Vitis vinifera
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                376   6e-126   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     375   8e-126   Vitis vinifera
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           377   1e-125   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    376   1e-125   Vitis vinifera
emb|CDP19839.1|  unnamed protein product                                374   3e-125   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             375   3e-125   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           375   9e-125   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             374   1e-124   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     374   1e-124   Vitis vinifera
ref|XP_003615973.1|  O-methyltransferase                                372   5e-124   
gb|ABK96707.1|  unknown                                                 372   7e-124   Populus trichocarpa x Populus deltoides
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   2e-123   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     369   2e-123   Vitis vinifera
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      369   3e-123   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   3e-123   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   4e-123   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    373   7e-123   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    369   1e-122   
emb|CDP15886.1|  unnamed protein product                                368   2e-122   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             368   2e-122   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    367   8e-122   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    366   9e-122   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    365   2e-121   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    364   1e-120   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    362   3e-120   
emb|CDP19709.1|  unnamed protein product                                361   9e-120   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    361   1e-119   
ref|XP_002517832.1|  o-methyltransferase, putative                      360   2e-119   Ricinus communis
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   360   5e-119   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         359   8e-119   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           359   1e-118   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    358   2e-118   
ref|XP_003615967.1|  O-methyltransferase                                357   3e-118   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             357   3e-118   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    357   4e-118   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     356   8e-118   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   9e-118   
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 356   1e-117   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    357   1e-117   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     355   2e-117   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   2e-117   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   3e-117   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   2e-116   
ref|XP_002522501.1|  o-methyltransferase, putative                      352   3e-116   Ricinus communis
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   4e-116   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   4e-116   
emb|CBI22005.3|  unnamed protein product                                349   7e-116   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    351   8e-116   
gb|AES89720.2|  orcinol O-methyltransferase                             350   2e-115   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    350   3e-115   
ref|XP_002517833.1|  o-methyltransferase, putative                      350   3e-115   Ricinus communis
emb|CDP20220.1|  unnamed protein product                                346   3e-115   
emb|CDP19713.1|  unnamed protein product                                349   5e-115   
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   1e-114   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    348   2e-114   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   3e-114   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   3e-114   Vitis vinifera
ref|XP_002517835.1|  o-methyltransferase, putative                      347   4e-114   Ricinus communis
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   6e-114   
ref|XP_003607523.1|  O-methyltransferase                                346   1e-113   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   2e-113   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   2e-113   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    344   3e-113   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    345   3e-113   Populus trichocarpa [western balsam poplar]
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         344   4e-113   
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   5e-112   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   6e-112   
ref|XP_003615968.1|  O-methyltransferase                                339   1e-111   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             337   1e-111   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           340   2e-111   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   2e-111   Vitis vinifera
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   2e-111   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 340   3e-111   Gossypium hirsutum [American cotton]
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     340   3e-111   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       340   3e-111   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    339   3e-111   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         339   4e-111   
ref|XP_002525163.1|  o-methyltransferase, putative                      337   6e-111   Ricinus communis
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   7e-111   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                337   4e-110   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   5e-110   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   6e-110   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     335   9e-110   Vitis vinifera
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   1e-109   
emb|CDP21582.1|  unnamed protein product                                335   2e-109   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     334   2e-109   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                335   3e-109   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      334   4e-109   
emb|CDP21583.1|  unnamed protein product                                332   4e-109   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   7e-109   
gb|AAR09603.1|  O-methyltransferase                                     333   7e-109   Mentha x piperita
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             334   8e-109   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   1e-108   
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   2e-108   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                332   4e-108   
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    332   5e-108   Vitis vinifera
emb|CBI21925.3|  unnamed protein product                                328   6e-108   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         331   8e-108   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       331   9e-108   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   9e-108   
ref|XP_003615962.1|  O-methyltransferase                                330   1e-107   
ref|XP_002517834.1|  o-methyltransferase, putative                      330   1e-107   Ricinus communis
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   2e-107   
emb|CDP21212.1|  unnamed protein product                                328   4e-107   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   6e-107   
emb|CBI21932.3|  unnamed protein product                                331   7e-107   
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   9e-107   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       327   2e-106   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   4e-106   
emb|CBI21931.3|  unnamed protein product                                323   5e-106   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      326   8e-106   
emb|CDP19711.1|  unnamed protein product                                325   1e-105   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    325   1e-105   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    324   4e-105   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   4e-105   
ref|XP_002522586.1|  o-methyltransferase, putative                      323   4e-105   
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   8e-105   
gb|ACU19152.1|  unknown                                                 320   1e-104   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   1e-104   
emb|CBI21927.3|  unnamed protein product                                319   1e-104   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   3e-104   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    322   4e-104   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   5e-104   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   8e-104   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   2e-103   
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            321   2e-103   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   2e-103   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              318   3e-103   
dbj|BAJ05384.1|  O-methyltransferase                                    318   4e-103   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   318   5e-103   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             317   5e-103   
dbj|BAI79244.1|  O-methyltransferase                                    318   7e-103   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   8e-103   
dbj|BAJ05387.1|  O-methyltransferase                                    317   1e-102   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   1e-102   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   2e-102   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     317   2e-102   
gb|AAR02421.1|  putative O-methyltransferase                            316   3e-102   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         316   3e-102   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   4e-102   
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                     316   4e-102   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   4e-102   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   4e-102   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   7e-102   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   7e-102   
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    315   7e-102   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    315   7e-102   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      315   1e-101   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    316   1e-101   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   2e-101   
emb|CBI21929.3|  unnamed protein product                                312   2e-101   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   2e-101   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    314   2e-101   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       314   3e-101   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   3e-101   
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   6e-101   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   6e-101   
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   7e-101   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                312   7e-101   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   7e-101   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         313   8e-101   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   1e-100   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   1e-100   
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   1e-100   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   1e-100   
dbj|BAA86059.1|  O-methyltransferase                                    312   4e-100   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   4e-100   
ref|NP_001267964.1|  O-methyltransferase                                311   4e-100   
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         309   5e-100   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   5e-100   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                307   7e-100   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    310   1e-99    
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   3e-99    
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    309   3e-99    
emb|CBI21921.3|  unnamed protein product                                306   5e-99    
ref|XP_002522500.1|  o-methyltransferase, putative                      308   7e-99    
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   1e-98    
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   1e-98    
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 307   2e-98    
emb|CAN75971.1|  hypothetical protein VITISV_009882                     306   2e-98    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   3e-98    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   6e-98    
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    305   8e-98    
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    305   8e-98    
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   305   8e-98    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   1e-97    
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   1e-97    
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    305   1e-97    
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   1e-96    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 302   2e-96    
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         301   2e-96    
dbj|BAI79245.1|  O-methyltransferase                                    301   4e-96    
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        300   7e-96    
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   7e-96    
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   8e-96    
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   1e-95    
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   1e-95    
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             299   1e-95    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    313   1e-95    
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    299   1e-95    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   2e-95    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   2e-95    
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    299   2e-95    
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 299   2e-95    
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   2e-95    
gb|ADO16249.1|  chavicol O-methyltransferase                            299   2e-95    
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   2e-95    
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   3e-95    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   3e-95    
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   3e-95    
dbj|BAJ05388.1|  O-methyltransferase                                    298   3e-95    
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   4e-95    
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 298   5e-95    
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   7e-95    
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase                293   8e-95    
dbj|BAI77794.1|  chavicol O-methyltransferase                           297   1e-94    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   5e-94    
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     295   5e-94    
dbj|BAJ05383.1|  O-methyltransferase                                    294   1e-93    
gb|ABD83946.1|  IOMT 7                                                  294   2e-93    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    295   2e-93    
dbj|BAI79243.1|  O-methyltransferase                                    293   2e-93    
gb|KEH29290.1|  isoflavone-7-O-methyltransferase                        294   2e-93    
emb|CAN77288.1|  hypothetical protein VITISV_004161                     291   4e-93    
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    291   1e-92    
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     291   1e-92    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     291   1e-92    
gb|KEH29280.1|  isoflavone-7-O-methyltransferase                        291   2e-92    
gb|ABD83942.1|  IOMT 2                                                  291   3e-92    
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    290   5e-92    
ref|XP_007132750.1|  hypothetical protein PHAVU_011G122000g             288   5e-92    
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    290   1e-91    
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   1e-91    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    289   2e-91    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       288   2e-91    
emb|CBI38115.3|  unnamed protein product                                286   2e-91    
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    289   3e-91    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    288   4e-91    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   287   5e-91    
sp|Q84KK4.1|I4OMT_LOTJA  RecName: Full=Isoflavone 4'-O-methyltran...    288   6e-91    
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   8e-91    
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   8e-91    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    287   9e-91    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    287   9e-91    
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   1e-90    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    287   1e-90    
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                   284   1e-90    
gb|ACU20151.1|  unknown                                                 286   1e-90    
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    286   2e-90    
ref|XP_003621486.1|  Isoflavone-7-O-methyltransferase                   291   3e-90    
ref|XP_003608212.1|  Isoflavone-7-O-methyltransferase                   291   4e-90    
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   7e-90    
ref|XP_007148101.1|  hypothetical protein PHAVU_006G180900g             284   1e-89    
gb|AAR02417.1|  putative O-methyltransferase                            284   1e-89    
gb|AEF14418.1|  isoflavone O-methyltranferase                           284   1e-89    
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   1e-89    
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   2e-89    
ref|XP_006387382.1|  hypothetical protein POPTR_1124s00200g             278   3e-89    
ref|NP_001241162.1|  uncharacterized protein LOC100813225               283   3e-89    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      283   3e-89    
ref|XP_003608214.1|  Isoflavone-7-O-methyltransferase                   283   4e-89    
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   5e-89    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    282   6e-89    
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    282   6e-89    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    282   8e-89    
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    281   2e-88    
gb|ABD83947.1|  IOMT 8                                                  281   2e-88    
gb|KEH29286.1|  isoflavone-7-O-methyltransferase                        281   2e-88    
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   4e-88    
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   4e-88    
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   6e-88    
gb|AFK47832.1|  unknown                                                 280   9e-88    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               279   9e-88    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    279   1e-87    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     278   1e-87    
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    279   1e-87    
sp|Q84KK5.1|D7OMT_GLYEC  RecName: Full=Isoflavone 7-O-methyltrans...    278   2e-87    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    278   3e-87    
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      277   5e-87    
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    277   7e-87    
gb|AAM97498.1|  O-methyltransferase                                     276   7e-87    
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    277   8e-87    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        283   8e-87    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   276   1e-86    
gb|ABD83944.1|  IOMT 4                                                  276   1e-86    
gb|AFK42082.1|  unknown                                                 276   2e-86    
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    276   2e-86    
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    276   2e-86    
gb|KHN13532.1|  Isoflavone 7-O-methyltransferase                        275   4e-86    
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         275   5e-86    
ref|XP_003552589.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    275   5e-86    
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    275   6e-86    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        273   7e-86    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    274   8e-86    
ref|XP_003542715.1|  PREDICTED: isoflavone 4'-O-methyltransferase       274   1e-85    
ref|XP_006446727.1|  hypothetical protein CICLE_v10015762mg             274   1e-85    
emb|CBI21926.3|  unnamed protein product                                271   1e-85    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             273   2e-85    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             273   2e-85    
pdb|1FPX|A  Chain A, Crystal Structure Analysis Of Selenomethioni...    273   2e-85    
ref|XP_008465175.1|  PREDICTED: trans-resveratrol di-O-methyltran...    272   2e-85    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             273   2e-85    
gb|KDP24059.1|  hypothetical protein JCGZ_25716                         269   3e-85    
ref|XP_004505105.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    273   3e-85    
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    272   4e-85    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 273   4e-85    
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    271   8e-85    
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    271   1e-84    
gb|ACU20413.1|  unknown                                                 271   1e-84    
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    271   1e-84    
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    271   2e-84    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             271   2e-84    
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    270   4e-84    
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        270   5e-84    
sp|Q84KK6.1|I4OMT_GLYEC  RecName: Full=Isoflavone 4'-O-methyltran...    270   5e-84    
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                        269   6e-84    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    270   6e-84    
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    269   8e-84    
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    269   1e-83    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        269   1e-83    
ref|XP_010052398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    269   1e-83    
gb|KDO37308.1|  hypothetical protein CISIN_1g041250mg                   265   3e-83    
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          268   3e-83    
emb|CAN76576.1|  hypothetical protein VITISV_035390                     263   3e-83    
gb|ABD83945.1|  IOMT 6                                                  267   4e-83    
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     268   5e-83    
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             266   7e-83    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    266   9e-83    
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg             264   1e-82    
ref|XP_010097396.1|  8-hydroxyquercetin 8-O-methyltransferase           265   1e-82    
ref|XP_003552574.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    266   1e-82    
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    266   1e-82    
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                        266   1e-82    
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        265   2e-82    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    265   2e-82    



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   501 bits (1291),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 240/329 (73%), Positives = 278/329 (84%), Gaps = 8/329 (2%)
 Frame = -1

Query  970  LLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            ++P++ E ++EIL +QTHIWNHI +FINS SLK A+QL IPDIIHKHG+PM+L QL NAL
Sbjct  2    VVPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANAL  61

Query  790  PINNAKSTHLARLMRTLIHSGFFV---ITKTEGSDD---EGYALAPPSILLLKDNPLSIR  629
             IN AK+THL RLMR LIHSGFFV   I + EG  +   EGYALAPPS LLLKD PLS+ 
Sbjct  62   SINKAKTTHLRRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSVT  121

Query  628  PLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMAR  449
            P +LA+LDPIL +PWH++ EWF+ND PTPF T HG T WDY  A  EP++NH F DAMA 
Sbjct  122  PFLLAMLDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDY--AGHEPRLNHFFNDAMAS  179

Query  448  DSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEG  269
            D++LVMNVVIKY + VFEGLNS++DVGG TGTVA  IA+AFP L+CTVFDLPHVV+GLEG
Sbjct  180  DAKLVMNVVIKYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEG  239

Query  268  TKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDM  89
             KNL+Y GGD FVSIPPADALLLKWILHDWSD+ESVKILKKCKE+IPS+EKGGKVIIIDM
Sbjct  240  NKNLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDM  299

Query  88   MVDNRIKDDESVETQIFFDMLMMILVTGR  2
            MVDN+I DDES+ETQIFFDMLMM+LVTGR
Sbjct  300  MVDNKIGDDESIETQIFFDMLMMVLVTGR  328



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   487 bits (1253),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 276/327 (84%), Gaps = 6/327 (2%)
 Frame = -1

Query  970  LLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            ++P++ E ++EIL +QTHIWNHI +FINS SLK A+QL IPDIIHKHG+PM+L QL NAL
Sbjct  2    VVPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANAL  61

Query  790  PINNAKSTHLARLMRTLIHSGFFVITKTEGSDDEG----YALAPPSILLLKDNPLSIRPL  623
             IN AK+THL RLMR LI SGFFV ++ + ++ E     Y+LAPPS LLLKD PLS+ P 
Sbjct  62   SINKAKTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPF  121

Query  622  VLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDS  443
            +LA+LDPIL +PWH++ EWF+ND PTPF T HG T WDY  A  EP++NH F DAMA D+
Sbjct  122  LLAMLDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDY--AGHEPRLNHFFNDAMASDA  179

Query  442  RLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK  263
            +LVMNVVIKY + VFEGLNS++DVGG TGTVA  IA+AFP L+CTVFDLPHVV+GLE +K
Sbjct  180  KLVMNVVIKYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESK  239

Query  262  NLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV  83
            NL+Y GGD FVSIPPADALLLKWILHDWSD+ESVKILKKCKE+IPS+EKGGKVIIIDMMV
Sbjct  240  NLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMV  299

Query  82   DNRIKDDESVETQIFFDMLMMILVTGR  2
            DN+I DDES+ETQIFFDMLMM+LVTGR
Sbjct  300  DNKIGDDESIETQIFFDMLMMVLVTGR  326



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   469 bits (1207),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 269/331 (81%), Gaps = 10/331 (3%)
 Frame = -1

Query  970  LLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            ++P++ E +SEIL +QTHIWNHI +FINS SLK A+QL IPDIIHKHG+PM+L +L NAL
Sbjct  2    VVPIVGEHESEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANAL  61

Query  790  PINNAKSTHLARLMRTLIHSGFFV--------ITKTEGSDDEGYALAPPSILLLKDNPLS  635
             IN +K THL RLMR LIHSGFF+           +   + EGY LAPP+ LLLKD PL+
Sbjct  62   SINKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLT  121

Query  634  IRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAM  455
            + P +LA+LDPIL +PWH++ EWF +D+PTPF   HG T WDY  A  E ++NH F DAM
Sbjct  122  VTPFLLAMLDPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDY--AGHEQRLNHFFNDAM  179

Query  454  ARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGL  275
            A D++LVM+VV+KY + VFEGLNS++DVGG TGTVA  IA  FP+L+CTVFDLPHVV+GL
Sbjct  180  ASDAKLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGL  239

Query  274  EGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIII  95
            EG+ NL Y GGD FVS+PPADALLLKWILHDWSD+ESVKILKKCKE+IPSKEKGGKVIII
Sbjct  240  EGSDNLSYVGGDFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIII  299

Query  94   DMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            DMMVDN+I DDES+ETQIFFDMLMM+LVTGR
Sbjct  300  DMMVDNKIGDDESIETQIFFDMLMMVLVTGR  330



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   454 bits (1167),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 215/318 (68%), Positives = 259/318 (81%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L +Q H+WNHI NFINS SLKCA+QL IPDIIH HG+PM+L +LV  LPI+  K
Sbjct  7    ETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSD-DEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
               + RLMR L+ SGFF   K E S+ +EGY L   S LLL+D+PLS+RP +LA+LDPIL
Sbjct  67   VWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPIL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WFQNDDPTPF T HG T WDY     EPK+N+ F +AMA D+RLV +V+IK
Sbjct  127  TKPWHYVSAWFQNDDPTPFDTAHGRTFWDY--GGHEPKINNFFNEAMASDARLVTSVLIK  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTVFDLPHVV GLEG+KNL+Y GGDM
Sbjct  185  DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F  IPPADA+LLKWILHDW+D+E VKIL++C+++IPSKEKGGKVIIIDMM++N+  DDES
Sbjct  245  FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDES  304

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMMILVTG+
Sbjct  305  METQLFFDMLMMILVTGQ  322



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   452 bits (1162),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 257/318 (81%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L +Q H+WNHI NFINS SLKCA+QL IPDIIH HG+PM+L +LV  LPI+  K
Sbjct  7    ETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSD-DEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
               + RLMR L+ SGFF   K E S+ +EGY L   S LLL+D+PLS+RP +LA+LDPIL
Sbjct  67   VWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPIL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WFQNDDPTPF T HG T WDY     EPK N+ F +AMA D+RLV + +IK
Sbjct  127  TKPWHYVSAWFQNDDPTPFDTAHGXTFWDY--GGHEPKJNNFFNEAMASDARLVTSXLIK  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTVFDLPHVV GLEG+KNL+Y GGDM
Sbjct  185  DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F  IPPADA+LLKWILHDW+D+E VKIL++C+++IPSKEKGGKVIIIDMM++N+  DDES
Sbjct  245  FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDES  304

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMMILVTG+
Sbjct  305  METQLFFDMLMMILVTGQ  322



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   448 bits (1153),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 270/328 (82%), Gaps = 7/328 (2%)
 Frame = -1

Query  970  LLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            ++P++ E ++EIL +QTHIWNHI +FINS SLK A+QL IPDIIHKHG+PM+L +L NAL
Sbjct  2    VVPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANAL  61

Query  790  PINNAKSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRP  626
             IN++K THL RLMR L+HSGFF+          GS + GY LAPP++LLLKD PL++ P
Sbjct  62   SINHSKITHLRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVTP  121

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDPIL +PWH++ EWF +D+PT F   HG T WDY  A  EP++NH F DAMA D
Sbjct  122  FLLAMLDPILVKPWHHVSEWFTSDEPTAFEVAHGRTFWDY--AGHEPRLNHFFNDAMASD  179

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            ++LVM+VV+KY + VFEGLNS++DVGG TGTVA  IA  FP+L+CTVFDLPHVV+GLEG+
Sbjct  180  AKLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGS  239

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMM  86
             NL Y GGD FVSIP A+ALLLKWILHDWSD+ESVKILKKCKE+IPSKEKGGKVIIIDMM
Sbjct  240  DNLTYVGGDFFVSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMM  299

Query  85   VDNRIKDDESVETQIFFDMLMMILVTGR  2
            VDN+I DDES+ETQIFFDMLMM+LVTGR
Sbjct  300  VDNKIGDDESIETQIFFDMLMMVLVTGR  327



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   442 bits (1136),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 256/321 (80%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P  +E  SE+L +Q H+WNHI NF+NS SLKCA+QL IPDIIH HG+PM+L QLV  LP+
Sbjct  3    PANSEMSSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPV  62

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAIL  608
            +  K+ ++ RLMR L+ S FF   + + S++E GY L   S LLLKD+ LS+RP +LA+L
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAML  122

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            DP LT+PWH +  WFQNDDPTPF T H  TLWDY  A  EP++N+ F +AMA D+RLV +
Sbjct  123  DPTLTKPWHYVSAWFQNDDPTPFDTAHERTLWDY--AGHEPQLNYFFNEAMASDARLVTS  180

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V++K  +GVFEGLNSL+DVGG TGTVA  IA+AFPHLKCTV DLPHVV GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGSKNLNYF  240

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE+GGKVIIIDMMV N+  
Sbjct  241  AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKG  300

Query  67   DDESVETQIFFDMLMMILVTG  5
            D +S ETQ+FFDMLMM+LVTG
Sbjct  301  DCKSRETQLFFDMLMMVLVTG  321



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   437 bits (1123),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 205/321 (64%), Positives = 254/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P   E  SE+L +Q H+WNHI NF+NS SLKCA+QL IPDIIH HG+PM+L +LV  LP+
Sbjct  3    PANGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAIL  608
            +  K+ ++ RLMR L+ S FF   + + S++E GY L   S LLLKD+ LS+RP +LA+L
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAML  122

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            DP LT+PWH +  WFQNDDPTPF T H  TLWDY  A  EP++N+ F +AMA D+RLV +
Sbjct  123  DPTLTKPWHYVSAWFQNDDPTPFDTAHERTLWDY--AGHEPQLNYFFNEAMASDARLVTS  180

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V++K  +GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE+GGKVIIIDMMV N+  
Sbjct  241  AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKG  300

Query  67   DDESVETQIFFDMLMMILVTG  5
            D +S ETQ+FFDMLMM+LVTG
Sbjct  301  DCKSRETQLFFDMLMMVLVTG  321



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   436 bits (1122),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG+PM+L++L +ALPIN  
Sbjct  17   GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPINPT  76

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR LIHSGFF   K   SD+EGY L   S LLLKD+PLSI P + A+LDP+L
Sbjct  77   KSHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLDPVL  136

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH    WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V++ 
Sbjct  137  TKPWHYFSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIVD  194

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             CRGVFEGL+SL+DVGG TGTVA  IA AFPH+KCTV DLPHVV  L+G+KNL Y GGDM
Sbjct  195  ECRGVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQGSKNLKYTGGDM  254

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPADA+LLKWILHDW+D+E VKIL++ KE+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  255  FEAVPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKVIIIDMMMENQKGDEES  314

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  315  METQLFFDMLMMALVTGK  332



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   435 bits (1118),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 252/314 (80%), Gaps = 3/314 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            SE+L +Q H+WNHI NF+NS SLKCA+QL IPDIIH HG+PM+L QLV  LP++  K+ +
Sbjct  3    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  62

Query  763  LARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+ S FF   + + S++E GY L   S LLLKD+ LS+RP +LA+LDP LT+P
Sbjct  63   VYRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  122

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T H  TLWDY  A  EP++N+ F +AMA D+RLV +V++K  +
Sbjct  123  WHYVSAWFQNDDPTPFDTAHERTLWDY--AGHEPQLNYXFNEAMASDARLVTSVLVKEGK  180

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GDMF +
Sbjct  181  GVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEA  240

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE+GGKVIIIDMMV N+  D +S ET
Sbjct  241  IPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGDCKSRET  300

Query  46   QIFFDMLMMILVTG  5
            Q+FFDMLMM+LVTG
Sbjct  301  QLFFDMLMMVLVTG  314



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   434 bits (1115),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 252/320 (79%), Gaps = 3/320 (1%)
 Frame = -1

Query  958  IAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINN  779
            + E  +E+L +  H+WNHI NFINS SLKCA++L IPDIIH HG+PM+L++LV  LP+N 
Sbjct  5    VGETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNP  64

Query  778  AKSTHLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
             K+  + RLMR L+ SGFF   +  E   +EGY L   S LLLKD+PLS RP +LA+LDP
Sbjct  65   EKTKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDP  124

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            +L  PW  +  WFQNDDPTPF T HG T WDY  A  EPK+N+ F +AMA D+RLV +V+
Sbjct  125  VLITPWQYVSAWFQNDDPTPFDTAHGRTFWDY--AGHEPKLNNFFNEAMASDARLVTSVL  182

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            IK C+G+F GLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GLEG+KNL+Y  G
Sbjct  183  IKDCKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAG  242

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD  62
            DMF +IPPADA+LLKWILHDW+  E VKILK+C+++IPSKEKGGKVIIIDMM++N+  DD
Sbjct  243  DMFEAIPPADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKADD  302

Query  61   ESVETQIFFDMLMMILVTGR  2
            ES+ETQ+F+DMLMMI++TG+
Sbjct  303  ESIETQLFWDMLMMIVLTGQ  322



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   433 bits (1114),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/321 (63%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P   E  SE+L +Q H+WNHI NF+NS SLKCA+QL IPDIIH HG+PM+L +LV  LP+
Sbjct  3    PAXGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAIL  608
            +  K+ ++ RLMR L+ S FF   + + S++E GY L   S LLLKD+ LS+RP +LA+L
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASXLLLKDDSLSVRPFLLAML  122

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            DP LT+PWH +  WFQNDDPTPF T H  TLWDY  A  EP++N+   +AMA D+RLV +
Sbjct  123  DPTLTKPWHYVSAWFQNDDPTPFNTAHERTLWDY--AGHEPQLNYFINEAMASDARLVTS  180

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V++K  +GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF  IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKEKGGKVIIIDMM+ N+  
Sbjct  241  AGDMFEXIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKG  300

Query  67   DDESVETQIFFDMLMMILVTG  5
            D +S ETQ+FFDMLMM+ VTG
Sbjct  301  DXKSRETQLFFDMLMMVXVTG  321



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   433 bits (1113),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 252/321 (79%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P   E  SE+L +Q H+WNHI NF+NS SLKCA+QL IPDIIH HG+PM+L +LV  LP+
Sbjct  3    PAKGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPV  62

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAIL  608
            +  K+ ++ RLMR L+ S FF   + + S++E GY L   S LLLKD+ LS+RP +LA+L
Sbjct  63   HPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQLLLKDDSLSVRPFLLAML  122

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            DP LT+PWH +  WFQNDDPTPF T H  TLWDY  A  EP++N+   +AMA D+RLV +
Sbjct  123  DPTLTKPWHYVSAWFQNDDPTPFNTAHERTLWDY--AGHEPQLNYFINEAMASDARLVTS  180

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V++K  +GVFEGLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y 
Sbjct  181  VLVKEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYF  240

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF  IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKEKGGKVIIIDMM+ N+  
Sbjct  241  AGDMFEPIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKG  300

Query  67   DDESVETQIFFDMLMMILVTG  5
            D +S ETQ+FFDMLMM+LVTG
Sbjct  301  DCKSRETQLFFDMLMMVLVTG  321



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   430 bits (1105),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLSI P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPADA+LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   429 bits (1104),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 200/318 (63%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMRTL+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDP PF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPAPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPADA+LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   428 bits (1101),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/318 (63%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWHYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSMAHFFNDAMACDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+CKE+I SK+K GKVIIIDM+++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQKVDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   428 bits (1100),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +++L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTGR
Sbjct  304  IETQLFFDMLMMALVTGR  321



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   427 bits (1099),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P++ H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNCLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPRIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FETVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   427 bits (1099),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   428 bits (1101),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  17   GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  76

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  77   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  136

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  137  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  194

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  195  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  254

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  255  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGDEES  314

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  315  IETQLFFDMLMMALVTGK  332



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   427 bits (1098),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   427 bits (1098),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM +N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMRENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   426 bits (1096),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   426 bits (1096),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I S++K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L +L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q+HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLSI P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F + PPADA+LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAAPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   426 bits (1094),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   426 bits (1094),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+++E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMTLVTGK  321



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   425 bits (1093),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY      P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   425 bits (1093),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+ NL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSTNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   425 bits (1093),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +++I SK+K GKVII+DMM++N+ +D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKRDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   425 bits (1093),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY      P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   425 bits (1093),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 250/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q+HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G++NL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   425 bits (1092),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +++L +Q H WNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   425 bits (1092),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +AL I+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   424 bits (1091),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTSWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AF H++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPADA+LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   425 bits (1093),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 200/319 (63%), Positives = 248/319 (78%), Gaps = 5/319 (2%)
 Frame = -1

Query  949  KDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKS  770
            + SE+L +QTH+WNHI NFINS SLKCA+QL IPDIIH H QPM+L +LV  LP+   K+
Sbjct  8    RSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKT  67

Query  769  THLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
              + RLMR L+HSGFF + +  E +D+EGY LA  S LLLKD+PLS+ P +LA+LDP LT
Sbjct  68   LCVHRLMRILVHSGFFTMQRVQESADEEGYVLANASRLLLKDHPLSVTPFLLAMLDPDLT  127

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PWH +  WFQNDDPTPF T HG T+WDY     EP+ N+ F +AMA D+RLV +V++K 
Sbjct  128  EPWHYVSAWFQNDDPTPFFTAHGRTIWDY--GCHEPRFNNFFNEAMASDARLVTSVLVKE  185

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+G FEGLNS +DVGG TGTVA  I  AFPHL  TV DLPHVV  L+G K+L Y  GDMF
Sbjct  186  CKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGGKSLTYLAGDMF  245

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE--  59
             +IPPADA+LLKWILHDWSD+E +KILK+C+E+IPSKEKGGKV+IIDM + N+  DD+  
Sbjct  246  EAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKGDDDES  305

Query  58   SVETQIFFDMLMMILVTGR  2
            +VETQ+FFDMLMM+L+ GR
Sbjct  306  NVETQLFFDMLMMVLLPGR  324



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   424 bits (1091),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   +   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E V+ILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   424 bits (1091),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKIL++  E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   424 bits (1091),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I S++K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   424 bits (1090),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 249/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +F+NS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S  LLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWHYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSMAHFFNDAMACDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+CKE+I SK+K GKVIIIDM+++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQKVDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   424 bits (1090),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   424 bits (1090),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY      P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   424 bits (1090),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G++NL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWI HDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPCIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDM ++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMTMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             +  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GKHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY      P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   424 bits (1089),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   423 bits (1088),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   423 bits (1088),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +AL I+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   423 bits (1087),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +   FQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTRFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   422 bits (1085),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +AL I+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCNGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   422 bits (1085),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   422 bits (1084),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL I DII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   422 bits (1084),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L  Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   422 bits (1084),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHI +FINS SLK A+QL I DII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HG T WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGTTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G++NL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPA  +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   421 bits (1082),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVRGQ  321



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   421 bits (1081),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +AL I+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+P S+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+  SK K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   421 bits (1081),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLP VV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K G+VIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   421 bits (1082),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 245/318 (77%), Gaps = 6/318 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
             E+  +Q HIWNHI NFINS SLKCA+QL IPDIIHKHGQPM+L QL++ALPINNAK+  
Sbjct  11   GELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAPF  70

Query  763  LARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR LIHSGFF+  K  +    EGYAL   S LLL ++P S+ P +LA+LDPILT P
Sbjct  71   VYRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLAMLDPILTDP  130

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH+  +WFQN + TPF T HG +LW+   A ++P++N  F + MA D+RLV  +VI+ C+
Sbjct  131  WHHFSQWFQNSEETPFHTCHGTSLWEL--AGRQPQLNQFFNEGMASDARLVSTMVIENCK  188

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
             VF GLNSLIDVGG TGTVA  IA AFPHL+C+V DLPHVV G E +KNL Y GGDMF +
Sbjct  189  DVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAYVGGDMFEA  248

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV---DNRIKDDES  56
            IPPADA+LLKWILHDWSD+E V+IL+KCKE+IPS EKGGKVIIIDM++    N   D E+
Sbjct  249  IPPADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKSQQNGDDDAEA  308

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM+ V GR
Sbjct  309  IETQLFFDMLMMVHVKGR  326



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   420 bits (1080),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEDSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  L RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH++  WFQNDD TPF T HGMT+WDY     +P  +H F DAMA D+RLV +V+I 
Sbjct  126  TKPWHHLSTWFQNDDLTPFATAHGMTMWDY--GNHQPSFSHFFNDAMASDARLVASVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  ECKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKIL++ KE+I SK+K GKVIIIDM++ N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKVIIIDMIMGNQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +E Q+FFDMLMM+L+ G+
Sbjct  304  IEMQLFFDMLMMVLLKGK  321



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   420 bits (1080),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDWSDQE +KIL++ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   421 bits (1081),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  17   GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  76

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  77   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  136

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  137  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  194

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  195  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  254

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDWSD+E +KIL++ + +I  KEK GKVIIIDMM++N+  D+ES
Sbjct  255  FEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGDEES  314

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  315  IETQLFFDMLMMALVGGK  332



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   420 bits (1079),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDWSD+E +KIL++ + +I  KEK GKVII+DMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIVDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   420 bits (1079),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGM  WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMAFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++P AD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   420 bits (1079),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   419 bits (1078),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  7    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  67   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  127  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  185  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  245  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  304

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  305  IETQLFFDMLMMALVGGK  322



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   419 bits (1078),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  ++ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGEEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 247/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHI NFINS SLKCA+QL IPDIIH HG+PM+  +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF    + + G  +EGY L   S LLL D+ LSIRP +LA+LDP+
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPV  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T H    WDY  A  EP++N+ F +AMA DSRLV++V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAHEQPFWDY--AGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K  +G+FEGLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+ +KNL+Y  GD
Sbjct  184  KEGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQESKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +
Sbjct  244  MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ++FDM+MMILVTGR
Sbjct  304  SVETQLYFDMVMMILVTGR  322



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   419 bits (1076),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDWSD+E +KIL++ + +I  KEK GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   419 bits (1076),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   418 bits (1075),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KIL++ + +I  KEK GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   418 bits (1075),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             +  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GQHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   418 bits (1074),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KIL++ + +I  KEK GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   417 bits (1073),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HS FF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNYQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LL+WILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV GR
Sbjct  304  IETQLFFDMLMMALVGGR  321



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   417 bits (1073),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL I D+I+KHG  M+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  304  IETQLFFDMLMMALVTGK  321



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 246/319 (77%), Gaps = 5/319 (2%)
 Frame = -1

Query  949  KDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKS  770
            + SE+L +QTH+WNHI NFINS SLKCA+QL IPDIIH H QPM+L +LV  LP+   K+
Sbjct  8    RSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKT  67

Query  769  THLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
              + RLMR L+HSGFF + +  E +D+EGYALA  S LLLKD+PLS  P +LA+LDP LT
Sbjct  68   LCVHRLMRILVHSGFFTMQRVQESADEEGYALANASRLLLKDHPLSATPFLLAMLDPDLT  127

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PWH +  WFQNDDPTPF T HG T+WDY     EP+ N+ F +AMA D+RLV +V+IK 
Sbjct  128  EPWHYVSAWFQNDDPTPFFTAHGRTIWDY--GCHEPRFNNFFNEAMASDARLVTSVLIKE  185

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+G FEGLNS +DVGG TGTVA  I  AFPHL  TV DLPHVV  L+G+KNL Y  GDMF
Sbjct  186  CKGAFEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGSKNLTYLAGDMF  245

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD-DES  56
             +IPPADA+LLKWILHDWSD+E +KIL++C+ +IPSKEKGGKV+IIDM + N+  D DES
Sbjct  246  EAIPPADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKVMIIDMAILNKKGDEDES  305

Query  55   -VETQIFFDMLMMILVTGR  2
             VETQ+F DMLMM+L  GR
Sbjct  306  KVETQLFMDMLMMVLYPGR  324



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   417 bits (1073),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI NFINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLK +PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTTHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +K+LK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  304  IETQLFLDMLMMALVGGK  321



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   417 bits (1073),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL I DII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P   H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSTAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   418 bits (1074),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 246/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHILNFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPL+LA+LDPI
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPI  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T H    WDY  A  EP++N+ F +AMA D+RLV +V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAHERPFWDY--AGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K  +GVFEGLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            +F +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +
Sbjct  244  IFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+FFDM MMI   GR
Sbjct  304  SIETQLFFDMTMMIFAAGR  322



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   417 bits (1072),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPA+ +LLKWILHDW+D+E VKILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAIPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  304  IETQLFLDMLMMALVGGK  321



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   417 bits (1072),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+K+G PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HS FF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNYQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   417 bits (1072),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 247/318 (78%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSELTSALPIHPT  64

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  65   KSPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  125  TTPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  182

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SLIDVGG  GTVA  IA AFPH++CTV DLP+VV  L+G+KNL Y GGDM
Sbjct  183  DCKGVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQGSKNLKYTGGDM  242

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I  K+K GKVIIIDMM++N+  D+ES
Sbjct  243  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGDEES  302

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  303  IETQLFFDMLMMALVTGK  320



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   417 bits (1072),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L +L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y  GDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   417 bits (1073),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 258/327 (79%), Gaps = 4/327 (1%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL   I ++  EIL +Q HI NH+ N++NS SLKCA+QLEIPDIIH HG+PM+L+ LVN
Sbjct  1    MALSNNIGDETREILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVN  60

Query  796  ALPINNAKSTH-LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPL  623
            ALPIN AK    + RLMR LIHSGFF+ TK  E  ++EGY L P S LLLK+ PLS+ P 
Sbjct  61   ALPINKAKGQDCIYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPF  120

Query  622  VLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDS  443
            VLA LDPIL  P+ ++ +W QNDD TPF T HG  L++Y  A +EP++N+LF +AMA D+
Sbjct  121  VLAQLDPILMDPFQSLSKWLQNDDSTPFATAHGKPLFEY--AGEEPRLNYLFNEAMASDA  178

Query  442  RLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK  263
            RL+++VVIK   G+F+GL SL+DVGG  GTVA  I++AFP +KCTVFDLPHVV+GLEG+K
Sbjct  179  RLMISVVIKTGSGIFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSK  238

Query  262  NLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV  83
            NL Y GGDMF S+P ADA+LLKWILHDWSD++ VKILKKCKE+IPSKE  GKVIIID++V
Sbjct  239  NLSYVGGDMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVV  298

Query  82   DNRIKDDESVETQIFFDMLMMILVTGR  2
            D++  D++S ETQ+F D+LMM+ V+G+
Sbjct  299  DSQKGDNKSFETQLFSDILMMVHVSGK  325



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  7    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPT  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K    D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  67   KSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  127  TKPWNYLSTWFQNDDPTPFDTTHGMTFWDY--GNHQPNIAHLFNDAMASDARLVTSVIID  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  185  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  245  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  304

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  305  IETQLFLDMLMMALVGGK  322



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K    D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTTHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  304  IETQLFLDMLMMALVGGK  321



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   416 bits (1070),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L  Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PL++ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTTHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  304  IETQLFLDMLMMALVGGK  321



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 245/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHILNFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF      + G ++EGY L   S LLL D+ LSIRPL+LA+LDPI
Sbjct  66   RSQCVYRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPI  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T H    WDY  A  EP++N+ F +AMA D+RLV +V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAHERPFWDY--AGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K  +GVFEGLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            +F +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +
Sbjct  244  IFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+FFDM MMI   GR
Sbjct  304  SIETQLFFDMTMMIFAAGR  322



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   417 bits (1071),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 253/326 (78%), Gaps = 3/326 (1%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL   I +K  EIL +Q HI NH+ N+IN  SLKCA+QLEIPDIIH HG+PM+L+ LVN
Sbjct  1    MALSNNIRDKTREILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVN  60

Query  796  ALPINNAKSTH-LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            ALPIN AK    + RLMR LIHSGFF+ TK   +++EGY L P S LLLK+ PLS+ P V
Sbjct  61   ALPINKAKGQDCIYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFV  120

Query  619  LAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSR  440
            LA LDPIL  P+ ++ +W QN D TPF T HG  L++Y  A  EP++N+LF +AMA D+R
Sbjct  121  LAQLDPILMDPFQSLSKWLQNSDSTPFATAHGKPLFEY--AGDEPRLNYLFNEAMASDAR  178

Query  439  LVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKN  260
            L+++VVIK  RG+FEGL SL DVGG  GTVA  I++AFP +KCTVFDLPHVV+GLEG+  
Sbjct  179  LMISVVIKNGRGIFEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNK  238

Query  259  LDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            L Y GGDMF S+P ADA+LLKWILHDWSD++ VKILKKCKE+IPSKE GGKVIIID++VD
Sbjct  239  LSYVGGDMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVVD  298

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            ++  D++S ETQ+F D LMM+ V+G+
Sbjct  299  SQKGDNKSFETQLFSDTLMMVHVSGK  324



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HI NHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+ DP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY      P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHHPSIAHFFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +E+I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM L+TG+
Sbjct  304  IETQLFFDMLMMALLTGK  321



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 246/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHI NFINS SLKCA+QL IPDIIH HG+PM+  +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF    + + G  +EGY L   S LLL D+ LSIRP +LA+LDP+
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPV  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T H    WDY  A  EP++N+ F +AMA DSRLV++V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAHEQPFWDY--AGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K  +G+FEGLNSL+DVGG TG VA  IA+AFPHL CTV D PHVV GL+ +KNL+Y  GD
Sbjct  184  KEGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQESKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +
Sbjct  244  MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ++FDM+MMILVTGR
Sbjct  304  SVETQLYFDMVMMILVTGR  322



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L +L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++P AD +LLKWILHDW+DQE +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   418 bits (1074),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 246/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E D+E+L++Q H+WNHI NFINS SLKCAV+L IPDII+KHG+PM+L +LV+AL IN +
Sbjct  46   GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPS  105

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKDNPLS+ P + A+
Sbjct  106  KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  165

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQNDDPTPF T HG +LW+Y  A  EPK+N+ F +AMA D+RL  
Sbjct  166  LDPILLSPWLKLSTWFQNDDPTPFDTAHGKSLWEY--AGDEPKINNFFNEAMASDARLAT  223

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
             VVI  C+ VFEGLNSL+DVGG TGTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  224  RVVIHKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  283

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +IPPADA+L KWILHDW+D+E VKILKKCKE+I S  K GKVIIIDMM +N+
Sbjct  284  YIGGDMFEAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENK  343

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              D ES+ETQ+FFDMLMM+LVTG
Sbjct  344  KGDSESIETQLFFDMLMMVLVTG  366



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/319 (63%), Positives = 246/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D E+L +Q HIWNHI NFINS SLKCA+ L IPDII+KH +P++L +L+ ALP++  
Sbjct  7    GKHDRELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPG  66

Query  775  KSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  + RLMR LIHSGFF   K +E   +EGY L   S LLLKDNP S+ P + A+LDPI
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLDPI  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  W +NDDPTPF T HG T WDY+    EP  NHLF DAMA D+RLV  V+I
Sbjct  127  LTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYV--GHEPVFNHLFNDAMASDARLVTRVLI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
              C+ VFEGL SL+DVGG TGTVA  IA AFPHL CTVFDLPHVV  L+G++NL Y GGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPAD ++LKWILHDW+D+E VKILKKCKE+I  +E GGKV+II+MM++N+  +D+
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGEDD  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQIFFDMLMMILVTG+
Sbjct  304  SIETQIFFDMLMMILVTGQ  322



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 247/318 (78%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  17   GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPT  75

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  76   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  135

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQN+DPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  136  TTPWNYLSTWFQNEDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  193

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  194  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  253

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  254  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  313

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  314  IETQLFFDMLMMALVRGQ  331



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   415 bits (1066),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 246/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D E+L +Q HIWNHI +FINS SLKCA+ L IPDII+KH +P++L +L+ ALP++ +
Sbjct  7    GKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPS  66

Query  775  KSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  + RLMR LIHSGFF   K +E   +EGY L   S LLLKDNP S+ P + A+LDPI
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPI  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  W +NDDPTPF T HG T WDY+    EP  NHLF DAMA D+RLV  V+I
Sbjct  127  LTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYV--GHEPVFNHLFNDAMASDARLVTRVLI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
              C+ VFEGL SL+DVGG TGTVA  IA AFPHL CTVFDLPHVV  L+G++NL Y GGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPAD ++LKWILHDW+D+E VKILKKCKE+I  +E GGKV+II+MM++N+  +DE
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGEDE  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQIFFDMLMMIL TG+
Sbjct  304  SIETQIFFDMLMMILFTGQ  322



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K    D+EGY L   S LL KD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSTWFQNDDPTPFDTTHGMTFWDY--GNHQPNIAHLFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DMLMM LV G+
Sbjct  304  IETQLFLDMLMMALVGGK  321



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 246/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E D+E+L++Q H+WNHI NFINS SLKCAV+L IPD+I+KHG+PM+L +LV+AL IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKDNPLS+ P + A+
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQNDDPTPF T HG + W+Y  A  EPK+N+ F +AMA D+RL  
Sbjct  126  LDPILLSPWLKLSTWFQNDDPTPFDTAHGKSFWEY--AGDEPKINNFFNEAMASDARLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
            +VVI  C+ VFEGLNSL+DVGG TGTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  184  SVVIHKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGD+F +IPPADA+L KWILHDW+D+E VKIL+KCKE+I S  K GKVIIIDMM +N+
Sbjct  244  YVGGDVFEAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKVIIIDMMRENK  303

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              D ES+ETQ+FFDMLMM+LVTG
Sbjct  304  KGDSESIETQLFFDMLMMVLVTG  326



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   413 bits (1062),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FIN  SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPT  64

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  65   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQN+DPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  125  TTPWNYLSTWFQNEDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  182

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  183  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  242

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  243  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  302

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  303  IETQLFFDMLMMALVRGQ  320



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   413 bits (1062),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  126  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGT+A  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHD +D+E +KIL++ + +I  KEK GKVIIIDMM++N+  D+ES
Sbjct  244  FEAVPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  304  IETQLFFDMLMMALVGGK  321



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 246/318 (77%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPT  64

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  65   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQN+DPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  125  TTPWNYLSTWFQNEDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIID  182

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA A PH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  183  DCKGVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQGSKNLKYTGGDM  242

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  243  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  302

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LV G+
Sbjct  303  IETQLFFDMLMMALVRGQ  320



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 243/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T H  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAHERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +S ET
Sbjct  248  IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAPGR  322



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T H  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAHERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +S ET
Sbjct  248  IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAAGR  322



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   412 bits (1060),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 245/318 (77%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPT  64

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP+L
Sbjct  65   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+ +  WFQNDDPTPF T HGMT WDY     +P + HLF DAMA D+RLV +V+I 
Sbjct  125  TNPWNYLSTWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHLFNDAMASDARLVTSVIIN  182

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL DVGG TGTVA  IA AFP+++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  183  DCKGVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDM  242

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDMM++N+  D+ES
Sbjct  243  FEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGDEES  302

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ FFDMLMM LV G+
Sbjct  303  IETQPFFDMLMMALVRGQ  320



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   413 bits (1061),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D E+L +Q HIWNHI +FINS SLKCA+ L IPDII+KH +P++L +L+  LP++ +
Sbjct  7    GKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPS  66

Query  775  KSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  + RLMR LIHSGFF   K +E   +EGY L   S LLLKDNP S+ P + A+LDPI
Sbjct  67   KARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPI  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  W +NDDPTPF T HG T WDY+    EP  NHLF DAMA D+RLV  V+I
Sbjct  127  LTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYV--GHEPVFNHLFNDAMASDARLVTRVLI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
              C+ VFEGL SL+DVGG TGTVA  IA AFPHL CTVFDLPHVV  L+G++NL Y GGD
Sbjct  185  NECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPAD ++LKWILHDW+D+E VKILKKCKE+I  +E GGKV+II+MM++N+  +DE
Sbjct  245  MFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGEDE  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQIFFDMLMMIL TG+
Sbjct  304  SIETQIFFDMLMMILFTGQ  322



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 242/313 (77%), Gaps = 2/313 (1%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L +Q HIWNHI +F+NS SLKCAVQL+I D+I KHGQPM L++LV+ALPI+  K+  +
Sbjct  10   ELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALPISPTKAHFI  69

Query  760  ARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWH  581
             RLMR L+HSGFF      G  ++GY L   S LLLKDNP+S RP +LA+L+P+LT PW 
Sbjct  70   PRLMRILVHSGFFARESLSGGGEQGYVLTDASALLLKDNPMSARPFLLAMLNPMLTDPWQ  129

Query  580  NIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGV  401
             +  WFQND+PTPF  VHGMT WDY    ++P + H F DAMA D++L+ +++I  C+GV
Sbjct  130  YLTTWFQNDNPTPFHVVHGMTFWDY--GNQDPTLAHFFNDAMASDAQLISSLMIDDCKGV  187

Query  400  FEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIP  221
            F+G++SL+DVGG TGTVA  IA AFPH+KCTV DLPHVV  L+G+KNL+Y  GDMF ++P
Sbjct  188  FQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFEAVP  247

Query  220  PADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQI  41
             ADA+ LKWILHDWSD+E VKIL++CKE+I  + K GKVII+DM V+N+  D ES ETQ+
Sbjct  248  EADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVENKNTDKESGETQL  307

Query  40   FFDMLMMILVTGR  2
            FFDMLMM+LV G+
Sbjct  308  FFDMLMMVLVKGK  320



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   412 bits (1058),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 243/315 (77%), Gaps = 4/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NF+NS SLKCA+QL IPD+IH HG+PM+L++LV  LPI+ +K+  
Sbjct  11   AELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPG  70

Query  763  LARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGFF      G ++ EGY L   S LL+KDNP S+ P +LA+LDPILTQP
Sbjct  71   IYRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLDPILTQP  130

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQND P+ F T H  T W+Y  A  E ++NH F +AMA D+RLV +V++  C+
Sbjct  131  WHYVSVWFQNDAPSSFYTAHQRTSWEY--AGHETELNHFFNEAMASDARLVSSVLVNECK  188

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGLNSL+DVGG TGTVA  IA  F HL CTVFDLPHVV GLEG++NL Y  GDMF +
Sbjct  189  GVFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGSENLKYLSGDMFEA  248

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IP ADA+LLKWILHDW+D+E VKILK+CKE+I  +E GGK+IIIDM+V+N  + + S ET
Sbjct  249  IPQADAILLKWILHDWNDEECVKILKQCKEAIKGRE-GGKLIIIDMVVENNKEVEGSTET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDMLMMILVTG+
Sbjct  308  QLFFDMLMMILVTGK  322



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHI NFI S SLKCA QL IPDIIH HG+PM+L +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPI
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPI  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T +    WDY  A  EP++N+ F +AMA D+RL+ +V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAYERPFWDY--AGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K  +GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GD
Sbjct  184  KEGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +
Sbjct  244  MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S ETQ+FFDM MMI   GR
Sbjct  304  STETQLFFDMTMMIFAAGR  322



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 241/313 (77%), Gaps = 3/313 (1%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L +Q HIWNHI +FINS SLKCAVQL IPD+I KHGQPM+L++LV+ALPI+  K+  +
Sbjct  10   ELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALPISPTKAHFI  69

Query  760  ARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWH  581
             RLMR L+HS FF      G + +GY L   S LLL+DNP+S RP +LA+L+PILT PW 
Sbjct  70   PRLMRILVHSSFFARESLSGGE-QGYVLTDASTLLLEDNPMSARPFLLAVLNPILTDPWQ  128

Query  580  NIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGV  401
             +  WFQND+PTPF  VHGMT WDY    ++P + H F DAMA D+RL+ ++VI  C+GV
Sbjct  129  YLTTWFQNDNPTPFHMVHGMTFWDY--GNQDPTIAHFFNDAMASDARLISSLVIDECKGV  186

Query  400  FEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIP  221
            F+G++SL+DVGG TGTVA  IA AFPH+KCTV DLPHVV  L+G+KNL+Y  GDMF ++P
Sbjct  187  FQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFDAVP  246

Query  220  PADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQI  41
             ADA+ LKWILHDWSD+E VKIL++CKE+I  + K GKVII+DM V+++  D ES ETQ+
Sbjct  247  AADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVEDKNTDKESGETQL  306

Query  40   FFDMLMMILVTGR  2
            FFDM MM+L TG+
Sbjct  307  FFDMEMMVLATGK  319



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 246/331 (74%), Gaps = 8/331 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            M L   I +   E+  +Q HIWNHI NFINS S+KCA+QL IPD+IHKHGQPM+L QL++
Sbjct  1    MDLARNIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLID  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRP  626
            ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   S LLLK NP S+ P
Sbjct  61   ALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTP  120

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDP LT PWH++ +WFQN D TPF T HG ++  Y +A  EP +N  F +AMA D
Sbjct  121  FLLAMLDPALTDPWHHLSQWFQNSDETPFYTCHGRSI--YAFASHEPWLNQFFNEAMASD  178

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            +R+V +VV K C+ VFEGLNSL+D+GG TGT A  IA AFP LKCTV DLPHVV GLE +
Sbjct  179  ARMVSSVVTKDCKHVFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS  238

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMM  86
            KNL Y GG+MF +IPPADA+L+KWIL DWSD E V+ILKKCKE+IPSKEKGGKVII+D  
Sbjct  239  KNLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTF  298

Query  85   VDNRIKDD---ESVETQIFFDMLMMILVTGR  2
              ++ K D   E++ETQ+F+DM  M+LV GR
Sbjct  299  CKSQQKGDDDHEAIETQLFYDMGAMVLVKGR  329



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/329 (62%), Positives = 251/329 (76%), Gaps = 9/329 (3%)
 Frame = -1

Query  967  LPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP  788
            L L  E  +EIL +Q HIWN I NFINS SLKCA+QL IPDII+ HG+PM+++QL  ALP
Sbjct  16   LILNEENSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLALP  75

Query  787  INNAKSTHLARLMRTLIHSGFFVITKTE-----GSDDEGYALAPPSILLLKDNPLSIRPL  623
            IN  KS  + RLMR LIHSGFF + K E     G ++EGY +   S LLLKDNP+S+ P 
Sbjct  76   INRKKSPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVTPF  135

Query  622  VLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDS  443
            +LA+LDP++T+PW  +  WFQN DPTPF T +GM  WDY     EPK+   F DAMA D+
Sbjct  136  LLAMLDPVMTKPWDFLSNWFQNGDPTPFDTANGMAFWDY--GSHEPKLARFFNDAMASDA  193

Query  442  RLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK  263
            RLV +VVI+ C+GVFEG+ SL+DVGG TGTVA+ IA AFPH++CTVFDLPHVV  L+G  
Sbjct  194  RLVTSVVIEKCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGN  253

Query  262  NLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIP-SKEKGGKVIIIDMM  86
            NL++ GGDMFV +P  + +LLKWILHDW+D+ESVKILKKCKE+I  S +KGGKVIIIDM 
Sbjct  254  NLNFVGGDMFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGKVIIIDMK  313

Query  85   VDN-RIKDDESVETQIFFDMLMMILVTGR  2
            V+N + +DDES ETQ+FFDMLMM LVTGR
Sbjct  314  VENEKDEDDESYETQLFFDMLMMALVTGR  342



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 245/318 (77%), Gaps = 2/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL IPDII+KHG PM+L++L + LPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K   +D+EGY L   S LLLKD+PLS+ P + A+LDP L
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLDPAL  125

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW+ +  WFQNDDPTPF T HGMT WDY     +P + H F DAMA D+RLV +V+I 
Sbjct  126  TKPWNYLSIWFQNDDPTPFDTAHGMTFWDY--GNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y GGDM
Sbjct  184  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDM  243

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++P AD +LLKWILHDW+D+E +KILK+ + +I SK+K GKVIIIDM+++N+  D+ES
Sbjct  244  FEAVPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMIMENQKGDEES  303

Query  55   VETQIFFDMLMMILVTGR  2
            +ET++FFDMLMM ++TG+
Sbjct  304  IETELFFDMLMMAILTGK  321



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   410 bits (1053),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 240/319 (75%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHI NFI S SLKCA QL IPDIIH HG+PM+L +LV  LP++  
Sbjct  6    GEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  775  KSTHLARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +S  + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPI
Sbjct  66   RSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPI  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PWH +  WFQNDDPTPF T +    WDY  A  EP++N+ F +AMA D+RL+  V++
Sbjct  126  LTKPWHYLSAWFQNDDPTPFHTAYEXXFWDY--AGHEPQLNNSFNEAMASDARLLTXVLL  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K   GVF GLNSL+DVGG TG VA  IA AFPHL CTV DL HVV GL+G+KNL+Y  GD
Sbjct  184  KEGXGVFAGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     DD+
Sbjct  244  MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDDK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+FFDM MMI   GR
Sbjct  304  SIETQLFFDMTMMIFSAGR  322



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/323 (61%), Positives = 244/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E D+E+L++Q H+WNHI NFINS SLKCAV+L IPDII+KHG+PM+L +LV+AL IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKD+PLS+ P + A+
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQAM  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQ+DDP PF T HG + W+Y  A  EPK+N+ F +AMA D+RL  
Sbjct  126  LDPILLSPWLKLSTWFQSDDPAPFDTAHGKSFWEY--AGDEPKINNFFNEAMASDARLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
             VVI  C+ VF+GLNSL+DVGG TGTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  184  RVVIHKCKDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +IPPADA++LKWILHDW+D+E VKILKKCKE+I S  K GKVIIIDMM +N+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENK  303

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              +DES ETQ+FFDMLMM+L TG
Sbjct  304  KGNDESTETQLFFDMLMMVLATG  326



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 241/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T +    WDY  A  EP++N+ F +AMA D+RL+ +V+IK  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAYERPFWDY--AGHEPQLNNSFNEAMASDARLLTSVLIKEGK  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +S+ET
Sbjct  248  IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSIET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM M I   GR
Sbjct  308  QLFFDMTMTIFAPGR  322



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA+QL IPD IH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T +  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTTYERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKW LHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +S+ET
Sbjct  248  IPPADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSIET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAPGR  322



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 244/315 (77%), Gaps = 5/315 (2%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L +Q HIWNHI NFINS SLK A+QL IPD IH HG+P+SL+QL+ ALP+  AK+  +
Sbjct  10   ELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARCI  69

Query  760  ARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
             RLMR L+HSGFF   K +G+D+E G+ L   S LLLKDNPLS+ P +LA+LDPILT+PW
Sbjct  70   PRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLDPILTEPW  129

Query  583  HNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRG  404
            H +  WFQNDD TPF TVHGM  W+Y  A  EPK N+ F +AMA D+RLVM V+I   +G
Sbjct  130  HYVSTWFQNDDATPFDTVHGMPFWEY--AGNEPKFNNFFNEAMASDARLVMRVLIDEYKG  187

Query  403  VFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSI  224
            VFEGLNSL+DVGG TGT+A  IA AFP L C VFDLPHVV GL+ + NL Y GG+MF  +
Sbjct  188  VFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNMFEGV  247

Query  223  PPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDN-RIKDDESVET  47
            PPADA+LLKWI+HDWSD+E +KIL++ KE+I  K KGGK+IIIDM+ +N ++ DD+ VET
Sbjct  248  PPADAILLKWIIHDWSDEECLKILQRSKEAIKGK-KGGKLIIIDMVSENQQVIDDQYVET  306

Query  46   QIFFDMLMMILVTGR  2
            Q+F+DMLMM L TG+
Sbjct  307  QLFYDMLMMALQTGK  321



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 245/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D+E+L++QTH+WNHI NFINS +LKCA+QL IPDII KHG+PM+L +LV+AL IN +
Sbjct  6    GDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFF-----VITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            KS  + RLMR LIH+GFF     + ++    +++GY L   S LLLKDNPLS+ P + A+
Sbjct  66   KSRCVYRLMRILIHTGFFAQQKLISSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQNDDPTPF T HG TLW+Y  A  EPK+N+ F +AMA D+ L  
Sbjct  126  LDPILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEY--AGDEPKLNNFFNEAMASDAWLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
            +V+I  C+ VFEGLNSL+DVGG  GT A  IA AFP L+CT FDLPHVV GL+    NL 
Sbjct  184  SVMIHKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +I PADA+LLKWILHDW+D+E VKILKKCKE+I S  K GKVIIIDM+ +N+
Sbjct  244  YVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENK  303

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              DD+S+ETQ+FFDMLMM+L+TG
Sbjct  304  KGDDKSIETQLFFDMLMMVLLTG  326



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   407 bits (1046),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 197/323 (61%), Positives = 243/323 (75%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D+E+L++Q H+WNHI NFINS SLKCAV+L IPDII+KHG+P +L  LV+AL IN +
Sbjct  6    GDHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKD+PLS+ PL+ A+
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAV  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQ+DDP PF  VHG + W+Y  A  EPK+N+ F +AMA D+RL  
Sbjct  126  LDPILLSPWLKLSTWFQSDDPAPFDMVHGKSFWEY--AGDEPKINNFFNEAMASDARLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
             VVI  C+ VFEGLNSL+DVGG+TGTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  184  RVVIHKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +IPPADA++LKWILHDW+D+E VKILKKCKE+I S  K GKVIIIDMM +N+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMRENK  303

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              DDES ETQ+FF MLMM+L TG
Sbjct  304  KGDDESTETQLFFYMLMMVLATG  326



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T +  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAYERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DL HVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWS++E VKILK+C+E+IPSKE GGKVIIIDM++     D +S ET
Sbjct  248  IPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAPGR  322



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T +  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAYERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DL HVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFGA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDWS++E VKILK+C+E+IPSKE GGKVIIIDM++     D +S ET
Sbjct  248  IPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAPGR  322



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   407 bits (1045),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 246/323 (76%), Gaps = 8/323 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D+E+L++QTH+WNHI NFINS +LKCA+QL IPDII KHG+PM+L +LV+AL IN +
Sbjct  6    GDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFF----VITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAI  611
            KS  + RLMR LIH+GFF    +I+    +D+E GY L   S LLLKDNPLS+ P + A+
Sbjct  66   KSRCVYRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQAM  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQNDDPTPF T HG TLW+Y  A  EPK+N+ F +AMA D+ L  
Sbjct  126  LDPILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEY--AGDEPKLNNFFNEAMASDAWLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
            +V+I  C+ VFEGLNSL+DVGG  GT A  IA AFP L+CT FDLPHVV GL+    NL 
Sbjct  184  SVMIHKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +I PADA+LLKWILHDW+D+E VKILKKCKE+I S  K GKVIIIDM+ +N+
Sbjct  244  YVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENK  303

Query  73   IKDDESVETQIFFDMLMMILVTG  5
              DD+S+ETQ+FFDMLMM+L+TG
Sbjct  304  KGDDKSIETQLFFDMLMMVLLTG  326



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 243/331 (73%), Gaps = 8/331 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            M L   + +   E+  +Q HIWNHI NFINS S+KCA QL IPD+IHKHGQPM+L QL++
Sbjct  1    MDLARNLGDHTGELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLID  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRP  626
            ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   S LLLK NP S+ P
Sbjct  61   ALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTP  120

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDP LT PW N+ +WFQN D TPF T HG ++  Y +A  EP +N  F +AMA D
Sbjct  121  FLLAMLDPTLTDPWQNLSQWFQNSDETPFYTCHGRSI--YAFASHEPWLNQFFNEAMASD  178

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            +RLV +VV K C+ VFE LNSL+DVGG TGT A  IA AFP LKCTV DLPHVV GLE +
Sbjct  179  TRLVSSVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS  238

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMM  86
            KNL Y GG+MF +IPPADA+L+KWIL DWSD E V+ILKKCKE+ PSKEKGGKVII+DM 
Sbjct  239  KNLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVIIVDMF  298

Query  85   VDNRIKDD---ESVETQIFFDMLMMILVTGR  2
              +  K D   E++ETQ+FFDM +M+L+ GR
Sbjct  299  CKSLQKGDDDHETIETQLFFDMEVMVLLKGR  329



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 246/331 (74%), Gaps = 8/331 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            M L   I +   E+  +Q HIWNHI NFINS S+KCA+QL IPD+IHKHGQP++L QL++
Sbjct  1    MDLARNIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLID  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRP  626
            ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   S LLLK NP S+ P
Sbjct  61   ALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTP  120

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDP LT PWH++ +WFQN D TPF T HG ++  Y +A  EP +N  F +AMA D
Sbjct  121  FLLAMLDPTLTDPWHHLSQWFQNSDETPFYTCHGRSI--YAFASHEPWLNQFFNEAMASD  178

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            +RLV +VV K C+ VFE LNSL+DVGG TGT A  IA AFP LKCTV DLPHVV GLE +
Sbjct  179  TRLVSSVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS  238

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMM  86
            KNL Y GG+MF +IPPADA+L+KWIL DWSD E V+ILKKCKE+IPSKEKGGKVII+DM 
Sbjct  239  KNLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDMF  298

Query  85   VDNRIKDD---ESVETQIFFDMLMMILVTGR  2
              +  K D   E++ETQ+FFDM++M+L+  R
Sbjct  299  CKSLQKGDDDHEAIETQLFFDMVVMVLLKRR  329



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +++L +QTHIWNHI +FINS SLKC V L IPDIIH +GQPM L+ L+ +LPI+ +K
Sbjct  7    EHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITK--TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +  + RLMR +IHSGFF   K   E   +  Y L   S+LLLK++P+S+ P + A+LDP+
Sbjct  67   TCFVHRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPV  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT PW+    WF+N DPTPF T HGM LWDY  A  +PK+N+LF DAMA D+R V ++VI
Sbjct  127  LTNPWNQFSTWFKNGDPTPFETAHGMMLWDY--AGADPKLNNLFNDAMASDARFVTSLVI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + C+GVF GL SL+DVGG TGT+A  IA +FP ++C VFDLPHVV GL+G++NL Y  GD
Sbjct  185  EKCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVSGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDW+D+E V ILKKCKE+I  K K GKVIIIDM+V+N  +DDE
Sbjct  245  MFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDE  304

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+FFDMLMM+LVTG+
Sbjct  305  SVETQLFFDMLMMVLVTGK  323



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q H+WNHI NFI S SLKCA+QL IPDIIH HG+PM+L +LV  LP++  +S  
Sbjct  10   AELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQC  69

Query  763  LARLMRTLIHSGFFVITKTE-GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGF    + + G ++EGY L   S LLL D+ LSIRPLVLA+LDPILT+P
Sbjct  70   VYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDDPTPF T +  + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +
Sbjct  130  WHYLSAWFQNDDPTPFHTAYERSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQ  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GLNSL+DVGG TG VA  IA+AFPHL CTV DL HVV GL+G+KNL+Y  GDMF +
Sbjct  188  GVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPA A+LLKWILHDWSD+E VKILK+C+ +IPSKEKGGKVIIIDM++     D +S+ET
Sbjct  248  IPPAVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKVIIIDMIMMKNQGDYKSIET  307

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDM MMI   GR
Sbjct  308  QLFFDMTMMIFAPGR  322



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 250/326 (77%), Gaps = 6/326 (2%)
 Frame = -1

Query  967  LPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP  788
            L +  EK +E+L +Q HIWN+I NFINS SLKCAVQL IPD IHKHG+PM+L++L+ ALP
Sbjct  15   LQINEEKATELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALP  74

Query  787  INNAKSTHLARLMRTLIHSGFF---VITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVL  617
            ++  K+ ++ RLMR L+HSGFF    I +++  ++EGY L   S LL+ DNPLS+ P +L
Sbjct  75   VHQNKAPYVYRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLL  134

Query  616  AILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRL  437
            A+LDP+LT+PW  +  WFQNDDPT F TV+G+  W Y    +EPK+ + F DAMA D+RL
Sbjct  135  AMLDPVLTKPWDFLSTWFQNDDPTAFDTVNGLPFWKY--GGQEPKMANFFNDAMASDARL  192

Query  436  VMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNL  257
            V++VVI+ C+ VF+ L S +DVGG TGTVA  IA  FP ++CTVFDLPHVV  L+G  NL
Sbjct  193  VISVVIENCKWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGKDNL  252

Query  256  DYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK-EKGGKVIIIDMMVD  80
             + GGDMF  +PPADA+LLKWILHDWSD E VKILKKCKE+I SK  K GKVIIID+M++
Sbjct  253  KFVGGDMFQQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVIIIDIMIE  312

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            N+ +DD+S ETQ+FFDM+MM+L TG+
Sbjct  313  NKDEDDKSYETQLFFDMMMMVLATGQ  338



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 243/319 (76%), Gaps = 4/319 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +++L +QTHIWNHI +FINS SLKC V L IPDIIH +GQPM L+ L+ +LPI+ +K
Sbjct  7    EHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITK--TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +  + RLMR +IHSGFF +     E   +  Y L   S+LLLK++P+S+ P + A+LDP+
Sbjct  67   TCFVHRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPV  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT PW+    WF+N DPTPF T HG   WDY  A  +PK+NHLF DAMA D+R V ++VI
Sbjct  127  LTNPWNQFSTWFKNGDPTPFETAHGKMFWDY--AGADPKLNHLFNDAMASDARFVTSLVI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + C+GVF GL SL+DVGG TGT+A  IA +FP ++C VFDLPHVV GL+G++NL Y  GD
Sbjct  185  EKCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDW+D+E V ILKKCKE+I  K K GKVIIIDM+V+N  +DDE
Sbjct  245  MFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDE  304

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+FFDMLMM+LVTG+
Sbjct  305  SVETQLFFDMLMMVLVTGK  323



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/331 (59%), Positives = 244/331 (74%), Gaps = 8/331 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            M L   I +   E+  +Q HIWNHI NFINS SLKCA+QL+IPD+IHKHG+PM+L QL++
Sbjct  1    MDLARNIGDHTDELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLID  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRP  626
            ALPI N K+  + RLM+ LIHSGFF+  K  G++++   GY L   S LLLK NP S+ P
Sbjct  61   ALPIKNEKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTP  120

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDP LT PWH++ +WFQN   +PF T HG +L+D+  A  E ++N  F +AMA D
Sbjct  121  FLLAMLDPALTDPWHHLSQWFQNSYESPFYTCHGRSLYDF--ASHESQLNQFFNEAMASD  178

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            +R+V +VV K C+ VFE LNSL+DVGG TGT A  IA AFP LKCTV DLPHVV GLE T
Sbjct  179  ARMVSSVVTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLEST  238

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMM  86
            KNL Y GG+MF +IPPADA+L+KWIL DWSD E V+ILKKCKE+IPSKEKGGKVII+D  
Sbjct  239  KNLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTF  298

Query  85   VDNRIKDD---ESVETQIFFDMLMMILVTGR  2
              +  K D   E++ETQ+F+DM  M+LV GR
Sbjct  299  CKSLQKGDDDHEAIETQLFYDMGAMVLVKGR  329



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 241/313 (77%), Gaps = 2/313 (1%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L +Q HIWNHI +FINS SLKCAVQL+IPD+I KHGQPM+L++LV+ALPI+  K+  +
Sbjct  9    ELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHFI  68

Query  760  ARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWH  581
             RLMR L+HSGFF      G  ++GY L   S LLLKDNP+S RP +LA+L PILT P+ 
Sbjct  69   PRLMRILVHSGFFAKESLSGCGEQGYILTDASALLLKDNPMSARPFLLAMLSPILTDPYQ  128

Query  580  NIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGV  401
             +  WFQND+PTPF  V+GMT WDY+   ++P + H F DAMA D++L+ ++VI  C+ V
Sbjct  129  YLTTWFQNDNPTPFHVVNGMTCWDYV--NQDPTLAHFFNDAMASDAQLISSLVIDDCKEV  186

Query  400  FEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIP  221
            F+G++SL+DVGG TGTVA  IA AFPH+KCTV DLPHVV  L+G+KNL+Y  GDMF ++P
Sbjct  187  FQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMFEAVP  246

Query  220  PADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQI  41
             ADA+ LKWILHDWSD+E VKIL++CK ++  + K GKVII++M V+N+  D ES ETQ+
Sbjct  247  AADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKVIIVEMTVENKNTDKESGETQL  306

Query  40   FFDMLMMILVTGR  2
            FFDM MM++ TG+
Sbjct  307  FFDMHMMVMSTGK  319



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 241/319 (76%), Gaps = 23/319 (7%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
             E+  +Q HIWNH+ NFINS SLKCA+QL IPDIIHKHGQPM+L QL++ALPINNAK+  
Sbjct  11   GELFQAQAHIWNHLFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAHF  70

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            + RLMR LIHSGFF+  K +  D+EG+                + P +LA+LDPILT PW
Sbjct  71   VYRLMRILIHSGFFI--KAKMPDNEGHE--------------GVTPFLLAMLDPILTDPW  114

Query  583  HNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRG  404
            H+  +WFQ+++ TPF + HG ++W+   A ++P++N  F + MA D+RLV  +VIK C+ 
Sbjct  115  HHFSQWFQDNEETPFHSCHGTSMWEL--AGRQPRLNQFFNEGMASDARLVCTMVIKNCKD  172

Query  403  VFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSI  224
            VF GLNSLIDVGG TGTVA  IA AFPHLKC+V DLPHVV G E +KNL Y GGDMF +I
Sbjct  173  VFMGLNSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSESSKNLAYVGGDMFEAI  232

Query  223  PPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD-----E  59
            PP+DA+LLKWILHDWSD+E V+IL+KCKE+IPSKEKGGKVIIIDM++ +R   D     E
Sbjct  233  PPSDAVLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVIIIDMLLKSRQNGDDDDNAE  292

Query  58   SVETQIFFDMLMMILVTGR  2
            ++ETQ+FFDMLMM+LV GR
Sbjct  293  AIETQLFFDMLMMVLVKGR  311



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 246/318 (77%), Gaps = 8/318 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E+ S++L +QTH+WNHI +FINS SLKCA++L+IPDIIHK+GQPM L++L  +L I+ +K
Sbjct  7    ERVSKLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            +  + RLMR L HSGFF   K   ++ E GY L   S LLLKDNPLS+ P + A+LDP L
Sbjct  67   ANCIYRLMRILTHSGFFSQHKVNENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            TQPW  +  WF+NDDP+PF T HGM +WDY  A +EP++N LF DAMA D++LV NVVI+
Sbjct  127  TQPWLQLPTWFKNDDPSPFQTAHGMKIWDY--ADREPRLNDLFNDAMASDTQLVANVVIE  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVF GL SL+DVGG TGT+A  IA +FP L+CTVFDLPHVV  L+G++NL Y GGDM
Sbjct  185  RCKGVFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F SIP ADA+LLKWILHDW+D++ VKILKKCKE+I S     KVIIIDM+V+N   DDES
Sbjct  245  FESIPSADAILLKWILHDWNDEQCVKILKKCKEAIKS-----KVIIIDMVVENEKGDDES  299

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+F DM++M+L  G+
Sbjct  300  IETQLFIDMVVMVLYPGK  317



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   400 bits (1028),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 237/313 (76%), Gaps = 3/313 (1%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L +Q  IWNH  +FINS SLKCAVQL+IPD+I KHGQPM+L++LV+ALPI+  K+  +
Sbjct  10   ELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHFI  69

Query  760  ARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWH  581
             RL+R L+HSGFF      G + +GY L   S LLLKDNP+S RP +LA+L+PILT PW 
Sbjct  70   PRLIRILVHSGFFASESLNGGE-QGYVLTDASALLLKDNPMSARPFLLAMLNPILTDPWQ  128

Query  580  NIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGV  401
             +  WFQND+PTPF   HGMT WDY    ++  + H F +AMA D+RL+ +++I  C+GV
Sbjct  129  YLTTWFQNDNPTPFHVAHGMTFWDY--GNQDTTLAHFFNEAMASDARLISSLMIDDCKGV  186

Query  400  FEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIP  221
            F+G++SL+DVGG TGTVA  IA AFPH+KCTV DLPHVV  L+G+ NL+Y  GDMF +IP
Sbjct  187  FQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSNNLEYVAGDMFEAIP  246

Query  220  PADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQI  41
             ADA+ LKWILHDWSD+E VKIL++CKE+I    K GKVII+DM V+N+  D ES ETQ+
Sbjct  247  GADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKVIIVDMTVENKNTDKESGETQL  306

Query  40   FFDMLMMILVTGR  2
            FFDM MM+L TG+
Sbjct  307  FFDMEMMVLATGK  319



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   400 bits (1028),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 242/319 (76%), Gaps = 4/319 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +++L +QTHIWNHI +FINS SLKC V L IPDIIH +GQPM L+ L+ +LPI+ +K
Sbjct  7    EHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITK--TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +  + RLMR +IHSGFF       E   D  Y L   S+LLLK++P+S+ P + A+LDPI
Sbjct  67   TCFVHRLMRIMIHSGFFSQQNHDMENQLDAKYVLTDASVLLLKNHPMSVTPFLHAMLDPI  126

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT PW+    WF+N D TPF T HGM LWDY  A  +PK N+LF DAMA D+R V ++VI
Sbjct  127  LTNPWNQFSTWFKNGDTTPFETAHGMMLWDY--AGADPKHNNLFNDAMASDARFVTSLVI  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + C+G+F GL SL+DVGG TGT+A  IA +FP ++C VFDLPHVV GL+G++NL Y  GD
Sbjct  185  EKCKGMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IPPADA+LLKWILHDW+D+E V ILKKCKE+I  K K GKVIIIDM+V+N  +DDE
Sbjct  245  MFEAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDE  304

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+FFDMLMM+LVTG+
Sbjct  305  SVETQLFFDMLMMVLVTGK  323



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   402 bits (1033),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/329 (60%), Positives = 253/329 (77%), Gaps = 9/329 (3%)
 Frame = -1

Query  985  KLKMALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQ  806
            K KMAL   I ++ +E+L +Q HI NH+ N+INS SLKCA+QL IPDIIH HG+ M+ + 
Sbjct  90   KEKMALPNNIGDETNEVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSD  149

Query  805  LVNALPINNAKSTH-LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIR  629
            LVNALPIN +K    + RLMR LIH+GFF    T+G  +EGY L P S LLLK+ PLS+ 
Sbjct  150  LVNALPINKSKGHDCIYRLMRILIHAGFF----TQG--EEGYLLTPTSRLLLKNEPLSLA  203

Query  628  PLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMAR  449
            P V A LDP+L  PWH++ EWF N+D TPF T HG  L++Y  A  E ++N+LF +AM  
Sbjct  204  PFVQAQLDPVLMDPWHSLGEWFANEDSTPFATAHGKPLFEY--AGDEQRLNNLFNEAMGC  261

Query  448  DSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEG  269
            D+RL+M+V+IK  +GVFEGL SL+DVGG  GTVA  I++AFP LKC+VFDLPHVV+GLEG
Sbjct  262  DARLIMSVLIKNGKGVFEGLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEG  321

Query  268  TKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDM  89
             KNL Y  GDMF  +P ADA+LLKWILHDWSD++ VKILKKCKE+IPSKE GGKVI+ID+
Sbjct  322  GKNLTYIAGDMFKFVPSADAILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVIVIDI  381

Query  88   MVDNRIKDDESVETQIFFDMLMMILVTGR  2
            ++DN+ +D++S ETQ+F D+LMM+ V+G+
Sbjct  382  VIDNQKRDNKSFETQLFSDVLMMVHVSGK  410



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 242/318 (76%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            ++ +++L +QTH+WNHIL+FINS SLKC V L IPDIIH HGQPMSL+ L+++LPI+++K
Sbjct  7    DQSAKLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  772  STHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            +  + RLMR ++HSGFF     TE   +  YAL   S+LLLK N +S+ P + A+LDP+L
Sbjct  67   THFIHRLMRIMVHSGFFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQAMLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+    WF+N +PT F    G   W+Y  A  +P++N LF DAMA D++LV +VVI+
Sbjct  127  TTPWNQFANWFKNGNPTTFEMAQGKPFWEY--AGSDPRINSLFNDAMASDAQLVTSVVIE  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VF GL SL+DVGG TGT+   IA +FP L+CTVFDLPHVV GL+G++NL Y GGDM
Sbjct  185  KCKRVFMGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+LLKWILHDWSD++SV ILKKCKE++  K K GKVIIIDM+VD  +KDDES
Sbjct  245  FEAIPPADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKDDES  304

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+FFDMLMM+  TG+
Sbjct  305  FETQLFFDMLMMVFFTGK  322



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   398 bits (1022),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 238/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  949  KDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKS  770
             D E+L +Q H+WN++ NFINS SLKCA+ L IPD+I  HG+PM++T+LV ALPIN  K+
Sbjct  13   NDHELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAALPINATKA  72

Query  769  THLARLMRTLIHSGFFVITKTEGSD-DEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + + RLMR L+HSGFF   K   +D +EGY L   S LLL  +PLS+ P + A+LDPILT
Sbjct  73   SSIYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASRLLLNGDPLSVTPFLKAMLDPILT  132

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PWH +  WFQNDDPTPF T HG T WDY     +P ++H F + MA D+RLV +++I  
Sbjct  133  KPWHFLGAWFQNDDPTPFDTAHGRTFWDY--GGHDPMLSHFFNEGMASDARLVSSILIHK  190

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C GVF+GLNS++DVGG  GTVA  I+ AFPHL+CTVFDLP VV GL+   NL Y GGDMF
Sbjct  191  CEGVFQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRGNLKYVGGDMF  250

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV--DNRIKDDE  59
             ++P ADA+LLKWILHDW+D+E VKILK+CKE+I    KGGK IIIDM++   N   +D 
Sbjct  251  EAVPAADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKAIIIDMVLTEKNHKVNDA  310

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+FFDMLMM+LVTG+
Sbjct  311  SIETQLFFDMLMMVLVTGK  329



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   397 bits (1020),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 247/326 (76%), Gaps = 9/326 (3%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL   I ++ +E+L +Q HI NH+LN++NS SLKCA+QL IPDIIH HG+ M+ + LVN
Sbjct  1    MALHNKIGDETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVN  60

Query  796  ALPINNAKSTH-LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            ALPIN +K    + RLMR LIH+GFF+    EG  +EGY L P S LLLK+ PL++ P V
Sbjct  61   ALPINKSKGHECIYRLMRILIHTGFFI----EG--EEGYLLTPTSRLLLKNEPLNLAPFV  114

Query  619  LAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSR  440
             A LDPIL  PWH++ EWF N D TPF T HG  L+DY  A  +P++N +F +AM  D+R
Sbjct  115  QAHLDPILMDPWHSLGEWFANGDSTPFATAHGKPLFDY--AGDDPRLNRIFNEAMESDAR  172

Query  439  LVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKN  260
            L+M+V+IK  + VFEGL SL+DVGG  GTVA  I++AFP LKC+VFDLPHVV+GLEG  N
Sbjct  173  LIMSVLIKNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNN  232

Query  259  LDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            L Y  GDMF S+P ADA+LLKWILHDWSD++  KILKKCKE+IPSKE GGKVI+ID ++D
Sbjct  233  LSYITGDMFKSVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVID  292

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            N+  DD+S ETQ+F D+LMM+ V+G+
Sbjct  293  NQKGDDKSFETQLFLDVLMMVHVSGK  318



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   395 bits (1016),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 240/321 (75%), Gaps = 6/321 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E+ SE+L +Q H+WNHI NFINS SLKCA+QL IPDIIH H +PM+L +LV  LP+   
Sbjct  6    GERSSELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRPN  65

Query  775  KSTHLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  + RLMR L+HSGFF   +  E +D+EGY LA  S LLLKD+PLSI P +L +    
Sbjct  66   KTLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASRLLLKDHPLSITPFLLLLDP-D  124

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT+PW     WFQNDDPTPF T HG TLWDY     EP+ N+ F + MA D+RLV +V++
Sbjct  125  LTEPWDYASAWFQNDDPTPFFTAHGRTLWDY--GCHEPRFNNFFNEGMASDARLVTSVLV  182

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            K C+G FEGLNS +DVGG TGTVA  I  AFPHL  TV DLPHVV  L G+KNL Y  GD
Sbjct  183  KECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGSKNLTYLAGD  242

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            +F +IPPADA+LLKWILHDWSD+E +KILK+C+E+IPSKEKGGKV+IIDM + N+  DD+
Sbjct  243  LFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKGDDD  302

Query  58   --SVETQIFFDMLMMILVTGR  2
              +VETQ+FFDMLMM+L+ GR
Sbjct  303  ESNVETQLFFDMLMMVLLPGR  323



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 240/318 (75%), Gaps = 7/318 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q HIWNHI +FINS SLK A+QL I D+I+KHG  M+L++L +ALPI+  
Sbjct  6    GEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS  + RLMR L+HSGFF   K    D+EGY L   S LLLKD+PLS+ P + A     +
Sbjct  66   KSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFLTA-----M  120

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
             +PW+ +  WFQN+DPTPF T HGMT WDY     +P + H F +AMA D+RLV +V+I 
Sbjct  121  NKPWNYLSTWFQNNDPTPFDTAHGMTFWDY--GNHQPSIAHFFNNAMASDARLVTSVIID  178

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVFEGL SL+DVGG TGTVA  IA AFPH++CTV DLPHVV  L+G+KNL Y  GDM
Sbjct  179  DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDM  238

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPAD +LLKWILHDW+D+E VKILK+ +++I SK+K GKVII+DMM++N+ +D+ES
Sbjct  239  FEAVPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKRDEES  298

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDMLMM LVTG+
Sbjct  299  IETQLFFDMLMMALVTGK  316



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 239/318 (75%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            ++ +++L +QTH+WNHIL+FINS SLKC V L IPDIIH HGQPMSL+ L+++LPI+++K
Sbjct  7    DQSAKLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  772  STHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            +  + RLMR ++ SGFF     TE   +  YAL   S+LLLK + +S+ P + A LDP  
Sbjct  67   THFIHRLMRIMVQSGFFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDPAF  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+    WF+ND PT F   HG   W+Y  A  +P+ N LF DAMA D++LV +VVI+
Sbjct  127  TNPWNQFSNWFKNDSPTTFEMAHGKPFWEY--AGSDPRFNILFNDAMASDAQLVTSVVIE  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVF GL SL+DVGG TGT+   I+ +FP L+CTVFDLPHVV GL+G++NL Y GGDM
Sbjct  185  KCKGVFMGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+LLKWILHDWSD+E VKILKKCKE+I  K K GKVIIIDM+VD  +KDDES
Sbjct  245  FEAIPPADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKVIIIDMVVDKEMKDDES  304

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+FFD++MM+L  G+
Sbjct  305  FETQLFFDLMMMVLFNGK  322



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/326 (59%), Positives = 243/326 (75%), Gaps = 9/326 (3%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL     ++ +E+L +Q HI NH+LN++NS SLKCA+QL IPDIIH HG+ M+ + LVN
Sbjct  1    MALPNKNGDETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVN  60

Query  796  ALPINNAKSTH-LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            ALPIN +K    + RLMR LIH+ FF+    EG D  GY L P S LLLK+ PLS+ P V
Sbjct  61   ALPINKSKGHECIYRLMRILIHASFFI----EGED--GYLLTPTSRLLLKNEPLSLAPFV  114

Query  619  LAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSR  440
             A LDPIL  PWH++ EWF N D TPF T HG  L+DY  A  +P++N +F +AM  D+R
Sbjct  115  QAQLDPILMDPWHSLGEWFANGDSTPFATAHGKPLFDY--AGDDPRLNRIFNEAMESDAR  172

Query  439  LVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKN  260
            L+M+ +IK  + VFEGL SL+DVGG  GTVA  I++AFP LKC+VFDLPHVV+GLEG  N
Sbjct  173  LIMSALIKNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNN  232

Query  259  LDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            L Y  GDMF S+P ADA+LLKWILHDWSD++  KILKKCKE+IPSKE GGKVI+ID ++D
Sbjct  233  LSYITGDMFKSVPSADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVID  292

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            N+  DD+S E+Q+F D+LMM+ V+G+
Sbjct  293  NQKGDDKSFESQLFLDVLMMVHVSGK  318



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   390 bits (1001),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 241/318 (76%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            ++ +++L +QTH+WNHI +FINS SLKC V L IPDIIH HGQPMSL+ L+++LPI+++K
Sbjct  7    DQSAKLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSK  66

Query  772  STHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            +  + RLMR ++HSGFF     TE   +  YAL   S+LLLK N +S+ P + A+LDP++
Sbjct  67   THFIHRLMRIMVHSGFFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLDPVM  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T PW+    WF+N +PT F   +G   W+Y  A  +P+ N LF DAMA D++LV ++V +
Sbjct  127  TNPWNQFSNWFKNGNPTTFEMENGKPFWEY--ASCDPRFNILFNDAMASDAQLVTSLVTE  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVF GL SL+DVGG TG +   IA +FP L+CTVFDLPHVV GL+G++NL Y GGDM
Sbjct  185  KCKGVFMGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+LLKWILHDWSD+E V ILKKCKE++  K K GKVIIIDM+VD  +KDDES
Sbjct  245  FEAIPPADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKDDES  304

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+FFD+LMM+L+TG+
Sbjct  305  FETQLFFDILMMVLLTGK  322



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 236/316 (75%), Gaps = 5/316 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
             E+L +Q +IWNHI NFINS SLK A+QL IPD IH HG+P+SL+ L+ ALPI+ AK+  
Sbjct  9    QELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIHPAKARC  68

Query  763  LARLMRTLIHSGFFVITKTEGSDD-EGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR LIHSGFF   K + +D+ EGY L   S LLLKDNP S+ P +LA+LD ILT+P
Sbjct  69   IPRLMRILIHSGFFAKAKLKENDEAEGYVLTKASKLLLKDNPFSVTPFLLAMLDRILTEP  128

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDD T F T HGM  W+Y  A  EPK+N+ F +AMA D+RLVM V+I   +
Sbjct  129  WHYLSTWFQNDDATAFTTAHGMGFWEY--AGNEPKLNNFFNEAMASDARLVMRVLIDEYK  186

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGL SL+DVGG TGT+A  IA AFP L C VFDLPHVV GL G++NL Y  GDMF  
Sbjct  187  GVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGLAGSENLKYVAGDMFEG  246

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR-IKDDESVE  50
            +PPADA+LLKWI+H WSD+E +K+LK  KE+I    K GK+IIIDM+++NR + D +S+E
Sbjct  247  VPPADAILLKWIMHVWSDEECLKLLKLSKEAIKG-NKEGKLIIIDMVLENRQVTDHQSIE  305

Query  49   TQIFFDMLMMILVTGR  2
            +Q+FFDMLMM L TG+
Sbjct  306  SQLFFDMLMMTLQTGK  321



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 235/316 (74%), Gaps = 4/316 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            S +L +Q+HIWNHI NFINS SLKC V L IPDIIH +G+PMSL++L+  LPI+ +K+  
Sbjct  11   SNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSKTFF  70

Query  763  LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR + HSGFF     +E   +  Y L   S+LLLKDNP+++R  V  + DP+LT+P
Sbjct  71   IYRLMRIMTHSGFFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFVHLVFDPVLTKP  130

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  W  NDDPT F T HGM  WDY  A +E K+N+LF DAMA D+RLV +VVI+ C+
Sbjct  131  WHQLSSWLTNDDPTAFETTHGMLFWDY--AERESKINNLFNDAMASDARLVSSVVIEKCK  188

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
             VF GL SL+DVGG TGT+A  +A +FP L+CTVFDLPHVV GL+GT NL Y GGDMF  
Sbjct  189  EVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGTDNLKYVGGDMFKE  248

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD-DESVE  50
            IPPADA+LLKWILHDW+D E VKILKKCKES+  K   GKVIIIDM++D +  D +ES +
Sbjct  249  IPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKVIIIDMVLDTKKGDINESGK  308

Query  49   TQIFFDMLMMILVTGR  2
            TQ+FFDMLM +LV G+
Sbjct  309  TQLFFDMLMTVLVKGK  324



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 240/316 (76%), Gaps = 5/316 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q HIWNHI +FINS SLK AVQL IPD IH HG+P+SL+QL+ ALPI+ AK+  
Sbjct  9    NELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIHPAKARG  68

Query  763  LARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR LIHSGFF   K E  D+E GY L   S LLLKDNPLSI P +LA+LDPIL +P
Sbjct  69   IPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLAMLDPILIKP  128

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  WFQNDD T F T HGM  W+Y  +  +P +N+ F +AMA D+RLVM V+I   +
Sbjct  129  WHYLSTWFQNDDATAFDTAHGMGFWEYTAS--DPNLNNFFNEAMASDARLVMKVLIDEHK  186

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            G+FEGL SL+DVGG TGT+A  IA AFP L+CTVFDLPHVV GL+GT+NL Y  GDMF +
Sbjct  187  GLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKYVAGDMFEA  246

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR-IKDDESVE  50
            IPPADA+LLKWI+H W+ +  VK+LK CKE+I  K KGGK+II+D++++++ + D + VE
Sbjct  247  IPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGK-KGGKLIIVDLVLESQHVTDHQDVE  305

Query  49   TQIFFDMLMMILVTGR  2
            TQ FFD+L+M L TG+
Sbjct  306  TQFFFDILLMTLQTGK  321



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 246/326 (75%), Gaps = 5/326 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL     +   E+LD+Q+H+WNH+ NF+NS SLKC +QL IPDII KHG+PM+L++L +
Sbjct  1    MALSSNGIQSTQELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTH  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            +L +N+AKS  L RLMR +IHS FF+  K ++  + EGY L P S LLL+D PLS+RP  
Sbjct  61   SLHLNDAKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHLLLRDEPLSVRPFA  120

Query  619  LAILDPILTQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDS  443
            L +LDPILT PWH++ EWF+ D D TPF+T HG TLW++  A ++P++N LF + MA DS
Sbjct  121  LGMLDPILTDPWHHLSEWFKTDGDLTPFLTTHGRTLWEH--AGQDPRLNELFNEGMASDS  178

Query  442  RLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK  263
             LV  V+ K CR VFEGL S++DVGG TGTVA  IA AF  L C V DLPHVV G EGT+
Sbjct  179  ELVATVITKDCRNVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEGTE  238

Query  262  NLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV  83
            +L +  GDMF  IPPADA+ +KWILHDW D++ +KILKKCK++I +K+KGGKVII+DM+V
Sbjct  239  SLTFVAGDMFDYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKVIIVDMVV  298

Query  82   DNRIKDDESVETQIFFDMLMMILVTG  5
            D + K+ +++ETQ+FFDMLM+ L +G
Sbjct  299  DFK-KEHKAIETQLFFDMLMINLTSG  323



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 234/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            + +L +Q HIWN I +FIN  SLKCAVQL IPDII KHG PMSL+ L++ALPI+  KS  
Sbjct  10   ANLLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNC  69

Query  763  LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGFF   K +E  ++EGY L   S LLLKD+PLS RP +L  LDP +T+P
Sbjct  70   VYRLMRILVHSGFFCRQKLSELDEEEGYVLTDASRLLLKDDPLSARPFLLGALDPFMTKP  129

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH    WFQNDDPT  VT HG T WD+     EP ++H+F DAMA D+RL+  VV    +
Sbjct  130  WHYFSTWFQNDDPTACVTAHGTTFWDF--GCLEPSLSHIFNDAMASDARLISKVVSNEYK  187

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGL SL+DVGG  GT+   IA  FPH++C VFDLPHVV  L+G++NL + GGDMF +
Sbjct  188  GVFEGLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGSENLKFFGGDMFEA  247

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPP DA+L+KWILHDWSD+E +KIL++ KE+I  KEK GKVII+DM++  +  DD+S+ET
Sbjct  248  IPPTDAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKVIIVDMVMKQK-GDDQSIET  306

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDMLMM+L TG+
Sbjct  307  QLFFDMLMMVLFTGK  321



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 238/318 (75%), Gaps = 8/318 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E+ S++L +QTH+WNHI +F+NS SLKCA+ LEIPDIIHK+G+ M  +QL  +L +N +K
Sbjct  7    ERVSKLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            +  + RLMR L HSGFF   +   +D E GY L   S LLLKDNPLS+ P   A+LDPIL
Sbjct  67   ANCIYRLMRILTHSGFFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLDPIL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WF+NDDPTPF T H M +WDY  A ++PK+N LF DAMA D++LV NVVI+
Sbjct  127  TKPWHQLPTWFRNDDPTPFHTAHEMKIWDY--AGRDPKLNQLFNDAMASDAQLVSNVVIE  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C GVF+GL SL+DVGG TG +A  IA +FPH+ CTVFDLPHVV  L+G +NL Y GGDM
Sbjct  185  RCSGVFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGCENLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F S+PPADA+LLKWILHDW+D++ VKILKKCKE I       KVI+IDM+V++  +D ES
Sbjct  245  FESVPPADAVLLKWILHDWNDEQCVKILKKCKEGIKR-----KVIVIDMVVESEEEDFES  299

Query  55   VETQIFFDMLMMILVTGR  2
             ET++  DM++M+L  G+
Sbjct  300  TETKLLVDMVVMVLYPGK  317



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   385 bits (988),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 243/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L +QTH+WNHI  FINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      +  + + Y+L   + LLLKDNP S+RPL+L  LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WFQNDD   F   H  T W+Y  A ++P++N+LF DAMARDS LV  VV+ 
Sbjct  127  TKPWDCLSTWFQNDDRNAFSVAHENTFWEY--AGQDPRINNLFNDAMARDSILVSKVVVC  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+F+G+NSL+DVGG  GT+A  IA AFPH+ CTVFDLPHVV  L+G+KNL Y GGDM
Sbjct  185  KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPS--KEKGGKVIIIDMMVDNRIKDD  62
            F ++PPADA+LLKWILHDWSD++ VKIL++CK++I S  ++K GKVIIIDM+ +N   D+
Sbjct  245  FEAVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAGKVIIIDMVRENLNGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+ FD+ +M+  +G
Sbjct  305  GSIETQLLFDLQLMVGFSG  323



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -1

Query  967  LPLIAEKD-SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            + LI E+   E+L +QTH+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+AL
Sbjct  7    MELINEESVGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSAL  66

Query  790  PINNAKSTHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLA  614
            PI+ +K+ ++ RLMR L+HSGFF      G  + E Y+L   + LLLKDNP ++RPL+L 
Sbjct  67   PIHPSKAQYVHRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTRLLLKDNPWNMRPLLLF  126

Query  613  ILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLV  434
             LD +LT+PW  +  WF+ND+ T F   H  T W+Y  A ++P++ +LF +AMA DS L 
Sbjct  127  ELDSVLTKPWDCLSTWFRNDEATAFSVAHENTFWEY--AGQDPRIKNLFNEAMASDSILA  184

Query  433  MNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLD  254
              +V+  C+G+FEGL+SL+DVGG  GT+A  IA AFPH+ CTVFDLPHVV  L+G KNL 
Sbjct  185  SKLVVSKCKGIFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGCKNLK  244

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVD  80
            Y GGDMF ++PPA+A+LLKWILHDWSD++ VKIL++C+++I SK  +K GKVIIIDM+ +
Sbjct  245  YVGGDMFQAVPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKVIIIDMVRE  304

Query  79   NRIKDDESVETQIFFDMLMMILVTG  5
            N   D+ S+ETQ+FFD+LMM+ V+G
Sbjct  305  NLNGDEGSIETQLFFDLLMMVAVSG  329



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 244/335 (73%), Gaps = 13/335 (4%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL     +   E+LD+Q+H+WNH+ NFINS SLKC +QL IPDII KHG+PM+L++L +
Sbjct  1    MALSSNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTH  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            +L +N AKS  L RLMR +IHS FF+  K +   + EGY L P S LLL+D PLS+RP  
Sbjct  61   SLHLNEAKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHLLLRDEPLSVRPFA  120

Query  619  LAILDPILTQPWHNIIEWFQND---------DPTPFVTVHGMTLWDYIYARKEPKVNHLF  467
            L++LDPILT PWH++ EWF+ D         D TPF+T HG TLW+Y  A ++P++N LF
Sbjct  121  LSMLDPILTDPWHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEY--AGQDPRLNGLF  178

Query  466  TDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHV  287
             + MA DS+LV  V+ K CR VFEGL S++DVGG TGTVA  +A AF  L C V DLPHV
Sbjct  179  NEGMASDSKLVATVITKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHV  238

Query  286  VQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGK  107
            V G EGT NL +  GDMF  IPPADA+ +KWILHDW D++ +KIL+KCK++I  K+K GK
Sbjct  239  VAGCEGTANLVFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGK  298

Query  106  VIIIDMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            VII+DM+VD + K+ +++ETQ+FFDML+M L +GR
Sbjct  299  VIIVDMVVDFQ-KEHKAIETQLFFDMLIMNLASGR  332



>gb|KDO39394.1| hypothetical protein CISIN_1g021867mg [Citrus sinensis]
Length=306

 Score =   380 bits (976),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 227/300 (76%), Gaps = 8/300 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E D+E+L++Q H+WNHI NFINS SLKCAV+L IPDII+KHG+PM+L +LV+AL IN +
Sbjct  6    GEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKDNPLS+ P + A+
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLKNASKLLLKDNPLSVTPFLQAM  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQNDDPTPF T+HG + W  +YA  EPK+N+ F +AMA D+RL  
Sbjct  126  LDPILLSPWLKLSTWFQNDDPTPFDTLHGKSFW--VYAGDEPKINNFFNEAMASDARLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
             VVI  C+ VFEGLNSL+DVGG  GTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  184  RVVIHKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +IPPADA+LLKWILHDW+D+E VKILKKCKE++ S +K GKVIIIDM+ +N+
Sbjct  244  YVGGDMFEAIPPADAVLLKWILHDWNDEECVKILKKCKEAVTSDDKKGKVIIIDMIRENK  303



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   382 bits (980),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 240/319 (75%), Gaps = 3/319 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +++L +Q+HIWNHIL++INS SLKC V L IPDIIH +G+PM L++L+ +LPI+++
Sbjct  6    GENAAKLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIHSS  65

Query  775  KSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+ ++ RLMR +IHSGFF     TE   +  Y L   SILLLK +P SI P +L   DPI
Sbjct  66   KAGNIPRLMRVMIHSGFFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLLCSNDPI  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            L +PWH++  WF+NDD TPF T HGM  WDY  A ++PKVN+L  ++MA D++L+  V I
Sbjct  126  LKKPWHHLSTWFKNDDLTPFETAHGMLPWDY--ANRDPKVNNLLNESMACDAQLIAGVFI  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + C+ +  GL SL+DVGG TGT+A  IA +FP LKCTVFDLPHVV  L+G++NL+Y GGD
Sbjct  184  EKCKDMLNGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGSENLEYIGGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF  IPPADA+LLKWILHDWSD+E +KILK CKE+I SK K GKVIIIDM+++    DD+
Sbjct  244  MFKEIPPADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKVIIIDMVIEEDKGDDK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+ FDM MM+L TG+
Sbjct  304  SVETQLLFDMGMMVLTTGK  322



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 242/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E+L +Q+H+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESAGEMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G  + E Y+L   + LLLKDNP S+RPL+L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLLLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WFQNDD   F   H  T W+Y  A ++ ++N+LF +AMA DS L   +V+ 
Sbjct  127  TKPWDCLSTWFQNDDRNAFSVAHEKTFWEY--AGQDARLNNLFNEAMASDSILASKLVVS  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+F+G+NSL+DVGG  GT+   IA AFPH+ CTVFDLPHVV  L+G KNL Y GGDM
Sbjct  185  KCKGIFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PPADALLLKWILHDWSD++ VKILK+CK++I SK  +K GKVIIIDM+ +N+ +D+
Sbjct  245  FEAVPPADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKVIIIDMVRENQNRDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+ FD+ MM+ V+G
Sbjct  305  GSIETQLLFDLEMMVAVSG  323



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 233/324 (72%), Gaps = 11/324 (3%)
 Frame = -1

Query  949  KDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKS  770
            + SE+L +QTH+WNHI NFINS SLKCA+QL IPDIIH H QPM+L +LV  LP+   K+
Sbjct  8    RSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKT  67

Query  769  THLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
              + RLMR L+HSGFF + +  E +D+EGY LA  S LLLKD+PLS  P +LA+LDP LT
Sbjct  68   LCVHRLMRILVHSGFFTMQRVQESADEEGYXLANASRLLLKDHPLSATPFLLAMLDPDLT  127

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PWH +  WFQNDDPTPF T HG T+WD  Y   EP+ N+ F +AMA D+RLV +V+IK 
Sbjct  128  EPWHYVSAWFQNDDPTPFFTAHGRTIWD--YGCHEPRFNNFFNEAMASDARLVTSVLIKE  185

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLD-----YA  248
            C+G FEGLNS +DVGG TGTVA  I  AFPHL  TV DLPHVV  L+G K LD     Y 
Sbjct  186  CKGAFEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRRGYV  245

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             G+        +  + +WILHDWSD+E +KILK+C+ +IPSKEKGGKV+IIDM + N+  
Sbjct  246  RGNSSCGCHFTEG-ITQWILHDWSDEECLKILKQCRXAIPSKEKGGKVMIIDMAIXNKKG  304

Query  67   DDES--VETQIFFDMLMMILVTGR  2
            DD+   VETQ+F DMLMM+L  GR
Sbjct  305  DDDESXVETQLFXDMLMMVLXPGR  328



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   380 bits (976),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/329 (56%), Positives = 242/329 (74%), Gaps = 17/329 (5%)
 Frame = -1

Query  958  IAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINN  779
            I ++  ++L +Q HIWNHI N+INS SLKCA+QLEIPDIIH HG+PM+L+ L  ALPINN
Sbjct  8    IGDETRQVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINN  67

Query  778  ---AKSTH--LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLA  614
                  TH  + RLMR L+H+GFF+        +EGY L P S LLLKD P+S+ P +  
Sbjct  68   NHDKAKTHDCVYRLMRILVHAGFFI-----QEAEEGYLLTPTSRLLLKDEPMSMIPFLNF  122

Query  613  ILDPILTQPWHNIIEWFQN----DDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             LDP L  PWH++ +WF N     + TP+ T HGM    + YA  EP++NHLF +AMA D
Sbjct  123  QLDPNLMDPWHSLSKWFNNVSDDSNTTPYATAHGMPF--FKYAENEPRLNHLFNEAMASD  180

Query  445  SRLVMNVVIKYCRG-VFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEG  269
            +RLVM V+I+  +G +FEGL SL+DVGG TGT+A  IA  FP + CTVF+LPHV++GL+G
Sbjct  181  TRLVMTVLIQNGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKG  240

Query  268  TKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDM  89
            +KNL + GGDMF SIP A+A+LLKWILHDWSD + +KILKKCKE+IPSKE GGKVI+I++
Sbjct  241  SKNLSFVGGDMFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVILIEI  300

Query  88   MVDNRIKDDESVETQIFFDMLMMILVTGR  2
            ++D    DD+S ETQ+  D+LMMIL++G+
Sbjct  301  VMDQNKDDDKSYETQLLIDILMMILLSGK  329



>gb|KDO40717.1| hypothetical protein CISIN_1g037127mg, partial [Citrus sinensis]
Length=307

 Score =   377 bits (968),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 227/304 (75%), Gaps = 8/304 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             + D+E+L++Q H+WNHI NFINS SLKCAV+L IPDII+KHG+P +L  LV+AL IN +
Sbjct  6    GDHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPS  65

Query  775  KSTHLARLMRTLIHSGFFV-----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            K+  + RLMR LIHSGFF       ++    +++GY L   S LLLKD+PLS+ PL+ A+
Sbjct  66   KTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAV  125

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDPIL  PW  +  WFQ+DDP PF  VHG + W+Y  A  EPK+N+ F +AMA D+RL  
Sbjct  126  LDPILLSPWLKLSTWFQSDDPAPFDMVHGKSFWEY--AGDEPKINNFFNEAMASDARLAT  183

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT-KNLD  254
             VVI  C+ VFEGLNSL+DVGG+TGTVA  IA AFP+L+CT FDLPHVV GLE    NL 
Sbjct  184  RVVIHKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLK  243

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF +IPPADA++LKWILHDW+D+E VKILKKCKE+I S  K GKVIIIDMM +N+
Sbjct  244  YVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMRENK  303

Query  73   IKDD  62
              DD
Sbjct  304  KGDD  307



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 238/316 (75%), Gaps = 4/316 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            S +L +Q+HIWNHI NFINS SLKC V L IPDIIH +G+P+SL++L++ LPI+ +K+  
Sbjct  12   SNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCF  71

Query  763  LARLMRTLIHSGFFV-ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR + HS FF     TE   +  Y L   SILLLKDNP+S+ P V A+LDP+LT P
Sbjct  72   IHRLMRIMTHSSFFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAMLDPVLTNP  131

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH    W +NDDPT F T H M LW+Y+    + K ++LF ++MA D+RLV N++I+ CR
Sbjct  132  WHQFSTWLKNDDPTTFETTHRMLLWEYVAC--DSKFSNLFNESMASDTRLVTNLLIEKCR  189

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GL SL+DVGG TGT+A  +A +FP ++ +VFDLPHVV GL+G++NL+Y GGDMF  
Sbjct  190  GVFNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGSENLNYVGGDMFKE  249

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD-DESVE  50
            IPP DA+LLKWILHDW+D+E VKILK CK++I  K K GKVI+IDM++++  +  +ESVE
Sbjct  250  IPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVIVIDMVLESEKESINESVE  309

Query  49   TQIFFDMLMMILVTGR  2
            TQ+FFDMLMM+++ G+
Sbjct  310  TQLFFDMLMMVVLAGK  325



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 233/319 (73%), Gaps = 6/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E+ +E+L +Q H W H  NF+NS  LKCA+QL IPD+IH HGQPM+L+QL+ AL +   K
Sbjct  8    ERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTK  67

Query  772  STHLARLMRTLIHSGFFVITKT--EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            +  L RLMR L+HSGFF   K      ++EGY+L   S  LLKD P+S  P +L  LDPI
Sbjct  68   APCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDPI  127

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT PWH + +WFQN+DPTPF T H  + WDY  A  EPK+N +F + M  DSRL+ N+++
Sbjct  128  LTAPWHFLGDWFQNEDPTPFHTAHRKSFWDY--AVHEPKLNDIFNETMVSDSRLIANMIV  185

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            +  + VFEGL SL+DVGG TGT+   IA AFP LKC VFD PHVV  LE  +NL+  GG+
Sbjct  186  RQYKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGENLEIVGGN  245

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            +F +IPPADA+LLKWILHDWSD+E VKILKKCK +IP+  KGGKVIIIDM+V++   D++
Sbjct  246  IFEAIPPADAILLKWILHDWSDEECVKILKKCKGAIPN--KGGKVIIIDMVVESNKGDNK  303

Query  58   SVETQIFFDMLMMILVTGR  2
            +VETQ+F DMLMM++V G+
Sbjct  304  AVETQLFIDMLMMVVVAGK  322



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 240/319 (75%), Gaps = 4/319 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INNA  776
            E  SE+L+++  IWN + ++INS SLKC  +L IP II+KHG+PM+LT+L+ ALP ++ A
Sbjct  7    EPSSELLEAEARIWNQVFSYINSMSLKCVTELGIPGIINKHGRPMTLTELMEALPGVDRA  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K+ H+ RLMRT++HSGFFV+ K + SD++GY L P S LL++D+P+S++  +L+ LD +L
Sbjct  67   KADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFLLSQLDSVL  126

Query  595  TQPWHNIIEWFQN-DDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
             +PW ++  WF+N +D T F T HGM+LW+     + P+  HLF   M  D+ +V +V+ 
Sbjct  127  CEPWQHLSGWFRNIEDRTAFHTTHGMSLWEQ--KEQNPRFGHLFDQGMGNDTPMVADVIA  184

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + CR VFEGL SL+DVGG TGT+A  IA AFP + CTV DL  +V GLEGT+NL Y  GD
Sbjct  185  RDCRQVFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLEGTRNLKYVEGD  244

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF  IPPADA+LLKWILHDWSD+E V+ILK+CKE+I S EKGGKV+II+M+VD++  D +
Sbjct  245  MFEYIPPADAVLLKWILHDWSDEECVEILKRCKEAIKSNEKGGKVVIIEMVVDDQNSDHK  304

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+ FDMLMM +V G+
Sbjct  305  SVETQLLFDMLMMTVVGGK  323



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             ++ S +L +Q H+WNH +NF+NS +LKCAV+L IPD I+ HGQP++L++LV AL IN  
Sbjct  6    GKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPI  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEG-YALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  L RLMR L+HSGFF   + + ++ E  Y+L   S  LLKD P S  PL+L  +DP 
Sbjct  66   KAPCLHRLMRVLVHSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPH  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT P H + +WF+N DPTPFVT +G   WDY  A  EPK N+ F +AMA DS+L+ +VV+
Sbjct  126  LTNPCHFLSDWFRNSDPTPFVTAYGKPFWDY--AAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
              C+ VF GL+SLIDVGG TGT+A +IA AFPHLKCTVFD PHVV  L+G +NL++ GGD
Sbjct  184  GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            +F +IPPADA+LLK ILH+WSD E VKILKKCKE+I P K+KGGKVIIID++++N  K D
Sbjct  244  IFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDIVMENN-KGD  302

Query  61   ESVETQIFFDMLMMILVTGR  2
            E+VE Q+F+D+LMM++V G+
Sbjct  303  EAVEAQLFYDILMMVVVAGK  322



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 225/295 (76%), Gaps = 4/295 (1%)
 Frame = -1

Query  880  SLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK--T  707
            SLKC V L IPDIIH +GQPM L+ L+ +LPI+ +K+  + RLMR +IHSGFF       
Sbjct  2    SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  706  EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVH  527
            E   +  Y L   S+LLLK++P+S+ P + A+LDP+LT PW+    WF+N DPTPF T H
Sbjct  62   ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFETAH  121

Query  526  GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVA  347
            GM LWDY  A  +PK+NHLF DAMA D+R V ++VI+ C+GVF GL SL+DVGG TGT+A
Sbjct  122  GMMLWDY--AGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGLESLVDVGGGTGTMA  179

Query  346  TIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQE  167
              IA +FP ++C VFDLPHVV GL+G++NL Y  GDMF +IPPADA+LLKWILHDW+D+E
Sbjct  180  KAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEE  239

Query  166  SVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
             V ILKKCKE+I  K K GKVIIIDM+V+N  +DDESVETQ+FFDMLMM+LVTG+
Sbjct  240  CVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGK  294



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   375 bits (964),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 225/318 (71%), Gaps = 35/318 (11%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +Q H+WNHILNFI S SLKCA+QL IPDIIH HG+PM+L +          
Sbjct  6    GEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPE----------  55

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
                                    G ++EGY L   S LLL D+ LSIRPL+LA+LDPIL
Sbjct  56   -----------------------AGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPIL  92

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PWH +  WFQNDDPTPF T H    WDY  A  EP++N+ F +AMA D+RLV +V++K
Sbjct  93   TKPWHYLSAWFQNDDPTPFHTAHERPFWDY--AGHEPQLNNFFNEAMASDARLVTSVLLK  150

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
              +GVFEGLNSL+DVGG TG VA  IA+AFPHL CTV DLPHVV GL+G+KNL+Y  GD+
Sbjct  151  EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDI  210

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+LLKWILHDWSD+E VKILK+C+E+IPSKE GGKVIIIDM++     D +S
Sbjct  211  FEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS  270

Query  55   VETQIFFDMLMMILVTGR  2
            +ETQ+FFDM MMI   GR
Sbjct  271  IETQLFFDMTMMIFAAGR  288



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 244/335 (73%), Gaps = 23/335 (7%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK---  773
            +E++ +Q HIWN+I NFINS SLKCAVQL IPD IH HG+PM+L+QL++ALPI+  K   
Sbjct  17   TELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSD  76

Query  772  STHLARLMRTLIHSGFFVITKTEGSD----DEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            S  + RLMR L++SGFFV+ +    +    +EGY L   S LLL+DNPLS+ PL+L++LD
Sbjct  77   SRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVTPLLLSMLD  136

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            PI+T+PWH++  W Q+DDPTPF   HGM +WDY     +P++ +LF +AMA D+RLV +V
Sbjct  137  PIMTKPWHSLSTWLQSDDPTPFAATHGMGIWDY--NEYDPRLGNLFNEAMASDARLVTSV  194

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            +I  C+ V EGL SL+D+ G TGTVA  IA+AFPHL CTVFDLPHV+  L+G+KNL + G
Sbjct  195  LIDKCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVG  254

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK-EKGGKVIIIDMMV--DNR  74
            GDMF  IPPADA+ +KWILHDWSD++ VK+L++CK +I  K  K GKVI++DM++  +  
Sbjct  255  GDMFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQN  314

Query  73   IKD-----------DESVETQIFFDMLMMILVTGR  2
             KD            +S ETQ+FFDMLMM+L  GR
Sbjct  315  NKDIGHDHHAHDHDHQSYETQLFFDMLMMVLYPGR  349



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 235/322 (73%), Gaps = 8/322 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            AE+  E+L +Q  + NH+ NF+NS +LKCA+ L IPD+IH HGQPM L+QLV AL +  +
Sbjct  6    AERADELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPS  65

Query  775  KSTHLARLMRTLIHSGFF----VITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAIL  608
            K+  L RLMR L+HSGFF    VI   E   +EGY+L   S  LLKD PL+  PL L  L
Sbjct  66   KAPCLHRLMRLLVHSGFFSQQQVIHNNE--QEEGYSLTSASRFLLKDEPLTGLPLSLLHL  123

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            +P+LT PWH +  WF+N DPTPF T HG   WDY    +EP  N LF +AMA DSR++ +
Sbjct  124  NPVLTAPWHFLSGWFRNGDPTPFYTAHGKPYWDY--TAQEPDFNDLFNEAMASDSRIIAS  181

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V+I  C+  F+GL SL+DVG  TGT+   IA AFPHLKC VFD PHVV  L+G  NL+  
Sbjct  182  VLITKCKEQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGGNLEVV  241

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
            GGDMF +IP A+A++LKWILH+WSD+E VKILKKCKE+IP+K+KGGK++IIDM+++N   
Sbjct  242  GGDMFETIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKG  301

Query  67   DDESVETQIFFDMLMMILVTGR  2
            DD++VETQ+F+DMLMM ++TG+
Sbjct  302  DDQAVETQLFWDMLMMTVLTGK  323



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   374 bits (961),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 225/299 (75%), Gaps = 8/299 (3%)
 Frame = -1

Query  880  SLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTEG  701
            S+KCA+QL IPD+IHKHGQPM+L QL++ALPI NAK+  + RLM+ LIHSGFF+  K  G
Sbjct  2    SVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPG  61

Query  700  SDDE---GYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTV  530
            ++++   GY L   S LLLK NP S+ P +LAILDP LT PWH++ +WFQN D TPF T 
Sbjct  62   NENDNQKGYLLTSASELLLKSNPFSMTPFLLAILDPTLTDPWHHLSQWFQNSDETPFYTC  121

Query  529  HGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTV  350
            HG ++  Y +A  EP +N  F +AMA D+RLV  VV K C+ VFEGLNSL+DVGG TGT 
Sbjct  122  HGRSI--YAFASHEPWLNQFFNEAMASDTRLVSRVVTKDCKHVFEGLNSLVDVGGGTGTF  179

Query  349  ATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQ  170
            A  IA AFP LKCTV DLPHVV GLE +KNL Y GG+MF +IPPADA+L+KWIL DWSD 
Sbjct  180  AKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDD  239

Query  169  ESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD---ESVETQIFFDMLMMILVTGR  2
            E V+ILKKCKE+IPSKEKGGKVII++M   ++ K D   E++ETQ+ +DM +M L  GR
Sbjct  240  ECVQILKKCKEAIPSKEKGGKVIIVEMFCKSQQKGDDDHEAIETQLCYDMEVMALGKGR  298



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 237/318 (75%), Gaps = 7/318 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E+L +QTH+WNHI  FINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + ++ RLMR L+HSGFF     +  + E Y+L   + LLLKDNPLS+R L+L +LDP+LT
Sbjct  67   AQYVHRLMRILVHSGFF---SQQNLNQEAYSLTQSTRLLLKDNPLSMRTLLLFVLDPVLT  123

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +P   +  WF+ND+ T F   H    W+Y  A ++ ++N+LF DAMA DS LV  VV+  
Sbjct  124  KPHDCLSTWFRNDEATAFSIAHESIFWEY--AGQDSRINNLFNDAMASDSILVSKVVVSK  181

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+G+FEG+NSL+DVGG  GT+A  IA AFPH+ CTVFDLP VV  L+G+KNL Y GGDMF
Sbjct  182  CKGIFEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGSKNLKYVGGDMF  241

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPS--KEKGGKVIIIDMMVDNRIKDDE  59
             ++PPAD +LLKWILH WSD++ VKILK+CK++I S  ++K GKVIIIDM+ +N   D  
Sbjct  242  EAVPPADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDMVRENLNGDGG  301

Query  58   SVETQIFFDMLMMILVTG  5
            S+ETQ+FFD+ MM+  TG
Sbjct  302  SIETQLFFDLQMMVAATG  319



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   375 bits (962),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 243/335 (73%), Gaps = 23/335 (7%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK---  773
            +E++ SQ HIWN I NFINS SLKCA+QL IPD I+ HG+PM L+QL+++LPI+  K   
Sbjct  17   TELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKRPD  76

Query  772  STHLARLMRTLIHSGFFVITKTEGSD----DEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            S  + RLMR L++SGFF + +    +    +EGY L   S LLL+DNPLS+ P +L++LD
Sbjct  77   SRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVTPFLLSMLD  136

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            PI+T+PWH+I  W Q+DDPTPF T HG   WDY     +P++ +LF +AMA D+RLV +V
Sbjct  137  PIMTKPWHSISTWLQSDDPTPFATTHGKEFWDY--NEYDPRLGNLFNEAMASDARLVTSV  194

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI+ C+ +FEGL SL+D+ G TGTVA  IA+AFPHL CTVFDLPHV+  L+G+KNL + G
Sbjct  195  VIEKCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVG  254

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK-EKGGKVIIIDMMV--DNR  74
            GDMF  IPPADA+ +KWILHDWSD++ VK+L++CK +I  K  K GKVI++DM++  +  
Sbjct  255  GDMFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQN  314

Query  73   IKD-----------DESVETQIFFDMLMMILVTGR  2
             KD            +S ETQ+FFDMLMM+L++GR
Sbjct  315  NKDIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGR  349



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 238/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L +QTH+WNHI  FINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDD-EGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G D+ E Y+L   + LLLKDNP S+R  +L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WFQNDD T F   H    W+Y+   ++P++N+L  + MARDS L   +V+ 
Sbjct  127  TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYV--GQDPRINNLCNEVMARDSILACKLVVN  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+FEG++SL+DVGG  GT+A  I  AFPH+ CTV DLPHVV  L+G KNL Y  GDM
Sbjct  185  KCKGIFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKYVAGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PPA+A+LLKW+LH+WSD++ VKILK+CK++I SK  +K GKVIIIDM+ +N   D+
Sbjct  245  FQAVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+FFD+ MM++V G
Sbjct  305  GSIETQLFFDLQMMVVVGG  323



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 240/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             ++ S +L +Q H+WNH +NF+NS +LKCAV+L IPD I+ HGQP++L++LV AL IN  
Sbjct  6    GKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPI  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEG-YALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  L RLMR L+ SGFF   + + ++ E  Y+L   S  LLKD P S  PL+L  +DP 
Sbjct  66   KAPCLHRLMRVLVXSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPH  125

Query  598  LTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
            LT P H + +WF+N DPTPFVT +G   WDY  A  EPK N+ F +AMA DS+L+ +VV+
Sbjct  126  LTNPCHFLSDWFRNSDPTPFVTAYGKPFWDY--AAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
              C+ VF GL+SLIDVGG TGT+A +IA AFPHLKCTVFD PHVV  L+G +NL++ GGD
Sbjct  184  GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            +F +IPPADA+LLK ILH+WSD E VKILKKCKE+I P K+KGGKVIIID++++N  K D
Sbjct  244  IFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDVVMENN-KGD  302

Query  61   ESVETQIFFDMLMMILVTGR  2
            E+VE Q+F+D+LMM++V G+
Sbjct  303  EAVEAQLFYDILMMVVVAGK  322



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   372 bits (955),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 231/316 (73%), Gaps = 4/316 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            S +L +Q+H+WNHI NFINS SLKC V L IPDIIH HG+PM +++L+++LPI+ +K   
Sbjct  12   SNLLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPC  71

Query  763  LARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR + HSGFF       ++ E  Y L   S LLLKDNP+S+ P V A+LDP++  P
Sbjct  72   IHRLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLDPVMMNP  131

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH    W +NDD T F T HGM LW+Y  A  + K N+LF ++MA D++LV N++++ C+
Sbjct  132  WHQFSMWLKNDDTTSFETTHGMLLWEY--AACDSKFNNLFNESMANDAQLVSNLLVEKCK  189

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF    SL+DVGG TGT+A   A +FP ++C VFDLPHVV GL+G++NL Y GGDMF  
Sbjct  190  GVFNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMFKE  249

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD-DESVE  50
            IPP DA+LLKWILHDW+D+E VKILK CK++I  K K GKV+IIDM++D    D +ESVE
Sbjct  250  IPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDNNESVE  309

Query  49   TQIFFDMLMMILVTGR  2
            T++FFDMLMM+ +TG+
Sbjct  310  TKLFFDMLMMVTLTGK  325



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 237/319 (74%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L +QTH+WNHI  FINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDD-EGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G D+ E Y+L   + LLLKDNP S+R  +L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WFQNDD T F   H    W+Y+   ++P++N+L  + MARDS L   +V+ 
Sbjct  127  TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYV--GQDPRINNLCNEVMARDSILACKLVVN  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+FEG++SL+DVGG  GT+A  I  AFPH+ CTV DLPHVV  L+G KNL +  GDM
Sbjct  185  KCKGIFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKFVAGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PPA+A+LLKWILH+WSD++ VKILK+CK++I SK  +K GKVIIIDM+ +N   D+
Sbjct  245  FQAVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+FFD+ MM++  G
Sbjct  305  GSIETQLFFDLQMMVVAGG  323



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 239/321 (74%), Gaps = 6/321 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INNA  776
            E+ SE L++Q HIWNH+L++ NS SLKCA +L IPD IH+HG PMSLT+LV+ALP ++  
Sbjct  7    EQSSEKLEAQAHIWNHVLSYTNSMSLKCATELGIPDAIHQHGGPMSLTELVDALPGVDKT  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSD-DEGYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            K+  + RLMR L+HSGFFV+ K + S+ +EGY+L   S LL+ D+P S++PLV+  L+PI
Sbjct  67   KADCVYRLMRILVHSGFFVLEKIDSSNYEEGYSLTSTSRLLVGDHPFSMKPLVICGLNPI  126

Query  598  LTQPWHNIIEWFQN-DDPTPF-VTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            LT+PW  +  W QN +D TPF +  +GM+ W+Y    + P+ +HL    MA D+ LV  V
Sbjct  127  LTEPWRQLGRWLQNTEDHTPFHIANNGMSFWEY--KERNPRFSHLLDQVMASDTPLVAGV  184

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            + + CR VFEGL+SL+DVGG TGT+A +IA  FP + CTV DL  VV GLEGT+NL Y  
Sbjct  185  ITRDCRQVFEGLDSLVDVGGGTGTLAKVIAEGFPQIHCTVLDLAPVVAGLEGTRNLKYVE  244

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF  IPP+DA+L KWILHDWSD++ V+ILKKCKE++   EK GKVIIIDM++D++  D
Sbjct  245  GDMFEFIPPSDAVLCKWILHDWSDEKCVQILKKCKEAVTRDEKKGKVIIIDMVIDDQKCD  304

Query  64   DESVETQIFFDMLMMILVTGR  2
             +SVET++FFDMLMM +V GR
Sbjct  305  HKSVETKLFFDMLMMTIVGGR  325



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 230/321 (72%), Gaps = 34/321 (11%)
 Frame = -1

Query  958  IAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINN  779
            + E  +E+L +  H+WNHI NFINS SLKCA++L IPDIIH HG+PM+L++LV  LP+N 
Sbjct  5    VGETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNP  64

Query  778  AKSTHLARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
             K+  + RLMR L+ SGFF   +  E   +EGY L   S LLLKD+PLS RP +LA+LDP
Sbjct  65   EKTKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDP  124

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            +L  PW  +                                N+ F +AMA D+RLV +V+
Sbjct  125  VLITPWQYL--------------------------------NNFFNEAMASDARLVTSVL  152

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            IK C+G+F GLNSL+DVGG TGTVA  IA+AFPHL CTV DLPHVV GLEG+KNL+Y  G
Sbjct  153  IKDCKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAG  212

Query  241  DMFVSIPPADALLLK-WILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            DMF +IPPADA+LLK WILHDW+  E VKILK+C+++IPSKEKGGKVIIIDMM++N+  D
Sbjct  213  DMFEAIPPADAILLKQWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKAD  272

Query  64   DESVETQIFFDMLMMILVTGR  2
            DES+ETQ+F+DMLMMI++TG+
Sbjct  273  DESIETQLFWDMLMMIVLTGQ  293



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   369 bits (946),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 226/294 (77%), Gaps = 8/294 (3%)
 Frame = -1

Query  880  SLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTEG  701
            SLKCA++L+IPDIIHK+GQPM L++L  +L I+ +K+  + RLMR L HSGFF   K   
Sbjct  2    SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNE  61

Query  700  SDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHG  524
            ++ E GY L   S LLLKDNPLS+ P + A+LDP LTQPW  +  WF+NDDP+PF T HG
Sbjct  62   NELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTLTQPWLQLPTWFKNDDPSPFQTAHG  121

Query  523  MTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVAT  344
            M +WDY  A +EP++N LF DAMA D++LV NVVI+ C+GVF GL SL+DVGG TGT+A 
Sbjct  122  MKIWDY--ADREPRLNDLFNDAMASDTQLVANVVIERCKGVFNGLESLVDVGGGTGTMAM  179

Query  343  IIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQES  164
             IA +FP L+CTVFDLPHVV  L+G++NL Y GGDMF SIP ADA+LLKWILHDW+D++ 
Sbjct  180  AIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDEQC  239

Query  163  VKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            VKILKKCKE+I S     KVIIIDM+V+N   DDES+ETQ+F DM++M+L  G+
Sbjct  240  VKILKKCKEAIKS-----KVIIIDMVVENEKGDDESIETQLFIDMVVMVLYPGK  288



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 232/315 (74%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            S +L +Q+HIWNHI NFINS SLKC V L IPDIIH +G+P+SL++L+  LPI+ +K+  
Sbjct  11   SNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPIHPSKTIF  70

Query  763  LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR + HSGFF     TE   +  Y L   S+LLL DNP+S+ P V A+LDP+LT P
Sbjct  71   IYRLMRIMTHSGFFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHAMLDPVLTNP  130

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WH +  W  N DPT F T HGM  WD   A +EPK N+LF DAMA D+RLV +VVI+ C+
Sbjct  131  WHQLSTWLTNGDPTAFETKHGMLFWDC--AEREPKFNNLFNDAMASDARLVSSVVIEKCK  188

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
             VF GL S++DVGG  GT+A  +A +FP L+CTV DLPHVV GL+ T+NL Y GGDMF  
Sbjct  189  EVFNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQETENLKYVGGDMFKE  248

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IP ADA+LLKWILHDW+D E VKILK CK++I  K K GKVIIIDM+++N    +ES++T
Sbjct  249  IPSADAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKVIIIDMVMENEKGKNESLQT  308

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDMLMM+LVTG+
Sbjct  309  QLFFDMLMMVLVTGK  323



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 236/318 (74%), Gaps = 7/318 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E+L +QTH+WNH+ NFINS +LKCAV+L IPD+I KHG+PM+L++LV ALPI+ +K
Sbjct  7    ESAGELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + ++ RLMR L+HSGFF     +    E Y+L   + LLLKDNP S+R L+L +LDP+LT
Sbjct  67   AQYVHRLMRILVHSGFF---SQQNLKQEAYSLTQSTRLLLKDNPWSMRTLLLFVLDPVLT  123

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +P   +  WF+ND+ + F   H  T W+Y  A ++P++N+LF DAMA DS L   VV+  
Sbjct  124  KPHDCLSTWFRNDEASAFSVAHENTFWEY--AGQDPRINNLFNDAMASDSILASKVVVSK  181

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+G+FEG+NSL+DVGG  GT+A  I  AFPH+ CTVFDLPHVV  L+G+KNL Y GGDMF
Sbjct  182  CKGIFEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMF  241

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDDE  59
             ++PPADA+LLK ILH W D++ VKIL++CK++I SK  +K GKVIIIDM+ +N   D+ 
Sbjct  242  QAVPPADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEG  301

Query  58   SVETQIFFDMLMMILVTG  5
            S+ETQ+FFD+ +M+  +G
Sbjct  302  SIETQLFFDLQLMVAASG  319



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 236/319 (74%), Gaps = 4/319 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INNA  776
            E  SE+L++  HIWN + ++INS SLKC  +L IP+IIHKHG+PM+LTQL+ ALP ++ A
Sbjct  107  EPSSELLEAGAHIWNQVFSYINSMSLKCVTELGIPEIIHKHGRPMTLTQLMEALPGVDRA  166

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K+ H+ RLMRT++HSGFFV+ K + SD++GY L P S LL++D+P+S++  VL+ L  +L
Sbjct  167  KADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFVLSQLGSVL  226

Query  595  TQPWHNIIEWFQN-DDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
             +PW ++  WF+N +D T F T HGM+LW+     + P   HLF   M  D+ +V +V+ 
Sbjct  227  CEPWQHLSGWFRNTEDRTSFHTTHGMSLWEL--KEQNPSFGHLFDRGMENDATIVADVIT  284

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
            + CR VFEGL SL+DVGG TGTVA  IA  FP + CTV DL  V+ GLEGT+NL Y  GD
Sbjct  285  RDCRQVFEGLGSLVDVGGGTGTVAKAIAEVFPQIHCTVLDLAPVIAGLEGTRNLKYVEGD  344

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF  IPPADA+LLKW+LHDW+D+E V+ILK+CKE+I S EK GKV+II+M+VD++  D +
Sbjct  345  MFEYIPPADAVLLKWLLHDWNDEECVEILKRCKEAIKSNEKRGKVVIIEMVVDDQNSDHK  404

Query  58   SVETQIFFDMLMMILVTGR  2
            SVETQ+FFD L+M +  GR
Sbjct  405  SVETQLFFDTLVMTIADGR  423



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 242/327 (74%), Gaps = 5/327 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            MAL     +   E+LD+Q+H+WNH+ NFINS SLKC +QL IPDII KHG+PM+L++L +
Sbjct  1    MALSGNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTH  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLV  620
            +L +N+AKS  L RLMR +IHS FF+  K ++  + +GY L P S LLL+D P S+RP  
Sbjct  61   SLHLNDAKSPSLERLMRIMIHSKFFINVKISQVEETDGYWLTPASHLLLRDEPSSMRPFA  120

Query  619  LAILDPILTQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDS  443
            L +LDPIL  PWH++ +WF++D D TPF+T HG T W+Y  A ++P++N  F +AMA D+
Sbjct  121  LVLLDPILIDPWHHVSKWFKSDHDLTPFLTTHGRTFWEY--AAQDPRLNCFFNEAMACDT  178

Query  442  RLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK  263
             LV +V+   CR VFEGL S++DVGG TGTVA  +A AF  L C V DLPHVV G EGT+
Sbjct  179  VLVASVITGDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTE  238

Query  262  NLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMV  83
            NL +  GDMF  IP ADA+ +KWILHDW D++ +KIL+KCK+++  K+K GKVII+D++V
Sbjct  239  NLVFVAGDMFEYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKVIIVDIVV  298

Query  82   DNRIKDDESVETQIFFDMLMMILVTGR  2
            D + K+ +++ETQ+FFDMLMM + +GR
Sbjct  299  DFQ-KEHKAIETQLFFDMLMMNVASGR  324



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 233/317 (74%), Gaps = 8/317 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +E+L +Q H+ N +LNF  S SLKCA++L IPD I++HG+P++L++LV+ALPIN +K
Sbjct  5    ENLTELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSK  64

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + H+ RLMR L ++GFFV+       D+GYAL     LLLK+ P ++R  +  + DP+L 
Sbjct  65   ANHIYRLMRFLSNAGFFVLQ------DQGYALTAAGRLLLKEEPFNLRAFIFYMSDPVLV  118

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PW+++ EWF+NDDP+PF T HG   W   YA +EP   +LF +AMA DS L++ V++  
Sbjct  119  KPWNSLTEWFRNDDPSPFHTAHGKNFW--AYAAEEPNFANLFNEAMANDSTLIVQVMMTQ  176

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+ VF+GL SL DVGG TG VA  IA  FP+LKC V DLPHV+ G EGT+NLD+  GDM 
Sbjct  177  CKFVFDGLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEGTENLDFVAGDML  236

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESV  53
              +P ADA+LLKWILHDWSD++ VKILK CKE+IP ++KGGKVIIIDM++++++KDD+SV
Sbjct  237  EKVPAADAILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKVIIIDMILESQVKDDDSV  296

Query  52   ETQIFFDMLMMILVTGR  2
            ETQ+  DM M++    +
Sbjct  297  ETQVGVDMQMLMCYGAK  313



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 242/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E+L +QTH+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G  ++  Y+L   + LLLKDNP S+RPL+L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WF+NDD   F   H  TLW+Y  A ++ ++N+LF DAMA DS L   +V+ 
Sbjct  127  TKPWDCLSTWFRNDDRNAFSVAHEKTLWEY--AGQDARLNNLFNDAMASDSILASKLVVS  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+F+G+NSL+DVGG  GT+A  IA AFPH+ CTVFDLPHVV  L+G KNL YAGGDM
Sbjct  185  KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYAGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PP DALLLKWILHDWSD++ VKILK+CK++I SK  +K GKVIIIDM+ DNR  D+
Sbjct  245  FEAVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKVIIIDMVRDNRNGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ TQ+ FD+ MM+ ++G
Sbjct  305  GSIGTQLLFDLEMMVALSG  323



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   367 bits (941),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 241/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +E+L +QTH+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G  + E Y+L   + LLLKDNP S+RPL+L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WF+NDD   F+  H  TLW+Y  A ++ + N+LF +AMA DS L   +V+ 
Sbjct  127  TKPWDCLSTWFRNDDCNAFIVAHEKTLWEY--AGQDARFNNLFNEAMASDSILASKLVVS  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+F+G+NSL+DVGG  GT+A  IA AFPH+ CTVFDLPHVV  L+G KNL Y GGDM
Sbjct  185  KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PPADALLLKW+LHDWSD+  VKILK+CK+++ SK  +K GKVIIIDM+ +N   D+
Sbjct  245  FEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+ FD+ +M+  +G
Sbjct  305  GSIETQLLFDLEIMVAASG  323



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   366 bits (940),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 241/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +E+L +QTH+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + ++ RLMR L+HSGFF      G  + E Y+L   + LLLKDNP S+RPL+L +LDP+L
Sbjct  67   AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+PW  +  WF+NDD   F+  H  TLW+Y  A ++ + N+LF +AMA DS L   +V+ 
Sbjct  127  TKPWDCLSTWFRNDDCNAFIVAHEKTLWEY--AGQDARFNNLFNEAMASDSILASKLVVS  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+G+F+G+NSL+DVGG  GT+A  IA AFPH+ CTVFDLPHVV  L+G KNL Y GGDM
Sbjct  185  KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDD  62
            F ++PPADALLLKW+LHDWSD+  VKILK+CK+++ SK  +K GKVIIIDM+ +N   D+
Sbjct  245  FEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDE  304

Query  61   ESVETQIFFDMLMMILVTG  5
             S+ETQ+ FD+ +M+  +G
Sbjct  305  GSIETQLLFDLEIMVAASG  323



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/326 (54%), Positives = 245/326 (75%), Gaps = 6/326 (2%)
 Frame = -1

Query  967  LPLIAEKDS-EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            + ++ +K S E+L+++ HIWNH+ N+INS SLKCA +L IPD+IHKHG PM+L +LV+AL
Sbjct  1    MEMVDQKQSLELLEAEAHIWNHVFNYINSTSLKCATELGIPDVIHKHGGPMTLLELVDAL  60

Query  790  P-INNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLA  614
            P ++ AK+  + RLMR L+HSGFFV+ K   S++E Y+L P S LL+ D P+S++P V++
Sbjct  61   PGVDKAKADCMYRLMRILVHSGFFVLEKINSSNEEAYSLTPASRLLVGDLPMSMKPYVIS  120

Query  613  ILDPILTQPWHNIIEWFQN-DDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSR  440
             +DPIL +P H++  WFQN ++ TPF T++ GM+ W+     +  + +HLF   +A D+ 
Sbjct  121  QIDPILVEPMHHLSRWFQNANNHTPFQTINNGMSFWEQ--KERNLRFSHLFDQGVASDTP  178

Query  439  LVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKN  260
            +V +V+ + CR VFEGL+SL+DVGG TGT+A  IA AFP + CTV DL  VV G++GTKN
Sbjct  179  MVAHVITRDCRQVFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKN  238

Query  259  LDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            L Y  G+MF  IPP+DA+LLKWILHDWSD++SV+ILKKCKE+I S  K GKVI+I+M+VD
Sbjct  239  LKYIEGNMFEYIPPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKVILIEMVVD  298

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            +   + ESVETQ+ FDMLMM LV G+
Sbjct  299  DERSNTESVETQLLFDMLMMTLVGGK  324



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 229/318 (72%), Gaps = 7/318 (2%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L SQ H+WN+I +F+NS SLKCA+QL IPDIIH H +PM+L QL+ AL I+  K+  +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHPTKTQCV  74

Query  760  ARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
             RLMR L+HSGFF + KT E   +EGY L   S LLLKD+PLS+ P +LA+LDPILT+PW
Sbjct  75   YRLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKPW  134

Query  583  HNIIEWFQNDDPTP----FVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            H +  W QNDD       F   HGM  WDY  A +E ++NH F + MA D+RL  + +I 
Sbjct  135  HQVSTWIQNDDDDDAATTFALPHGMNFWDY--AVRETRLNHFFNEGMASDTRLTSSALIH  192

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VFEGLN+L+DVGG TGT+A+ IA  FPH++CTVFD PHVV  L+   NL Y GG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNM  252

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+L+K +LH+W+D+E VKILK CK++I    K GKVIIID+ +++   D ++
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEKADYKT  312

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+F DMLMM+LV G 
Sbjct  313  TETQLFMDMLMMVLVKGE  330



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 235/315 (75%), Gaps = 3/315 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            S +L +Q+HIWNH+ NFINS SLKC V L IPDIIH + +PM L+ L+++LPI+ +K   
Sbjct  7    SNLLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIHPSKIPC  66

Query  763  LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR + H GFF     TE   +  Y L   SILLLKD+P+S+ P +  +LDPI+  P
Sbjct  67   IYRLMRIMTHLGFFSKDNVTENELEIEYMLTDESILLLKDHPMSVTPFLQVVLDPIVANP  126

Query  586  WHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            WHN+  W +NDDPT F T HGM +WDY  A +EPK N+LF DAMA D+RLV +VVI+ C+
Sbjct  127  WHNLSTWLKNDDPTTFETTHGMLIWDY--AAREPKFNNLFNDAMASDARLVTSVVIEKCK  184

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVF GL SL+DVGG TGT+A  +A  FP ++C VFDLPHVV GL+G+ NL+Y GGDMF +
Sbjct  185  GVFNGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGSDNLNYVGGDMFKN  244

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPPADA+LLKWILHDW+D E VKILK CK++I  K K GKVIIIDM+++    ++E++ T
Sbjct  245  IPPADAILLKWILHDWNDDECVKILKNCKDAIAKKGKKGKVIIIDMVMEKEKGNNETLGT  304

Query  46   QIFFDMLMMILVTGR  2
            Q+FFDMLMM+L TG+
Sbjct  305  QLFFDMLMMVLATGK  319



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   361 bits (926),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 227/317 (72%), Gaps = 8/317 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +E+L +Q H+ N + NF  S SLKCA++L IPD I++HG+P++L++LV+ALPIN +K
Sbjct  5    ENLTELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSK  64

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + H+ RLMR L ++GFFV+       D+GYAL     LLLK+ P ++R  +    DP+L 
Sbjct  65   ANHIYRLMRFLSNAGFFVL------QDQGYALTAAGRLLLKEEPFNLRAFIFYTSDPVLV  118

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +PW+++ EWF+NDDP+PF T HG   W   YA +EP   +LF +AMA DS L + V++  
Sbjct  119  KPWNSLTEWFRNDDPSPFHTAHGKNFW--AYAAEEPNFANLFNEAMANDSTLTVQVMMTQ  176

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+ VF+GL SL+DVGG TG VA  IA  FP+L+C V DLPHV+ G EGT+NLD+  GDM 
Sbjct  177  CKFVFDGLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEGTENLDFVAGDML  236

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESV  53
              +P ADA+LLKWILHDWSD + VKILK CKE+IP ++KGGKVIIIDM++++ +KDDESV
Sbjct  237  EKVPAADAILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKVIIIDMILESHMKDDESV  296

Query  52   ETQIFFDMLMMILVTGR  2
            ETQ   DM M+     +
Sbjct  297  ETQFVVDMQMLTCYGAK  313



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 228/320 (71%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFINS  LKCA+QL IPD IH HGQPM+L  LV+AL I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMNLDALVSALQIHPS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  + RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDP L
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPCNVAPFALSMLDPTL  125

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM+ W Y  A +EP +N LF D MA D+RLV ++V+
Sbjct  126  INPWHGLSAWFHNRVDPTPFEMVQGMSFWRY--AGQEPGLNRLFNDGMASDARLVASMVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +GVFEG+ SL+DVGG TGT A  IA+AFPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTTAKAIANAFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF SIPPADA++LKWILHDWSD+++VKILK+CKE++   K K  KVIIIDM++DN   D 
Sbjct  244  MFESIPPADAIILKWILHDWSDEDAVKILKRCKEALGKGKGKKQKVIIIDMVMDNTKSDK  303

Query  61   ESVETQIFFDMLMMILVTGR  2
            E+VETQ+F+DMLMM L +GR
Sbjct  304  ETVETQLFYDMLMMTLASGR  323



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 225/318 (71%), Gaps = 3/318 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            EK  E++ +QTHIWNH  +FI S SLKCAVQL IPDII+ HGQPM+L++LV  L ++  K
Sbjct  7    EKIDELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTK  66

Query  772  STHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + HL RLMR L+HSGFF +   ++    EGY L P S LLLKD     RP +   LDP+ 
Sbjct  67   TDHLYRLMRVLVHSGFFNLQNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALDPVA  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+P++ +I + +NDDPT FVT  G TL+ Y  A  E ++NHLF + MA DS ++   VI 
Sbjct  127  TEPYNYLIPFLRNDDPTAFVTAFGETLFGY--AGNEARINHLFNECMASDSSVIGRAVII  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VFEG+NSL+DVGG TG +A  I   FP+LKCTV DLPHVV  L+G+ NL + GGDM
Sbjct  185  KCKKVFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F ++PPADA+LLKWILHDW D+E +KILK CKE++  K  GGKV+IIDM++ N+  DD  
Sbjct  245  FQAVPPADAILLKWILHDWPDEECIKILKNCKEAVSEKGTGGKVMIIDMVMGNQSWDDSL  304

Query  55   VETQIFFDMLMMILVTGR  2
            +E Q+ FDM MM L+ G+
Sbjct  305  MEAQLCFDMQMMALLMGK  322



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   360 bits (923),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 227/318 (71%), Gaps = 7/318 (2%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L SQ H+WN+I +F+NS SLKCA+QL IPDIIH H +PM+L QL+  L I+  K+  +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQCV  74

Query  760  ARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
              LMR L+HSGFF + KT E   +EGY L   S LLLKD+PLS+ P +LA+LDPILT+PW
Sbjct  75   YHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKPW  134

Query  583  HNIIEWFQNDDPTP----FVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            H +  W QNDD       F   HGM  WDY  A +E ++NH F + MA D+RL  + +I 
Sbjct  135  HQVSTWIQNDDDDDAATTFALPHGMNFWDY--AVRETRLNHFFNEGMASDTRLTSSALIH  192

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VFEGLN+L+DVGG TGT+A+ IA  FPH++CTVFD PHVV  L+   NL Y GG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNM  252

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+L+K +LH+W+D+E VKILK CK++I    K GKVIIID+ +++   D ++
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEKADYKT  312

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+F DMLMM+LV G 
Sbjct  313  TETQLFMDMLMMVLVKGE  330



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   359 bits (921),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 236/326 (72%), Gaps = 11/326 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            ++  +++L +Q HIWNHI NFINS SLKCA+QL IPD I+KHG+PM+L+ L+ AL I+ A
Sbjct  10   SQDHNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSIHPA  69

Query  775  KSTHLARLMRTLIHSGFFVITKTE--GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
            K+  + RL+R L+HSGF    KTE    + EGY L   S LL+K++P S++  +LA+LDP
Sbjct  70   KTHAIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAMLDP  129

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            +LT PW ++  WF NDDPTPF T HG  +W Y  A   P++N  F +AMA D+++V +++
Sbjct  130  VLTGPWDHLTTWFLNDDPTPFQTCHGRGIWKY--AGHNPELNSSFNEAMACDAKMVASIL  187

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            IK C GVF+GL SL+DVGG TGTVA  +A +FP L C VFDLPHVV GL+   NL + GG
Sbjct  188  IKECEGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDGDNLKFVGG  247

Query  241  DMFVSIPPADALLLK------WILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            DMF  IPPADA+LLK      WI+HDW D++ +KILK CKE+I  + KGGK+IIIDM+++
Sbjct  248  DMFEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGR-KGGKLIIIDMVME  306

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
             + +D ++ ET++F DMLM++L  G+
Sbjct  307  TQKEDKDATETELFLDMLMIVLYNGK  332



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 232/329 (71%), Gaps = 17/329 (5%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKS--  770
            +E L +Q HIWN I NFINS SLKCA+QL IPD IH HG+PM+L+QL++ALPI+  K   
Sbjct  16   TEQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLD  75

Query  769  THL-ARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRPLVLAILDP  602
            +HL  RLMR L++S FF + +  G  D+   GY L   S LL++DNP S+ P++L +LDP
Sbjct  76   SHLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTPILLTVLDP  135

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            I+T+PWH+I  W Q+DDPTPF T HGM  WDY    ++P+  ++F +AMA D+RLV++V+
Sbjct  136  IMTKPWHSISTWLQSDDPTPFATTHGMEFWDYTV--RDPRFGNVFNEAMASDARLVVSVL  193

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
                  VFEGL SL+D+ G TGTV   IA AFPH++CTVFDLPHV+  L+G+ NL + GG
Sbjct  194  FDKRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGSTNLKFVGG  253

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK-EKGGKVIIIDMMVDNRIK-  68
            DMF  IPPADA+ +KWILHDWSD++ VK+LK+CK +I  K  K GKVI++DM++  +   
Sbjct  254  DMFDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGKVILVDMVIVEKQNN  313

Query  67   -------DDESVETQIFFDMLMMILVTGR  2
                   D +  ETQI FDMLMM+   GR
Sbjct  314  KDIGHDHDHQLYETQILFDMLMMVSFPGR  342



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 236/320 (74%), Gaps = 9/320 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INNA  776
            +++ E+L+++ HIWN + N+INS SLKCA +L IPD+IHKHG PM+LT+L++ALP ++ A
Sbjct  7    KQNLEVLEAEAHIWNQVFNYINSTSLKCATELGIPDVIHKHGGPMTLTELLDALPAVDKA  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K+  + RLMRTL+HSGFFV+ K   S++EGY+L P   LL+ D P+S++P V++ +DPIL
Sbjct  67   KANCMYRLMRTLVHSGFFVLEKLNSSNEEGYSLTPAPRLLVGDRPMSMKPFVISQIDPIL  126

Query  595  TQPWHNIIEWFQND-DPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            T+  H++  WFQ   D T F T + G + W+     + P+ +HLF   M  D+ +V +V+
Sbjct  127  TESMHHLGRWFQTTHDRTTFHTANNGTSFWEQ--KERNPRFSHLFDQGMESDTPMVASVI  184

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
             + CR VFEGL+S++DVGG TGT+A  IA AFP + CTV DLPH+V GLEG +NL Y  G
Sbjct  185  TRDCRQVFEGLDSVVDVGGGTGTLAKAIAEAFPQIHCTVLDLPHIVAGLEGRRNLKYIEG  244

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD  62
            +MF  IPP+DA++LKW+LHDWSD+ESVKILKKCKE++ S  K GKVIII+M+V    K++
Sbjct  245  NMFDYIPPSDAVVLKWLLHDWSDEESVKILKKCKEAVTSNGKRGKVIIIEMVV----KEN  300

Query  61   ESVETQIFFDMLMMILVTGR  2
            ESVETQ+  DMLMM    G+
Sbjct  301  ESVETQLLLDMLMMATFKGK  320



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 236/321 (74%), Gaps = 4/321 (1%)
 Frame = -1

Query  958  IAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINN  779
            I +  S +L +Q+H+WNH+ NFINS SLKC V L IPDIIH +G+P+ L++L+++L I+ 
Sbjct  6    IEQVASNLLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSIHP  65

Query  778  AKSTHLARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDP  602
            +K+  + RLMR + HSGFF      G++ E  Y L   S LLLKDNP+S+ P V A+++P
Sbjct  66   SKNHGIHRLMRIMTHSGFFSQKNVIGNELEIEYMLTDASKLLLKDNPMSVAPYVHAMVNP  125

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            ++  PW+    W +NDD   F T HGM+ W+Y  A ++ ++N+LF ++MA D+RLV +++
Sbjct  126  VMMNPWYQFSTWLKNDDTNTFETTHGMSTWEY--AARDSEINNLFNESMANDTRLVSDLL  183

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            ++ C+GVF  + SL+DVGG TGT+A  +  +FP ++C VFDLPHVV GL+G++ L Y GG
Sbjct  184  VEKCKGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGSEKLRYVGG  243

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD-  65
            DMF  IPPADA+LLKWILHDW+D++ +KILK CK++I  K K GKV+IIDM++D    D 
Sbjct  244  DMFKEIPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDN  303

Query  64   DESVETQIFFDMLMMILVTGR  2
            +ESVETQ+FFDMLMM L+TG+
Sbjct  304  NESVETQLFFDMLMMALLTGK  324



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 226/318 (71%), Gaps = 7/318 (2%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHL  761
            E+L SQ H+WN+I +F+NS SLKCA+QL IPDIIH H +PM+L QL+  L I+  K+  +
Sbjct  15   ELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQCV  74

Query  760  ARLMRTLIHSGFFVITKT-EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
              LMR L+HSGFF + KT E   +EGY L   S LLLKD+PLS+ P +LA+LDPILT+PW
Sbjct  75   YHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKPW  134

Query  583  HNIIEWFQNDDPTP----FVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            H +  W QNDD       F   HGM  WDY  A +E ++NH F + MA D+RL  + +I 
Sbjct  135  HQVSTWIQNDDDDDAATTFALPHGMNFWDY--AVRETRLNHFFNEGMASDTRLTSSALIN  192

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VFEGLN+L+DVGG TGT+A+ IA  FPH++CTVFD PHVV  L+    L Y GG+M
Sbjct  193  KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGYLKYVGGNM  252

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IPPADA+L+K +LH+W+D+E VKILK CK++I    K GKVIIID+ +++   D ++
Sbjct  253  FEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEKADYKT  312

Query  55   VETQIFFDMLMMILVTGR  2
             ETQ+F DMLMM+LV G 
Sbjct  313  TETQLFMDMLMMVLVKGE  330



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 227/320 (71%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFINS  LKCA+QL IPD IH HGQPM+L  LV+AL I+ +
Sbjct  4    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  63

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  + RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPIL
Sbjct  64   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNHVSKLLLTDNPSNVAPFALSMLDPIL  123

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM+ W Y  A +EP  N LF D MA D+RLV ++V+
Sbjct  124  INPWHGLSAWFHNHVDPTPFEMVQGMSFWRY--AGQEPGFNRLFNDGMASDARLVASMVV  181

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +GVFEG+ SL+DVGG TGT A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  182  NEHKGVFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  241

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF +IPPADA++LKWILHDWSD+++VK+LK+C+E++   + K  KVIIIDM++DN   D 
Sbjct  242  MFEAIPPADAIILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIDMVMDNTKSDK  301

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM L +GR
Sbjct  302  EMVETQLFYDMLMMTLTSGR  321



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 229/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFINS  LKCA+QL IPD IH H QPM+L  LV+AL I+ +
Sbjct  4    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPS  63

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  L RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPI+
Sbjct  64   RAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIV  123

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM++W Y+   +EP +N LF D MA D+RLV ++V+
Sbjct  124  INPWHGLSAWFHNHVDPTPFEMVQGMSIWRYV--GQEPGLNRLFNDGMATDARLVASMVV  181

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +G+FEG+ SL+DVGG TGT A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  182  NEHKGMFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  241

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF SIPPADA++LKWILHDWSD+++VKILK+C+E++   + K  KVIIIDM++DN   D 
Sbjct  242  MFESIPPADAIILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKSDK  301

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM LV+GR
Sbjct  302  EMVETQLFYDMLMMTLVSGR  321



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 229/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFINS  LKCA+QL IPD IH H QPM+L  LV+AL I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  L RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPI+
Sbjct  66   RAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIV  125

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM++W Y+   +EP +N LF D MA D+RLV ++V+
Sbjct  126  INPWHGLSAWFHNHVDPTPFEMVQGMSIWRYV--GQEPGLNRLFNDGMATDARLVASMVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +G+FEG+ SL+DVGG TGT A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  184  NEHKGMFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF SIPPADA++LKWILHDWSD+++VKILK+C+E++   + K  KVIIIDM++DN   D 
Sbjct  244  MFESIPPADAIILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKSDK  303

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM LV+GR
Sbjct  304  EMVETQLFYDMLMMTLVSGR  323



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 230/322 (71%), Gaps = 10/322 (3%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +   IWN  LNFI   SLKCAV+L IPDII+ HGQP++L++L+++LPI+++K+  
Sbjct  10   NELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHC  69

Query  763  LARLMRTLIHSGFFVITKTEGSDDE--------GYALAPPSILLLKDNPLSIRPLVLAIL  608
            + RLMR L+HSGFF   K +   DE         Y+L   S LLLKD P    P  L  L
Sbjct  70   IYRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQL  129

Query  607  DPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMN  428
            +P L  PWH +  W QN DPTPF  VHG T WD +    EP++ +LFT+AMA DS+L++ 
Sbjct  130  EPHLMTPWHFVSTWLQNSDPTPFEMVHGKTFWDGV--GDEPRLKYLFTEAMATDSQLMVK  187

Query  427  VVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYA  248
            V+++ C+ VFEGL SL+DVGG TG VA  IA  FP++ CTV DLP+VV   +G KNL++ 
Sbjct  188  VIVEECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVANSQGAKNLNFI  247

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF  IPPA+A+LLKWILHDWSD+E+V ILK+C+E+I SKEKG KVIIIDM+++N   
Sbjct  248  AGDMFKEIPPANAILLKWILHDWSDEEAVMILKRCREAIWSKEKGEKVIIIDMVIENPKM  307

Query  67   DDESVETQIFFDMLMMILVTGR  2
            D +S ETQ++FDMLMM+ +TGR
Sbjct  308  DKKSAETQLYFDMLMMVNLTGR  329



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 235/318 (74%), Gaps = 5/318 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  +++L +QT ++N I +FINS SLKCA++L IPDIIH +GQP+ L+QL+++LPI+ +K
Sbjct  41   EHATKLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQLISSLPIHPSK  100

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            S  + RLMR L HS FF++TK E   +  Y L   S LLLKD+P S+  ++  IL PI++
Sbjct  101  SGDIDRLMRVLTHSNFFIVTKNE--LEVMYELTDASRLLLKDHPFSMTSMLHVILGPIMS  158

Query  592  QPWHNIIEWFQNDDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            +PWH +  W++N+DP+PF T + G+  WDY  A  +P+ NHLF +AMA ++R+   VV+ 
Sbjct  159  KPWHQLSNWYKNEDPSPFYTENNGIEFWDY--AGHDPEFNHLFNEAMACETRMASTVVMG  216

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVF+GL SL+DVGG  GT++  IA +FP+++C VFDLPHVV GL+G++N  Y  GDM
Sbjct  217  KCKGVFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGSENFKYVAGDM  276

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F SIPP  ++LLK +LHDW+D+E +KILKKCKE+I SK K GKVIIID ++ N   D+ES
Sbjct  277  FESIPPTQSILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVIIIDAVMGNEKADNES  336

Query  55   VETQIFFDMLMMILVTGR  2
             E Q+F+D+ MM+LV G+
Sbjct  337  FEAQLFYDLEMMVLVNGK  354



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 229/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFI+S  LKCA+QL IPD IH HGQPM+L  LV+AL I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  + RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPIL
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPIL  125

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM+ W Y  A +EP +N LF D MA D+RLV ++V+
Sbjct  126  INPWHGLSAWFHNHADPTPFEMVQGMSFWRY--AGQEPGLNRLFNDGMASDARLVASMVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +GVFEG+ SL+DVGG TGT+A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF +IPPADA++LKWILHDWSD+++VK+LK+C+E++   + K  KVIII+M++DN   D 
Sbjct  244  MFEAIPPADAIILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKSDK  303

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM L +GR
Sbjct  304  EMVETQLFYDMLMMTLASGR  323



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 229/320 (72%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFI+S  LKCA+QL IPD IH HGQPM+L  LV+AL I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  + RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPIL
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPIL  125

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM+ W Y  A +EP +N LF D MA D+RLV ++V+
Sbjct  126  INPWHGLSAWFHNHADPTPFEMVQGMSFWRY--AGQEPGLNRLFNDGMASDARLVASMVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +GVFEG+ SL+DVGG TGT+A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF +IPPADA++LKWILHDWSD+++VK+LK+C+E++   + K  KVIII+M++DN   D 
Sbjct  244  MFEAIPPADAIILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKSDK  303

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM L +GR
Sbjct  304  EMVETQLFYDMLMMTLTSGR  323



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   355 bits (910),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 232/318 (73%), Gaps = 7/318 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +++L +QTHI++    FINS SLKCA+ L IPD+IHK+GQPM L+QL+ +LPI+ +K+  
Sbjct  10   AKLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIHPSKACF  69

Query  763  LARLMRTLIHSGFFV----ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + RLM+ L HSGFF      T+    ++  Y L   S LLLKD+  S+  L   ILDPIL
Sbjct  70   IFRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISLPQVILDPIL  129

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
              PW     WF N+DPTPF T +GM  WDY  A  EPK+NHLF DAM  DSRL+ +V+I+
Sbjct  130  VNPWFQFSTWFTNEDPTPFHTQNGMAFWDY--ASSEPKLNHLFNDAMTNDSRLISSVLIE  187

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+GVF GL SL+DVGG TGT+A  IA +FP LKC VFDLPHVV GL+GT+N++Y  GDM
Sbjct  188  KCKGVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGTENVEYVHGDM  247

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F +IP AD+++LK I+H+W+D+E +KILK+CKE+I +K+K GKVIIID+++ N   D E 
Sbjct  248  FEAIPSADSIMLKTIMHNWNDEECLKILKRCKEAIANKDK-GKVIIIDVVIGNEKGDSEL  306

Query  55   VETQIFFDMLMMILVTGR  2
             +T++F+D+ MM+LVTG+
Sbjct  307  DQTKLFYDIEMMVLVTGK  324



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 227/320 (71%), Gaps = 4/320 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  S+ L +Q HIWNHI NFINS  LKC +QL IPD IH HGQPM+L  LV+AL I+ +
Sbjct  6    GEMGSQQLLAQAHIWNHIFNFINSMCLKCTIQLGIPDTIHHHGQPMTLDALVSALQIHPS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            ++  + RLMR L+HSGFF   K        Y L   S LLL DNP ++ P  L++LDPIL
Sbjct  66   RAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPIL  125

Query  595  TQPWHNIIEWFQND-DPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVI  419
              PWH +  WF N  DPTPF  V GM+ W Y  A +EP  + LF D MA D+RLV ++V+
Sbjct  126  INPWHGLSAWFHNHADPTPFEMVQGMSFWRY--AGQEPGFDRLFNDGMASDARLVASMVV  183

Query  418  KYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGD  239
               +GVFEG+ SL+DVGG TGT+A  IA++FPH++CT+FDLPHVV  LE ++N+    GD
Sbjct  184  NEHKGVFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGD  243

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESI-PSKEKGGKVIIIDMMVDNRIKDD  62
            MF +IPPADA++LKWILHDWSD+++VK+LK+C+E++   + K  KVIII+M++DN   D 
Sbjct  244  MFEAIPPADAIILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKSDK  303

Query  61   ESVETQIFFDMLMMILVTGR  2
            E VETQ+F+DMLMM L +GR
Sbjct  304  EMVETQLFYDMLMMTLASGR  323



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   352 bits (903),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 232/322 (72%), Gaps = 7/322 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            ++K +E+L +Q H++NHI N+INS  LKCAVQL IPDIIHKHG+P++L +LV+AL I+  
Sbjct  6    SQKATELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEG---YALAPPSILLLKDNPLSIRPLVLAILD  605
            K   + RLMR L+HSGFF ITK     +EG   Y L P S LL+KDNP  ++P V ++L 
Sbjct  66   KINFMYRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFVDSLLK  125

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P    P H + +WF+ ++ T F   HGM  W+Y    + P+ N LF +AMA DSR+ MN+
Sbjct  126  PDFVTPGHVLGDWFRGNELTVFQRAHGMAFWEY--NERNPEFNQLFNEAMASDSRM-MNL  182

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI+ C+ +FEG+NSL+DVGG  G++A II+ AFP +KCTV +LP V+  LEGTKNL+Y G
Sbjct  183  VIRDCKPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGTKNLNYVG  242

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGG-KVIIIDMMVDNRIK  68
            GDMF  IP ADA++LK ILH W+D+E VKILKKCKE+I S  KG  KVI+ID++++++  
Sbjct  243  GDMFQHIPSADAIILKLILHGWNDEECVKILKKCKEAISSTGKGSEKVIVIDLVINDKKD  302

Query  67   DDESVETQIFFDMLMMILVTGR  2
            + E  ET++ FDMLMM + TG+
Sbjct  303  EYEFTETKLLFDMLMMFVATGK  324



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   352 bits (903),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 223/319 (70%), Gaps = 8/319 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            A   SE+L +Q  +WN   N++NS SLKCAV+L I DIIH HGQP +L+Q+ +AL I   
Sbjct  7    AASSSELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASALNIKPN  66

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K   +  +MR L+HSGFF   K    DDE Y L P S LLLKD PL   P V  + DP+ 
Sbjct  67   KVECIQSVMRILVHSGFFAQQK----DDE-YFLTPASRLLLKDTPLKAAPFVDLVADPLY  121

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T  +H +  W QNDDPT F T HG  +WD +    EPK   LF D M  DS L+  +VIK
Sbjct  122  TTAFHCLGTWLQNDDPTLFETAHGKKVWDRV--ADEPKFKSLFYDLMITDSELIAGIVIK  179

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK-NLDYAGGD  239
             C+ VFEGL SL+DV G TG +A  IA AFP +KCTVFDLPHVV  L+GT  NLD+ GG+
Sbjct  180  DCKEVFEGLKSLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGN  239

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IP A+A+LLKWILH+W+D+ESVK+LKKCKE+IPSK++GGKVIIIDM ++N+ +D E
Sbjct  240  MFEAIPQANAVLLKWILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKE  299

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+ FD+LM+ L  G+
Sbjct  300  SMETQLCFDILMVSLFRGK  318



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 239/333 (72%), Gaps = 10/333 (3%)
 Frame = -1

Query  976  MALLPLIAEKDSEIL-DSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLV  800
            MA+  +I  +++++L  +Q HIWNHI NF+NS SLKCAVQL IPD++H HG+PM L++LV
Sbjct  1    MAMAIVIDNEEAKMLVQAQAHIWNHIFNFLNSMSLKCAVQLGIPDVLHSHGKPMLLSELV  60

Query  799  NALPINNAKSTHLARLMRTLIHSGFFVITKT------EGSDDEGYALAPPSILLLKDNPL  638
             AL +  +++  L RLMR L+HSGFF + +       E  +++GY L P S LLLKDNPL
Sbjct  61   LALGVPQSRTACLHRLMRMLVHSGFFSMHRVYKDPEEEEEEEKGYVLTPSSRLLLKDNPL  120

Query  637  SIRPLVLAILDPILTQPWHNIIEWFQ-NDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTD  461
            ++   ++A+LDP+L  PWH +  WFQ N   TPF   +G   W+Y     +P+ N+LF  
Sbjct  121  NVSQFLIAMLDPVLVTPWHFLSAWFQGNGLATPFEATNGRAFWNY--GAHDPEYNNLFNV  178

Query  460  AMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQ  281
            AMA D+RLVM+VV++ C   F+GL SL+DVGG TG  A  IA  FP LKC VFDLPHVV 
Sbjct  179  AMANDARLVMSVVLRECEATFQGLGSLVDVGGGTGAAAMAIADKFPQLKCIVFDLPHVVG  238

Query  280  GLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVI  101
             L G+KNLDY GGDMF  IP ADA+LLKWILHDWSD+E VKILK+C+E+IP  +KGG+VI
Sbjct  239  NLVGSKNLDYVGGDMFDFIPHADAVLLKWILHDWSDEECVKILKRCREAIPCTDKGGRVI  298

Query  100  IIDMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            IIDM++ +   ++E  ETQ+ FDMLMM LVTGR
Sbjct  299  IIDMVIGDNKMENELTETQLLFDMLMMGLVTGR  331



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   349 bits (896),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 214/294 (73%), Gaps = 22/294 (7%)
 Frame = -1

Query  880  SLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTE-  704
            SLKCA+QL IPDIIH HG+PM+L +LV  LP++  +S  + RLMR L+HSGF    + + 
Sbjct  2    SLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQ  61

Query  703  GSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHG  524
            G ++EG                   PLVLA+LDPILT+PWH +  WFQNDDPTPF T + 
Sbjct  62   GKEEEG-------------------PLVLAMLDPILTKPWHYLSAWFQNDDPTPFHTAYE  102

Query  523  MTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVAT  344
             + WDY  A  EP++N+ F +AMA D+RL+ +V++K  +GVF GLNSL+DVGG TG VA 
Sbjct  103  RSFWDY--AGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAGLNSLVDVGGGTGKVAK  160

Query  343  IIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQES  164
             IA+AFPHL CTV DL HVV GL+G+KNL+Y  GDMF +IPPADA+LLKWILHDWS++E 
Sbjct  161  AIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSNEEC  220

Query  163  VKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            VKILK+C+E+IPSKE GGKVIIIDM++     D +S ETQ+FFDM MMI   GR
Sbjct  221  VKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGR  274



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   351 bits (901),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/326 (54%), Positives = 241/326 (74%), Gaps = 7/326 (2%)
 Frame = -1

Query  967  LPLIAEKDS-EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            + ++ +K S E+L+++  IW  +LN IN  SLKCA +L IPD+IHKHG PM+L +LV+AL
Sbjct  1    MEMVNQKQSLELLEAEAQIWKQMLNCINPMSLKCATELGIPDVIHKHGGPMTLLELVDAL  60

Query  790  P-INNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLA  614
            P ++ AK+  + RLMR L+HSGFFV+ K   S++EGY+L P S LL+ D+P+S++P V  
Sbjct  61   PGVDKAKADCMYRLMRILVHSGFFVLEKINSSNEEGYSLTPASRLLVGDHPMSMKPYVSQ  120

Query  613  ILDPILTQPWHNIIEWFQN-DDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSR  440
            I  PIL  P H+   WFQ+ ++PTPF TV+ GM+LW+     + P  +HLF  +MA D+ 
Sbjct  121  I-HPILLDPMHHWSRWFQDANNPTPFHTVNNGMSLWEL--KERHPGFSHLFDQSMASDTS  177

Query  439  LVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKN  260
            +V +V+ + CR VFEGL+SL+DVGG TGT+A  IA AFP + CTV DL  VV G++GTKN
Sbjct  178  VVADVITRDCRQVFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKN  237

Query  259  LDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVD  80
            L Y  G+MF  IPP+DA+LLKWILHDWSD++SV+ILKKCKE+I S  K GKVI+I+M+VD
Sbjct  238  LKYIEGNMFEYIPPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKVILIEMVVD  297

Query  79   NRIKDDESVETQIFFDMLMMILVTGR  2
            +   + ESVETQ+ FDM+MM L+ G+
Sbjct  298  DERSNTESVETQLQFDMIMMTLLGGK  323



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 238/315 (76%), Gaps = 5/315 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +++L +QT ++NHI +FINS SLKCA++L IPD+IH +GQP+ L++L++ LPI+ +K+  
Sbjct  10   AKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGD  69

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            + RLMR L HSGFF ++K +   +  Y L   S LLLKD+P S+  L+  IL PIL++PW
Sbjct  70   IHRLMRVLTHSGFFNVSKND--LEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPW  127

Query  583  HNIIEWFQNDDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            + +  W++NDDP+PF T + G+  WDY  A  +P  N+LF +AMA ++RL  +VV+  C+
Sbjct  128  YQLSNWYKNDDPSPFHTENNGVAFWDY--AGHDPNHNNLFNEAMACETRLASSVVMGKCK  185

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGL SL+DVGG  GT+  +IA +FP+++C VFDLPHVV GL+G++NL Y GGDMF +
Sbjct  186  GVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEA  245

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IPP  ++LLK +LHDW+D+E +KILKKCKE+I +K K GKVIIID ++ N  +D+ES+E 
Sbjct  246  IPPTHSILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKEDNESIEA  305

Query  46   QIFFDMLMMILVTGR  2
            Q+F+D+ MM+LV G+
Sbjct  306  QLFYDLEMMVLVNGK  320



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 232/324 (72%), Gaps = 7/324 (2%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P+  +K +E+  +QTH++  + N++NS SL CA QL IPDIIH HG+P++L +LV+AL I
Sbjct  18   PIQEQKATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELVSALHI  77

Query  784  NNAKSTHLARLMRTLIHSGFFVITKT---EGSDDEGYALAPPSILLLKDNPLSIRPLVLA  614
               KS+ + RLMR L+HSGFF  TK    +G  +E Y L PPS LL+KDN   + P  ++
Sbjct  78   PPNKSSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPPSQLLVKDNTNCLSPF-MS  136

Query  613  ILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLV  434
            +++P    PWH++ +WF+  +PT F   +GM  W+Y    + P++N LF  AMA DS++ 
Sbjct  137  LINPAFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEY--NNQNPELNGLFNAAMACDSQM-  193

Query  433  MNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLD  254
            MN+VI+ C+ +FEGL+S++DVGG TG++A II+  FPH+ CTV ++P V+  LEGT+NL 
Sbjct  194  MNLVIRDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGTENLK  253

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF  IP ADA+LLK I H WSD++ VKILKKCKE+I SKEKGGKVII+D++++ +
Sbjct  254  YVGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINEK  313

Query  73   IKDDESVETQIFFDMLMMILVTGR  2
              + E  ET++ FDMLMM++  G+
Sbjct  314  KDEHELTETKLLFDMLMMVVAAGK  337



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 228/330 (69%), Gaps = 4/330 (1%)
 Frame = -1

Query  985  KLKMALLPLIAEKD-SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLT  809
            K+K   + L+ E++  E++ +QTHIWN   +FI S SLKCAVQL IPDII+ HGQPM+L+
Sbjct  10   KIKNNQMELVNEENIDELIKAQTHIWNETFHFIKSMSLKCAVQLGIPDIINSHGQPMTLS  69

Query  808  QLVNALPINNAKSTHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSI  632
            +LV AL +   K+ HL RLMR L+ SGFF +   ++    EGY L P S LLL+++    
Sbjct  70   ELVLALQVRPTKTHHLYRLMRVLVRSGFFNLQNASDNYSQEGYILTPASRLLLQNSSFDT  129

Query  631  RPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMA  452
            RP +  +LDPI+T+P++++  + +NDD TPFVT    TLW    A  E ++NHL  D MA
Sbjct  130  RPFISLVLDPIITEPYNSLTSFLRNDDLTPFVTAFKDTLWGC--AGNEARINHLVNDCMA  187

Query  451  RDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLE  272
             DS ++   VI  C+ VFEGLNSL+DVGG TG +A  IA  FP+LKCTV DLPHVV  L+
Sbjct  188  SDSSVIGRAVIIKCKEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQ  247

Query  271  GTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIID  92
            G  NL + GGDMF ++PPADA+LLKWILHDW D+E +KILK CKE+I  K K GKV+IID
Sbjct  248  GINNLSFLGGDMFQAVPPADAILLKWILHDWPDEECIKILKNCKEAISRKGKEGKVMIID  307

Query  91   MMVDNRIKDDESVETQIFFDMLMMILVTGR  2
            +++  +  DD   E Q+ FDM MM+ V G+
Sbjct  308  IVMGYQTWDDSLTEAQLLFDMKMMVAVMGK  337



>emb|CDP20220.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   346 bits (888),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 204/271 (75%), Gaps = 5/271 (2%)
 Frame = -1

Query  976  MALLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN  797
            M L   I +   E+  +Q HIW+HI NFINS SLKCA+QL IPD+IHKHGQPM+L QL++
Sbjct  1    MDLARNIGDHTGELFQAQAHIWSHIFNFINSMSLKCAIQLGIPDVIHKHGQPMTLDQLID  60

Query  796  ALPINNAKSTHLARLMRTLIHSGFFVITKTEGSDDE---GYALAPPSILLLKDNPLSIRP  626
            ALPI NAK+T + RLM+ LIHSGFF+  K  G++++   GY L P S LLLK NP S+ P
Sbjct  61   ALPIKNAKATFIYRLMQNLIHSGFFIEAKIPGNENDNQKGYLLTPASELLLKSNPFSVTP  120

Query  625  LVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARD  446
             +LA+LDP LT PWH++ +WFQN D TPF T HG +L+D+  A  EP++N  F  AMA D
Sbjct  121  FLLAMLDPTLTDPWHHLSQWFQNSDETPFYTCHGRSLYDF--ASHEPRINQFFNKAMASD  178

Query  445  SRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGT  266
            +RLV +VV K C+ VFEGLNSL+DVGG TGT+A  IA AFP LKCTV DLPHVV GLE +
Sbjct  179  ARLVSSVVTKDCKHVFEGLNSLVDVGGGTGTLAKAIADAFPSLKCTVLDLPHVVDGLESS  238

Query  265  KNLDYAGGDMFVSIPPADALLLKWILHDWSD  173
            KNL Y GG+MF +IPPA+A+L+KWIL DWSD
Sbjct  239  KNLAYVGGNMFEAIPPANAVLMKWILIDWSD  269



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 229/315 (73%), Gaps = 10/315 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            AE  +E+L +Q H+ N +LNF  S SLKCA++L IP+ I++HG+P++L++LV+ALP+N +
Sbjct  4    AENLTELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPS  63

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K++H+ RLMR L  +GFFV+       D+ YAL     LLLKD+P ++R L+  + DP+L
Sbjct  64   KASHIYRLMRFLSKAGFFVL------QDQCYALTAAGRLLLKDDPFNLRALIFFMSDPVL  117

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
             +PW+++ EWF+NDDP PF T HG   W   YA +EP   + F +AMA DS  ++ V++ 
Sbjct  118  VKPWNSLTEWFRNDDPAPFDTAHGKNFW--AYAAEEPNFANRFNEAMANDSTFIVQVMMT  175

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VF+GL SL+DVGG TGTVA  IA  FP+L+C V DLPHV+   EGT+NLD+  GDM
Sbjct  176  RCKFVFDGLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEGTENLDFVAGDM  235

Query  235  FVSIPPADALLLKW--ILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD  62
               +P ADA+LLK    +HDWSD++ VKILK CKE+IP + KGG+VIIIDM+++++IKDD
Sbjct  236  LEKVPTADAILLKKPDSIHDWSDEDCVKILKNCKEAIPGRNKGGRVIIIDMILESQIKDD  295

Query  61   ESVETQIFFDMLMMI  17
            ESVETQ+  DM M++
Sbjct  296  ESVETQVGMDMQMLM  310



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/320 (53%), Positives = 235/320 (73%), Gaps = 5/320 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INNA  776
            E+ SE+L++Q HIWN + ++INS SLKCA +L IPDIIHKHG+PM+LT+LV+ALP  +  
Sbjct  208  ERSSELLEAQAHIWNQVFSYINSMSLKCATELGIPDIIHKHGRPMTLTELVDALPGADKP  267

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K+  + RLMR L+HSGFFV+ K +  + E Y+L P S LL+ D+ +S++  VL+ LDPIL
Sbjct  268  KADCVYRLMRILVHSGFFVLEKIDSCNKEAYSLTPASRLLIGDHTMSMKAYVLSQLDPIL  327

Query  595  TQPWHNIIEWFQNDD-PTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            T+PW ++  WFQN +  T F T + G ++W+     + P+ +HLF   MA D+ +V + +
Sbjct  328  TEPWQHLSRWFQNTEYHTAFHTANNGTSIWEQ--KERNPRFSHLFDQGMACDTPMVADAI  385

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
             + CR VFEGL+S++DVGG TGT+A  IA AFP + C V +L  V+ GL+GT+NL+Y  G
Sbjct  386  TRDCRQVFEGLDSIVDVGGGTGTLAKAIAEAFPQIHCLVLELAPVIAGLQGTRNLEYVEG  445

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDD  62
            DMF  IPPADA++LKWILHDWSD+E V ILKKCK +I S  K GKV+II+M++D++  D 
Sbjct  446  DMFEYIPPADAVVLKWILHDWSDEECVGILKKCKAAITSNGKRGKVVIIEMVLDDQNADH  505

Query  61   ESVETQIFFDMLMMILVTGR  2
            +SVETQ+F DMLMM ++ GR
Sbjct  506  KSVETQLFIDMLMMTILRGR  525



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 230/325 (71%), Gaps = 8/325 (2%)
 Frame = -1

Query  964  PLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI  785
            P+  +K++E+  +QTH++  + N++NS SL CA QL IPDIIH HG P++L +LV+AL I
Sbjct  18   PIQEQKETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHI  77

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDEG----YALAPPSILLLKDNPLSIRPLVL  617
               K++ + RLMR L+HSGFF  T+      EG    Y L PPS LL+KDN   + P  +
Sbjct  78   PPNKTSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-M  136

Query  616  AILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRL  437
            ++++P    PWH++ +WF+  +PT F   +GM  W+Y    + P++N LF  AMA DS++
Sbjct  137  SLINPAFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEY--NNQNPELNCLFNAAMACDSQM  194

Query  436  VMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNL  257
             MN+VI+ C+ +FEGL+S++DVGG TG++A II+  FPH+KCTV + P V+  LEGT+NL
Sbjct  195  -MNLVIRDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGTENL  253

Query  256  DYAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDN  77
             Y GGDMF  IP ADA+LLK I H WSD++ VKILKKCKE+I SKEKGGKVII+D++++ 
Sbjct  254  KYVGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINK  313

Query  76   RIKDDESVETQIFFDMLMMILVTGR  2
            +  + E  ET++ FDMLMM++  G+
Sbjct  314  KKDEHELTETKLLFDMLMMVVAAGK  338



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 223/319 (70%), Gaps = 7/319 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            A   SE+L +Q  +WN   N++NS SLKCAV+L+I DIIH HGQP +L+Q+ +AL I   
Sbjct  204  AASSSELLKAQAQVWNCTFNYVNSMSLKCAVELDIADIIHSHGQPTTLSQIASALNIKPN  263

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K   +  +MR L+HSGFF   K    DD+ Y L P S LLLKD PL   P V  + DP+ 
Sbjct  264  KVQCIQSVMRILVHSGFFAQQK----DDDEYFLTPASRLLLKDTPLKAAPFVDLVADPLY  319

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T  +H +  W QNDDPT F T HG   WD +    EPK   LF D M  DS L+  +VIK
Sbjct  320  TTAFHYLGTWLQNDDPTLFETAHGKNFWDRV--ADEPKFKSLFYDLMITDSELIARIVIK  377

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK-NLDYAGGD  239
             C+ VFEGL SL+DV G TGT+A  IA AFP +KCTVFDLPHVV  L+GT  NLD+ GG+
Sbjct  378  DCKEVFEGLKSLVDVAGGTGTMARAIAAAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGN  437

Query  238  MFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDE  59
            MF +IP A+A+LLK ILH+W+D+ESVK+LKKCKE+IPSK++GGKVIIIDM ++N+ +D E
Sbjct  438  MFEAIPQANAVLLKGILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKE  497

Query  58   SVETQIFFDMLMMILVTGR  2
            S+ETQ+ FD+LM+ L  G+
Sbjct  498  SMETQLCFDILMVSLFRGK  516



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 227/324 (70%), Gaps = 9/324 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  SE+  +Q+H++ HI NFINS +LKCAV+L IPDIIH H  P+SL QLV+AL +   
Sbjct  6    GEGGSELFQAQSHMYKHIFNFINSMALKCAVELGIPDIIHTHNHPISLPQLVSALHLPPT  65

Query  775  KSTHLARLMRTLIHSGFFVITK---TEGSDDEGYALAPPSILLL---KDNPLSIRPLVLA  614
            K+ ++ RLMR L+HSGFF   K    +  +DEGY L   S LLL    +N  ++   VLA
Sbjct  66   KTRYVNRLMRVLVHSGFFATAKVHENQEEEDEGYVLTTSSRLLLSKDNNNVPNLSAFVLA  125

Query  613  ILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLV  434
            +LDP+L  PWH + +WF+ +D T F T HG + WDY     + K  +LF +AMA DSR+ 
Sbjct  126  MLDPVLVTPWHFLGDWFRGNDLTAFDTAHGKSFWDY--GSHDHKFFNLFNEAMASDSRM-  182

Query  433  MNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLD  254
            M++VIK CR VFEGL SL+DVGG  G +A II+ AFP LKCTVFDLPHVV       NL 
Sbjct  183  MSLVIKDCRPVFEGLGSLVDVGGGKGLIARIISEAFPQLKCTVFDLPHVVSNFPECGNLK  242

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNR  74
            Y GGDMF S+P ADA+LLK +LH  SD+E VKILKKC+E+IPSKEKGGKVI+ID++++ +
Sbjct  243  YVGGDMFQSVPTADAILLKLVLHSLSDEECVKILKKCREAIPSKEKGGKVIVIDIVINEK  302

Query  73   IKDDESVETQIFFDMLMMILVTGR  2
             ++ +  E ++ FD+LMM +VTGR
Sbjct  303  KEEHDITEAKLLFDLLMMTVVTGR  326



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 216/317 (68%), Gaps = 2/317 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E++ +QTHI N   +FI S SLKCAVQL IPD I+ HGQPM+L++LV AL ++  K
Sbjct  7    ENTDELIKAQTHIRNETFHFIKSMSLKCAVQLGIPDTINSHGQPMTLSELVRALQVHPTK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + HL  LMR L+HSGFF +     +  + Y L P S LLLKD+    RP +  +LDPI+T
Sbjct  67   THHLYCLMRVLVHSGFFNLQNASDNYSQKYVLTPASRLLLKDSSFDTRPFISLVLDPIMT  126

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +P++++  + +NDD TPFVT  G+TLW Y     E + NHL  D MA DS ++   VI  
Sbjct  127  EPYNSLTPFLRNDDLTPFVTAFGVTLWGY--TGNEARANHLVNDCMASDSSVIGRAVIIK  184

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+ VFEGLNSL+DVGG TG +A  IA  FP+LKCTV DLPHVV  L+G  NL + GGDMF
Sbjct  185  CKEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLGGDMF  244

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESV  53
              +PPADA+LLKWILHDW D+E +KILK CKE+I  K K GKV+II +++ N+  DD   
Sbjct  245  QPVPPADAILLKWILHDWPDEECIKILKNCKEAISRKGKEGKVMIIGIVMGNQSPDDSLT  304

Query  52   ETQIFFDMLMMILVTGR  2
            E Q+ FDM MM+   G+
Sbjct  305  ELQLLFDMEMMVAAMGK  321



>ref|XP_006364110.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=267

 Score =   343 bits (880),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 206/268 (77%), Gaps = 10/268 (4%)
 Frame = -1

Query  970  LLPLIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            ++P++ E ++EIL +QTHIWNHI +FINS SLK A+QL IPDIIHKHG+PM+L +L NAL
Sbjct  2    VVPIVGEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANAL  61

Query  790  PINNAKSTHLARLMRTLIHSGFFV--------ITKTEGSDDEGYALAPPSILLLKDNPLS  635
             IN +K THL RLMR LIHSGFF+           +   + EGY LAPP+ LLLKD PL+
Sbjct  62   SINKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLT  121

Query  634  IRPLVLAILDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAM  455
            + P +LA+LDPIL +PWH++ EWF +D+PTPF   HG T WDY  A  E ++NH F DAM
Sbjct  122  VTPFLLAMLDPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDY--AGHEQRLNHFFNDAM  179

Query  454  ARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGL  275
            A D++LVM+VV+KY + VFEGLNS++DVGG TGTVA  IA  FP+L+CTVFDLPHVV+GL
Sbjct  180  ASDAKLVMSVVMKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGL  239

Query  274  EGTKNLDYAGGDMFVSIPPADALLLKWI  191
            EG+ NL Y GGD FVS+PPADALLLK I
Sbjct  240  EGSDNLSYVGGDFFVSVPPADALLLKVI  267



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 238/316 (75%), Gaps = 6/316 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +++L +QT ++NHI +FINS SLKCA++L IPD+IH +GQP+ L++L++ LPI+ +K+  
Sbjct  24   AKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGD  83

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            + RLMR L HSGFF ++K +   +  Y L   S LLLKD+P S+  L+  IL PIL++PW
Sbjct  84   IHRLMRVLTHSGFFNVSKND--LEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPW  141

Query  583  HNIIEWFQNDDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
            + +  W++NDDP+PF T + G+  WDY  A  +P  N+LF +AMA ++RL  +VV+  C+
Sbjct  142  YQLSNWYKNDDPSPFHTENNGVAFWDY--AGHDPNHNNLFNEAMACETRLASSVVMGKCK  199

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
            GVFEGL SL+DVGG  GT+  +IA +FP+++C VFDLPHVV GL+G++NL Y GGDMF +
Sbjct  200  GVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEA  259

Query  226  IPPADALLLK-WILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVE  50
            IPP  ++LLK  +LHDW+D+E +KILKKCKE+I +K K GKVIIID ++ N  +D+ES+E
Sbjct  260  IPPTHSILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKEDNESIE  319

Query  49   TQIFFDMLMMILVTGR  2
             Q+F+D+ MM+LV G+
Sbjct  320  AQLFYDLEMMVLVNGK  335



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 226/323 (70%), Gaps = 11/323 (3%)
 Frame = -1

Query  961  LIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHG-QPMSLTQLVNALPI  785
            ++A    E+L++Q+H+WNHI NFINS SLKCA+QL IPD IH HG  P+ L+ LV++L +
Sbjct  8    MLAMGGDELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQL  67

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            +  K+  + RLMR L HSGFFV        +EGY L   S LLLKDNP ++ P +L++L 
Sbjct  68   HPNKTQFIYRLMRLLTHSGFFV------QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQ  121

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P LT PW  +  WFQ DD TPF T HG+  W Y+  R +PK   +F   MA D+RLV+NV
Sbjct  122  PALTDPWQFLSIWFQTDDQTPFETAHGVPFWKYM--RNKPKEGEVFNAGMASDARLVINV  179

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK-NLDYA  248
            +++  R VFEG+ SL+DVGG TGTVA  I+ AFP ++CTV DLP VV  L+G + N  Y 
Sbjct  180  LLEKHRSVFEGVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYV  239

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIP-SKEKGGKVIIIDMMVDNRI  71
             GDMF  IPPAD +LLKWILHDWSD+E V+ILKKCKE+I  S  K GKV++ID+++ N  
Sbjct  240  EGDMFTLIPPADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTK  299

Query  70   KDDESVETQIFFDMLMMILVTGR  2
             D +S+ETQ+ +DMLMMI+  G+
Sbjct  300  NDADSIETQLLYDMLMMIVPGGK  322



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 226/323 (70%), Gaps = 11/323 (3%)
 Frame = -1

Query  961  LIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHG-QPMSLTQLVNALPI  785
            ++A    E+L++Q+H+WNHI NFINS SLKCA+QL IPD IH HG  P+ L+ LV++L +
Sbjct  8    MLAMGGDELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQL  67

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            +  K+  + RLMR L HSGFFV        +EGY L   S LLLKDNP ++ P +L++L 
Sbjct  68   HPNKTQFIYRLMRLLTHSGFFV------QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQ  121

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P LT PW  +  WFQ DD TPF T HG+  W Y+  R +PK   +F   MA D+RLV+NV
Sbjct  122  PALTDPWQFLSIWFQTDDQTPFETAHGVPFWKYM--RNKPKEGEVFNAGMASDARLVINV  179

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK-NLDYA  248
            +++  R VFEG+ SL+DVGG TGTVA  I+ AFP ++CTV DLP VV  L+G + N  Y 
Sbjct  180  LLEKHRSVFEGVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYV  239

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIP-SKEKGGKVIIIDMMVDNRI  71
             GDMF  IPPAD +LLKWILHDWSD+E V+ILKKCKE+I  S  K GKV++ID+++ N  
Sbjct  240  EGDMFTLIPPADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTK  299

Query  70   KDDESVETQIFFDMLMMILVTGR  2
             D +S+ETQ+ +DMLMMI+  G+
Sbjct  300  NDADSIETQLLYDMLMMIVPGGK  322



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/315 (52%), Positives = 223/315 (71%), Gaps = 9/315 (3%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L + T IWNHI NF++S + KCAVQL IPD+++KHG+ M L+ L  ALP+N +K + 
Sbjct  9    TELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALPLNPSKISF  68

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            L  L+R+L+HSGF          ++ Y+L P S L LKD+PLS+R   L + DP + +PW
Sbjct  69   LPILIRSLVHSGFL------NEHEDYYSLTPASRLFLKDDPLSMRSYFLIMHDPCVQKPW  122

Query  583  HNIIEWFQNDDPTPFVTVH-GMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCR  407
              +  WFQND PT F   H G + WDY     EP+VN++F D+MA DS L+ NV+I  C+
Sbjct  123  FELSSWFQNDFPTAFHAAHNGKSFWDYF--ADEPRVNNIFNDSMANDSSLIANVLITECK  180

Query  406  GVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVS  227
             VFEGL SL+DVGG TGT+A  IA AFP + CTV DLPHV+  L+G+ NL++ GG MF  
Sbjct  181  HVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSGNLEFVGGSMFEK  240

Query  226  IPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVET  47
            IP A+A+LLKWILH+W D++ VKILKKCKESIPS+EKGGKVIIID++++N  + D+SV  
Sbjct  241  IPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVIIIDIVLENPKQKDDSVRA  300

Query  46   QIFFDMLMMILVTGR  2
            Q   D++MM+L   +
Sbjct  301  QHNMDLVMMVLFGAK  315



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 229/321 (71%), Gaps = 8/321 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            +K +E+  + TH+ + + N+INS SL CA QL IPDIIH HG+P++L  LV+AL I   K
Sbjct  8    QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNK  67

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEG----YALAPPSILLLKDNPLSIRPLVLAILD  605
            ++ + RLMR L+HSGFF  TK      EG    Y L PPS LL+KDN   + P  +++++
Sbjct  68   TSIIYRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P    PW ++ +WF+ ++PT F   +GM  W+Y    + P++N LF +AMA DS++ MN+
Sbjct  127  PAFVTPWLSLGDWFRGNEPTAFEHAYGMAFWEY--HNQNPELNRLFNEAMACDSQM-MNL  183

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI+ C+ +FEGLNS++DVGG TG+++ II+ AFPH+ CTV +LP V+  LEGTKNL+Y G
Sbjct  184  VIRDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVG  243

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF  IP ADA+LLK I H WSD++ +KILKKCKE+I SKEKGGKVII+D+++D +  +
Sbjct  244  GDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKVIIVDVVIDEKKDE  303

Query  64   DESVETQIFFDMLMMILVTGR  2
             E  ET++ FDMLMM++  G+
Sbjct  304  KELTETKLLFDMLMMVVAAGK  324



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 228/322 (71%), Gaps = 8/322 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             E  +E+L +  HIWNH  NF+ S SLKCA++L IPDIIH HGQPM+L+ LV+AL I  +
Sbjct  6    GESTNELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQS  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            KS H+ RLM+ L+ SGFF + K   SD+ GY L   S+LL+K++P++ RP VLA+LDPIL
Sbjct  66   KSHHIHRLMQVLVQSGFFSLQKV--SDENGYLLTQSSLLLVKEHPVTARPYVLAVLDPIL  123

Query  595  TQPWHNIIEWFQNDD---PTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            T+PWH +  WFQN D    TPF   H    WD   A  E + N  F +AMA DS +V  V
Sbjct  124  TKPWHFLSSWFQNTDDKETTPFSVAHEQKFWDL--ASNEDRFNKFFNEAMASDSSIVKQV  181

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI  C+ VF+GL SL+DVGG+TG +   IA  FP+LKCTV DLPHVV GL+GTKNL+Y G
Sbjct  182  VISNCKEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGTKNLNYIG  241

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKG-GKVIIIDMMVDNRIK  68
            G+MF  IPPADA+LLK I H   D++ +K+LKKCKE++ + E+G GKVIIID+++++   
Sbjct  242  GNMFEFIPPADAILLKMICHILDDEDCLKLLKKCKEAVMNNEEGSGKVIIIDIVMESPNW  301

Query  67   DDESVETQIFFDMLMMILVTGR  2
             D++ ET   +D+ M++LV+G+
Sbjct  302  VDKATETIQLYDLEMLVLVSGQ  323



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 228/321 (71%), Gaps = 8/321 (2%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            +K +E+  + TH+ + + N+INS SL CA QL IPDIIH HG+P++L  LV+AL I   K
Sbjct  8    QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNK  67

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEG----YALAPPSILLLKDNPLSIRPLVLAILD  605
            ++ + RLMR L+HSGFF  T+      EG    Y L PPS LL+KDN   + P  +++++
Sbjct  68   TSIIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P    PW ++ +WF+ ++PT F   +GM  W+Y    + P++N LF +AMA DS++ MN+
Sbjct  127  PAFVTPWLSLGDWFRGNEPTAFEQAYGMAFWEY--HNQNPELNRLFNEAMACDSQM-MNL  183

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI+ C+ +FEGLNS++DVGG TG+++ II+ AFPH+ CTV +LP V+  LEGTKNL+Y G
Sbjct  184  VIRDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVG  243

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF  IP ADA+LLK I H WSD++ +KILKKCKE+I SK KGGKVII+D+++D +  +
Sbjct  244  GDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKGKGGKVIIVDVVIDEKKDE  303

Query  64   DESVETQIFFDMLMMILVTGR  2
             E  ET++ FDMLMM++  G+
Sbjct  304  KELTETKLLFDMLMMVVAAGK  324



>ref|XP_011091734.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=337

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 218/318 (69%), Gaps = 23/318 (7%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E  SE+L++  HIWN + ++INS SLKC  +L IP+IIHKH                   
Sbjct  7    ELRSELLEAGAHIWNQVFSYINSMSLKCVTELGIPEIIHKH-------------------  47

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
              H+ RLM+T++HSGFFV+ K + SD++GY L P S LL+ D+P+S++  VL+ LD +L 
Sbjct  48   -DHVRRLMQTVVHSGFFVLEKVDSSDEQGYWLTPASRLLIGDHPMSMKAFVLSQLDSVLC  106

Query  592  QPWHNIIEWFQN-DDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            +PW ++  WFQN  D T F   HGM+ W+     + P+   LF   M  D+ +V +V+ +
Sbjct  107  EPWQHLSGWFQNIKDRTAFHNTHGMSFWEL--KEQNPRFGLLFDQGMGNDTPMVADVIAR  164

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             CR VFEGL SL+DVGG TGT+A  IA AFP + CTV DL  VV GLEGT+NL Y  GDM
Sbjct  165  DCRQVFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPVVAGLEGTRNLKYVEGDM  224

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F  IPPADA+LLKWILHDWSD+E VKILK+CKE+I S EK GKV+II+M+VD++  D +S
Sbjct  225  FEYIPPADAVLLKWILHDWSDEECVKILKRCKEAIKSNEKRGKVVIIEMVVDDQNSDHKS  284

Query  55   VETQIFFDMLMMILVTGR  2
            VETQ+FFDMLMM +V G+
Sbjct  285  VETQLFFDMLMMTVVGGK  302



>ref|XP_003615968.1| O-methyltransferase [Medicago truncatula]
 gb|AES98926.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=326

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 216/321 (67%), Gaps = 35/321 (11%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            +   S +L +Q+HIWNHI NFINS SLKC V L IPDIIH +G+PM L++L+++LPI+ +
Sbjct  3    SHNSSTLLKAQSHIWNHICNFINSMSLKCVVDLGIPDIIHNYGKPMPLSKLISSLPIHPS  62

Query  775  KSTHLARLMRTLIHSGFFV---ITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            K + + RLM+ +  SGFF    +T+ E   D  Y L   SILLLKD+P+S+ P + A+L 
Sbjct  63   KKSCIYRLMQIMTQSGFFYEHDVTENELEID--YILTDESILLLKDHPMSVTPFLQAVLH  120

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            PIL  PWH +  W + DDP+ F T HGM++WDY                           
Sbjct  121  PILANPWHEMSGWLKTDDPSTFGTTHGMSMWDYA--------------------------  154

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
                C GVF GL SL+DVGG TGT+A  +A +FP L+CTVFDLPHVV GL+G  NL+Y G
Sbjct  155  ----CGGVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVDGLQGGDNLNYVG  210

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF  IPPADA+LLKWILHDW+D+E VKIL+ CK++I  K K GKVIIIDM+V+    +
Sbjct  211  GDMFKRIPPADAILLKWILHDWNDEECVKILRNCKDAIAKKGKEGKVIIIDMVVEKEKGN  270

Query  64   DESVETQIFFDMLMMILVTGR  2
             ES +TQ+FFDMLMM+L TG+
Sbjct  271  SESAKTQLFFDMLMMVLATGK  291



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 194/251 (77%), Gaps = 4/251 (2%)
 Frame = -1

Query  751  MRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPWHNI  575
            MR LIHSGFF   K +E   +EGY L   S LLLKDNP S+ P + A+LDPILT+PWH +
Sbjct  1    MRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVTPFLQAMLDPILTKPWHFV  60

Query  574  IEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFE  395
              W +NDDPTPF T HG T WDY     EP +NH F DAMA D+RLV  V++  C+ VFE
Sbjct  61   STWLKNDDPTPFDTAHGRTFWDY--GGHEPMLNHFFNDAMASDARLVTRVLVNECKEVFE  118

Query  394  GLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPA  215
            GL SL+DVGG TGTVA  +A AFPHL CTVFDLPHVV  L+G++NL Y GGDMF +IPPA
Sbjct  119  GLGSLVDVGGGTGTVAKSLAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPPA  178

Query  214  DALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQIFF  35
            D ++LKWILHDW+D+E V+ILKKCKE+I  +E GGKV+IIDMM++N+  +DES+ETQIFF
Sbjct  179  DGIVLKWILHDWNDEECVRILKKCKEAIKDRE-GGKVMIIDMMMENQKGEDESIETQIFF  237

Query  34   DMLMMILVTGR  2
            DMLMMILVTG+
Sbjct  238  DMLMMILVTGQ  248



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 224/316 (71%), Gaps = 4/316 (1%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
             E+LD+Q HIWNHI N INS +LK AVQL IPDIIHKH +PM+L+QL +A+PIN AKS  
Sbjct  11   QELLDAQAHIWNHIFNHINSMTLKWAVQLGIPDIIHKHDKPMTLSQLADAIPINRAKSDA  70

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            L R+MR L+HS FF   +T  +++E Y L   S LLL+D PLS+ P  LA+LD  L   +
Sbjct  71   LHRIMRILVHSKFFDRVRTLPNEEEAYCLTRASRLLLRDEPLSLTPFALAVLDEDLMGTF  130

Query  583  HNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRG  404
            H + EWF N+ P+P    H  ++ +  +A    + + LF + MA D+RLV +++ K  R 
Sbjct  131  HCVPEWFGNECPSPLEFKHEKSIRE--FAENNQRWSLLFNEGMANDARLVGSILAKESRK  188

Query  403  VFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSI  224
            VFEGL +++DVGG TG V+  I  AFP +K  V DLP+VV GL+G+ NL Y GGDMF S+
Sbjct  189  VFEGLETMVDVGGGTGMVSKAIVDAFPGMKGIVLDLPYVVSGLKGSGNLRYVGGDMFHSV  248

Query  223  PPADALLLKWILHDWSDQESVKILKKCKESIPSKE--KGGKVIIIDMMVDNRIKDDESVE  50
            PPADA+ LKWILH+WSD E +KIL+KCKE+I + +  KGGKVII+DM++    + DE+VE
Sbjct  249  PPADAVFLKWILHNWSDDECIKILEKCKEAITTSKNMKGGKVIIVDMILGYEKQQDEAVE  308

Query  49   TQIFFDMLMMILVTGR  2
            TQ+FFDM+MM  +TG+
Sbjct  309  TQLFFDMMMMTTLTGK  324



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 224/318 (70%), Gaps = 4/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             +  SE+ ++Q+ I+ H+ +F++S SLKCAVQL IPD IH H QP++L +L +A+ +   
Sbjct  6    GQGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPE  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K++ L +LMR L+HSGFF + K +  + EGY L PPS LL+K N  S+ P+VL +LDP+L
Sbjct  66   KTSRLHQLMRLLVHSGFFAMQKVD-ENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
              PWH +  W Q    T F   HGM LW+Y    + P+   L  + MA DSR+ M++ I+
Sbjct  125  VTPWHFLGSWLQGSSLTAFEAAHGMDLWNY--GNQNPEFFSLIGEIMATDSRM-MSLAIR  181

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ +FEGL+SL+DVGG TGT+A  I  AFPHLKCTV DLP VV  L  ++NLDY GGDM
Sbjct  182  ECKEIFEGLSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDM  241

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F SIP ADA+ +K +LH+W D++ VKILK+C+E+IPS  +GGKVIIID+++ N+  + E 
Sbjct  242  FQSIPSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKKDEHEL  301

Query  55   VETQIFFDMLMMILVTGR  2
             +T++F DM+MM+LV G+
Sbjct  302  AKTKLFNDMMMMVLVAGK  319



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 243/325 (75%), Gaps = 10/325 (3%)
 Frame = -1

Query  967  LPLIAEKDS-EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNAL  791
            + LI E  + E+L +QTH+WNHI NFINS +LKCAVQL IPD+I KHG+PM+L++LV+AL
Sbjct  1    MELIDEGSAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSAL  60

Query  790  PINNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAI  611
            PI+ +K+ ++ RLMR L+H+GFF     +  + E Y+L   + LLLKDNPLS+RPL+L +
Sbjct  61   PIHPSKAQYVHRLMRILVHAGFF---SQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLLML  117

Query  610  LDPILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVM  431
            LDP+LT+P   +  WFQND+ T F   H  TLW+  YA ++P++++LF +AMA DS L  
Sbjct  118  LDPVLTKPHDCLSTWFQNDEATAFSVAHERTLWE--YAGQDPRLSNLFNEAMASDSILAS  175

Query  430  NVVIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLE-GTKNLD  254
             +V+  C+G+FEG+NSL+DVGG +GT+A  IA AFPH+ CTVFDLP VV  L+ G+KNL 
Sbjct  176  KLVVSKCQGIFEGVNSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGSKNLK  235

Query  253  YAGGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVD  80
            Y GGDMF ++PPAD +LLKW LHDW+D++ VKILK+CK +I SK  +K GKVIIID +V 
Sbjct  236  YVGGDMFEAVPPADVILLKWTLHDWNDEDCVKILKQCKHAIMSKGQQKAGKVIIID-IVR  294

Query  79   NRIKDDESVETQIFFDMLMMILVTG  5
                 DES ETQ+ +D+ MM+ VTG
Sbjct  295  GSQNGDESNETQLLWDLEMMVTVTG  319



>gb|ACV65500.1| deoxyhemigossypol-6-O-methyltransferase [Gossypium hirsutum]
Length=365

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/325 (52%), Positives = 226/325 (70%), Gaps = 9/325 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALP-INN  779
             E   E L +  HIW H  NF++  SLKCA+ L I DIIH HG+PM++TQLV AL  +N 
Sbjct  8    GEDAIEALQAHAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVGALQMLNP  67

Query  778  AKSTHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
             K+  + RLM  L+HS FF   K +  + +EGY L   S +LLK+NP  I P + A +DP
Sbjct  68   TKACDIYRLMHILVHSDFFARQKLDNDAQEEGYVLTNSSRILLKNNPFCITPTLKATMDP  127

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            I+T+PW  +  WFQNDD TPF T +G TLWDY     +P++  L  D +A DS+LV +V+
Sbjct  128  IITKPWSFLGTWFQNDDHTPFATAYGKTLWDYF--THDPQLKDLINDGLASDSQLVTSVL  185

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            +  C+G FEGL SL+DVGG TGT A  IA  FPH++CTVFDLPH+V GL+G+KNL Y GG
Sbjct  186  VDKCKGAFEGLESLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVGG  245

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEK-GGKVIIIDMMV-DNRIK  68
            +MF + P  DA+LLK +LHDW+D+  + ILK+CKE+I S++K G K+IIIDM+V +N   
Sbjct  246  NMFEAFPTGDAILLKKVLHDWNDKGCLTILKRCKEAISSQDKVGRKLIIIDMVVRENEQV  305

Query  67   DDES---VETQIFFDMLMMILVTGR  2
            +DE+    +TQ+FFDMLM++LV G+
Sbjct  306  NDEASSLTKTQLFFDMLMLVLVAGK  330



>gb|AJD20223.1| norcoclaurine 6-O-methyltransferase [Podophyllum peltatum]
Length=373

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 227/322 (70%), Gaps = 11/322 (3%)
 Frame = -1

Query  940  EILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQ-PMSLTQLVNALPINNAKSTH  764
            E+L +Q HIWNHI NFI++ SLKCAVQL IP+IIH H Q P++L QLV AL I   KS +
Sbjct  19   ELLAAQAHIWNHIFNFISTMSLKCAVQLNIPEIIHNHPQKPITLAQLVQALQIPETKSIY  78

Query  763  LARLMRTLIHSGFFVITKTEGSDDE-----GYALAPPSILLLKDNPLSIRPLVLAILDPI  599
            L RLMR L+HS FF I + + + +E     GY L   S LL K++P+S+   +L + DPI
Sbjct  79   LYRLMRILVHSRFFGIERIQETAEEQVEEEGYVLTLSSKLLRKNHPVSMSLYLLCLSDPI  138

Query  598  LTQPWHNIIEWFQNDDP--TPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            +  P H + +WF+  D   TPF    GM  W Y    +E     LF  +MA D+++VM++
Sbjct  139  MVTPCHFLSDWFKKTDELITPFEATQGMPFWKYFGDNQES--GKLFDKSMACDAKMVMSI  196

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            V+K C+  FEG+ SL+DVGG TGTVA +IA A P +KCTV DLPHVV  L+G+KNL++  
Sbjct  197  VLKECKMKFEGIMSLVDVGGGTGTVARVIAEAVPGVKCTVLDLPHVVGTLQGSKNLEFVS  256

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF SIP AD  LLK I+HDWSD E V ILK+CKE+IPSKE GGKVIIIDM+VD++ K+
Sbjct  257  GDMFESIPSADVALLKSIMHDWSDDECVMILKRCKEAIPSKEAGGKVIIIDMVVDDKNKN  316

Query  64   D-ESVETQIFFDMLMMILVTGR  2
              ES ETQ+FFDMLMM+L+TG+
Sbjct  317  HYESTETQLFFDMLMMVLITGK  338



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 222/322 (69%), Gaps = 11/322 (3%)
 Frame = -1

Query  961  LIAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHG-QPMSLTQLVNALPI  785
            ++A    E+L++Q+HIWNHI NFINS SLKCA+QL IPD IH HG  P+ L+ LV++L +
Sbjct  33   MLAMGGDELLEAQSHIWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQL  92

Query  784  NNAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            +  K+  + RLMR L HSGFFV        +EGY L   S LLLKDNP ++ P +L++L 
Sbjct  93   HPNKTQFIYRLMRLLTHSGFFV------QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQ  146

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
            P LT PW  +  WFQ DD TPF T HG+  W Y+  R +PK   +F   MA D+RLV +V
Sbjct  147  PALTDPWQFLSIWFQTDDQTPFETAHGVPFWKYM--RNKPKEGEVFNAGMASDARLVNSV  204

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTK-NLDYA  248
            ++   + VFEG+ SL+DVGG TGT+A  I+ AFP ++CTVFDLP VV  L G + NL+Y 
Sbjct  205  LLGKHKSVFEGVKSLVDVGGGTGTMAKAISQAFPQMECTVFDLPQVVAHLRGDQPNLNYV  264

Query  247  GGDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK  68
             GDMF  IPPAD LLLKWILHDWSD+E V+ILK CK +I S    GKV++ID+++    K
Sbjct  265  EGDMFKRIPPADVLLLKWILHDWSDEECVEILKNCKAAIRSNGNKGKVMVIDIVLFGNYK  324

Query  67   DDESVETQIFFDMLMMILVTGR  2
             D S+ETQ+ FDMLMM LV G+
Sbjct  325  KD-SMETQLLFDMLMMTLVGGK  345



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 237/318 (75%), Gaps = 8/318 (3%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            E   E+L +QTH+WNHI  FINS +LKCAVQL IPD+I KHG+PM+L++LV+ALPI+ +K
Sbjct  7    ESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  772  STHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILT  593
            + ++ RLMR L+HSGFF     +  + E Y+L   + LLLKDNPLS+RPL+L +LDP+LT
Sbjct  67   AQYVHRLMRILVHSGFF---SQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLT  123

Query  592  QPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            +P   +  WFQND+ T F   H  TLW+Y  A ++P++++LF +AMA DS L   +V+  
Sbjct  124  KPHDCLSTWFQNDEATAFSVAHERTLWEY--AGQDPRLSNLFNEAMASDSILASKLVLSQ  181

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C+G+F+G++SL+DVGG +GT+A  IA AFPH+ CTVFDLP VV  L+G KNL Y GGDMF
Sbjct  182  CKGIFDGVDSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGRKNLKYVGGDMF  241

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSK--EKGGKVIIIDMMVDNRIKDDE  59
             ++PPAD +LLKW LHDWSD++ VKILK+CK +I SK  +K GKVIIID +V      +E
Sbjct  242  EAVPPADVILLKWTLHDWSDEDCVKILKQCKHAIMSKGQQKAGKVIIID-IVRGSQNGEE  300

Query  58   SVETQIFFDMLMMILVTG  5
            S ETQ+ +D+ MM+ VTG
Sbjct  301  SNETQLLWDLEMMVTVTG  318



>gb|KDP21023.1| hypothetical protein JCGZ_21494 [Jatropha curcas]
Length=358

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 224/321 (70%), Gaps = 6/321 (2%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
            ++K SEIL +Q H+ NH+LN++NS +LKCAVQL IPDI+H HG+P++L +L++AL I   
Sbjct  6    SQKASEILQAQVHLINHMLNYMNSMALKCAVQLGIPDILHSHGKPITLPELLSALHIPPT  65

Query  775  KSTHLARLMRTLIHSGFFVITKT---EGSDDEGYALAPPSILLLKDNPLSIRPLVLAILD  605
            K +++ RLMR L+ SGFF  TK    +G   E Y L P S LL+K NP  + P V ++L 
Sbjct  66   KLSNMYRLMRMLVFSGFFSTTKVLNGQGDGQEAYVLTPSSRLLVKGNPNCLAPFVNSLLK  125

Query  604  PILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNV  425
                 P H + +WFQ ++ T F   HGM  W+Y    ++P+ N LF +AMA DSR+ MN+
Sbjct  126  AEFVSPGHLLGDWFQGNELTVFEKAHGMAFWEY--NERKPEFNQLFNEAMACDSRM-MNL  182

Query  424  VIKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAG  245
            VI+ C+ +FEG+NSL+DVGG  G++A II+ AFP +KCTV DLP V+  LEGTKNL Y G
Sbjct  183  VIRDCKQIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLDLPQVIANLEGTKNLSYVG  242

Query  244  GDMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKD  65
            GDMF  IP  D ++LK ILH WSD E + ILKKCKE+I SK KGGK+++ID++++ +  +
Sbjct  243  GDMFKHIPSGDCIILKLILHGWSDDECLTILKKCKEAISSKGKGGKLVVIDLVINEKKDE  302

Query  64   DESVETQIFFDMLMMILVTGR  2
             E  ET++ FDMLMM +  GR
Sbjct  303  PELTETKLLFDMLMMSVTCGR  323



>ref|XP_002525163.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37290.1| o-methyltransferase, putative [Ricinus communis]
Length=321

 Score =   337 bits (865),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 215/309 (70%), Gaps = 3/309 (1%)
 Frame = -1

Query  952  EKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAK  773
            EK  E++ +QTHIWNH  +FI S SLKCAVQL IPDII  HGQPM+L++LV AL ++  K
Sbjct  7    EKIDELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIIKSHGQPMTLSELVLALQVHPTK  66

Query  772  STHLARLMRTLIHSGFFVI-TKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            + HL  LMR L+HSGFF + T ++    EGY L P S LLLKD+    RP +  +LDP+ 
Sbjct  67   THHLYHLMRVLVHSGFFNLQTASDNHSQEGYILTPASRLLLKDSSFDTRPFISLVLDPVA  126

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
            T+P++ +I + +NDD TPFVT    TLW    A  E ++NHL  D MA DS ++   VI 
Sbjct  127  TEPYNYLIPFLRNDDLTPFVTAFKDTLWGC--AGNEARINHLVNDCMASDSSVIGRAVII  184

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ VFEG+NSL+DVGG TG +A  I   FP+LKCTV DLPHVV  L+G+ NL + GGDM
Sbjct  185  KCKEVFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGDM  244

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
              ++PPADA+LL+ ILH+W D+E +KILK CKE++  K  GGKVIIIDM++ N+  DD  
Sbjct  245  IQAVPPADAILLESILHNWPDEECIKILKNCKEAVSEKGTGGKVIIIDMVMGNQSWDDSL  304

Query  55   VETQIFFDM  29
            +E Q+  DM
Sbjct  305  MEGQLCLDM  313



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 231/353 (65%), Gaps = 36/353 (10%)
 Frame = -1

Query  958  IAEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINN  779
            ++    E+L +Q H+WNHI  FINS SLKCAVQL IPD+IH HGQP+SL+ L++ L ++ 
Sbjct  6    VSATSHELLQAQAHVWNHIFQFINSMSLKCAVQLGIPDVIHSHGQPISLSNLISGLNVHP  65

Query  778  AKSTHLARLMRTLIHSGFFV-------------------ITKTEGSDDEG------YALA  674
            +K+  +ARLMR L+HS FF                    I   +  D+E       Y L 
Sbjct  66   SKAHFIARLMRILVHSNFFAQDQQVQLPLLPNDNNNNENIVHQDLDDEEEEKTVVVYRLT  125

Query  673  PPSILLLKDNPLSIRPLVLAILDPILTQPWHNIIEWFQ------NDDP-TPFVTVHGMTL  515
            P S LLLK++PLS    +L ILDP++T P+H +  W Q       D P +PF   HG   
Sbjct  126  PASRLLLKESPLSTTQFLLMILDPVVTDPFHLMGTWCQMNNHGNQDHPASPFEMAHGRPF  185

Query  514  WDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRGVFEGLNSLIDVGGSTGTVATIIA  335
            W    A ++PK   LF +AM  DS+L+   V++ C GVFEGLNSL+DVGG TGT+A  IA
Sbjct  186  WGL--AAQQPKFGSLFNEAMEADSQLLARAVVEECEGVFEGLNSLVDVGGGTGTMAKAIA  243

Query  334  HAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSIPPADALLLKWILHDWSDQESVKI  155
             AFP++ CTVFD PHVV  L+GT NLD+ GGDMF  IPPA+A+ LKWILHDWSD+ESVKI
Sbjct  244  KAFPNINCTVFDQPHVVANLQGTHNLDFVGGDMFEKIPPANAIFLKWILHDWSDEESVKI  303

Query  154  LKKCKESIPSKEKGGKVIIIDM--MVDNRIKDDESVETQIFFDMLMMILVTGR  2
            LKK +E+I SK  GGKVII+D+   VDN+  D +S+ETQ+ +D+LMM+ + G+
Sbjct  304  LKKSREAILSKNGGGKVIILDINVSVDNKKMDKKSIETQLMWDILMMVDLNGK  356



>gb|AEN94899.1| desoxyhemigossypol-6-O-methyltransferase [Gossypium barbadense]
Length=365

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 227/325 (70%), Gaps = 9/325 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPI-NN  779
             E   E L SQ HIW H  NF++  SLKCA+ L I DIIH HG+PM++TQLV AL I N 
Sbjct  8    GEDAIEALQSQAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVAALQILNP  67

Query  778  AKSTHLARLMRTLIHSGFFVITKTEG-SDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
             K+  + RLMR L+HS FF   K +  + +EGY L   S +LLK+NP  I P + A +DP
Sbjct  68   TKACDIYRLMRILVHSDFFARQKLDNDAQEEGYVLTNSSRILLKNNPFCITPTLKATMDP  127

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            I+T+PW  +  WFQNDD TPF T +G TLWDY     +P++  L  D +A DS+LV +V+
Sbjct  128  IITKPWSFLGTWFQNDDHTPFATAYGKTLWDYF--THDPQLKDLINDGLASDSQLVTSVL  185

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            +  C+G FEGL+SL+DVGG TGT A  IA  FP ++CTVFDLP++V GL+G+KNL Y GG
Sbjct  186  VDKCKGAFEGLDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQGSKNLKYVGG  245

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEK-GGKVIIIDMMV-DNRIK  68
            +MF + P  DA+LLK +LHDW+D+  + ILK+ KE+I S++K G K+IIIDM+V +N   
Sbjct  246  NMFEAFPTGDAILLKKVLHDWNDEGCLTILKRSKEAISSQDKVGRKLIIIDMVVRENEQV  305

Query  67   DDES---VETQIFFDMLMMILVTGR  2
            +DE+    +TQ+FFDMLM++LV G+
Sbjct  306  NDEASSLTKTQLFFDMLMLVLVAGK  330



>ref|XP_009625456.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 228/323 (71%), Gaps = 9/323 (3%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVN--ALPIN  782
            +E  +E+L +Q  IWNHI NFI+S +++CA+QL I D+++K+G+PMSL+ L    +L IN
Sbjct  4    SESSTELLRAQAQIWNHIFNFISSSAVRCALQLGILDVLYKYGKPMSLSDLSAELSLVIN  63

Query  781  NAKSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDP  602
             +K + L  LMR L+HSGF      +   D  Y+L P S LL+K+ P ++R L++   DP
Sbjct  64   PSKVSFLPILMRFLVHSGFL----NQDDQDHHYSLTPASCLLVKNEPFNVRSLLVINHDP  119

Query  601  ILTQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVV  422
            + ++ W  +  WFQND PT F T +G +LWDYI  ++   +  +F DA+A DSRL  NV+
Sbjct  120  VFSKAWFVLSTWFQNDSPTAFHTANGKSLWDYIVDQESRVLGDIFNDALASDSRLNTNVL  179

Query  421  IKYCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGG  242
            I  C+ VFEGLNSL+DVGG TGTV+  IA AFP++KCTV DLPHVV+  +G+ NL++ GG
Sbjct  180  ITECKHVFEGLNSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPHVVEDCKGSGNLEFVGG  239

Query  241  DMFVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK--  68
            DMF +IP A+A+LLK ILHDW D++ VKILKKCKESIP++EKGGKVIIID ++++  K  
Sbjct  240  DMFDNIPHANAILLKCILHDWRDEDCVKILKKCKESIPNREKGGKVIIIDTVMEDDTKKQ  299

Query  67   -DDESVETQIFFDMLMMILVTGR  2
             +DE +  Q   DMLMM+L   +
Sbjct  300  SNDEFIRAQHNMDMLMMVLCASK  322



>ref|XP_009778350.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=350

 Score =   336 bits (861),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 220/314 (70%), Gaps = 5/314 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            SE+L +Q   WNHI +F NS +++CAVQL IPD+++KHG+PM L+ L++ LP++ +K + 
Sbjct  7    SELLQAQAQTWNHIFDFTNSSAVRCAVQLGIPDVLYKHGKPMCLSDLLSQLPLHPSKVSS  66

Query  763  LARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQPW  584
            +  L+R L+HSGF         D   Y+L P S LL+++ PL+IR L+L   +P L + W
Sbjct  67   MPILLRLLVHSGFL---NQHEKDHYYYSLTPASRLLVRNEPLNIRSLLLINHEPFLQKAW  123

Query  583  HNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYCRG  404
              +  WFQND PT F T HG + WDY    ++P+    F DAMA DSRL+ +V +K C+ 
Sbjct  124  FELSSWFQNDFPTAFHTAHGKSFWDYF--TEKPRQGSDFNDAMASDSRLIADVFVKECKH  181

Query  403  VFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFVSI  224
            VFEGL SL+DVGG TGTVAT+IA A P +KC VFDLP VV  L+G+ NL++ GG MF  I
Sbjct  182  VFEGLESLVDVGGGTGTVATVIAKANPTIKCIVFDLPRVVADLKGSGNLEFVGGSMFDEI  241

Query  223  PPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESVETQ  44
            P  +A+LLK ILHDWSD++ VKILKKCKESIPS++KGGKVIIID+++++  + DE V  Q
Sbjct  242  PHVNAILLKCILHDWSDEDCVKILKKCKESIPSRDKGGKVIIIDIVMEDPTQSDEFVRAQ  301

Query  43   IFFDMLMMILVTGR  2
               D+LMMIL   +
Sbjct  302  HSMDLLMMILFAAK  315



>emb|CAN75970.1| hypothetical protein VITISV_009881 [Vitis vinifera]
Length=354

 Score =   335 bits (860),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 222/318 (70%), Gaps = 4/318 (1%)
 Frame = -1

Query  955  AEKDSEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNA  776
             +  SE+ ++Q+ I+ H+ +F++S SLKCAVQL IPD IH H QP++L +L +A+ +   
Sbjct  6    GQGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPE  65

Query  775  KSTHLARLMRTLIHSGFFVITKTEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPIL  596
            K++ L +LMR L+HSGFF + K +  + EGY L PPS LL+K N  S+ P+VL +LDP+L
Sbjct  66   KTSRLHQLMRLLVHSGFFAMQKVD-ENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVL  124

Query  595  TQPWHNIIEWFQNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIK  416
              PWH +  W Q    T F   HGM LW+Y    + P+      + MA DSR+ M++ I+
Sbjct  125  VTPWHFLGSWLQGSSLTAFEAAHGMDLWNY--GNQNPEXFSXIGEIMATDSRM-MSLAIR  181

Query  415  YCRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDM  236
             C+ +FEG +SL+DVGG TGT+A  I  AFPHLKCTV DLP VV  L  ++NLDY GGDM
Sbjct  182  ECKEIFEGXSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDM  241

Query  235  FVSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDES  56
            F SIP ADA+ +K +LH+W D++ VKILK+C+E+IPS  +GGKVIIID+++ N+  + E 
Sbjct  242  FQSIPSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKKDEHEL  301

Query  55   VETQIFFDMLMMILVTGR  2
             +T++F DM+MM+LV G+
Sbjct  302  AKTKLFNDMMMMVLVAGK  319



>ref|XP_010023968.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60372.1| hypothetical protein EUGRSUZ_H03087 [Eucalyptus grandis]
Length=361

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 220/313 (70%), Gaps = 5/313 (2%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            SE+L +Q HIWNHI +FINS  LKCA+QL IPD+IH HG+PM+L +L++AL +   ++  
Sbjct  13   SELLRAQAHIWNHIFSFINSMCLKCAIQLGIPDLIHGHGRPMTLPELISALHVQPTRAHC  72

Query  763  LARLMRTLIHSGFFVITKTEGSDDE-GYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR L+HSGFF +   +G D + GYAL   S LL+K +PL++ P  L  L+P    P
Sbjct  73   IRRLMRVLVHSGFFEVRDLDGVDRQTGYALTGASRLLVKHDPLTLAPFALFALEPYSMDP  132

Query  586  WHNIIEWF--QNDDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKY  413
            W  +  W   + D P+     HG+  W+Y+  R+ P+V   F +AMA DSRL+  +V   
Sbjct  133  WQYLSAWLGDREDVPSTLDMAHGVPAWEYV--RRNPEVASSFHEAMASDSRLIAKLVGDT  190

Query  412  CRGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMF  233
            C GVFEG++S++DVGG +GT+A  IA AFPHL CTVFDLP VV GL G++ L + GGDMF
Sbjct  191  CGGVFEGMSSVVDVGGGSGTMAKAIADAFPHLTCTVFDLPAVVDGLVGSERLKFVGGDMF  250

Query  232  VSIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIKDDESV  53
            V IP ADA+LLKWILHDWSD++ ++ILK+ KE++  + K GKVI+I+++V N+ +D  S 
Sbjct  251  VEIPQADAILLKWILHDWSDEKCIEILKRSKEAVSGRGKVGKVILIEIVVGNQTEDHRST  310

Query  52   ETQIFFDMLMMIL  14
            ETQ+FFDM MM L
Sbjct  311  ETQLFFDMWMMNL  323



>emb|CDP21582.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 222/319 (70%), Gaps = 38/319 (12%)
 Frame = -1

Query  943  SEILDSQTHIWNHILNFINSGSLKCAVQLEIPDIIHKHGQPMSLTQLVNALPINNAKSTH  764
            +E+L +Q HIWN I NFINS SLKCA+QL IPDIIHKH +PM+L +L NALPI NAK+  
Sbjct  28   NELLQAQAHIWNRIFNFINSMSLKCAIQLGIPDIIHKHCKPMTLDELTNALPIGNAKAPF  87

Query  763  LARLMRTLIHSGFFVITK-TEGSDDEGYALAPPSILLLKDNPLSIRPLVLAILDPILTQP  587
            + RLMR LIHSGFF+  K ++  ++EGY L   S LLLKD PLS+   +L++LDP L  P
Sbjct  88   VYRLMRILIHSGFFIEAKISQHDEEEGYMLTSSSKLLLKDEPLSLTAFLLSMLDPTLMDP  147

Query  586  WHNIIEWFQN-DDPTPFVTVHGMTLWDYIYARKEPKVNHLFTDAMARDSRLVMNVVIKYC  410
            W+++ +WFQN  D  PF T HG   W+   A ++ K+N+ F + MA DSRLV +++I+ C
Sbjct  148  WYHLSQWFQNYSDVNPFKTCHGKVAWE--LAGQDQKLNNFFNEGMASDSRLVGSILIRDC  205

Query  409  RGVFEGLNSLIDVGGSTGTVATIIAHAFPHLKCTVFDLPHVVQGLEGTKNLDYAGGDMFV  230
            + VF GLNSL+DVG +                                KNL + GGDMFV
Sbjct  206  KDVFSGLNSLVDVGAN-------------------------------NKNLAFVGGDMFV  234

Query  229  SIPPADALLLKWILHDWSDQESVKILKKCKESIPSKEKGGKVIIIDMMVDNRIK---DDE  59
            +IPPADA+++KWILHDW+D+E ++ILKKCKE IPSK+ GG+ IIIDM+++++ K   DDE
Sbjct  235  AIPPADAVIMKWILHDWNDEECIQILKKCKEVIPSKQNGGRAIIIDMVLNDQQKGADDDE  294

Query  58   SVETQIFFDMLMMILVTGR  2
            ++ETQ+FF+MLMM+LVTG+
Sbjct  295  AIETQLFFNMLMMVLVTGK  313



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2181636186120